F495715
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1789 | 775 | 3578 | 216 |
Family's Representative Sequence
| Representative Sequence | 3300049571|Ga0501034_0099570|Ga0501034_0099570_1951_2727 |
| Length | 258 |
| Sequence | MFRHLPPRDEFGLPLFWLASDDPGVIDGRHRTNAMTFPTQLINGYRAFLYARLRLEQGRYRELSEAGQSPEVMVIGCADSRVSPEVIFDAGPGELFVARNVASLVPPYTPDGATRAVSAALEFAVQALRVKHIVVLGHAQCGGIRAYAEQSKPLSPGDFIGRWMELLAPGADKLGGPDKFASFADYVVALEHQSVATTIDNLMTFPCVKVLVERGKLQLHGAYFGVATGQLSVRNETTGKFEPVAAEDHARLFAKPRF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 2 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 9 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 10 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 12 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 13 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 16 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 73 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 79 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 80 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 81 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 82 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 84 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 85 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 86 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 87 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 91 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 92 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 93 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 95 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 96 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 97 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 98 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 99 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 100 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 103 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 104 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 105 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 106 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 107 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 108 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 122 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 125 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 135 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 141 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 142 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 143 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 144 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 145 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 146 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 147 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 148 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 149 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 157 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 225 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 226 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 227 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 228 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 231 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 232 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 236 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 237 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 238 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 239 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 240 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 241 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 242 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 243 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 244 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 245 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 246 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 247 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 248 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 249 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 250 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 251 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 252 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 253 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 254 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 255 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 256 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 257 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 258 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 259 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 260 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 261 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 262 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 263 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 264 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 265 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 266 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 267 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 268 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 269 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 270 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 271 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 272 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 273 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 274 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 275 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 276 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 277 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 278 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 279 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 280 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 281 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 282 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 283 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 284 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 285 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 286 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 287 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 288 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 289 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 290 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 291 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 292 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 293 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 294 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 295 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 296 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 297 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 298 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 299 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 300 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 301 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 302 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 303 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 304 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 305 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 306 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 307 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 308 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 309 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 310 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 311 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 312 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 313 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 314 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 315 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 316 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 317 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 318 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 319 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 320 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 321 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 322 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 323 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 324 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 412 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 413 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 414 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 415 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 416 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 417 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 418 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 419 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 420 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 421 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 422 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 423 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 424 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 425 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 426 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 427 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 428 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 429 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 430 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 431 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 432 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 433 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 434 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 435 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 436 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 437 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 438 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 443 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 444 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 448 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 449 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 450 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 453 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 456 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 457 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 458 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 459 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 460 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 461 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 462 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 463 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 465 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 466 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 467 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 468 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 469 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 470 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 471 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 472 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 473 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 474 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 475 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 476 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 477 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 478 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 479 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 480 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 483 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 487 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 488 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 489 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 490 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 491 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 492 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 493 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 494 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 495 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 496 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 497 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 498 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 499 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 500 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 501 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 502 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 503 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 504 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 505 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 506 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 507 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 508 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 509 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 510 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 511 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 512 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 513 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 514 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 515 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 516 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 517 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 518 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 519 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 520 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 521 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 522 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 523 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 524 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 525 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 526 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 527 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 528 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 529 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 530 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 531 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 532 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 533 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 534 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 535 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 536 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 537 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 538 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 539 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 540 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 541 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 542 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 543 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 544 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 545 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 546 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 547 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 548 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 549 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 550 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 551 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 552 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 553 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 554 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 555 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 556 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 557 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 558 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 559 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 560 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 561 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 562 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 563 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 564 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 565 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 566 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 567 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 568 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 569 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 570 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 571 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 572 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 573 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 574 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 575 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 576 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 577 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 578 | 2791355199 | |||
| 579 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 580 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 581 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 582 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 583 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 584 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 585 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 586 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 587 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 588 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 589 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 590 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 591 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 592 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 593 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 594 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 595 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 596 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 597 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 598 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 599 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 600 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 601 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 602 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 603 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 604 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 605 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 606 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 607 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 608 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 609 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 610 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 611 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 612 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 613 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 614 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 615 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 616 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 617 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 618 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 619 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 620 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 621 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 622 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 623 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 624 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 625 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 626 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 627 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 628 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 629 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 630 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 631 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 632 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 633 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 634 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 635 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 636 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 637 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 638 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 639 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 640 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 641 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 642 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 643 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 644 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 645 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 646 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 647 | 2904699407 | |||
| 648 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 649 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 650 | 2906610324 | |||
| 651 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 652 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 653 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 654 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 655 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 656 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 657 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 658 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 659 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 660 | 2922368715 | |||
| 661 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 662 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 663 | 2922425934 | |||
| 664 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 665 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 666 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 667 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 668 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 669 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 670 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 671 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 672 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 673 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 674 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 675 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 676 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 677 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 678 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 679 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 680 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 681 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 682 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 683 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 684 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 685 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 686 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 687 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 688 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 689 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 690 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 691 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 692 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 693 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 694 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 695 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 696 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 697 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 698 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 699 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 700 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 701 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 702 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 703 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 704 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 705 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 706 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 707 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 708 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 709 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 710 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 711 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 712 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 713 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 714 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 715 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 716 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 717 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 718 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 719 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 720 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 721 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 722 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 723 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 724 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 725 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 726 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 727 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 728 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 729 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 730 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 731 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 732 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 733 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 734 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 735 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 736 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 737 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 738 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 739 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 740 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 741 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 742 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 743 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 744 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 745 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 746 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 747 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 748 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 749 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 750 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 751 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 752 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 753 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 754 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 755 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 756 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 757 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 758 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 759 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 760 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 761 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 762 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 763 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 764 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 765 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 766 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 767 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 768 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 769 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 770 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 771 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 772 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 773 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 774 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 775 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.05 |
| Metatranscriptomes | 0.17 |
| Isolates | 12.78 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.9 |
| Nodule | 10.45 |
| Rhizoplane | 6.48 |
| Rhizosphere | 62.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501034_0099570 | 3300049571 | Bacteria | 2901 |
| 2 | RicEn_C5253 | 2010549000 | Bacteria | 2664 |
| 3 | JGI24736J21556_1015157 | 3300001904 | Bacteria | 1236 |
| 4 | JGI24740J21852_10005020 | 3300001979 | Bacteria | 5618 |
| 5 | JGI24739J22299_10011782 | 3300001989 | Bacteria | 3222 |
| 6 | JGI24737J22298_10001303 | 3300001990 | Bacteria | 8838 |
| 7 | JGI24738J21930_10019553 | 3300002075 | Bacteria | 1411 |
| 8 | JGI25406J46586_10000915 | 3300003203 | Bacteria | 13864 |
| 9 | JGI25406J46586_10001108 | 3300003203 | Bacteria | 12622 |
| 10 | JGI25153J46596_10002773 | 3300003215 | Bacteria | 9963 |
| 11 | JGI25153J46596_10035478 | 3300003215 | Bacteria | 1615 |
| 12 | JGI25153J46596_10042611 | 3300003215 | Bacteria | 1383 |
| 13 | JGI25160J50197_1022345 | 3300003354 | Bacteria | 1856 |
| 14 | JGI25161J50226_1012969 | 3300003374 | Bacteria | 980 |
| 15 | JGI25404J52841_10016932 | 3300003659 | Bacteria | 1581 |
| 16 | JGI25404J52841_10027307 | 3300003659 | Bacteria | 1228 |
| 17 | JGI25404J52841_10029378 | 3300003659 | Bacteria | 1179 |
| 18 | Ga0055524_1063574 | 3300003775 | Bacteria | 750 |
| 19 | Ga0055531_10014320 | 3300003794 | Bacteria | 3577 |
| 20 | Ga0065165_1003849 | 3300005262 | Bacteria | 9980 |
| 21 | Ga0065712_10310656 | 3300005290 | Bacteria | 844 |
| 22 | Ga0070658_10063913 | 3300005327 | Bacteria | 3001 |
| 23 | Ga0070658_10087834 | 3300005327 | Bacteria | 2559 |
| 24 | Ga0070658_10160418 | 3300005327 | Bacteria | 1886 |
| 25 | Ga0070658_10442291 | 3300005327 | Bacteria | 1120 |
| 26 | Ga0070676_10173494 | 3300005328 | Bacteria | 1397 |
| 27 | Ga0070683_100003459 | 3300005329 | Bacteria | 12827 |
| 28 | Ga0070683_100019475 | 3300005329 | Bacteria | 6027 |
| 29 | Ga0070683_100517072 | 3300005329 | Bacteria | 1141 |
| 30 | Ga0070670_100091679 | 3300005331 | Bacteria | 2613 |
| 31 | Ga0068869_100256572 | 3300005334 | Bacteria | 1398 |
| 32 | Ga0070666_10152374 | 3300005335 | Bacteria | 1613 |
| 33 | Ga0070666_10465026 | 3300005335 | Bacteria | 915 |
| 34 | Ga0070680_100070610 | 3300005336 | Bacteria | 2868 |
| 35 | Ga0070680_100095019 | 3300005336 | Bacteria | 2470 |
| 36 | Ga0068868_100126102 | 3300005338 | Bacteria | 2091 |
| 37 | Ga0070660_100001075 | 3300005339 | Bacteria | 18360 |
| 38 | Ga0070660_100237712 | 3300005339 | Bacteria | 1483 |
| 39 | Ga0070689_100069435 | 3300005340 | Bacteria | 2749 |
| 40 | Ga0070689_100240294 | 3300005340 | Bacteria | 1491 |
| 41 | Ga0070689_100472744 | 3300005340 | Bacteria | 1070 |
| 42 | Ga0070689_100708273 | 3300005340 | Bacteria | 879 |
| 43 | Ga0070691_10020941 | 3300005341 | Bacteria | 3024 |
| 44 | Ga0070661_100035628 | 3300005344 | Bacteria | 3614 |
| 45 | Ga0070661_100098519 | 3300005344 | Bacteria | 2171 |
| 46 | Ga0070661_100149531 | 3300005344 | Bacteria | 1764 |
| 47 | Ga0070668_100148724 | 3300005347 | Bacteria | 1892 |
| 48 | Ga0070668_100304066 | 3300005347 | Bacteria | 1338 |
| 49 | Ga0070668_100316121 | 3300005347 | Bacteria | 1313 |
| 50 | Ga0070668_100437999 | 3300005347 | Bacteria | 1121 |
| 51 | Ga0070669_100256611 | 3300005353 | Bacteria | 1394 |
| 52 | Ga0070669_100353386 | 3300005353 | Bacteria | 1193 |
| 53 | Ga0070669_100511051 | 3300005353 | Bacteria | 997 |
| 54 | Ga0070671_100014330 | 3300005355 | Bacteria | 6404 |
| 55 | Ga0070671_100144815 | 3300005355 | Bacteria | 2005 |
| 56 | Ga0070674_100392047 | 3300005356 | Bacteria | 1132 |
| 57 | Ga0070674_100707807 | 3300005356 | Bacteria | 862 |
| 58 | Ga0070673_100195488 | 3300005364 | Bacteria | 1739 |
| 59 | Ga0070673_100394240 | 3300005364 | Bacteria | 1237 |
| 60 | Ga0070659_100140179 | 3300005366 | Bacteria | 1968 |
| 61 | Ga0070659_100498025 | 3300005366 | Bacteria | 1038 |
| 62 | Ga0070659_100650783 | 3300005366 | Bacteria | 909 |
| 63 | Ga0070667_100190323 | 3300005367 | Bacteria | 1818 |
| 64 | Ga0070667_100374381 | 3300005367 | Bacteria | 1293 |
| 65 | Ga0070667_100843003 | 3300005367 | Bacteria | 852 |
| 66 | Ga0070709_10007523 | 3300005434 | Bacteria | 5974 |
| 67 | Ga0070709_10010268 | 3300005434 | Bacteria | 5176 |
| 68 | Ga0070709_10015617 | 3300005434 | Bacteria | 4324 |
| 69 | Ga0070714_100006699 | 3300005435 | Bacteria | 8921 |
| 70 | Ga0070714_100065772 | 3300005435 | Bacteria | 3123 |
| 71 | Ga0070714_100253140 | 3300005435 | Bacteria | 1629 |
| 72 | Ga0070713_100016372 | 3300005436 | Bacteria | 5574 |
| 73 | Ga0070713_100019605 | 3300005436 | Bacteria | 5169 |
| 74 | Ga0070713_100053638 | 3300005436 | Bacteria | 3341 |
| 75 | Ga0070713_100248034 | 3300005436 | Bacteria | 1623 |
| 76 | Ga0070713_100843365 | 3300005436 | Bacteria | 880 |
| 77 | Ga0070710_10000802 | 3300005437 | Bacteria | 15088 |
| 78 | Ga0070710_10121265 | 3300005437 | Bacteria | 1583 |
| 79 | Ga0070701_10222776 | 3300005438 | Bacteria | 1126 |
| 80 | Ga0070711_100017892 | 3300005439 | Bacteria | 4517 |
| 81 | Ga0070711_100020415 | 3300005439 | Bacteria | 4269 |
| 82 | Ga0070711_100055881 | 3300005439 | Bacteria | 2728 |
| 83 | Ga0070711_100076565 | 3300005439 | Bacteria | 2372 |
| 84 | Ga0070711_100137440 | 3300005439 | Bacteria | 1828 |
| 85 | Ga0070711_100356657 | 3300005439 | Bacteria | 1177 |
| 86 | Ga0070711_100493047 | 3300005439 | Bacteria | 1009 |
| 87 | Ga0070700_100251139 | 3300005441 | Bacteria | 1269 |
| 88 | Ga0070663_100066899 | 3300005455 | Bacteria | 2605 |
| 89 | Ga0070663_100104953 | 3300005455 | Bacteria | 2114 |
| 90 | Ga0070663_100105112 | 3300005455 | Bacteria | 2113 |
| 91 | Ga0070678_100129896 | 3300005456 | Bacteria | 2000 |
| 92 | Ga0070678_100172405 | 3300005456 | Bacteria | 1763 |
| 93 | Ga0070678_100354954 | 3300005456 | Bacteria | 1262 |
| 94 | Ga0070678_100594137 | 3300005456 | Bacteria | 987 |
| 95 | Ga0070662_100037993 | 3300005457 | Bacteria | 3417 |
| 96 | Ga0070662_100327014 | 3300005457 | Bacteria | 1251 |
| 97 | Ga0070681_10009671 | 3300005458 | Bacteria | 9485 |
| 98 | Ga0070681_10025343 | 3300005458 | Bacteria | 5966 |
| 99 | Ga0070681_10195696 | 3300005458 | Bacteria | 1941 |
| 100 | Ga0070681_10638533 | 3300005458 | Bacteria | 979 |
| 101 | Ga0068867_100102312 | 3300005459 | Bacteria | 2189 |
| 102 | Ga0068867_100144706 | 3300005459 | Bacteria | 1861 |
| 103 | Ga0070685_10374239 | 3300005466 | Bacteria | 980 |
| 104 | Ga0070706_100350976 | 3300005467 | Bacteria | 1375 |
| 105 | Ga0070706_100774025 | 3300005467 | Bacteria | 889 |
| 106 | Ga0070707_100078821 | 3300005468 | Bacteria | 3179 |
| 107 | Ga0070699_100616597 | 3300005518 | Bacteria | 990 |
| 108 | Ga0070679_100048159 | 3300005530 | Bacteria | 4248 |
| 109 | Ga0070679_100109136 | 3300005530 | Bacteria | 2753 |
| 110 | Ga0070684_100007076 | 3300005535 | Bacteria | 8722 |
| 111 | Ga0070684_100046071 | 3300005535 | Bacteria | 3778 |
| 112 | Ga0070697_100013361 | 3300005536 | Bacteria | 6440 |
| 113 | Ga0068853_100037102 | 3300005539 | Bacteria | 4145 |
| 114 | Ga0068853_100052993 | 3300005539 | Bacteria | 3494 |
| 115 | Ga0068853_100526871 | 3300005539 | Bacteria | 1117 |
| 116 | Ga0068853_100541794 | 3300005539 | Bacteria | 1102 |
| 117 | Ga0070672_100562753 | 3300005543 | Bacteria | 991 |
| 118 | Ga0070672_100746402 | 3300005543 | Bacteria | 859 |
| 119 | Ga0070686_100314555 | 3300005544 | Bacteria | 1165 |
| 120 | Ga0070693_100400440 | 3300005547 | Bacteria | 951 |
| 121 | Ga0070665_100019646 | 3300005548 | Bacteria | 6780 |
| 122 | Ga0070665_100042207 | 3300005548 | Bacteria | 4584 |
| 123 | Ga0070665_100061160 | 3300005548 | Bacteria | 3775 |
| 124 | Ga0070665_100094748 | 3300005548 | Bacteria | 2990 |
| 125 | Ga0070665_100273433 | 3300005548 | Bacteria | 1691 |
| 126 | Ga0070665_100407722 | 3300005548 | Bacteria | 1367 |
| 127 | Ga0070665_100547367 | 3300005548 | Bacteria | 1169 |
| 128 | Ga0070665_100607495 | 3300005548 | Bacteria | 1107 |
| 129 | Ga0070704_100255708 | 3300005549 | Bacteria | 1441 |
| 130 | Ga0068855_100044373 | 3300005563 | Bacteria | 5261 |
| 131 | Ga0068855_100075096 | 3300005563 | Bacteria | 3925 |
| 132 | Ga0068855_100082985 | 3300005563 | Bacteria | 3713 |
| 133 | Ga0068855_100084323 | 3300005563 | Bacteria | 3679 |
| 134 | Ga0068855_100155703 | 3300005563 | Bacteria | 2596 |
| 135 | Ga0068855_100240979 | 3300005563 | Bacteria | 2021 |
| 136 | Ga0068855_100386058 | 3300005563 | Bacteria | 1537 |
| 137 | Ga0070664_100231974 | 3300005564 | Bacteria | 1654 |
| 138 | Ga0068857_100008930 | 3300005577 | Bacteria | 8683 |
| 139 | Ga0068857_100022226 | 3300005577 | Bacteria | 5580 |
| 140 | Ga0068857_100064498 | 3300005577 | Bacteria | 3257 |
| 141 | Ga0068857_100071907 | 3300005577 | Bacteria | 3083 |
| 142 | Ga0068857_100541391 | 3300005577 | Bacteria | 1096 |
| 143 | Ga0068854_100028179 | 3300005578 | Bacteria | 3878 |
| 144 | Ga0068854_100147734 | 3300005578 | Bacteria | 1810 |
| 145 | Ga0068854_100206859 | 3300005578 | Bacteria | 1546 |
| 146 | Ga0068854_100232479 | 3300005578 | Bacteria | 1464 |
| 147 | Ga0068854_100441631 | 3300005578 | Bacteria | 1085 |
| 148 | Ga0068856_100013958 | 3300005614 | Bacteria | 7767 |
| 149 | Ga0068856_100042359 | 3300005614 | Bacteria | 4478 |
| 150 | Ga0068856_100050282 | 3300005614 | Bacteria | 4109 |
| 151 | Ga0068856_100105736 | 3300005614 | Bacteria | 2808 |
| 152 | Ga0068856_100328008 | 3300005614 | Bacteria | 1548 |
| 153 | Ga0068856_100343963 | 3300005614 | Bacteria | 1510 |
| 154 | Ga0068856_100572280 | 3300005614 | Bacteria | 1151 |
| 155 | Ga0068856_100765277 | 3300005614 | Bacteria | 986 |
| 156 | Ga0068856_100872328 | 3300005614 | Bacteria | 919 |
| 157 | Ga0070702_100291029 | 3300005615 | Bacteria | 1126 |
| 158 | Ga0068852_100017184 | 3300005616 | Bacteria | 5670 |
| 159 | Ga0068852_100048394 | 3300005616 | Bacteria | 3632 |
| 160 | Ga0068852_100076112 | 3300005616 | Bacteria | 2962 |
| 161 | Ga0068852_100198957 | 3300005616 | Bacteria | 1895 |
| 162 | Ga0068852_100445913 | 3300005616 | Bacteria | 1280 |
| 163 | Ga0068852_100488403 | 3300005616 | Bacteria | 1225 |
| 164 | Ga0068852_100587897 | 3300005616 | Bacteria | 1117 |
| 165 | Ga0068852_100806567 | 3300005616 | Bacteria | 953 |
| 166 | Ga0068859_100113514 | 3300005617 | Bacteria | 2773 |
| 167 | Ga0068859_100281859 | 3300005617 | Bacteria | 1755 |
| 168 | Ga0068859_100583019 | 3300005617 | Bacteria | 1212 |
| 169 | Ga0068859_100776293 | 3300005617 | Bacteria | 1046 |
| 170 | Ga0068864_100106658 | 3300005618 | Bacteria | 2491 |
| 171 | Ga0068864_100665701 | 3300005618 | Bacteria | 1015 |
| 172 | Ga0068866_10161358 | 3300005718 | Bacteria | 1307 |
| 173 | Ga0068861_100089459 | 3300005719 | Bacteria | 2427 |
| 174 | Ga0068861_100226997 | 3300005719 | Bacteria | 1581 |
| 175 | Ga0068861_100265120 | 3300005719 | Bacteria | 1472 |
| 176 | Ga0068851_10006622 | 3300005834 | Bacteria | 5301 |
| 177 | Ga0068851_10026964 | 3300005834 | Bacteria | 2828 |
| 178 | Ga0068870_10278445 | 3300005840 | Bacteria | 1048 |
| 179 | Ga0068863_100262320 | 3300005841 | Bacteria | 1670 |
| 180 | Ga0068858_100082051 | 3300005842 | Bacteria | 2996 |
| 181 | Ga0068860_100000477 | 3300005843 | Bacteria | 49839 |
| 182 | Ga0068860_100193755 | 3300005843 | Bacteria | 1967 |
| 183 | Ga0068860_100300493 | 3300005843 | Bacteria | 1572 |
| 184 | Ga0068860_100469711 | 3300005843 | Bacteria | 1253 |
| 185 | Ga0068860_101113883 | 3300005843 | Bacteria | 809 |
| 186 | Ga0068862_100087301 | 3300005844 | Bacteria | 2713 |
| 187 | Ga0068862_100109043 | 3300005844 | Bacteria | 2428 |
| 188 | Ga0068862_100138409 | 3300005844 | Bacteria | 2159 |
| 189 | Ga0068862_100490597 | 3300005844 | Bacteria | 1164 |
| 190 | Ga0068862_100493133 | 3300005844 | Bacteria | 1161 |
| 191 | Ga0081455_10011031 | 3300005937 | Bacteria | 9101 |
| 192 | Ga0081455_10023057 | 3300005937 | Bacteria | 5800 |
| 193 | Ga0081455_10028111 | 3300005937 | Bacteria | 5141 |
| 194 | Ga0081455_10059467 | 3300005937 | Bacteria | 3227 |
| 195 | Ga0081538_10014581 | 3300005981 | Bacteria | 6145 |
| 196 | Ga0081538_10018074 | 3300005981 | Bacteria | 5318 |
| 197 | Ga0081540_1001247 | 3300005983 | Bacteria | 22221 |
| 198 | Ga0081540_1006252 | 3300005983 | Bacteria | 8720 |
| 199 | Ga0081540_1007349 | 3300005983 | Bacteria | 7874 |
| 200 | Ga0081540_1011012 | 3300005983 | Bacteria | 6074 |
| 201 | Ga0081540_1011793 | 3300005983 | Bacteria | 5811 |
| 202 | Ga0081540_1020406 | 3300005983 | Bacteria | 3987 |
| 203 | Ga0081540_1023508 | 3300005983 | Bacteria | 3602 |
| 204 | Ga0081540_1090817 | 3300005983 | Bacteria | 1344 |
| 205 | Ga0081540_1108981 | 3300005983 | Bacteria | 1176 |
| 206 | Ga0081539_10000265 | 3300005985 | Bacteria | 120457 |
| 207 | Ga0081539_10000371 | 3300005985 | Bacteria | 98455 |
| 208 | Ga0081539_10012180 | 3300005985 | Bacteria | 6673 |
| 209 | Ga0070717_10007759 | 3300006028 | Bacteria | 7984 |
| 210 | Ga0070717_10010181 | 3300006028 | Bacteria | 7080 |
| 211 | Ga0070717_10029710 | 3300006028 | Bacteria | 4388 |
| 212 | Ga0070717_10588910 | 3300006028 | Bacteria | 1009 |
| 213 | Ga0075365_10008765 | 3300006038 | Bacteria | 5768 |
| 214 | Ga0075365_10023785 | 3300006038 | Bacteria | 3857 |
| 215 | Ga0075365_10038902 | 3300006038 | Bacteria | 3094 |
| 216 | Ga0075365_10061500 | 3300006038 | Bacteria | 2508 |
| 217 | Ga0075365_10154659 | 3300006038 | Bacteria | 1596 |
| 218 | Ga0075365_10477978 | 3300006038 | Bacteria | 880 |
| 219 | Ga0075368_10015416 | 3300006042 | Bacteria | 2835 |
| 220 | Ga0075368_10028027 | 3300006042 | Bacteria | 2174 |
| 221 | Ga0075363_100008349 | 3300006048 | Bacteria | 4818 |
| 222 | Ga0075363_100047253 | 3300006048 | Bacteria | 2285 |
| 223 | Ga0075363_100196507 | 3300006048 | Bacteria | 1151 |
| 224 | Ga0075363_100298469 | 3300006048 | Bacteria | 935 |
| 225 | Ga0075363_100365837 | 3300006048 | Bacteria | 844 |
| 226 | Ga0075364_10034975 | 3300006051 | Bacteria | 3245 |
| 227 | Ga0075364_10041445 | 3300006051 | Bacteria | 2990 |
| 228 | Ga0075364_10152333 | 3300006051 | Bacteria | 1558 |
| 229 | Ga0075364_10509677 | 3300006051 | Bacteria | 822 |
| 230 | Ga0075364_10583863 | 3300006051 | Bacteria | 764 |
| 231 | Ga0070715_10000872 | 3300006163 | Bacteria | 8336 |
| 232 | Ga0070715_10246234 | 3300006163 | Bacteria | 932 |
| 233 | Ga0070716_100019142 | 3300006173 | Bacteria | 3575 |
| 234 | Ga0070716_100051216 | 3300006173 | Bacteria | 2346 |
| 235 | Ga0070716_100089432 | 3300006173 | Bacteria | 1860 |
| 236 | Ga0070716_100456401 | 3300006173 | Bacteria | 933 |
| 237 | Ga0070716_100535237 | 3300006173 | Bacteria | 871 |
| 238 | Ga0070716_100549528 | 3300006173 | Bacteria | 861 |
| 239 | Ga0070712_100012131 | 3300006175 | Bacteria | 5476 |
| 240 | Ga0070712_100023475 | 3300006175 | Bacteria | 4076 |
| 241 | Ga0070712_100042188 | 3300006175 | Bacteria | 3137 |
| 242 | Ga0070712_100092434 | 3300006175 | Bacteria | 2219 |
| 243 | Ga0070712_100094994 | 3300006175 | Bacteria | 2192 |
| 244 | Ga0070712_100100219 | 3300006175 | Bacteria | 2140 |
| 245 | Ga0070712_100148078 | 3300006175 | Bacteria | 1799 |
| 246 | Ga0075367_10005815 | 3300006178 | Bacteria | 6174 |
| 247 | Ga0075367_10016144 | 3300006178 | Bacteria | 4074 |
| 248 | Ga0075367_10043731 | 3300006178 | Bacteria | 2623 |
| 249 | Ga0075367_10045040 | 3300006178 | Bacteria | 2588 |
| 250 | Ga0075367_10045943 | 3300006178 | Bacteria | 2564 |
| 251 | Ga0075367_10192270 | 3300006178 | Bacteria | 1273 |
| 252 | Ga0075369_10011258 | 3300006186 | Bacteria | 3517 |
| 253 | Ga0075369_10124756 | 3300006186 | Bacteria | 1167 |
| 254 | Ga0075369_10205780 | 3300006186 | Bacteria | 909 |
| 255 | Ga0075366_10050660 | 3300006195 | Bacteria | 2466 |
| 256 | Ga0075366_10097799 | 3300006195 | Bacteria | 1760 |
| 257 | Ga0097621_100573771 | 3300006237 | Bacteria | 1029 |
| 258 | Ga0075370_10182744 | 3300006353 | Bacteria | 1234 |
| 259 | Ga0075370_10184224 | 3300006353 | Bacteria | 1229 |
| 260 | Ga0075370_10286595 | 3300006353 | Bacteria | 978 |
| 261 | Ga0075370_10349089 | 3300006353 | Bacteria | 884 |
| 262 | Ga0068871_100121609 | 3300006358 | Bacteria | 2205 |
| 263 | Ga0068871_100488421 | 3300006358 | Bacteria | 1108 |
| 264 | Ga0075428_100167202 | 3300006844 | Bacteria | 2385 |
| 265 | Ga0075433_10246735 | 3300006852 | Bacteria | 1585 |
| 266 | Ga0075433_10538565 | 3300006852 | Bacteria | 1027 |
| 267 | Ga0075434_100098208 | 3300006871 | Bacteria | 2933 |
| 268 | Ga0075434_100159055 | 3300006871 | Bacteria | 2279 |
| 269 | Ga0068865_100134104 | 3300006881 | Bacteria | 1858 |
| 270 | Ga0068865_100207434 | 3300006881 | Bacteria | 1525 |
| 271 | Ga0075436_100200900 | 3300006914 | Bacteria | 1412 |
| 272 | Ga0075436_100615442 | 3300006914 | Bacteria | 801 |
| 273 | Ga0097620_100113524 | 3300006931 | Bacteria | 2773 |
| 274 | Ga0097620_100281862 | 3300006931 | Bacteria | 1755 |
| 275 | Ga0097620_100582996 | 3300006931 | Bacteria | 1212 |
| 276 | Ga0097620_100776279 | 3300006931 | Bacteria | 1046 |
| 277 | Ga0099825_1014654 | 3300006941 | Bacteria | 7264 |
| 278 | Ga0099825_1034410 | 3300006941 | Bacteria | 1886 |
| 279 | Ga0099824_1009377 | 3300006942 | Bacteria | 12072 |
| 280 | Ga0099822_1000918 | 3300006943 | Bacteria | 31646 |
| 281 | Ga0099823_1092027 | 3300006944 | Bacteria | 1020 |
| 282 | Ga0075435_100317550 | 3300007076 | Bacteria | 1333 |
| 283 | Ga0099795_10003456 | 3300007788 | Bacteria | 3911 |
| 284 | Ga0099795_10089479 | 3300007788 | Bacteria | 1191 |
| 285 | Ga0099795_10139209 | 3300007788 | Bacteria | 986 |
| 286 | Ga0105244_10247152 | 3300009036 | Bacteria | 832 |
| 287 | Ga0105250_10086965 | 3300009092 | Bacteria | 1269 |
| 288 | Ga0105240_10014175 | 3300009093 | Bacteria | 10888 |
| 289 | Ga0105240_10015716 | 3300009093 | Bacteria | 10272 |
| 290 | Ga0105240_10067208 | 3300009093 | Bacteria | 4443 |
| 291 | Ga0105240_10078467 | 3300009093 | Bacteria | 4066 |
| 292 | Ga0105240_10159656 | 3300009093 | Bacteria | 2679 |
| 293 | Ga0105240_10258968 | 3300009093 | Bacteria | 2008 |
| 294 | Ga0105240_10406693 | 3300009093 | Bacteria | 1532 |
| 295 | Ga0105240_10655452 | 3300009093 | Bacteria | 1150 |
| 296 | Ga0111539_10103107 | 3300009094 | Bacteria | 3348 |
| 297 | Ga0111539_10466201 | 3300009094 | Bacteria | 1471 |
| 298 | Ga0105245_10091504 | 3300009098 | Bacteria | 2800 |
| 299 | Ga0105245_10259834 | 3300009098 | Bacteria | 1690 |
| 300 | Ga0105245_10355126 | 3300009098 | Bacteria | 1453 |
| 301 | Ga0105247_10026096 | 3300009101 | Bacteria | 3527 |
| 302 | Ga0105247_10033576 | 3300009101 | Bacteria | 3121 |
| 303 | Ga0105247_10046601 | 3300009101 | Bacteria | 2661 |
| 304 | Ga0105247_10059759 | 3300009101 | Bacteria | 2361 |
| 305 | Ga0105247_10222365 | 3300009101 | Bacteria | 1278 |
| 306 | Ga0105247_10256530 | 3300009101 | Bacteria | 1197 |
| 307 | Ga0105247_10377197 | 3300009101 | Bacteria | 1004 |
| 308 | Ga0114129_10094360 | 3300009147 | Bacteria | 4144 |
| 309 | Ga0105243_10022131 | 3300009148 | Bacteria | 4831 |
| 310 | Ga0105243_10148449 | 3300009148 | Bacteria | 2009 |
| 311 | Ga0105243_10635806 | 3300009148 | Bacteria | 1032 |
| 312 | Ga0105241_10000249 | 3300009174 | Bacteria | 40643 |
| 313 | Ga0105241_10045364 | 3300009174 | Bacteria | 3335 |
| 314 | Ga0105241_10082928 | 3300009174 | Bacteria | 2514 |
| 315 | Ga0105241_10120371 | 3300009174 | Bacteria | 2113 |
| 316 | Ga0105241_10184541 | 3300009174 | Bacteria | 1733 |
| 317 | Ga0105241_10285018 | 3300009174 | Bacteria | 1412 |
| 318 | Ga0105241_10587520 | 3300009174 | Bacteria | 1004 |
| 319 | Ga0105241_10681981 | 3300009174 | Bacteria | 936 |
| 320 | Ga0105242_10486081 | 3300009176 | Bacteria | 1171 |
| 321 | Ga0105248_10075762 | 3300009177 | Bacteria | 3781 |
| 322 | Ga0105248_10185622 | 3300009177 | Bacteria | 2343 |
| 323 | Ga0105248_10372892 | 3300009177 | Bacteria | 1607 |
| 324 | Ga0105237_10010653 | 3300009545 | Bacteria | 9769 |
| 325 | Ga0105237_10014068 | 3300009545 | Bacteria | 8372 |
| 326 | Ga0105237_10031484 | 3300009545 | Bacteria | 5378 |
| 327 | Ga0105237_10090906 | 3300009545 | Bacteria | 3042 |
| 328 | Ga0105237_10133438 | 3300009545 | Bacteria | 2478 |
| 329 | Ga0105237_10148701 | 3300009545 | Bacteria | 2338 |
| 330 | Ga0105237_10225036 | 3300009545 | Bacteria | 1876 |
| 331 | Ga0105237_10264422 | 3300009545 | Bacteria | 1723 |
| 332 | Ga0105237_10342475 | 3300009545 | Bacteria | 1499 |
| 333 | Ga0105237_10410021 | 3300009545 | Bacteria | 1360 |
| 334 | Ga0105237_10616920 | 3300009545 | Bacteria | 1091 |
| 335 | Ga0105237_10897912 | 3300009545 | Bacteria | 893 |
| 336 | Ga0105238_10012601 | 3300009551 | Bacteria | 8535 |
| 337 | Ga0105238_10013147 | 3300009551 | Bacteria | 8352 |
| 338 | Ga0105238_10045519 | 3300009551 | Bacteria | 4432 |
| 339 | Ga0105238_10122350 | 3300009551 | Bacteria | 2581 |
| 340 | Ga0105238_10134900 | 3300009551 | Bacteria | 2446 |
| 341 | Ga0105238_10375515 | 3300009551 | Bacteria | 1412 |
| 342 | Ga0105238_10863820 | 3300009551 | Bacteria | 922 |
| 343 | Ga0105238_10873018 | 3300009551 | Bacteria | 917 |
| 344 | Ga0099796_10006620 | 3300010159 | Bacteria | 2979 |
| 345 | Ga0105239_10012784 | 3300010375 | Bacteria | 9339 |
| 346 | Ga0105239_10014648 | 3300010375 | Bacteria | 8695 |
| 347 | Ga0105239_10043484 | 3300010375 | Bacteria | 4924 |
| 348 | Ga0105239_10252509 | 3300010375 | Bacteria | 1981 |
| 349 | Ga0105239_10275967 | 3300010375 | Bacteria | 1891 |
| 350 | Ga0105239_10403086 | 3300010375 | Bacteria | 1548 |
| 351 | Ga0105239_10705601 | 3300010375 | Bacteria | 1154 |
| 352 | Ga0105246_10030977 | 3300011119 | Bacteria | 3537 |
| 353 | Ga0105246_10683328 | 3300011119 | Bacteria | 897 |
| 354 | Ga0105246_10823378 | 3300011119 | Bacteria | 826 |
| 355 | Ga0157326_1017363 | 3300012513 | Bacteria | 860 |
| 356 | Ga0157371_10098485 | 3300013102 | Bacteria | 2073 |
| 357 | Ga0157370_10115412 | 3300013104 | Bacteria | 2508 |
| 358 | Ga0157370_10217796 | 3300013104 | Bacteria | 1769 |
| 359 | Ga0157369_10004221 | 3300013105 | Bacteria | 17017 |
| 360 | Ga0157369_10032586 | 3300013105 | Bacteria | 5729 |
| 361 | Ga0157369_10072902 | 3300013105 | Bacteria | 3684 |
| 362 | Ga0157369_10352990 | 3300013105 | Bacteria | 1527 |
| 363 | Ga0157369_10916204 | 3300013105 | Bacteria | 899 |
| 364 | Ga0157378_10209003 | 3300013297 | Bacteria | 1850 |
| 365 | Ga0163162_10080261 | 3300013306 | Bacteria | 3330 |
| 366 | Ga0163162_10323885 | 3300013306 | Bacteria | 1673 |
| 367 | Ga0163162_10499188 | 3300013306 | Bacteria | 1347 |
| 368 | Ga0157372_10317616 | 3300013307 | Bacteria | 1813 |
| 369 | Ga0157372_10651143 | 3300013307 | Bacteria | 1227 |
| 370 | Ga0157372_10751246 | 3300013307 | Bacteria | 1134 |
| 371 | Ga0157372_10931895 | 3300013307 | Bacteria | 1007 |
| 372 | Ga0157375_10050169 | 3300013308 | Bacteria | 4093 |
| 373 | Ga0157375_10055933 | 3300013308 | Bacteria | 3892 |
| 374 | Ga0157375_10317851 | 3300013308 | Bacteria | 1721 |
| 375 | Ga0157375_10353089 | 3300013308 | Bacteria | 1636 |
| 376 | Ga0157375_10729935 | 3300013308 | Bacteria | 1143 |
| 377 | Ga0157375_10875242 | 3300013308 | Bacteria | 1043 |
| 378 | Ga0157375_11631355 | 3300013308 | Bacteria | 763 |
| 379 | Ga0163163_10024457 | 3300014325 | Bacteria | 5749 |
| 380 | Ga0163163_10062893 | 3300014325 | Bacteria | 3679 |
| 381 | Ga0163163_10084364 | 3300014325 | Bacteria | 3183 |
| 382 | Ga0163163_10098316 | 3300014325 | Bacteria | 2948 |
| 383 | Ga0163163_10983136 | 3300014325 | Bacteria | 907 |
| 384 | Ga0157380_10122416 | 3300014326 | Bacteria | 2206 |
| 385 | Ga0157380_10489307 | 3300014326 | Bacteria | 1192 |
| 386 | Ga0157380_10681912 | 3300014326 | Bacteria | 1030 |
| 387 | Ga0157380_10921319 | 3300014326 | Bacteria | 901 |
| 388 | Ga0182008_10081970 | 3300014497 | Bacteria | 1588 |
| 389 | Ga0182008_10196222 | 3300014497 | Bacteria | 1026 |
| 390 | Ga0157377_10417280 | 3300014745 | Bacteria | 918 |
| 391 | Ga0157377_10597971 | 3300014745 | Bacteria | 786 |
| 392 | Ga0157379_10111718 | 3300014968 | Bacteria | 2455 |
| 393 | Ga0157379_10299945 | 3300014968 | Bacteria | 1464 |
| 394 | Ga0157379_10422882 | 3300014968 | Bacteria | 1227 |
| 395 | Ga0157376_10068910 | 3300014969 | Bacteria | 2997 |
| 396 | Ga0157376_10449819 | 3300014969 | Bacteria | 1256 |
| 397 | Ga0157376_10581389 | 3300014969 | Bacteria | 1112 |
| 398 | Ga0157376_11025595 | 3300014969 | Bacteria | 848 |
| 399 | Ga0163161_10042345 | 3300017792 | Bacteria | 3275 |
| 400 | Ga0206350_10581160 | 3300020080 | Bacteria | 1434 |
| 401 | Ga0214544_1000056 | 3300021320 | Bacteria | 132760 |
| 402 | Ga0214544_1023817 | 3300021320 | Bacteria | 3325 |
| 403 | Ga0214542_1000071 | 3300021321 | Bacteria | 124568 |
| 404 | Ga0214545_1000033 | 3300021324 | Bacteria | 124568 |
| 405 | Ga0214543_1000105 | 3300021327 | Bacteria | 108404 |
| 406 | Ga0214543_1025733 | 3300021327 | Bacteria | 3324 |
| 407 | Ga0213872_10133386 | 3300021361 | Bacteria | 1093 |
| 408 | Ga0213876_10011834 | 3300021384 | Bacteria | 4651 |
| 409 | Ga0213876_10074857 | 3300021384 | Bacteria | 1789 |
| 410 | Ga0213876_10351938 | 3300021384 | Bacteria | 783 |
| 411 | Ga0213875_10078334 | 3300021388 | Bacteria | 1542 |
| 412 | Ga0213871_10008728 | 3300021441 | Bacteria | 2247 |
| 413 | Ga0224712_10026527 | 3300022467 | Bacteria | 2049 |
| 414 | Ga0224712_10116748 | 3300022467 | Bacteria | 1151 |
| 415 | Ga0209563_108510 | 3300025230 | Bacteria | 1612 |
| 416 | Ga0209677_100170 | 3300025253 | Bacteria | 55896 |
| 417 | Ga0209677_102931 | 3300025253 | Bacteria | 5964 |
| 418 | Ga0209148_1000295 | 3300025254 | Bacteria | 73660 |
| 419 | Ga0209233_1017816 | 3300025261 | Bacteria | 1925 |
| 420 | Ga0209233_1029177 | 3300025261 | Bacteria | 1315 |
| 421 | Ga0209233_1029207 | 3300025261 | Bacteria | 1314 |
| 422 | Ga0209455_1001656 | 3300025272 | Bacteria | 9651 |
| 423 | Ga0209455_1004571 | 3300025272 | Bacteria | 4489 |
| 424 | Ga0209455_1008507 | 3300025272 | Bacteria | 2784 |
| 425 | Ga0209673_1052348 | 3300025273 | Bacteria | 1072 |
| 426 | Ga0209025_1068889 | 3300025294 | Bacteria | 1268 |
| 427 | Ga0209564_1006432 | 3300025295 | Bacteria | 6337 |
| 428 | Ga0209564_1012927 | 3300025295 | Bacteria | 3593 |
| 429 | Ga0209758_1000069 | 3300025297 | Bacteria | 286161 |
| 430 | Ga0209758_1000253 | 3300025297 | Bacteria | 107937 |
| 431 | Ga0209758_1000397 | 3300025297 | Bacteria | 75408 |
| 432 | Ga0209758_1001436 | 3300025297 | Bacteria | 28156 |
| 433 | Ga0209758_1013802 | 3300025297 | Bacteria | 4366 |
| 434 | Ga0209758_1017963 | 3300025297 | Bacteria | 3492 |
| 435 | Ga0209758_1021734 | 3300025297 | Bacteria | 2978 |
| 436 | Ga0209758_1046585 | 3300025297 | Bacteria | 1561 |
| 437 | Ga0209256_1020904 | 3300025299 | Bacteria | 2028 |
| 438 | Ga0207426_1001927 | 3300025302 | Bacteria | 14934 |
| 439 | Ga0207426_1035148 | 3300025302 | Bacteria | 1601 |
| 440 | Ga0209257_1005744 | 3300025304 | Bacteria | 8484 |
| 441 | Ga0207697_10040913 | 3300025315 | Bacteria | 1903 |
| 442 | Ga0207697_10069070 | 3300025315 | Bacteria | 1478 |
| 443 | Ga0207656_10004553 | 3300025321 | Bacteria | 4851 |
| 444 | Ga0207656_10066142 | 3300025321 | Bacteria | 1597 |
| 445 | Ga0207656_10090068 | 3300025321 | Bacteria | 1391 |
| 446 | Ga0207656_10190896 | 3300025321 | Bacteria | 986 |
| 447 | Ga0207653_10025862 | 3300025885 | Bacteria | 1879 |
| 448 | Ga0207682_10140169 | 3300025893 | Bacteria | 1085 |
| 449 | Ga0207692_10027705 | 3300025898 | Bacteria | 2672 |
| 450 | Ga0207692_10048558 | 3300025898 | Bacteria | 2137 |
| 451 | Ga0207710_10093199 | 3300025900 | Bacteria | 1413 |
| 452 | Ga0207710_10185266 | 3300025900 | Bacteria | 1023 |
| 453 | Ga0207710_10289226 | 3300025900 | Bacteria | 826 |
| 454 | Ga0207688_10071971 | 3300025901 | Bacteria | 1964 |
| 455 | Ga0207688_10076837 | 3300025901 | Bacteria | 1902 |
| 456 | Ga0207688_10082681 | 3300025901 | Bacteria | 1835 |
| 457 | Ga0207688_10097379 | 3300025901 | Bacteria | 1695 |
| 458 | Ga0207680_10095610 | 3300025903 | Bacteria | 1899 |
| 459 | Ga0207680_10277501 | 3300025903 | Bacteria | 1164 |
| 460 | Ga0207680_10579454 | 3300025903 | Bacteria | 802 |
| 461 | Ga0207647_10003295 | 3300025904 | Bacteria | 12129 |
| 462 | Ga0207647_10016684 | 3300025904 | Bacteria | 5006 |
| 463 | Ga0207685_10000480 | 3300025905 | Bacteria | 6752 |
| 464 | Ga0207699_10005583 | 3300025906 | Bacteria | 6034 |
| 465 | Ga0207699_10150422 | 3300025906 | Bacteria | 1540 |
| 466 | Ga0207699_10225105 | 3300025906 | Bacteria | 1282 |
| 467 | Ga0207699_10405283 | 3300025906 | Bacteria | 972 |
| 468 | Ga0207645_10225378 | 3300025907 | Bacteria | 1236 |
| 469 | Ga0207705_10412280 | 3300025909 | Bacteria | 1045 |
| 470 | Ga0207705_10430754 | 3300025909 | Bacteria | 1022 |
| 471 | Ga0207684_10649857 | 3300025910 | Bacteria | 899 |
| 472 | Ga0207654_10000083 | 3300025911 | Bacteria | 62205 |
| 473 | Ga0207654_10029560 | 3300025911 | Bacteria | 3002 |
| 474 | Ga0207654_10097456 | 3300025911 | Bacteria | 1806 |
| 475 | Ga0207654_10128503 | 3300025911 | Bacteria | 1601 |
| 476 | Ga0207654_10255148 | 3300025911 | Bacteria | 1177 |
| 477 | Ga0207707_10000445 | 3300025912 | Bacteria | 42982 |
| 478 | Ga0207707_10001947 | 3300025912 | Bacteria | 18789 |
| 479 | Ga0207707_10004159 | 3300025912 | Bacteria | 12822 |
| 480 | Ga0207707_10046091 | 3300025912 | Bacteria | 3796 |
| 481 | Ga0207707_10105824 | 3300025912 | Bacteria | 2459 |
| 482 | Ga0207695_10000148 | 3300025913 | Bacteria | 208344 |
| 483 | Ga0207695_10000387 | 3300025913 | Bacteria | 99734 |
| 484 | Ga0207695_10033885 | 3300025913 | Bacteria | 5560 |
| 485 | Ga0207695_10322626 | 3300025913 | Bacteria | 1434 |
| 486 | Ga0207695_10854830 | 3300025913 | Bacteria | 790 |
| 487 | Ga0207671_10011727 | 3300025914 | Bacteria | 7101 |
| 488 | Ga0207671_10022076 | 3300025914 | Bacteria | 4818 |
| 489 | Ga0207671_10092220 | 3300025914 | Bacteria | 2284 |
| 490 | Ga0207671_10110957 | 3300025914 | Bacteria | 2087 |
| 491 | Ga0207671_10599549 | 3300025914 | Bacteria | 878 |
| 492 | Ga0207671_10709443 | 3300025914 | Bacteria | 800 |
| 493 | Ga0207693_10003401 | 3300025915 | Bacteria | 13595 |
| 494 | Ga0207693_10020364 | 3300025915 | Bacteria | 5277 |
| 495 | Ga0207693_10033227 | 3300025915 | Bacteria | 4071 |
| 496 | Ga0207693_10040625 | 3300025915 | Bacteria | 3663 |
| 497 | Ga0207693_10560558 | 3300025915 | Bacteria | 891 |
| 498 | Ga0207693_10647952 | 3300025915 | Bacteria | 821 |
| 499 | Ga0207663_10000246 | 3300025916 | Bacteria | 23915 |
| 500 | Ga0207663_10015460 | 3300025916 | Bacteria | 4211 |
| 501 | Ga0207663_10022999 | 3300025916 | Bacteria | 3571 |
| 502 | Ga0207663_10049403 | 3300025916 | Bacteria | 2609 |
| 503 | Ga0207663_10101555 | 3300025916 | Bacteria | 1933 |
| 504 | Ga0207663_10178832 | 3300025916 | Bacteria | 1513 |
| 505 | Ga0207663_10337414 | 3300025916 | Bacteria | 1137 |
| 506 | Ga0207660_10001773 | 3300025917 | Bacteria | 14441 |
| 507 | Ga0207660_10048372 | 3300025917 | Bacteria | 3009 |
| 508 | Ga0207660_10098973 | 3300025917 | Bacteria | 2175 |
| 509 | Ga0207660_10811179 | 3300025917 | Bacteria | 764 |
| 510 | Ga0207657_10003784 | 3300025919 | Bacteria | 16083 |
| 511 | Ga0207657_10147964 | 3300025919 | Bacteria | 1914 |
| 512 | Ga0207657_10148515 | 3300025919 | Bacteria | 1910 |
| 513 | Ga0207657_10309041 | 3300025919 | Bacteria | 1252 |
| 514 | Ga0207649_10032393 | 3300025920 | Bacteria | 3116 |
| 515 | Ga0207649_10108820 | 3300025920 | Bacteria | 1848 |
| 516 | Ga0207652_10011651 | 3300025921 | Bacteria | 7094 |
| 517 | Ga0207652_10139161 | 3300025921 | Bacteria | 2169 |
| 518 | Ga0207652_10166123 | 3300025921 | Bacteria | 1979 |
| 519 | Ga0207652_10228683 | 3300025921 | Bacteria | 1676 |
| 520 | Ga0207681_10279713 | 3300025923 | Bacteria | 1313 |
| 521 | Ga0207681_10305018 | 3300025923 | Bacteria | 1261 |
| 522 | Ga0207681_10346780 | 3300025923 | Bacteria | 1188 |
| 523 | Ga0207694_10000121 | 3300025924 | Bacteria | 83123 |
| 524 | Ga0207694_10026270 | 3300025924 | Bacteria | 4428 |
| 525 | Ga0207694_10083167 | 3300025924 | Bacteria | 2517 |
| 526 | Ga0207694_10092611 | 3300025924 | Bacteria | 2386 |
| 527 | Ga0207694_10100769 | 3300025924 | Bacteria | 2288 |
| 528 | Ga0207650_10171033 | 3300025925 | Bacteria | 1727 |
| 529 | Ga0207650_10201559 | 3300025925 | Bacteria | 1594 |
| 530 | Ga0207687_10079093 | 3300025927 | Bacteria | 2370 |
| 531 | Ga0207687_10155075 | 3300025927 | Bacteria | 1751 |
| 532 | Ga0207687_10703327 | 3300025927 | Bacteria | 858 |
| 533 | Ga0207700_10072422 | 3300025928 | Bacteria | 2657 |
| 534 | Ga0207700_10251740 | 3300025928 | Bacteria | 1509 |
| 535 | Ga0207664_10010393 | 3300025929 | Bacteria | 6574 |
| 536 | Ga0207664_10182205 | 3300025929 | Bacteria | 1804 |
| 537 | Ga0207664_10204329 | 3300025929 | Bacteria | 1707 |
| 538 | Ga0207664_10547262 | 3300025929 | Bacteria | 1038 |
| 539 | Ga0207644_10063880 | 3300025931 | Bacteria | 2674 |
| 540 | Ga0207644_10261401 | 3300025931 | Bacteria | 1384 |
| 541 | Ga0207644_10412647 | 3300025931 | Bacteria | 1105 |
| 542 | Ga0207644_10839471 | 3300025931 | Bacteria | 769 |
| 543 | Ga0207690_10356032 | 3300025932 | Bacteria | 1158 |
| 544 | Ga0207706_10176050 | 3300025933 | Bacteria | 1879 |
| 545 | Ga0207706_10241977 | 3300025933 | Bacteria | 1577 |
| 546 | Ga0207686_10132978 | 3300025934 | Bacteria | 1709 |
| 547 | Ga0207686_10178699 | 3300025934 | Bacteria | 1503 |
| 548 | Ga0207686_10232711 | 3300025934 | Bacteria | 1337 |
| 549 | Ga0207686_10452097 | 3300025934 | Bacteria | 988 |
| 550 | Ga0207709_10170416 | 3300025935 | Bacteria | 1527 |
| 551 | Ga0207709_10355602 | 3300025935 | Bacteria | 1107 |
| 552 | Ga0207670_10129044 | 3300025936 | Bacteria | 1849 |
| 553 | Ga0207670_10631456 | 3300025936 | Bacteria | 882 |
| 554 | Ga0207669_10022383 | 3300025937 | Bacteria | 3356 |
| 555 | Ga0207669_10077747 | 3300025937 | Bacteria | 2112 |
| 556 | Ga0207704_10362022 | 3300025938 | Bacteria | 1133 |
| 557 | Ga0207665_10000883 | 3300025939 | Bacteria | 20232 |
| 558 | Ga0207665_10012221 | 3300025939 | Bacteria | 5639 |
| 559 | Ga0207665_10022858 | 3300025939 | Bacteria | 4116 |
| 560 | Ga0207665_10115534 | 3300025939 | Bacteria | 1891 |
| 561 | Ga0207691_10536158 | 3300025940 | Bacteria | 993 |
| 562 | Ga0207711_10053689 | 3300025941 | Bacteria | 3456 |
| 563 | Ga0207711_10159713 | 3300025941 | Bacteria | 2039 |
| 564 | Ga0207711_10193091 | 3300025941 | Bacteria | 1856 |
| 565 | Ga0207711_10274003 | 3300025941 | Bacteria | 1553 |
| 566 | Ga0207689_10027093 | 3300025942 | Bacteria | 4798 |
| 567 | Ga0207689_10154733 | 3300025942 | Bacteria | 1890 |
| 568 | Ga0207661_10005672 | 3300025944 | Bacteria | 8808 |
| 569 | Ga0207661_10011706 | 3300025944 | Bacteria | 6367 |
| 570 | Ga0207661_10030324 | 3300025944 | Bacteria | 4165 |
| 571 | Ga0207679_10194024 | 3300025945 | Bacteria | 1691 |
| 572 | Ga0207679_10325726 | 3300025945 | Bacteria | 1332 |
| 573 | Ga0207679_10795778 | 3300025945 | Bacteria | 862 |
| 574 | Ga0207667_10013785 | 3300025949 | Bacteria | 9237 |
| 575 | Ga0207667_10076007 | 3300025949 | Bacteria | 3486 |
| 576 | Ga0207667_10116122 | 3300025949 | Bacteria | 2758 |
| 577 | Ga0207667_10186019 | 3300025949 | Bacteria | 2132 |
| 578 | Ga0207667_10287329 | 3300025949 | Bacteria | 1680 |
| 579 | Ga0207667_10363976 | 3300025949 | Bacteria | 1475 |
| 580 | Ga0207667_10446067 | 3300025949 | Bacteria | 1315 |
| 581 | Ga0207667_10569218 | 3300025949 | Bacteria | 1145 |
| 582 | Ga0207651_10401057 | 3300025960 | Bacteria | 1167 |
| 583 | Ga0207712_10029029 | 3300025961 | Bacteria | 3707 |
| 584 | Ga0207712_10415076 | 3300025961 | Bacteria | 1134 |
| 585 | Ga0207668_10166618 | 3300025972 | Bacteria | 1723 |
| 586 | Ga0207668_10171153 | 3300025972 | Bacteria | 1703 |
| 587 | Ga0207668_10184220 | 3300025972 | Bacteria | 1649 |
| 588 | Ga0207668_10191691 | 3300025972 | Bacteria | 1620 |
| 589 | Ga0207668_10691793 | 3300025972 | Bacteria | 895 |
| 590 | Ga0207640_10037366 | 3300025981 | Bacteria | 3054 |
| 591 | Ga0207640_10043166 | 3300025981 | Bacteria | 2880 |
| 592 | Ga0207640_10127987 | 3300025981 | Bacteria | 1831 |
| 593 | Ga0207640_10313514 | 3300025981 | Bacteria | 1246 |
| 594 | Ga0207640_10692248 | 3300025981 | Bacteria | 873 |
| 595 | Ga0207658_10201278 | 3300025986 | Bacteria | 1663 |
| 596 | Ga0207658_10382859 | 3300025986 | Bacteria | 1232 |
| 597 | Ga0207677_10082113 | 3300026023 | Bacteria | 2315 |
| 598 | Ga0207677_10109588 | 3300026023 | Bacteria | 2053 |
| 599 | Ga0207677_10650593 | 3300026023 | Bacteria | 930 |
| 600 | Ga0207703_10664426 | 3300026035 | Bacteria | 989 |
| 601 | Ga0207703_10711093 | 3300026035 | Bacteria | 956 |
| 602 | Ga0207639_10005857 | 3300026041 | Bacteria | 8325 |
| 603 | Ga0207639_10071612 | 3300026041 | Bacteria | 2712 |
| 604 | Ga0207639_10071905 | 3300026041 | Bacteria | 2707 |
| 605 | Ga0207639_10148092 | 3300026041 | Bacteria | 1963 |
| 606 | Ga0207639_10398839 | 3300026041 | Bacteria | 1239 |
| 607 | Ga0207639_11156156 | 3300026041 | Bacteria | 726 |
| 608 | Ga0207678_10070411 | 3300026067 | Bacteria | 2999 |
| 609 | Ga0207678_10122679 | 3300026067 | Bacteria | 2217 |
| 610 | Ga0207678_10191437 | 3300026067 | Bacteria | 1748 |
| 611 | Ga0207678_10289410 | 3300026067 | Bacteria | 1407 |
| 612 | Ga0207708_10274520 | 3300026075 | Bacteria | 1364 |
| 613 | Ga0207702_10000004 | 3300026078 | Bacteria | 422182 |
| 614 | Ga0207702_10010411 | 3300026078 | Bacteria | 7783 |
| 615 | Ga0207702_10119063 | 3300026078 | Bacteria | 2360 |
| 616 | Ga0207702_10165491 | 3300026078 | Bacteria | 2023 |
| 617 | Ga0207702_10269383 | 3300026078 | Bacteria | 1606 |
| 618 | Ga0207702_10596896 | 3300026078 | Bacteria | 1083 |
| 619 | Ga0207702_10671654 | 3300026078 | Bacteria | 1020 |
| 620 | Ga0207702_10860770 | 3300026078 | Bacteria | 897 |
| 621 | Ga0207641_10109214 | 3300026088 | Bacteria | 2450 |
| 622 | Ga0207641_10921228 | 3300026088 | Bacteria | 868 |
| 623 | Ga0207648_10043666 | 3300026089 | Bacteria | 3935 |
| 624 | Ga0207648_10718355 | 3300026089 | Bacteria | 927 |
| 625 | Ga0207676_10721106 | 3300026095 | Bacteria | 968 |
| 626 | Ga0207674_10004725 | 3300026116 | Bacteria | 16330 |
| 627 | Ga0207674_10005754 | 3300026116 | Bacteria | 14710 |
| 628 | Ga0207674_10051030 | 3300026116 | Bacteria | 4223 |
| 629 | Ga0207674_10054515 | 3300026116 | Bacteria | 4070 |
| 630 | Ga0207674_10253984 | 3300026116 | Bacteria | 1705 |
| 631 | Ga0207674_10570540 | 3300026116 | Bacteria | 1093 |
| 632 | Ga0207675_100066332 | 3300026118 | Bacteria | 3373 |
| 633 | Ga0207675_100103203 | 3300026118 | Bacteria | 2687 |
| 634 | Ga0207675_100256940 | 3300026118 | Bacteria | 1692 |
| 635 | Ga0207675_100320949 | 3300026118 | Bacteria | 1512 |
| 636 | Ga0207675_100431583 | 3300026118 | Bacteria | 1303 |
| 637 | Ga0207683_10042727 | 3300026121 | Bacteria | 3959 |
| 638 | Ga0207683_10100679 | 3300026121 | Bacteria | 2580 |
| 639 | Ga0207683_10216139 | 3300026121 | Bacteria | 1746 |
| 640 | Ga0207683_10315563 | 3300026121 | Bacteria | 1431 |
| 641 | Ga0207683_10319671 | 3300026121 | Bacteria | 1422 |
| 642 | Ga0207683_10564394 | 3300026121 | Bacteria | 1053 |
| 643 | Ga0207698_10020218 | 3300026142 | Bacteria | 4577 |
| 644 | Ga0207698_10062251 | 3300026142 | Bacteria | 2913 |
| 645 | Ga0207698_10105572 | 3300026142 | Bacteria | 2347 |
| 646 | Ga0207698_10188168 | 3300026142 | Bacteria | 1836 |
| 647 | Ga0207698_10214105 | 3300026142 | Bacteria | 1736 |
| 648 | Ga0207698_10775302 | 3300026142 | Bacteria | 959 |
| 649 | Ga0209389_1000157 | 3300027296 | Bacteria | 56696 |
| 650 | Ga0209389_1002628 | 3300027296 | Bacteria | 13948 |
| 651 | Ga0209589_1000035 | 3300027357 | Bacteria | 134091 |
| 652 | Ga0209589_1010054 | 3300027357 | Bacteria | 13948 |
| 653 | Ga0209489_100079 | 3300027361 | Bacteria | 134091 |
| 654 | Ga0209489_101111 | 3300027361 | Bacteria | 54702 |
| 655 | Ga0209489_108314 | 3300027361 | Bacteria | 14326 |
| 656 | Ga0209700_100011 | 3300027363 | Bacteria | 362159 |
| 657 | Ga0209700_100077 | 3300027363 | Bacteria | 134091 |
| 658 | Ga0209179_1025672 | 3300027512 | Bacteria | 1177 |
| 659 | Ga0209588_1021388 | 3300027671 | Bacteria | 2032 |
| 660 | Ga0209813_10017597 | 3300027866 | Bacteria | 1964 |
| 661 | Ga0207428_10116488 | 3300027907 | Bacteria | 2052 |
| 662 | Ga0268266_10001236 | 3300028379 | Bacteria | 31292 |
| 663 | Ga0268266_10004650 | 3300028379 | Bacteria | 13084 |
| 664 | Ga0268266_10023413 | 3300028379 | Bacteria | 5260 |
| 665 | Ga0268266_11101644 | 3300028379 | Bacteria | 768 |
| 666 | Ga0268265_10181291 | 3300028380 | Bacteria | 1809 |
| 667 | Ga0268264_10000062 | 3300028381 | Bacteria | 302110 |
| 668 | Ga0265326_10042825 | 3300028558 | Bacteria | 1285 |
| 669 | Ga0265319_1012209 | 3300028563 | Bacteria | 3481 |
| 670 | Ga0265334_10018421 | 3300028573 | Bacteria | 2879 |
| 671 | Ga0265318_10113347 | 3300028577 | Bacteria | 997 |
| 672 | Ga0265323_10002052 | 3300028653 | Bacteria | 9454 |
| 673 | Ga0265322_10019902 | 3300028654 | Bacteria | 1924 |
| 674 | Ga0265336_10006935 | 3300028666 | Bacteria | 4057 |
| 675 | Ga0307517_10000175 | 3300028786 | Bacteria | 105567 |
| 676 | Ga0307517_10154848 | 3300028786 | Bacteria | 1559 |
| 677 | Ga0307517_10184938 | 3300028786 | Bacteria | 1336 |
| 678 | Ga0307515_10153519 | 3300028794 | Bacteria | 2392 |
| 679 | Ga0307515_10256125 | 3300028794 | Bacteria | 1494 |
| 680 | Ga0265338_10001066 | 3300028800 | Bacteria | 45588 |
| 681 | Ga0265324_10006962 | 3300029957 | Bacteria | 4653 |
| 682 | Ga0307511_10248289 | 3300030521 | Bacteria | 859 |
| 683 | Ga0307512_10264446 | 3300030522 | Bacteria | 841 |
| 684 | Ga0265330_10029574 | 3300031235 | Bacteria | 2463 |
| 685 | Ga0265330_10041820 | 3300031235 | Bacteria | 2031 |
| 686 | Ga0265332_10064907 | 3300031238 | Bacteria | 1559 |
| 687 | Ga0265325_10014735 | 3300031241 | Bacteria | 4411 |
| 688 | Ga0265340_10014954 | 3300031247 | Bacteria | 4041 |
| 689 | Ga0265339_10012660 | 3300031249 | Bacteria | 5138 |
| 690 | Ga0265331_10069792 | 3300031250 | Bacteria | 1645 |
| 691 | Ga0265331_10191712 | 3300031250 | Bacteria | 922 |
| 692 | Ga0307513_10333874 | 3300031456 | Bacteria | 1269 |
| 693 | Ga0307509_10038191 | 3300031507 | Bacteria | 5240 |
| 694 | Ga0307509_10143590 | 3300031507 | Bacteria | 2317 |
| 695 | Ga0307509_10500397 | 3300031507 | Bacteria | 900 |
| 696 | Ga0307408_100800975 | 3300031548 | Bacteria | 855 |
| 697 | Ga0307508_10000045 | 3300031616 | Bacteria | 142824 |
| 698 | Ga0307508_10139575 | 3300031616 | Bacteria | 2027 |
| 699 | Ga0307508_10147259 | 3300031616 | Bacteria | 1959 |
| 700 | Ga0307508_10553802 | 3300031616 | Bacteria | 748 |
| 701 | Ga0265314_10005887 | 3300031711 | Bacteria | 10968 |
| 702 | Ga0265314_10050484 | 3300031711 | Bacteria | 2905 |
| 703 | Ga0265314_10071752 | 3300031711 | Bacteria | 2316 |
| 704 | Ga0265342_10008380 | 3300031712 | Bacteria | 7418 |
| 705 | Ga0265342_10288626 | 3300031712 | Bacteria | 867 |
| 706 | Ga0265342_10293897 | 3300031712 | Bacteria | 857 |
| 707 | Ga0307516_10016686 | 3300031730 | Bacteria | 7667 |
| 708 | Ga0307516_10117042 | 3300031730 | Bacteria | 2459 |
| 709 | Ga0307405_10056708 | 3300031731 | Bacteria | 2458 |
| 710 | Ga0307410_10307002 | 3300031852 | Bacteria | 1254 |
| 711 | Ga0307406_10269253 | 3300031901 | Bacteria | 1293 |
| 712 | Ga0307407_10734445 | 3300031903 | Bacteria | 746 |
| 713 | Ga0307412_10065283 | 3300031911 | Bacteria | 2463 |
| 714 | Ga0307416_100145455 | 3300032002 | Bacteria | 2163 |
| 715 | Ga0307416_100631037 | 3300032002 | Bacteria | 1154 |
| 716 | Ga0307411_10515635 | 3300032005 | Bacteria | 1014 |
| 717 | Ga0307411_10758544 | 3300032005 | Bacteria | 851 |
| 718 | Ga0307415_100412418 | 3300032126 | Bacteria | 1156 |
| 719 | Ga0307507_10148703 | 3300033179 | Bacteria | 1770 |
| 720 | Ga0307510_10013138 | 3300033180 | Bacteria | 9823 |
| 721 | Ga0307510_10014518 | 3300033180 | Bacteria | 9322 |
| 722 | Ga0315911_1000008 | 3300033442 | Bacteria | 381285 |
| 723 | Ga0373926_0004776 | 3300035083 | Bacteria | 4455 |
| 724 | Ga0373926_0028267 | 3300035083 | Bacteria | 1968 |
| 725 | Ga0373928_0038806 | 3300035084 | Bacteria | 1086 |
| 726 | Ga0373934_0000780 | 3300035086 | Bacteria | 11447 |
| 727 | Ga0373934_0026919 | 3300035086 | Bacteria | 2232 |
| 728 | Ga0373944_0052814 | 3300035089 | Bacteria | 1285 |
| 729 | Ga0373923_0008412 | 3300035111 | Bacteria | 3677 |
| 730 | Ga0373923_0076584 | 3300035111 | Bacteria | 1445 |
| 731 | Ga0373923_0083745 | 3300035111 | Bacteria | 1386 |
| 732 | Ga0373923_0172575 | 3300035111 | Bacteria | 991 |
| 733 | Ga0373936_0021610 | 3300035113 | Bacteria | 2503 |
| 734 | Ga0373936_0027809 | 3300035113 | Bacteria | 2219 |
| 735 | Ga0373936_0043664 | 3300035113 | Bacteria | 1802 |
| 736 | Ga0373936_0076313 | 3300035113 | Bacteria | 1389 |
| 737 | Ga0373945_0002845 | 3300035116 | Bacteria | 5442 |
| 738 | Ga0373945_0061846 | 3300035116 | Bacteria | 1399 |
| 739 | Ga0373953_0092119 | 3300035117 | Bacteria | 1268 |
| 740 | Ga0373956_0001732 | 3300035119 | Bacteria | 8991 |
| 741 | Ga0373956_0061422 | 3300035119 | Bacteria | 1702 |
| 742 | Ga0373956_0090808 | 3300035119 | Bacteria | 1409 |
| 743 | Ga0373957_0001309 | 3300035120 | Bacteria | 6685 |
| 744 | Ga0373957_0012503 | 3300035120 | Bacteria | 2860 |
| 745 | Ga0373957_0033998 | 3300035120 | Bacteria | 1885 |
| 746 | Ga0373960_0050314 | 3300035121 | Bacteria | 1235 |
| 747 | Ga0373943_0037844 | 3300035170 | Bacteria | 2317 |
| 748 | Ga0373943_0037978 | 3300035170 | Bacteria | 2313 |
| 749 | Ga0373943_0140321 | 3300035170 | Bacteria | 1301 |
| 750 | Ga0373943_0241441 | 3300035170 | Bacteria | 1012 |
| 751 | Ga0373943_0325905 | 3300035170 | Bacteria | 876 |
| 752 | Ga0373946_0001716 | 3300035171 | Bacteria | 7640 |
| 753 | Ga0373955_0126352 | 3300035172 | Bacteria | 1490 |
| 754 | Ga0373962_0047155 | 3300035242 | Bacteria | 1232 |
| 755 | Ga0373924_0005291 | 3300035410 | Bacteria | 4561 |
| 756 | Ga0373924_0021215 | 3300035410 | Bacteria | 2533 |
| 757 | Ga0373931_0153079 | 3300035691 | Bacteria | 1346 |
| 758 | Ga0373931_0179829 | 3300035691 | Bacteria | 1252 |
| 759 | Ga0373935_0001046 | 3300035692 | Bacteria | 15076 |
| 760 | Ga0373935_0413110 | 3300035692 | Bacteria | 970 |
| 761 | Ga0373935_0417320 | 3300035692 | Bacteria | 966 |
| 762 | Ga0373927_0001064 | 3300035695 | Bacteria | 20972 |
| 763 | Ga0373927_0001972 | 3300035695 | Bacteria | 15136 |
| 764 | Ga0373927_0008017 | 3300035695 | Bacteria | 7129 |
| 765 | Ga0373927_0010444 | 3300035695 | Bacteria | 6189 |
| 766 | Ga0373927_0021518 | 3300035695 | Bacteria | 4227 |
| 767 | Ga0373927_0052332 | 3300035695 | Bacteria | 2641 |
| 768 | Ga0373927_0068391 | 3300035695 | Bacteria | 2298 |
| 769 | Ga0373933_0000068 | 3300035724 | Bacteria | 63195 |
| 770 | Ga0373933_0057503 | 3300035724 | Bacteria | 2337 |
| 771 | Ga0373933_0085973 | 3300035724 | Bacteria | 1934 |
| 772 | Ga0373933_0356621 | 3300035724 | Bacteria | 950 |
| 773 | Ga0373933_0449094 | 3300035724 | Bacteria | 843 |
| 774 | Ga0373947_0002167 | 3300035725 | Bacteria | 11925 |
| 775 | Ga0373947_0019455 | 3300035725 | Bacteria | 3915 |
| 776 | Ga0373947_0030529 | 3300035725 | Bacteria | 3167 |
| 777 | Ga0373947_0058446 | 3300035725 | Bacteria | 2337 |
| 778 | Ga0373947_0150565 | 3300035725 | Bacteria | 1498 |
| 779 | Ga0373947_0151038 | 3300035725 | Bacteria | 1496 |
| 780 | Ga0373947_0252253 | 3300035725 | Bacteria | 1167 |
| 781 | Ga0373937_0043074 | 3300036401 | Bacteria | 4120 |
| 782 | Ga0373937_0075202 | 3300036401 | Bacteria | 3117 |
| 783 | Ga0373925_0005141 | 3300037068 | Bacteria | 9804 |
| 784 | Ga0373925_0024532 | 3300037068 | Bacteria | 4402 |
| 785 | Ga0373925_0040045 | 3300037068 | Bacteria | 3468 |
| 786 | Ga0373925_0056601 | 3300037068 | Bacteria | 2937 |
| 787 | Ga0373925_0105266 | 3300037068 | Bacteria | 2174 |
| 788 | Ga0373925_0286126 | 3300037068 | Bacteria | 1328 |
| 789 | Ga0373925_0597686 | 3300037068 | Bacteria | 909 |
| 790 | Ga0373925_0783684 | 3300037068 | Bacteria | 786 |
| 791 | Ga0395899_0262652 | 3300037312 | Bacteria | 1180 |
| 792 | Ga0395900_0006757 | 3300037418 | Bacteria | 11904 |
| 793 | Ga0395900_0015450 | 3300037418 | Bacteria | 7783 |
| 794 | Ga0395900_0137229 | 3300037418 | Bacteria | 2506 |
| 795 | Ga0395900_0298834 | 3300037418 | Bacteria | 1597 |
| 796 | Ga0395900_0860627 | 3300037418 | Bacteria | 832 |
| 797 | Ga0395898_0011951 | 3300037466 | Bacteria | 8989 |
| 798 | Ga0395898_0016369 | 3300037466 | Bacteria | 7589 |
| 799 | Ga0395898_0052957 | 3300037466 | Bacteria | 3964 |
| 800 | Ga0395898_0090210 | 3300037466 | Bacteria | 2950 |
| 801 | Ga0395905_0001948 | 3300037471 | Bacteria | 23653 |
| 802 | Ga0395905_0023265 | 3300037471 | Bacteria | 5858 |
| 803 | Ga0395905_0312554 | 3300037471 | Bacteria | 1460 |
| 804 | Ga0436364_0617141 | 3300037853 | Bacteria | 1769 |
| 805 | Ga0436364_0976416 | 3300037853 | Bacteria | 7958 |
| 806 | Ga0436364_1015631 | 3300037853 | Bacteria | 1261 |
| 807 | Ga0436364_1444289 | 3300037853 | Bacteria | 3251 |
| 808 | Ga0395901_0165896 | 3300038443 | Bacteria | 2319 |
| 809 | Ga0395901_0305186 | 3300038443 | Bacteria | 1650 |
| 810 | Ga0436365_0112616 | 3300039437 | Bacteria | 4886 |
| 811 | Ga0436365_0469659 | 3300039437 | Bacteria | 1474 |
| 812 | Ga0436365_0671443 | 3300039437 | Bacteria | 806 |
| 813 | Ga0436365_1040719 | 3300039437 | Bacteria | 1321 |
| 814 | Ga0436365_1629119 | 3300039437 | Bacteria | 1772 |
| 815 | Ga0436365_1908508 | 3300039437 | Bacteria | 1698 |
| 816 | Ga0436360_0233780 | 3300039438 | Bacteria | 747 |
| 817 | Ga0436360_1049680 | 3300039438 | Bacteria | 1204 |
| 818 | Ga0436361_0364288 | 3300039447 | Bacteria | 989 |
| 819 | Ga0436361_0750635 | 3300039447 | Bacteria | 2353 |
| 820 | Ga0436361_1013106 | 3300039447 | Bacteria | 2298 |
| 821 | Ga0436363_0426668 | 3300039450 | Bacteria | 750 |
| 822 | Ga0436363_0779766 | 3300039450 | Bacteria | 2350 |
| 823 | Ga0436363_0977790 | 3300039450 | Bacteria | 7072 |
| 824 | Ga0436363_1376007 | 3300039450 | Bacteria | 1039 |
| 825 | Ga0436362_0251519 | 3300039453 | Bacteria | 1080 |
| 826 | Ga0436362_0570020 | 3300039453 | Bacteria | 1022 |
| 827 | Ga0436362_0987028 | 3300039453 | Bacteria | 2211 |
| 828 | Ga0451787_220816 | 3300041441 | Bacteria | 1321 |
| 829 | Ga0451789_0350437 | 3300041443 | Bacteria | 1244 |
| 830 | Ga0451791_1697094 | 3300041451 | Bacteria | 1060 |
| 831 | Ga0451795_0375601 | 3300041456 | Bacteria | 1300 |
| 832 | Ga0451843_0148428 | 3300041509 | Bacteria | 1584 |
| 833 | Ga0466969_0016565 | 3300044656 | Bacteria | 3855 |
| 834 | Ga0466972_0002927 | 3300044658 | Bacteria | 8463 |
| 835 | Ga0466972_0012390 | 3300044658 | Bacteria | 4284 |
| 836 | Ga0466972_0126517 | 3300044658 | Bacteria | 1204 |
| 837 | Ga0466965_0011930 | 3300044683 | Bacteria | 4079 |
| 838 | Ga0466965_0071960 | 3300044683 | Bacteria | 1740 |
| 839 | Ga0466965_0119356 | 3300044683 | Bacteria | 1361 |
| 840 | Ga0466966_0022780 | 3300044684 | Bacteria | 4106 |
| 841 | Ga0466966_0051085 | 3300044684 | Bacteria | 2629 |
| 842 | Ga0466961_0000709 | 3300044693 | Bacteria | 20961 |
| 843 | Ga0466961_0273462 | 3300044693 | Bacteria | 1035 |
| 844 | Ga0466963_0087882 | 3300044694 | Bacteria | 2114 |
| 845 | Ga0466963_0438665 | 3300044694 | Bacteria | 921 |
| 846 | Ga0466963_0475982 | 3300044694 | Bacteria | 881 |
| 847 | Ga0466964_0221722 | 3300044706 | Bacteria | 919 |
| 848 | Ga0466968_0056766 | 3300044735 | Bacteria | 1682 |
| 849 | Ga0466968_0157130 | 3300044735 | Bacteria | 1048 |
| 850 | Ga0466970_0081759 | 3300044765 | Bacteria | 1747 |
| 851 | Ga0466957_0037744 | 3300044842 | Bacteria | 2909 |
| 852 | Ga0466957_0094669 | 3300044842 | Bacteria | 1876 |
| 853 | Ga0466957_0395161 | 3300044842 | Bacteria | 945 |
| 854 | Ga0466959_0009693 | 3300045049 | Bacteria | 6858 |
| 855 | Ga0466959_0013890 | 3300045049 | Bacteria | 5846 |
| 856 | Ga0466959_0147742 | 3300045049 | Bacteria | 1658 |
| 857 | Ga0466958_0156277 | 3300045836 | Bacteria | 1440 |
| 858 | Ga0466967_0052224 | 3300045976 | Bacteria | 3587 |
| 859 | Ga0466967_0060911 | 3300045976 | Bacteria | 3346 |
| 860 | Ga0466967_0068756 | 3300045976 | Bacteria | 3164 |
| 861 | Ga0466967_0140103 | 3300045976 | Bacteria | 2252 |
| 862 | Ga0466967_0145430 | 3300045976 | Bacteria | 2211 |
| 863 | Ga0466967_0178275 | 3300045976 | Bacteria | 2003 |
| 864 | Ga0495617_007858 | 3300046452 | Bacteria | 3690 |
| 865 | Ga0495592_0017770 | 3300046454 | Bacteria | 5405 |
| 866 | Ga0495592_0032666 | 3300046454 | Bacteria | 3925 |
| 867 | Ga0495592_0057120 | 3300046454 | Bacteria | 2881 |
| 868 | Ga0495592_0077436 | 3300046454 | Bacteria | 2411 |
| 869 | Ga0495603_0002438 | 3300046455 | Bacteria | 10936 |
| 870 | Ga0495603_0036471 | 3300046455 | Bacteria | 2952 |
| 871 | Ga0495603_0097607 | 3300046455 | Bacteria | 1716 |
| 872 | Ga0495603_0119907 | 3300046455 | Bacteria | 1533 |
| 873 | Ga0495603_0156802 | 3300046455 | Bacteria | 1321 |
| 874 | Ga0495603_0193120 | 3300046455 | Bacteria | 1177 |
| 875 | Ga0495590_0048632 | 3300046457 | Bacteria | 1480 |
| 876 | Ga0495629_0003619 | 3300046459 | Bacteria | 11680 |
| 877 | Ga0495629_0008023 | 3300046459 | Bacteria | 7770 |
| 878 | Ga0495629_0085166 | 3300046459 | Bacteria | 2205 |
| 879 | Ga0495629_0091272 | 3300046459 | Bacteria | 2125 |
| 880 | Ga0495629_0191718 | 3300046459 | Bacteria | 1415 |
| 881 | Ga0495629_0676205 | 3300046459 | Bacteria | 686 |
| 882 | Ga0495638_0080061 | 3300046460 | Bacteria | 1985 |
| 883 | Ga0495638_0098501 | 3300046460 | Bacteria | 1751 |
| 884 | Ga0495638_0163579 | 3300046460 | Bacteria | 1282 |
| 885 | Ga0495641_0002985 | 3300046461 | Bacteria | 12986 |
| 886 | Ga0495641_0219236 | 3300046461 | Bacteria | 853 |
| 887 | Ga0495651_0029728 | 3300046462 | Bacteria | 4260 |
| 888 | Ga0495651_0051549 | 3300046462 | Bacteria | 3171 |
| 889 | Ga0495651_0216124 | 3300046462 | Bacteria | 1330 |
| 890 | Ga0495651_0222108 | 3300046462 | Bacteria | 1307 |
| 891 | Ga0495653_0001635 | 3300046463 | Bacteria | 17593 |
| 892 | Ga0495653_0019937 | 3300046463 | Bacteria | 5435 |
| 893 | Ga0495653_0193389 | 3300046463 | Bacteria | 1386 |
| 894 | Ga0495650_0066621 | 3300046471 | Bacteria | 1425 |
| 895 | Ga0495580_0001546 | 3300046472 | Bacteria | 20242 |
| 896 | Ga0495580_0022982 | 3300046472 | Bacteria | 4585 |
| 897 | Ga0495580_0075302 | 3300046472 | Bacteria | 2355 |
| 898 | Ga0495580_0119762 | 3300046472 | Bacteria | 1828 |
| 899 | Ga0495582_0000535 | 3300046473 | Bacteria | 20995 |
| 900 | Ga0495582_0015124 | 3300046473 | Bacteria | 4244 |
| 901 | Ga0495582_0236394 | 3300046473 | Bacteria | 1047 |
| 902 | Ga0495639_0001501 | 3300046475 | Bacteria | 10399 |
| 903 | Ga0495639_0060279 | 3300046475 | Bacteria | 1738 |
| 904 | Ga0495639_0078492 | 3300046475 | Bacteria | 1534 |
| 905 | Ga0495639_0225122 | 3300046475 | Bacteria | 923 |
| 906 | Ga0495662_0000510 | 3300046476 | Bacteria | 17683 |
| 907 | Ga0495664_0006101 | 3300046477 | Bacteria | 6651 |
| 908 | Ga0495664_0082524 | 3300046477 | Bacteria | 1928 |
| 909 | Ga0495664_0152430 | 3300046477 | Bacteria | 1402 |
| 910 | Ga0495664_0189099 | 3300046477 | Bacteria | 1248 |
| 911 | Ga0495664_0371466 | 3300046477 | Bacteria | 860 |
| 912 | Ga0495664_0398054 | 3300046477 | Bacteria | 827 |
| 913 | Ga0495585_0059571 | 3300046492 | Bacteria | 2103 |
| 914 | Ga0495585_0188504 | 3300046492 | Bacteria | 1056 |
| 915 | Ga0495585_0214663 | 3300046492 | Bacteria | 973 |
| 916 | Ga0495594_0000467 | 3300046499 | Bacteria | 20554 |
| 917 | Ga0495594_0037377 | 3300046499 | Bacteria | 2649 |
| 918 | Ga0495594_0064308 | 3300046499 | Bacteria | 2034 |
| 919 | Ga0495594_0087032 | 3300046499 | Bacteria | 1748 |
| 920 | Ga0495594_0274512 | 3300046499 | Bacteria | 960 |
| 921 | Ga0495596_0067988 | 3300046500 | Bacteria | 1385 |
| 922 | Ga0495596_0103078 | 3300046500 | Bacteria | 1108 |
| 923 | Ga0495596_0158952 | 3300046500 | Bacteria | 878 |
| 924 | Ga0495583_0035839 | 3300046506 | Bacteria | 2364 |
| 925 | Ga0495606_0000831 | 3300046507 | Bacteria | 46699 |
| 926 | Ga0495606_0080287 | 3300046507 | Bacteria | 2030 |
| 927 | Ga0495606_0107909 | 3300046507 | Bacteria | 1683 |
| 928 | Ga0495606_0153961 | 3300046507 | Bacteria | 1347 |
| 929 | Ga0495608_0018999 | 3300046511 | Bacteria | 4736 |
| 930 | Ga0495608_0035295 | 3300046511 | Bacteria | 3373 |
| 931 | Ga0495610_0035434 | 3300046512 | Bacteria | 2562 |
| 932 | Ga0495616_0060651 | 3300046513 | Bacteria | 1857 |
| 933 | Ga0495616_0081206 | 3300046513 | Bacteria | 1551 |
| 934 | Ga0495618_0035312 | 3300046514 | Bacteria | 3138 |
| 935 | Ga0495618_0322370 | 3300046514 | Bacteria | 957 |
| 936 | Ga0495618_0471414 | 3300046514 | Bacteria | 760 |
| 937 | Ga0495620_0048269 | 3300046515 | Bacteria | 1828 |
| 938 | Ga0495620_0087635 | 3300046515 | Bacteria | 1252 |
| 939 | Ga0495628_0043951 | 3300046516 | Bacteria | 3556 |
| 940 | Ga0495628_0223081 | 3300046516 | Bacteria | 1415 |
| 941 | Ga0495628_0297867 | 3300046516 | Bacteria | 1194 |
| 942 | Ga0495628_0570056 | 3300046516 | Bacteria | 811 |
| 943 | Ga0495630_0009913 | 3300046517 | Bacteria | 6861 |
| 944 | Ga0495631_0024014 | 3300046518 | Bacteria | 2820 |
| 945 | Ga0495631_0106620 | 3300046518 | Bacteria | 1205 |
| 946 | Ga0495632_0049014 | 3300046519 | Bacteria | 2089 |
| 947 | Ga0495632_0083902 | 3300046519 | Bacteria | 1517 |
| 948 | Ga0495632_0108892 | 3300046519 | Bacteria | 1302 |
| 949 | Ga0495637_0142636 | 3300046520 | Bacteria | 908 |
| 950 | Ga0495643_0097652 | 3300046522 | Bacteria | 1509 |
| 951 | Ga0495643_0117498 | 3300046522 | Bacteria | 1346 |
| 952 | Ga0495644_0023987 | 3300046523 | Bacteria | 2321 |
| 953 | Ga0495644_0070904 | 3300046523 | Bacteria | 1309 |
| 954 | Ga0495648_0002812 | 3300046524 | Bacteria | 15664 |
| 955 | Ga0495648_0027211 | 3300046524 | Bacteria | 3833 |
| 956 | Ga0495666_0057156 | 3300046526 | Bacteria | 1868 |
| 957 | Ga0495666_0142311 | 3300046526 | Bacteria | 1117 |
| 958 | Ga0495652_0059360 | 3300046529 | Bacteria | 3236 |
| 959 | Ga0495652_0068112 | 3300046529 | Bacteria | 2982 |
| 960 | Ga0495652_0070098 | 3300046529 | Bacteria | 2932 |
| 961 | Ga0495652_0165886 | 3300046529 | Bacteria | 1709 |
| 962 | Ga0495652_0167037 | 3300046529 | Bacteria | 1702 |
| 963 | Ga0495652_0258866 | 3300046529 | Bacteria | 1285 |
| 964 | Ga0495654_0015350 | 3300046530 | Bacteria | 4068 |
| 965 | Ga0495654_0112650 | 3300046530 | Bacteria | 1240 |
| 966 | Ga0495654_0236238 | 3300046530 | Bacteria | 767 |
| 967 | Ga0495665_0001927 | 3300046531 | Bacteria | 11189 |
| 968 | Ga0495665_0022232 | 3300046531 | Bacteria | 3409 |
| 969 | Ga0495665_0139778 | 3300046531 | Bacteria | 1266 |
| 970 | Ga0495640_0007295 | 3300046533 | Bacteria | 8711 |
| 971 | Ga0495640_0015412 | 3300046533 | Bacteria | 5753 |
| 972 | Ga0495640_0023272 | 3300046533 | Bacteria | 4517 |
| 973 | Ga0495640_0064128 | 3300046533 | Bacteria | 2485 |
| 974 | Ga0495640_0138819 | 3300046533 | Bacteria | 1568 |
| 975 | Ga0495640_0431526 | 3300046533 | Bacteria | 806 |
| 976 | Ga0495586_0064230 | 3300046535 | Bacteria | 2000 |
| 977 | Ga0495586_0125755 | 3300046535 | Bacteria | 1434 |
| 978 | Ga0495587_0005610 | 3300046536 | Bacteria | 8189 |
| 979 | Ga0495587_0110680 | 3300046536 | Bacteria | 1578 |
| 980 | Ga0495598_0053475 | 3300046537 | Bacteria | 1223 |
| 981 | Ga0495597_0123966 | 3300046542 | Bacteria | 1075 |
| 982 | Ga0495645_0045402 | 3300046543 | Bacteria | 3205 |
| 983 | Ga0495645_0052602 | 3300046543 | Bacteria | 2962 |
| 984 | Ga0495645_0245387 | 3300046543 | Bacteria | 1193 |
| 985 | Ga0495622_0008565 | 3300046557 | Bacteria | 4740 |
| 986 | Ga0495622_0008650 | 3300046557 | Bacteria | 4717 |
| 987 | Ga0495622_0011328 | 3300046557 | Bacteria | 4118 |
| 988 | Ga0495622_0014834 | 3300046557 | Bacteria | 3623 |
| 989 | Ga0495622_0055608 | 3300046557 | Bacteria | 1835 |
| 990 | Ga0495622_0123865 | 3300046557 | Bacteria | 1179 |
| 991 | Ga0495667_0010575 | 3300046559 | Bacteria | 6244 |
| 992 | Ga0495667_0018500 | 3300046559 | Bacteria | 4707 |
| 993 | Ga0495667_0025319 | 3300046559 | Bacteria | 3998 |
| 994 | Ga0495667_0036607 | 3300046559 | Bacteria | 3274 |
| 995 | Ga0495667_0158642 | 3300046559 | Bacteria | 1455 |
| 996 | Ga0495667_0170067 | 3300046559 | Bacteria | 1400 |
| 997 | Ga0495667_0299273 | 3300046559 | Bacteria | 1019 |
| 998 | Ga0495656_0012319 | 3300046615 | Bacteria | 3152 |
| 999 | Ga0495656_0048289 | 3300046615 | Bacteria | 1808 |
| 1000 | Ga0495668_0065348 | 3300046616 | Bacteria | 2002 |
| 1001 | Ga0495668_0115910 | 3300046616 | Bacteria | 1465 |
| 1002 | Ga0495668_0116320 | 3300046616 | Bacteria | 1462 |
| 1003 | Ga0495668_0148055 | 3300046616 | Bacteria | 1285 |
| 1004 | Ga0495634_0011829 | 3300046642 | Bacteria | 6346 |
| 1005 | Ga0495634_0013239 | 3300046642 | Bacteria | 5964 |
| 1006 | Ga0495634_0036690 | 3300046642 | Bacteria | 3351 |
| 1007 | Ga0495634_0036827 | 3300046642 | Bacteria | 3344 |
| 1008 | Ga0495634_0120863 | 3300046642 | Bacteria | 1677 |
| 1009 | Ga0495634_0457594 | 3300046642 | Bacteria | 752 |
| 1010 | Ga0495625_0231521 | 3300046660 | Bacteria | 1206 |
| 1011 | Ga0495625_0544764 | 3300046660 | Bacteria | 703 |
| 1012 | Ga0495635_0017402 | 3300046663 | Bacteria | 5021 |
| 1013 | Ga0495635_0052925 | 3300046663 | Bacteria | 2796 |
| 1014 | Ga0495635_0088614 | 3300046663 | Bacteria | 2117 |
| 1015 | Ga0495635_0100102 | 3300046663 | Bacteria | 1981 |
| 1016 | Ga0495635_0292186 | 3300046663 | Bacteria | 1093 |
| 1017 | Ga0495659_0047094 | 3300046664 | Bacteria | 1558 |
| 1018 | Ga0495661_0022644 | 3300046665 | Bacteria | 4086 |
| 1019 | Ga0495661_0221179 | 3300046665 | Bacteria | 981 |
| 1020 | Ga0495588_0002722 | 3300046674 | Bacteria | 7577 |
| 1021 | Ga0495588_0045412 | 3300046674 | Bacteria | 2252 |
| 1022 | Ga0495588_0063663 | 3300046674 | Bacteria | 1912 |
| 1023 | Ga0495588_0114666 | 3300046674 | Bacteria | 1420 |
| 1024 | Ga0495588_0210595 | 3300046674 | Bacteria | 1026 |
| 1025 | Ga0495588_0309897 | 3300046674 | Bacteria | 831 |
| 1026 | Ga0495657_0013439 | 3300046675 | Bacteria | 6042 |
| 1027 | Ga0495657_0062004 | 3300046675 | Bacteria | 2472 |
| 1028 | Ga0495657_0072896 | 3300046675 | Bacteria | 2238 |
| 1029 | Ga0495657_0099160 | 3300046675 | Bacteria | 1858 |
| 1030 | Ga0495599_0000562 | 3300046678 | Bacteria | 21198 |
| 1031 | Ga0495599_0083667 | 3300046678 | Bacteria | 1993 |
| 1032 | Ga0495599_0163328 | 3300046678 | Bacteria | 1376 |
| 1033 | Ga0495623_0028554 | 3300046679 | Bacteria | 3588 |
| 1034 | Ga0495623_0062253 | 3300046679 | Bacteria | 2339 |
| 1035 | Ga0495646_0056073 | 3300046680 | Bacteria | 2363 |
| 1036 | Ga0495647_0000600 | 3300046681 | Bacteria | 10656 |
| 1037 | Ga0495647_0052850 | 3300046681 | Bacteria | 1583 |
| 1038 | Ga0495647_0060656 | 3300046681 | Bacteria | 1492 |
| 1039 | Ga0495647_0094038 | 3300046681 | Bacteria | 1233 |
| 1040 | Ga0495658_0001083 | 3300046683 | Bacteria | 14340 |
| 1041 | Ga0495658_0058586 | 3300046683 | Bacteria | 2203 |
| 1042 | Ga0495658_0442412 | 3300046683 | Bacteria | 830 |
| 1043 | Ga0495669_0016067 | 3300046684 | Bacteria | 3205 |
| 1044 | Ga0495669_0172151 | 3300046684 | Bacteria | 1030 |
| 1045 | Ga0495669_0299933 | 3300046684 | Bacteria | 774 |
| 1046 | Ga0495613_0005438 | 3300046689 | Bacteria | 9568 |
| 1047 | Ga0495613_0031723 | 3300046689 | Bacteria | 3925 |
| 1048 | Ga0495613_0045965 | 3300046689 | Bacteria | 3229 |
| 1049 | Ga0495613_0094203 | 3300046689 | Bacteria | 2167 |
| 1050 | Ga0495613_0133484 | 3300046689 | Bacteria | 1777 |
| 1051 | Ga0495624_0005136 | 3300046690 | Bacteria | 9454 |
| 1052 | Ga0495624_0110305 | 3300046690 | Bacteria | 1692 |
| 1053 | Ga0495624_0174956 | 3300046690 | Bacteria | 1309 |
| 1054 | Ga0495624_0194110 | 3300046690 | Bacteria | 1234 |
| 1055 | Ga0495670_0156078 | 3300046691 | Bacteria | 1198 |
| 1056 | Ga0495671_0145537 | 3300046692 | Bacteria | 1154 |
| 1057 | Ga0495649_0333587 | 3300046694 | Bacteria | 768 |
| 1058 | Ga0495589_0106446 | 3300046794 | Bacteria | 1355 |
| 1059 | Ga0495589_0173069 | 3300046794 | Bacteria | 1026 |
| 1060 | Ga0495589_0314973 | 3300046794 | Bacteria | 724 |
| 1061 | Ga0495600_0016680 | 3300046809 | Bacteria | 4666 |
| 1062 | Ga0495600_0040589 | 3300046809 | Bacteria | 3031 |
| 1063 | Ga0495600_0135105 | 3300046809 | Bacteria | 1602 |
| 1064 | Ga0495600_0135335 | 3300046809 | Bacteria | 1601 |
| 1065 | Ga0495660_0125536 | 3300046810 | Bacteria | 1293 |
| 1066 | Ga0495660_0228576 | 3300046810 | Bacteria | 873 |
| 1067 | Ga0495581_0003213 | 3300047315 | Bacteria | 9361 |
| 1068 | Ga0495581_0083551 | 3300047315 | Bacteria | 1850 |
| 1069 | Ga0495581_0094681 | 3300047315 | Bacteria | 1734 |
| 1070 | Ga0495581_0150796 | 3300047315 | Bacteria | 1357 |
| 1071 | Ga0495581_0204030 | 3300047315 | Bacteria | 1156 |
| 1072 | Ga0495581_0219225 | 3300047315 | Bacteria | 1112 |
| 1073 | Ga0495581_0306475 | 3300047315 | Bacteria | 928 |
| 1074 | Ga0495604_0006935 | 3300047317 | Bacteria | 8979 |
| 1075 | Ga0495604_0043593 | 3300047317 | Bacteria | 3511 |
| 1076 | Ga0495604_0052890 | 3300047317 | Bacteria | 3142 |
| 1077 | Ga0495604_0081771 | 3300047317 | Bacteria | 2417 |
| 1078 | Ga0495604_0096764 | 3300047317 | Bacteria | 2177 |
| 1079 | Ga0495604_0407825 | 3300047317 | Bacteria | 894 |
| 1080 | Ga0495636_0141303 | 3300047318 | Bacteria | 1075 |
| 1081 | Ga0495674_0010035 | 3300047319 | Bacteria | 8975 |
| 1082 | Ga0495674_0023287 | 3300047319 | Bacteria | 5710 |
| 1083 | Ga0495674_0034718 | 3300047319 | Bacteria | 4557 |
| 1084 | Ga0495674_0036341 | 3300047319 | Bacteria | 4434 |
| 1085 | Ga0495672_0056579 | 3300047320 | Bacteria | 2281 |
| 1086 | Ga0495672_0076637 | 3300047320 | Bacteria | 1877 |
| 1087 | Ga0495672_0112047 | 3300047320 | Bacteria | 1463 |
| 1088 | Ga0495676_0007949 | 3300047321 | Bacteria | 9724 |
| 1089 | Ga0495676_0030366 | 3300047321 | Bacteria | 4588 |
| 1090 | Ga0495676_0075768 | 3300047321 | Bacteria | 2571 |
| 1091 | Ga0495676_0154352 | 3300047321 | Bacteria | 1630 |
| 1092 | Ga0495680_0009468 | 3300047322 | Bacteria | 8758 |
| 1093 | Ga0495680_0108926 | 3300047322 | Bacteria | 2055 |
| 1094 | Ga0495680_0142242 | 3300047322 | Bacteria | 1754 |
| 1095 | Ga0495687_031149 | 3300047443 | Bacteria | 2449 |
| 1096 | Ga0495675_0003041 | 3300047444 | Bacteria | 10085 |
| 1097 | Ga0495675_0024619 | 3300047444 | Bacteria | 3838 |
| 1098 | Ga0495677_0109489 | 3300047445 | Bacteria | 1049 |
| 1099 | Ga0495677_0134387 | 3300047445 | Bacteria | 948 |
| 1100 | Ga0495685_031546 | 3300047447 | Bacteria | 1821 |
| 1101 | Ga0495685_050130 | 3300047447 | Bacteria | 1417 |
| 1102 | Ga0495681_0217698 | 3300047470 | Bacteria | 767 |
| 1103 | Ga0495684_0005455 | 3300047471 | Bacteria | 9899 |
| 1104 | Ga0495684_0008298 | 3300047471 | Bacteria | 8046 |
| 1105 | Ga0495684_0016579 | 3300047471 | Bacteria | 5675 |
| 1106 | Ga0495684_0103944 | 3300047471 | Bacteria | 2147 |
| 1107 | Ga0495686_0023297 | 3300047472 | Bacteria | 4086 |
| 1108 | Ga0495686_0117418 | 3300047472 | Bacteria | 1589 |
| 1109 | Ga0495593_0005017 | 3300047673 | Bacteria | 7832 |
| 1110 | Ga0495593_0006937 | 3300047673 | Bacteria | 6634 |
| 1111 | Ga0495593_0246952 | 3300047673 | Bacteria | 894 |
| 1112 | Ga0495602_0014209 | 3300048088 | Bacteria | 8091 |
| 1113 | Ga0495602_0056225 | 3300048088 | Bacteria | 3461 |
| 1114 | Ga0495602_0083756 | 3300048088 | Bacteria | 2670 |
| 1115 | Ga0495614_0045529 | 3300048089 | Bacteria | 1881 |
| 1116 | Ga0495614_0116556 | 3300048089 | Bacteria | 1176 |
| 1117 | Ga0495615_0066073 | 3300048090 | Bacteria | 965 |
| 1118 | Ga0495626_0062128 | 3300048091 | Bacteria | 1697 |
| 1119 | Ga0496100_0062747 | 3300048903 | Bacteria | 2453 |
| 1120 | Ga0496100_0089284 | 3300048903 | Bacteria | 2099 |
| 1121 | Ga0496100_0143565 | 3300048903 | Bacteria | 1695 |
| 1122 | Ga0496100_0442803 | 3300048903 | Bacteria | 995 |
| 1123 | Ga0496100_0460513 | 3300048903 | Bacteria | 976 |
| 1124 | Ga0496101_0008819 | 3300048904 | Bacteria | 6598 |
| 1125 | Ga0496101_0067232 | 3300048904 | Bacteria | 2616 |
| 1126 | Ga0496101_0186034 | 3300048904 | Bacteria | 1601 |
| 1127 | Ga0496101_0190630 | 3300048904 | Bacteria | 1582 |
| 1128 | Ga0496101_0247327 | 3300048904 | Bacteria | 1389 |
| 1129 | Ga0496101_0814301 | 3300048904 | Bacteria | 736 |
| 1130 | Ga0496102_0047085 | 3300048905 | Bacteria | 3917 |
| 1131 | Ga0496102_0239155 | 3300048905 | Bacteria | 1712 |
| 1132 | Ga0496102_0287108 | 3300048905 | Bacteria | 1551 |
| 1133 | Ga0496102_0291410 | 3300048905 | Bacteria | 1538 |
| 1134 | Ga0496102_0389582 | 3300048905 | Bacteria | 1311 |
| 1135 | Ga0496102_0391795 | 3300048905 | Bacteria | 1307 |
| 1136 | Ga0496102_0527933 | 3300048905 | Bacteria | 1103 |
| 1137 | Ga0496102_0927540 | 3300048905 | Bacteria | 792 |
| 1138 | Ga0496103_0020714 | 3300048906 | Bacteria | 3953 |
| 1139 | Ga0496103_0025116 | 3300048906 | Bacteria | 3599 |
| 1140 | Ga0496103_0043006 | 3300048906 | Bacteria | 2781 |
| 1141 | Ga0496103_0108597 | 3300048906 | Bacteria | 1761 |
| 1142 | Ga0496103_0315427 | 3300048906 | Bacteria | 1006 |
| 1143 | Ga0496104_0015949 | 3300048907 | Bacteria | 6820 |
| 1144 | Ga0496104_0060516 | 3300048907 | Bacteria | 3587 |
| 1145 | Ga0496104_0063253 | 3300048907 | Bacteria | 3509 |
| 1146 | Ga0496104_0063908 | 3300048907 | Bacteria | 3491 |
| 1147 | Ga0496104_0121670 | 3300048907 | Bacteria | 2506 |
| 1148 | Ga0496104_0454660 | 3300048907 | Bacteria | 1192 |
| 1149 | Ga0496105_0035046 | 3300048908 | Bacteria | 4129 |
| 1150 | Ga0496105_0125522 | 3300048908 | Bacteria | 2115 |
| 1151 | Ga0496105_0132833 | 3300048908 | Bacteria | 2051 |
| 1152 | Ga0496105_0144798 | 3300048908 | Bacteria | 1954 |
| 1153 | Ga0496105_0185145 | 3300048908 | Bacteria | 1704 |
| 1154 | Ga0496105_0319146 | 3300048908 | Bacteria | 1245 |
| 1155 | Ga0496105_0503361 | 3300048908 | Bacteria | 951 |
| 1156 | Ga0496106_0001075 | 3300048909 | Bacteria | 20159 |
| 1157 | Ga0496106_0006134 | 3300048909 | Bacteria | 8889 |
| 1158 | Ga0496106_0033686 | 3300048909 | Bacteria | 3823 |
| 1159 | Ga0496106_0034614 | 3300048909 | Bacteria | 3774 |
| 1160 | Ga0496106_0078180 | 3300048909 | Bacteria | 2538 |
| 1161 | Ga0496106_0089316 | 3300048909 | Bacteria | 2376 |
| 1162 | Ga0496106_0125167 | 3300048909 | Bacteria | 2012 |
| 1163 | Ga0496106_0164580 | 3300048909 | Bacteria | 1755 |
| 1164 | Ga0496106_0233168 | 3300048909 | Bacteria | 1470 |
| 1165 | Ga0496106_0233297 | 3300048909 | Bacteria | 1469 |
| 1166 | Ga0496106_0963860 | 3300048909 | Bacteria | 672 |
| 1167 | Ga0496107_0002790 | 3300048910 | Bacteria | 11524 |
| 1168 | Ga0496107_0016231 | 3300048910 | Bacteria | 5227 |
| 1169 | Ga0496107_0068417 | 3300048910 | Bacteria | 2577 |
| 1170 | Ga0496107_0103174 | 3300048910 | Bacteria | 2092 |
| 1171 | Ga0496107_0162297 | 3300048910 | Bacteria | 1656 |
| 1172 | Ga0496107_0168553 | 3300048910 | Bacteria | 1624 |
| 1173 | Ga0496108_0000309 | 3300048911 | Bacteria | 41957 |
| 1174 | Ga0496108_0016858 | 3300048911 | Bacteria | 5971 |
| 1175 | Ga0496108_0028705 | 3300048911 | Bacteria | 4603 |
| 1176 | Ga0496108_0051538 | 3300048911 | Bacteria | 3448 |
| 1177 | Ga0496108_0063183 | 3300048911 | Bacteria | 3118 |
| 1178 | Ga0496108_0121642 | 3300048911 | Bacteria | 2239 |
| 1179 | Ga0496108_0189426 | 3300048911 | Bacteria | 1783 |
| 1180 | Ga0496108_0604487 | 3300048911 | Bacteria | 955 |
| 1181 | Ga0496109_0000229 | 3300048912 | Bacteria | 54733 |
| 1182 | Ga0496109_0032621 | 3300048912 | Bacteria | 4682 |
| 1183 | Ga0496109_0077882 | 3300048912 | Bacteria | 3051 |
| 1184 | Ga0496109_0170106 | 3300048912 | Bacteria | 2044 |
| 1185 | Ga0496109_0313659 | 3300048912 | Bacteria | 1479 |
| 1186 | Ga0496109_0416058 | 3300048912 | Bacteria | 1270 |
| 1187 | Ga0496109_0516448 | 3300048912 | Bacteria | 1127 |
| 1188 | Ga0496110_0006428 | 3300048913 | Bacteria | 9306 |
| 1189 | Ga0496110_0011598 | 3300048913 | Bacteria | 7224 |
| 1190 | Ga0496110_0054776 | 3300048913 | Bacteria | 3508 |
| 1191 | Ga0496110_0062128 | 3300048913 | Bacteria | 3298 |
| 1192 | Ga0496110_0074112 | 3300048913 | Bacteria | 3022 |
| 1193 | Ga0496110_0205482 | 3300048913 | Bacteria | 1790 |
| 1194 | Ga0496110_0208458 | 3300048913 | Bacteria | 1776 |
| 1195 | Ga0496110_0662554 | 3300048913 | Bacteria | 944 |
| 1196 | Ga0496110_0772862 | 3300048913 | Bacteria | 864 |
| 1197 | Ga0496111_0083463 | 3300048914 | Bacteria | 2334 |
| 1198 | Ga0496111_0101763 | 3300048914 | Bacteria | 2111 |
| 1199 | Ga0496112_0000018 | 3300048915 | Bacteria | 188820 |
| 1200 | Ga0496112_0004329 | 3300048915 | Bacteria | 12004 |
| 1201 | Ga0496112_0109234 | 3300048915 | Bacteria | 2736 |
| 1202 | Ga0496112_0115294 | 3300048915 | Bacteria | 2657 |
| 1203 | Ga0496112_0146630 | 3300048915 | Bacteria | 2328 |
| 1204 | Ga0496112_0149444 | 3300048915 | Bacteria | 2303 |
| 1205 | Ga0496112_0769298 | 3300048915 | Bacteria | 888 |
| 1206 | Ga0496112_0809407 | 3300048915 | Bacteria | 861 |
| 1207 | Ga0496112_0912388 | 3300048915 | Bacteria | 800 |
| 1208 | Ga0496113_0033720 | 3300048916 | Bacteria | 3730 |
| 1209 | Ga0496113_0085981 | 3300048916 | Bacteria | 2416 |
| 1210 | Ga0496113_0090910 | 3300048916 | Bacteria | 2352 |
| 1211 | Ga0496113_0103971 | 3300048916 | Bacteria | 2203 |
| 1212 | Ga0496113_0119404 | 3300048916 | Bacteria | 2060 |
| 1213 | Ga0496113_0196200 | 3300048916 | Bacteria | 1603 |
| 1214 | Ga0496113_0502883 | 3300048916 | Bacteria | 973 |
| 1215 | Ga0496114_0135739 | 3300048917 | Bacteria | 2127 |
| 1216 | Ga0496114_0144988 | 3300048917 | Bacteria | 2058 |
| 1217 | Ga0496114_0176135 | 3300048917 | Bacteria | 1866 |
| 1218 | Ga0496114_0505154 | 3300048917 | Bacteria | 1069 |
| 1219 | Ga0496114_0556609 | 3300048917 | Bacteria | 1013 |
| 1220 | Ga0496114_0623241 | 3300048917 | Bacteria | 950 |
| 1221 | Ga0496114_0635180 | 3300048917 | Bacteria | 940 |
| 1222 | Ga0496115_0011619 | 3300048918 | Bacteria | 6606 |
| 1223 | Ga0496115_0036077 | 3300048918 | Bacteria | 3913 |
| 1224 | Ga0496115_0042915 | 3300048918 | Bacteria | 3605 |
| 1225 | Ga0496115_0057694 | 3300048918 | Bacteria | 3123 |
| 1226 | Ga0496115_0094397 | 3300048918 | Bacteria | 2447 |
| 1227 | Ga0496115_0162644 | 3300048918 | Bacteria | 1845 |
| 1228 | Ga0496115_0243978 | 3300048918 | Bacteria | 1480 |
| 1229 | Ga0496116_0007008 | 3300048919 | Bacteria | 10091 |
| 1230 | Ga0496116_0023038 | 3300048919 | Bacteria | 4647 |
| 1231 | Ga0496116_0159763 | 3300048919 | Bacteria | 1238 |
| 1232 | Ga0496117_0019265 | 3300048920 | Bacteria | 5612 |
| 1233 | Ga0496117_0066469 | 3300048920 | Bacteria | 2445 |
| 1234 | Ga0496117_0076623 | 3300048920 | Bacteria | 2216 |
| 1235 | Ga0496117_0095389 | 3300048920 | Bacteria | 1901 |
| 1236 | Ga0496117_0195937 | 3300048920 | Bacteria | 1146 |
| 1237 | Ga0496117_0217508 | 3300048920 | Bacteria | 1066 |
| 1238 | Ga0496118_0001623 | 3300048921 | Bacteria | 33200 |
| 1239 | Ga0496118_0036906 | 3300048921 | Bacteria | 3943 |
| 1240 | Ga0496118_0040080 | 3300048921 | Bacteria | 3728 |
| 1241 | Ga0496118_0079139 | 3300048921 | Bacteria | 2321 |
| 1242 | Ga0496118_0124268 | 3300048921 | Bacteria | 1674 |
| 1243 | Ga0496118_0136255 | 3300048921 | Bacteria | 1566 |
| 1244 | Ga0496119_0020608 | 3300048922 | Bacteria | 4802 |
| 1245 | Ga0496119_0062296 | 3300048922 | Bacteria | 2223 |
| 1246 | Ga0496119_0102194 | 3300048922 | Bacteria | 1607 |
| 1247 | Ga0496119_0106419 | 3300048922 | Bacteria | 1565 |
| 1248 | Ga0496119_0106789 | 3300048922 | Bacteria | 1562 |
| 1249 | Ga0496119_0114762 | 3300048922 | Bacteria | 1489 |
| 1250 | Ga0496120_0033680 | 3300048923 | Bacteria | 3076 |
| 1251 | Ga0496120_0210876 | 3300048923 | Bacteria | 934 |
| 1252 | Ga0496121_0000278 | 3300048924 | Bacteria | 106838 |
| 1253 | Ga0496121_0001257 | 3300048924 | Bacteria | 43906 |
| 1254 | Ga0496121_0001616 | 3300048924 | Bacteria | 37413 |
| 1255 | Ga0496121_0007162 | 3300048924 | Bacteria | 13519 |
| 1256 | Ga0496121_0015944 | 3300048924 | Bacteria | 7801 |
| 1257 | Ga0496121_0018665 | 3300048924 | Bacteria | 6980 |
| 1258 | Ga0496121_0023428 | 3300048924 | Bacteria | 5945 |
| 1259 | Ga0496121_0056238 | 3300048924 | Bacteria | 3269 |
| 1260 | Ga0496121_0079961 | 3300048924 | Bacteria | 2593 |
| 1261 | Ga0496121_0080084 | 3300048924 | Bacteria | 2591 |
| 1262 | Ga0496121_0093322 | 3300048924 | Bacteria | 2344 |
| 1263 | Ga0496121_0185204 | 3300048924 | Bacteria | 1498 |
| 1264 | Ga0496121_0190564 | 3300048924 | Bacteria | 1470 |
| 1265 | Ga0496121_0190901 | 3300048924 | Bacteria | 1468 |
| 1266 | Ga0496121_0217736 | 3300048924 | Bacteria | 1347 |
| 1267 | Ga0496121_0221531 | 3300048924 | Bacteria | 1332 |
| 1268 | Ga0496121_0228696 | 3300048924 | Bacteria | 1304 |
| 1269 | Ga0496121_0406186 | 3300048924 | Bacteria | 890 |
| 1270 | Ga0496122_0039152 | 3300048925 | Bacteria | 3784 |
| 1271 | Ga0496122_0084029 | 3300048925 | Bacteria | 2204 |
| 1272 | Ga0496122_0097485 | 3300048925 | Bacteria | 1979 |
| 1273 | Ga0496123_0030316 | 3300048926 | Bacteria | 3961 |
| 1274 | Ga0496123_0054034 | 3300048926 | Bacteria | 2648 |
| 1275 | Ga0496123_0113666 | 3300048926 | Bacteria | 1541 |
| 1276 | Ga0496123_0244904 | 3300048926 | Bacteria | 888 |
| 1277 | Ga0496124_0003470 | 3300048927 | Bacteria | 19250 |
| 1278 | Ga0496124_0119785 | 3300048927 | Bacteria | 2105 |
| 1279 | Ga0496124_0260355 | 3300048927 | Bacteria | 1277 |
| 1280 | Ga0496125_0000407 | 3300048928 | Bacteria | 80570 |
| 1281 | Ga0496125_0000516 | 3300048928 | Bacteria | 67232 |
| 1282 | Ga0496125_0063468 | 3300048928 | Bacteria | 2945 |
| 1283 | Ga0496125_0065510 | 3300048928 | Bacteria | 2878 |
| 1284 | Ga0496125_0198579 | 3300048928 | Bacteria | 1316 |
| 1285 | Ga0496126_0003267 | 3300048929 | Bacteria | 20694 |
| 1286 | Ga0496126_0003347 | 3300048929 | Bacteria | 20346 |
| 1287 | Ga0496126_0013009 | 3300048929 | Bacteria | 8491 |
| 1288 | Ga0496126_0022484 | 3300048929 | Bacteria | 6134 |
| 1289 | Ga0496126_0036990 | 3300048929 | Bacteria | 4560 |
| 1290 | Ga0496126_0056455 | 3300048929 | Bacteria | 3549 |
| 1291 | Ga0496126_0085105 | 3300048929 | Bacteria | 2788 |
| 1292 | Ga0496126_0095786 | 3300048929 | Bacteria | 2603 |
| 1293 | Ga0496126_0151402 | 3300048929 | Bacteria | 1988 |
| 1294 | Ga0496126_0169916 | 3300048929 | Bacteria | 1858 |
| 1295 | Ga0496126_0177574 | 3300048929 | Bacteria | 1810 |
| 1296 | Ga0496126_0186810 | 3300048929 | Bacteria | 1757 |
| 1297 | Ga0496126_0271210 | 3300048929 | Bacteria | 1408 |
| 1298 | Ga0496126_0322405 | 3300048929 | Bacteria | 1269 |
| 1299 | Ga0496126_0342420 | 3300048929 | Bacteria | 1224 |
| 1300 | Ga0496126_0355671 | 3300048929 | Bacteria | 1197 |
| 1301 | Ga0496126_0384659 | 3300048929 | Bacteria | 1141 |
| 1302 | Ga0496126_0510452 | 3300048929 | Bacteria | 959 |
| 1303 | Ga0495678_080281 | 3300049459 | Bacteria | 1173 |
| 1304 | Ga0495682_0150731 | 3300049460 | Bacteria | 829 |
| 1305 | Ga0501031_0006376 | 3300049568 | Bacteria | 7696 |
| 1306 | Ga0501031_0016900 | 3300049568 | Bacteria | 4739 |
| 1307 | Ga0501031_0037027 | 3300049568 | Bacteria | 3183 |
| 1308 | Ga0501031_0247488 | 3300049568 | Bacteria | 1159 |
| 1309 | Ga0501031_0327285 | 3300049568 | Bacteria | 992 |
| 1310 | Ga0501032_0001063 | 3300049569 | Bacteria | 21964 |
| 1311 | Ga0501032_0058641 | 3300049569 | Bacteria | 2584 |
| 1312 | Ga0501032_0142644 | 3300049569 | Bacteria | 1577 |
| 1313 | Ga0501032_0160872 | 3300049569 | Bacteria | 1474 |
| 1314 | Ga0501032_0222461 | 3300049569 | Bacteria | 1228 |
| 1315 | Ga0501033_0000082 | 3300049570 | Bacteria | 89837 |
| 1316 | Ga0501033_0001708 | 3300049570 | Bacteria | 19234 |
| 1317 | Ga0501033_0035311 | 3300049570 | Bacteria | 3748 |
| 1318 | Ga0501034_0000198 | 3300049571 | Bacteria | 113672 |
| 1319 | Ga0501034_0091995 | 3300049571 | Bacteria | 3031 |
| 1320 | Ga0501034_0166246 | 3300049571 | Bacteria | 2174 |
| 1321 | Ga0501034_0489493 | 3300049571 | Bacteria | 1144 |
| 1322 | Ga0501034_0592677 | 3300049571 | Bacteria | 1015 |
| 1323 | Ga0501034_0694792 | 3300049571 | Bacteria | 916 |
| 1324 | Ga0501036_0001033 | 3300049572 | Bacteria | 21031 |
| 1325 | Ga0501036_0021624 | 3300049572 | Bacteria | 5408 |
| 1326 | Ga0501036_0078034 | 3300049572 | Bacteria | 2802 |
| 1327 | Ga0501036_0296898 | 3300049572 | Bacteria | 1351 |
| 1328 | Ga0501036_0320776 | 3300049572 | Bacteria | 1294 |
| 1329 | Ga0501036_0403881 | 3300049572 | Bacteria | 1140 |
| 1330 | Ga0501037_0000050 | 3300049573 | Bacteria | 112824 |
| 1331 | Ga0501037_0008923 | 3300049573 | Bacteria | 7345 |
| 1332 | Ga0501037_0080378 | 3300049573 | Bacteria | 2365 |
| 1333 | Ga0501037_0415273 | 3300049573 | Bacteria | 921 |
| 1334 | Ga0501038_0004264 | 3300049574 | Bacteria | 13298 |
| 1335 | Ga0501038_0010520 | 3300049574 | Bacteria | 8462 |
| 1336 | Ga0501038_0023661 | 3300049574 | Bacteria | 5488 |
| 1337 | Ga0501038_0035664 | 3300049574 | Bacteria | 4366 |
| 1338 | Ga0501038_0055066 | 3300049574 | Bacteria | 3418 |
| 1339 | Ga0501038_0143438 | 3300049574 | Bacteria | 1952 |
| 1340 | Ga0501038_0166075 | 3300049574 | Bacteria | 1790 |
| 1341 | Ga0501039_0000366 | 3300049575 | Bacteria | 32333 |
| 1342 | Ga0501039_0078556 | 3300049575 | Bacteria | 2567 |
| 1343 | Ga0501039_0079837 | 3300049575 | Bacteria | 2545 |
| 1344 | Ga0501039_0154373 | 3300049575 | Bacteria | 1803 |
| 1345 | Ga0501039_0156867 | 3300049575 | Bacteria | 1788 |
| 1346 | Ga0501039_0258789 | 3300049575 | Bacteria | 1368 |
| 1347 | Ga0501039_0487024 | 3300049575 | Bacteria | 968 |
| 1348 | Ga0501041_0286756 | 3300049577 | Bacteria | 1036 |
| 1349 | Ga0501042_0061835 | 3300049578 | Bacteria | 2674 |
| 1350 | Ga0501042_0110747 | 3300049578 | Bacteria | 1977 |
| 1351 | Ga0501043_0001664 | 3300049579 | Bacteria | 19297 |
| 1352 | Ga0501043_0008468 | 3300049579 | Bacteria | 8095 |
| 1353 | Ga0501043_0028438 | 3300049579 | Bacteria | 4388 |
| 1354 | Ga0501043_0195154 | 3300049579 | Bacteria | 1573 |
| 1355 | Ga0501043_0669817 | 3300049579 | Bacteria | 760 |
| 1356 | Ga0501046_0003642 | 3300049580 | Bacteria | 14115 |
| 1357 | Ga0501046_0005790 | 3300049580 | Bacteria | 11029 |
| 1358 | Ga0501046_0046637 | 3300049580 | Bacteria | 3438 |
| 1359 | Ga0501046_0082240 | 3300049580 | Bacteria | 2487 |
| 1360 | Ga0501047_0000131 | 3300049581 | Bacteria | 91079 |
| 1361 | Ga0501047_0006910 | 3300049581 | Bacteria | 10662 |
| 1362 | Ga0501047_0025713 | 3300049581 | Bacteria | 5661 |
| 1363 | Ga0501047_0030818 | 3300049581 | Bacteria | 5170 |
| 1364 | Ga0501047_0167451 | 3300049581 | Bacteria | 2068 |
| 1365 | Ga0501048_0000531 | 3300049582 | Bacteria | 26809 |
| 1366 | Ga0501048_0233544 | 3300049582 | Bacteria | 1305 |
| 1367 | Ga0501067_0000101 | 3300049583 | Bacteria | 49019 |
| 1368 | Ga0501067_0108255 | 3300049583 | Bacteria | 1545 |
| 1369 | Ga0501068_0000988 | 3300049584 | Bacteria | 14949 |
| 1370 | Ga0501068_0433160 | 3300049584 | Bacteria | 850 |
| 1371 | Ga0501069_0000565 | 3300049585 | Bacteria | 17071 |
| 1372 | Ga0501070_0004413 | 3300049586 | Bacteria | 12077 |
| 1373 | Ga0501070_0013834 | 3300049586 | Bacteria | 6796 |
| 1374 | Ga0501070_0030097 | 3300049586 | Bacteria | 4549 |
| 1375 | Ga0501070_0047792 | 3300049586 | Bacteria | 3555 |
| 1376 | Ga0501070_0212624 | 3300049586 | Bacteria | 1587 |
| 1377 | Ga0501070_0227802 | 3300049586 | Bacteria | 1527 |
| 1378 | Ga0501070_0372460 | 3300049586 | Bacteria | 1157 |
| 1379 | Ga0501072_0734565 | 3300049588 | Bacteria | 775 |
| 1380 | Ga0501073_0000230 | 3300049589 | Bacteria | 36799 |
| 1381 | Ga0501073_0158573 | 3300049589 | Bacteria | 1568 |
| 1382 | Ga0501073_0229530 | 3300049589 | Bacteria | 1282 |
| 1383 | Ga0501074_0000141 | 3300049590 | Bacteria | 37729 |
| 1384 | Ga0501074_0041688 | 3300049590 | Bacteria | 3323 |
| 1385 | Ga0501079_0069255 | 3300049741 | Bacteria | 2723 |
| 1386 | Ga0501079_0654753 | 3300049741 | Bacteria | 827 |
| 1387 | Ga0501080_0000093 | 3300049742 | Bacteria | 60276 |
| 1388 | Ga0501080_0128172 | 3300049742 | Bacteria | 2349 |
| 1389 | Ga0501080_0369499 | 3300049742 | Bacteria | 1293 |
| 1390 | Ga0501083_0000341 | 3300049744 | Bacteria | 29641 |
| 1391 | Ga0501035_0005747 | 3300049822 | Bacteria | 11700 |
| 1392 | Ga0501035_0018523 | 3300049822 | Bacteria | 6414 |
| 1393 | Ga0501035_0050826 | 3300049822 | Bacteria | 3713 |
| 1394 | Ga0501035_0304426 | 3300049822 | Bacteria | 1342 |
| 1395 | Ga0501044_0000100 | 3300049823 | Bacteria | 106729 |
| 1396 | Ga0501044_0151247 | 3300049823 | Bacteria | 2303 |
| 1397 | Ga0501044_0208205 | 3300049823 | Bacteria | 1911 |
| 1398 | Ga0501044_0365010 | 3300049823 | Bacteria | 1361 |
| 1399 | Ga0501044_0381750 | 3300049823 | Bacteria | 1324 |
| 1400 | Ga0501044_0426579 | 3300049823 | Bacteria | 1235 |
| 1401 | Ga0501044_0594789 | 3300049823 | Bacteria | 1000 |
| 1402 | Ga0501044_0644912 | 3300049823 | Bacteria | 948 |
| 1403 | Ga0501045_0010802 | 3300049824 | Bacteria | 6400 |
| 1404 | nmdc:mga03683_55008_c1 | 3300050489 | Bacteria | 1670 |
| 1405 | nmdc:mga03683_55598_c1 | 3300050489 | Bacteria | 1663 |
| 1406 | nmdc:mga03n38_10224_c1 | 3300050490 | Bacteria | 3444 |
| 1407 | nmdc:mga03n38_142092_c1 | 3300050490 | Bacteria | 1200 |
| 1408 | nmdc:mga03n38_191436_c1 | 3300050490 | Bacteria | 1054 |
| 1409 | nmdc:mga03n38_442925_c1 | 3300050490 | Bacteria | 721 |
| 1410 | nmdc:mga03n38_58333_c1 | 3300050490 | Bacteria | 1748 |
| 1411 | nmdc:mga00v17_245180_c1 | 3300050491 | Bacteria | 1162 |
| 1412 | nmdc:mga00v17_26711_c1 | 3300050491 | Bacteria | 3366 |
| 1413 | nmdc:mga0yw44_122406_c1 | 3300050492 | Bacteria | 1677 |
| 1414 | nmdc:mga0yw44_137756_c1 | 3300050492 | Bacteria | 1584 |
| 1415 | nmdc:mga0yw44_234700_c1 | 3300050492 | Bacteria | 1218 |
| 1416 | nmdc:mga0yw44_270253_c1 | 3300050492 | Bacteria | 1135 |
| 1417 | nmdc:mga0yw44_28542_c1 | 3300050492 | Bacteria | 3211 |
| 1418 | nmdc:mga0yw44_39867_c1 | 3300050492 | Bacteria | 2787 |
| 1419 | nmdc:mga0yw44_458341_c1 | 3300050492 | Bacteria | 864 |
| 1420 | nmdc:mga0k408_33226_c2 | 3300050493 | Bacteria | 2521 |
| 1421 | nmdc:mga06z11_260162_c1 | 3300050494 | Bacteria | 1024 |
| 1422 | nmdc:mga06z11_435041_c1 | 3300050494 | Bacteria | 792 |
| 1423 | nmdc:mga06z11_97958_c1 | 3300050494 | Bacteria | 1604 |
| 1424 | nmdc:mga04h51_14508_c1 | 3300050495 | Bacteria | 2253 |
| 1425 | nmdc:mga07m45_13705_c1 | 3300050496 | Bacteria | 4306 |
| 1426 | nmdc:mga07m45_35028_c1 | 3300050496 | Bacteria | 2792 |
| 1427 | nmdc:mga08y16_384673_c1 | 3300050511 | Bacteria | 1438 |
| 1428 | nmdc:mga0n895_17771_c1 | 3300050512 | Bacteria | 6564 |
| 1429 | nmdc:mga0n895_181515_c1 | 3300050512 | Bacteria | 2136 |
| 1430 | nmdc:mga0n895_31488_c1 | 3300050512 | Bacteria | 5079 |
| 1431 | nmdc:mga0rr50_346913_c1 | 3300050513 | Bacteria | 1248 |
| 1432 | nmdc:mga0rr50_375527_c1 | 3300050513 | Bacteria | 1198 |
| 1433 | nmdc:mga08x19_486796_c1 | 3300050514 | Bacteria | 870 |
| 1434 | nmdc:mga0a205_554655_c1 | 3300050515 | Bacteria | 1004 |
| 1435 | nmdc:mga0a205_835376_c1 | 3300050515 | Bacteria | 768 |
| 1436 | nmdc:mga0sz30_16062_c1 | 3300050516 | Bacteria | 2966 |
| 1437 | nmdc:mga0sz30_28046_c1 | 3300050516 | Bacteria | 2315 |
| 1438 | nmdc:mga0sz30_5780_c2 | 3300050516 | Bacteria | 4146 |
| 1439 | Ga0495601_0000392 | 3300053077 | Bacteria | 23195 |
| 1440 | Ga0495601_0054488 | 3300053077 | Bacteria | 2530 |
| 1441 | Ga0495601_0215628 | 3300053077 | Bacteria | 1254 |
| 1442 | Ga0495601_0338167 | 3300053077 | Bacteria | 979 |
| 1443 | Ga0495601_0525539 | 3300053077 | Bacteria | 762 |
| 1444 | Ga0495612_0008868 | 3300053078 | Bacteria | 4074 |
| 1445 | Ga0495612_0153126 | 3300053078 | Bacteria | 1004 |
| 1446 | Ga0500610_0147797 | 3300053079 | Bacteria | 1181 |
| 1447 | Ga0500610_0163685 | 3300053079 | Bacteria | 1104 |
| 1448 | Ga0495655_0044956 | 3300053083 | Bacteria | 1145 |
| 1449 | Ga0495655_0127737 | 3300053083 | Bacteria | 780 |
| 1450 | Ga0495595_0003205 | 3300053084 | Bacteria | 6493 |
| 1451 | Ga0495595_0118623 | 3300053084 | Bacteria | 1288 |
| 1452 | Ga0495619_0014255 | 3300053085 | Bacteria | 5021 |
| 1453 | Ga0495619_0014580 | 3300053085 | Bacteria | 4965 |
| 1454 | Ga0495619_0027133 | 3300053085 | Bacteria | 3689 |
| 1455 | Ga0500578_0218103 | 3300053086 | Bacteria | 1161 |
| 1456 | Ga0500643_000076 | 3300053087 | Bacteria | 106911 |
| 1457 | Ga0500643_043764 | 3300053087 | Bacteria | 1304 |
| 1458 | Ga0500644_0308840 | 3300053088 | Bacteria | 678 |
| 1459 | Ga0500581_052772 | 3300053089 | Bacteria | 2070 |
| 1460 | Ga0500647_0018897 | 3300053091 | Bacteria | 3197 |
| 1461 | Ga0500583_0173565 | 3300053092 | Bacteria | 1073 |
| 1462 | Ga0500651_0038112 | 3300053093 | Bacteria | 3028 |
| 1463 | Ga0500651_0078589 | 3300053093 | Bacteria | 2046 |
| 1464 | Ga0500566_0000107 | 3300053094 | Bacteria | 42130 |
| 1465 | Ga0500566_0000277 | 3300053094 | Bacteria | 27736 |
| 1466 | Ga0500566_0009047 | 3300053094 | Bacteria | 5890 |
| 1467 | Ga0500566_0084678 | 3300053094 | Bacteria | 1759 |
| 1468 | Ga0500566_0219786 | 3300053094 | Bacteria | 945 |
| 1469 | Ga0500641_0045694 | 3300053096 | Bacteria | 1784 |
| 1470 | Ga0500641_0066694 | 3300053096 | Bacteria | 1508 |
| 1471 | Ga0500650_0048502 | 3300053098 | Bacteria | 1969 |
| 1472 | Ga0500554_004326 | 3300053102 | Bacteria | 3000 |
| 1473 | Ga0500555_020273 | 3300053103 | Bacteria | 1915 |
| 1474 | Ga0500556_0000081 | 3300053104 | Bacteria | 90508 |
| 1475 | Ga0500556_0008699 | 3300053104 | Bacteria | 2933 |
| 1476 | Ga0500557_000102 | 3300053105 | Bacteria | 26497 |
| 1477 | Ga0500562_019322 | 3300053108 | Bacteria | 1762 |
| 1478 | Ga0500572_000551 | 3300053111 | Bacteria | 12753 |
| 1479 | Ga0500572_066946 | 3300053111 | Bacteria | 1102 |
| 1480 | Ga0500591_030555 | 3300053115 | Bacteria | 2599 |
| 1481 | Ga0500592_011263 | 3300053116 | Bacteria | 1430 |
| 1482 | Ga0500592_021433 | 3300053116 | Bacteria | 1040 |
| 1483 | Ga0500594_0024035 | 3300053118 | Bacteria | 1549 |
| 1484 | Ga0500594_0065760 | 3300053118 | Bacteria | 1055 |
| 1485 | Ga0500595_001181 | 3300053119 | Bacteria | 14424 |
| 1486 | Ga0500595_007372 | 3300053119 | Bacteria | 4567 |
| 1487 | Ga0500595_014778 | 3300053119 | Bacteria | 2951 |
| 1488 | Ga0500595_022824 | 3300053119 | Bacteria | 2208 |
| 1489 | Ga0500595_025522 | 3300053119 | Bacteria | 2047 |
| 1490 | Ga0500595_026407 | 3300053119 | Bacteria | 2001 |
| 1491 | Ga0500595_041399 | 3300053119 | Bacteria | 1480 |
| 1492 | Ga0500595_086467 | 3300053119 | Bacteria | 912 |
| 1493 | Ga0500608_021321 | 3300053122 | Bacteria | 2992 |
| 1494 | Ga0500608_044035 | 3300053122 | Bacteria | 2143 |
| 1495 | Ga0500628_044666 | 3300053129 | Bacteria | 1027 |
| 1496 | Ga0500642_0000042 | 3300053130 | Bacteria | 86476 |
| 1497 | Ga0500642_0000225 | 3300053130 | Bacteria | 22158 |
| 1498 | Ga0500652_001540 | 3300053131 | Bacteria | 7053 |
| 1499 | Ga0500658_0027327 | 3300053134 | Bacteria | 2205 |
| 1500 | Ga0500658_0089989 | 3300053134 | Bacteria | 1326 |
| 1501 | Ga0500658_0140101 | 3300053134 | Bacteria | 1084 |
| 1502 | Ga0500559_0000857 | 3300053136 | Bacteria | 19581 |
| 1503 | Ga0500559_0001081 | 3300053136 | Bacteria | 16536 |
| 1504 | Ga0500559_0019840 | 3300053136 | Bacteria | 2840 |
| 1505 | Ga0500559_0028884 | 3300053136 | Bacteria | 2371 |
| 1506 | Ga0500561_0047514 | 3300053137 | Bacteria | 1159 |
| 1507 | Ga0500568_0002631 | 3300053139 | Bacteria | 10435 |
| 1508 | Ga0500568_0006224 | 3300053139 | Bacteria | 6025 |
| 1509 | Ga0500568_0026198 | 3300053139 | Bacteria | 2449 |
| 1510 | Ga0500573_0084823 | 3300053140 | Bacteria | 1796 |
| 1511 | Ga0500577_0001501 | 3300053142 | Bacteria | 5949 |
| 1512 | Ga0500577_0199001 | 3300053142 | Bacteria | 864 |
| 1513 | Ga0500579_217814 | 3300053143 | Bacteria | 672 |
| 1514 | Ga0500585_151812 | 3300053144 | Bacteria | 808 |
| 1515 | Ga0500589_166450 | 3300053147 | Bacteria | 881 |
| 1516 | Ga0500590_023202 | 3300053148 | Bacteria | 3224 |
| 1517 | Ga0500590_151556 | 3300053148 | Bacteria | 1045 |
| 1518 | Ga0500603_002896 | 3300053150 | Bacteria | 3716 |
| 1519 | Ga0500603_010161 | 3300053150 | Bacteria | 2119 |
| 1520 | Ga0500603_054382 | 3300053150 | Bacteria | 1104 |
| 1521 | Ga0500603_056077 | 3300053150 | Bacteria | 1091 |
| 1522 | Ga0500604_0005100 | 3300053151 | Bacteria | 3472 |
| 1523 | Ga0500616_0000227 | 3300053153 | Bacteria | 88098 |
| 1524 | Ga0500616_0000244 | 3300053153 | Bacteria | 85079 |
| 1525 | Ga0500616_0017169 | 3300053153 | Bacteria | 4111 |
| 1526 | Ga0500619_044245 | 3300053154 | Bacteria | 1418 |
| 1527 | Ga0500620_051856 | 3300053155 | Bacteria | 1377 |
| 1528 | Ga0500622_0002743 | 3300053156 | Bacteria | 12429 |
| 1529 | Ga0500622_0004369 | 3300053156 | Bacteria | 8919 |
| 1530 | Ga0500624_035402 | 3300053157 | Bacteria | 877 |
| 1531 | Ga0500627_0165099 | 3300053158 | Bacteria | 998 |
| 1532 | Ga0500627_0237262 | 3300053158 | Bacteria | 810 |
| 1533 | Ga0500633_0047836 | 3300053160 | Bacteria | 1465 |
| 1534 | Ga0500638_000149 | 3300053162 | Bacteria | 13453 |
| 1535 | Ga0500638_036029 | 3300053162 | Bacteria | 2399 |
| 1536 | Ga0500639_093771 | 3300053163 | Bacteria | 1490 |
| 1537 | Ga0500636_0001169 | 3300053177 | Bacteria | 14139 |
| 1538 | Ga0500636_0003600 | 3300053177 | Bacteria | 8736 |
| 1539 | Ga0500636_0083689 | 3300053177 | Bacteria | 1835 |
| 1540 | Ga0500636_0100367 | 3300053177 | Bacteria | 1646 |
| 1541 | Ga0500637_0001223 | 3300053178 | Bacteria | 10739 |
| 1542 | Ga0500637_0002162 | 3300053178 | Bacteria | 8644 |
| 1543 | Ga0500637_0186371 | 3300053178 | Bacteria | 1187 |
| 1544 | Ga0500649_183161 | 3300053722 | Bacteria | 704 |
| 1545 | Ga0500576_024107 | 3300053725 | Bacteria | 2776 |
| 1546 | Ga0500552_016468 | 3300053733 | Bacteria | 1000 |
| 1547 | Ga0500596_002382 | 3300053735 | Bacteria | 3706 |
| 1548 | Ga0500596_006512 | 3300053735 | Bacteria | 1969 |
| 1549 | Ga0500601_001128 | 3300053737 | Bacteria | 3018 |
| 1550 | Ga0500601_005258 | 3300053737 | Bacteria | 1416 |
| 1551 | Ga0501084_0003619 | 3300054114 | Bacteria | 12549 |
| 1552 | Ga0500661_005511 | 3300055283 | Bacteria | 2362 |
| 1553 | Ga0500661_009014 | 3300055283 | Bacteria | 1832 |
| 1554 | Ga0501082_0005938 | 3300060353 | Bacteria | 10588 |
| 1555 | Ga0466962_0077292 | 3300061719 | Bacteria | 1591 |
| 1556 | Ga0530510_0504883 | 3300061734 | Bacteria | 917 |
| 1557 | 2507505402 | 2507262055 | Bacteria | 8048963 |
| 1558 | 2508539291 | 2508501009 | Bacteria | 7784016 |
| 1559 | 2508695614 | 2508501042 | Bacteria | 8719808 |
| 1560 | 2509151963 | 2508501128 | Bacteria | 8613869 |
| 1561 | 2511394505 | 2511231028 | Bacteria | 8046582 |
| 1562 | 2513623970 | 2513237092 | Bacteria | 8341956 |
| 1563 | 2513642143 | 2513237094 | Bacteria | 8789602 |
| 1564 | 2513651384 | 2513237095 | Bacteria | 8976980 |
| 1565 | 2513661433 | 2513237096 | Bacteria | 8722461 |
| 1566 | 2513675005 | 2513237098 | Bacteria | 9902361 |
| 1567 | 2513695245 | 2513237101 | Bacteria | 7952346 |
| 1568 | 2513705567 | 2513237102 | Bacteria | 7703324 |
| 1569 | 2513718191 | 2513237104 | Bacteria | 10034502 |
| 1570 | 2513859430 | 2513237137 | Bacteria | 9558895 |
| 1571 | 2513873396 | 2513237139 | Bacteria | 8737671 |
| 1572 | 2513888621 | 2513237141 | Bacteria | 8496279 |
| 1573 | 2513923129 | 2513237145 | Bacteria | 8979722 |
| 1574 | 2514014725 | 2513237161 | Bacteria | 8871253 |
| 1575 | 2515627601 | 2515154112 | Bacteria | 8294334 |
| 1576 | 2517106331 | 2517093001 | Bacteria | 9002274 |
| 1577 | 2517889002 | 2517572143 | Bacteria | 9484767 |
| 1578 | 2524442480 | 2524023205 | Bacteria | 8918781 |
| 1579 | 2524467023 | 2524023210 | Bacteria | 9029266 |
| 1580 | 2524537430 | 2524023228 | Bacteria | 10118060 |
| 1581 | 2528855063 | 2528768022 | Bacteria | 10457665 |
| 1582 | 2603858332 | 2602042107 | Bacteria | 6226103 |
| 1583 | 2617352106 | 2617270735 | Bacteria | 9163226 |
| 1584 | 2617373577 | 2617270741 | Bacteria | 8201522 |
| 1585 | 2644291052 | 2643221651 | Bacteria | 4798932 |
| 1586 | 2671122599 | 2667528175 | Bacteria | 7532676 |
| 1587 | 2723841770 | 2721755755 | Bacteria | 8322773 |
| 1588 | 2728748477 | 2728368998 | Bacteria | 8720350 |
| 1589 | 2745077523 | 2744054633 | Bacteria | 8678936 |
| 1590 | 2793062183 | 2791355196 | Bacteria | 7323613 |
| 1591 | 2793073692 | 2791355197 | Bacteria | 8420563 |
| 1592 | 2793078354 | |||
| 1593 | 2805920744 | 2802429603 | Bacteria | 8777136 |
| 1594 | 2818237807 | 2816332527 | Bacteria | 8933356 |
| 1595 | 2824607315 | 2824600985 | Bacteria | 8488197 |
| 1596 | 2824616879 | 2824609381 | Bacteria | 8672835 |
| 1597 | 2824624409 | 2824617872 | Bacteria | 8814715 |
| 1598 | 2824632778 | 2824626560 | Bacteria | 8813858 |
| 1599 | 2824642050 | 2824635225 | Bacteria | 8785348 |
| 1600 | 2824649494 | 2824644064 | Bacteria | 8743947 |
| 1601 | 2824659699 | 2824653114 | Bacteria | 8493680 |
| 1602 | 2824669406 | 2824661429 | Bacteria | 9877870 |
| 1603 | 2824677372 | 2824671348 | Bacteria | 8369588 |
| 1604 | 2824686313 | 2824679649 | Bacteria | 8248951 |
| 1605 | 2824694108 | 2824687955 | Bacteria | 8360029 |
| 1606 | 2824702718 | 2824696289 | Bacteria | 8335049 |
| 1607 | 2824711440 | 2824704595 | Bacteria | 9667483 |
| 1608 | 2824719379 | 2824714736 | Bacteria | 8717648 |
| 1609 | 2824729884 | 2824723954 | Bacteria | 8758240 |
| 1610 | 2824738921 | 2824732956 | Bacteria | 7810675 |
| 1611 | 2824751649 | 2824746037 | Bacteria | 7911610 |
| 1612 | 2824762546 | 2824753945 | Bacteria | 9787441 |
| 1613 | 2824771880 | 2824763712 | Bacteria | 9792355 |
| 1614 | 2824780787 | 2824773399 | Bacteria | 8360218 |
| 1615 | 2838124649 | 2838122688 | Bacteria | 8803140 |
| 1616 | 2841945340 | 2841941048 | Bacteria | 8688029 |
| 1617 | 2841952125 | 2841949485 | Bacteria | 8680857 |
| 1618 | 2841965462 | 2841957949 | Bacteria | 8652217 |
| 1619 | 2841970487 | 2841966195 | Bacteria | 8673214 |
| 1620 | 2841981735 | 2841974524 | Bacteria | 8931498 |
| 1621 | 2841985016 | 2841983080 | Bacteria | 8395090 |
| 1622 | 2842043374 | 2842038055 | Bacteria | 8002051 |
| 1623 | 2842052636 | 2842045827 | Bacteria | 8006841 |
| 1624 | 2844315493 | 2844315083 | Bacteria | 8138177 |
| 1625 | 2847931202 | 2847930680 | Bacteria | 9342022 |
| 1626 | 2847942291 | 2847939898 | Bacteria | 8606328 |
| 1627 | 2849083161 | 2849076700 | Bacteria | 7039503 |
| 1628 | 2857516405 | 2857509624 | Bacteria | 7472071 |
| 1629 | 2857526569 | 2857524615 | Bacteria | 6615449 |
| 1630 | 2874591677 | 2874590934 | Bacteria | 8299676 |
| 1631 | 2874607933 | 2874604998 | Bacteria | 7834745 |
| 1632 | 2874619107 | 2874612657 | Bacteria | 8252029 |
| 1633 | 2874621250 | 2874620515 | Bacteria | 8290088 |
| 1634 | 2874628656 | 2874628541 | Bacteria | 8630250 |
| 1635 | 2874646162 | 2874645413 | Bacteria | 8214782 |
| 1636 | 2876769592 | 2876761206 | Bacteria | 10111113 |
| 1637 | 2876771778 | 2876771140 | Bacteria | 8287509 |
| 1638 | 2876819122 | 2876818435 | Bacteria | 8274608 |
| 1639 | 2879075631 | 2879074833 | Bacteria | 8279565 |
| 1640 | 2879085541 | 2879083081 | Bacteria | 8587928 |
| 1641 | 2879105888 | 2879099564 | Bacteria | 10442239 |
| 1642 | 2879113359 | 2879110137 | Bacteria | 8907982 |
| 1643 | 2879128440 | 2879127579 | Bacteria | 8294491 |
| 1644 | 2879143582 | 2879142872 | Bacteria | 8267021 |
| 1645 | 2881369272 | 2881364244 | Bacteria | 7710352 |
| 1646 | 2881669949 | 2881665667 | Bacteria | 8175609 |
| 1647 | 2885369381 | 2885366525 | Bacteria | 8326213 |
| 1648 | 2885382790 | 2885374607 | Bacteria | 8927485 |
| 1649 | 2885388544 | 2885383462 | Bacteria | 9473874 |
| 1650 | 2885411832 | 2885409591 | Bacteria | 9235467 |
| 1651 | 2888379452 | 2888378607 | Bacteria | 9652610 |
| 1652 | 2888390549 | 2888388044 | Bacteria | 7304136 |
| 1653 | 2888420174 | 2888419890 | Bacteria | 7857137 |
| 1654 | 2889035349 | 2889033259 | Bacteria | 9099371 |
| 1655 | 2893067185 | 2893066018 | Bacteria | 6158120 |
| 1656 | 2903733446 | 2903727486 | Bacteria | 8281579 |
| 1657 | 2903758962 | 2903748898 | Bacteria | 9972761 |
| 1658 | 2903775477 | 2903768456 | Bacteria | 9749579 |
| 1659 | 2904667795 | 2904666416 | Bacteria | 8226587 |
| 1660 | 2904691054 | 2904690495 | Bacteria | 9412302 |
| 1661 | 2904708458 | |||
| 1662 | 2904716376 | 2904711408 | Bacteria | 9771557 |
| 1663 | 2906608582 | 2906602504 | Bacteria | 8295279 |
| 1664 | 2906613628 | |||
| 1665 | 2906628553 | 2906626472 | Bacteria | 8826946 |
| 1666 | 2906641628 | 2906635258 | Bacteria | 8601019 |
| 1667 | 2906651392 | 2906643746 | Bacteria | 8722424 |
| 1668 | 2906668156 | 2906660503 | Bacteria | 8595048 |
| 1669 | 2908747600 | 2908739725 | Bacteria | 8628932 |
| 1670 | 2908756448 | 2908756301 | Bacteria | 8864324 |
| 1671 | 2908776050 | 2908775508 | Bacteria | 8092255 |
| 1672 | 2919073612 | 2919073203 | Bacteria | 6531949 |
| 1673 | 2922363162 | 2922361189 | Bacteria | 7436256 |
| 1674 | 2922369438 | |||
| 1675 | 2922388534 | 2922386360 | Bacteria | 7017218 |
| 1676 | 2922398125 | 2922393267 | Bacteria | 8285685 |
| 1677 | 2922434063 | |||
| 1678 | 2929618733 | 2929615660 | Bacteria | 9193770 |
| 1679 | 2929628582 | 2929624759 | Bacteria | 9339455 |
| 1680 | 2932790914 | 2932784394 | Bacteria | 9704911 |
| 1681 | 2932794191 | 2932794094 | Bacteria | 7915132 |
| 1682 | 2932808214 | 2932801729 | Bacteria | 7987968 |
| 1683 | 2932812033 | 2932809354 | Bacteria | 9135765 |
| 1684 | 2932825516 | 2932818245 | Bacteria | 9955613 |
| 1685 | 2932833630 | 2932828146 | Bacteria | 9745859 |
| 1686 | 2933580557 | 2933577622 | Bacteria | 9116884 |
| 1687 | 2935615571 | 2935608549 | Bacteria | 8203142 |
| 1688 | 2935623156 | 2935616580 | Bacteria | 9032984 |
| 1689 | 2935636093 | 2935630451 | Bacteria | 8169952 |
| 1690 | 2935644231 | 2935638405 | Bacteria | 10015038 |
| 1691 | 2935654500 | 2935648319 | Bacteria | 8801166 |
| 1692 | 2935663380 | 2935656913 | Bacteria | 8965014 |
| 1693 | 2935672187 | 2935665750 | Bacteria | 9571747 |
| 1694 | 2935679291 | 2935675223 | Bacteria | 9928132 |
| 1695 | 2935686533 | 2935684952 | Bacteria | 9590419 |
| 1696 | 2935700316 | 2935694250 | Bacteria | 9291695 |
| 1697 | 2935710264 | 2935703347 | Bacteria | 10242284 |
| 1698 | 2935716221 | 2935713505 | Bacteria | 9608509 |
| 1699 | 2935723655 | 2935722832 | Bacteria | 9608746 |
| 1700 | 2935735210 | 2935732158 | Bacteria | 9706831 |
| 1701 | 2935743999 | 2935741537 | Bacteria | 9707219 |
| 1702 | 2935752499 | 2935750917 | Bacteria | 9590372 |
| 1703 | 2935763367 | 2935760218 | Bacteria | 9817913 |
| 1704 | 2935772910 | 2935769743 | Bacteria | 7878163 |
| 1705 | 2935783299 | 2935777560 | Bacteria | 8077691 |
| 1706 | 2935788102 | 2935785616 | Bacteria | 7962367 |
| 1707 | 2935796322 | 2935793552 | Bacteria | 8012592 |
| 1708 | 2935808255 | 2935801545 | Bacteria | 9301974 |
| 1709 | 2935816132 | 2935810662 | Bacteria | 9401221 |
| 1710 | 2935825628 | 2935819856 | Bacteria | 8261050 |
| 1711 | 2935833525 | 2935827899 | Bacteria | 10038562 |
| 1712 | 2935844478 | 2935837841 | Bacteria | 9454360 |
| 1713 | 2935853392 | 2935847175 | Bacteria | 8228321 |
| 1714 | 2935861404 | 2935855204 | Bacteria | 9035059 |
| 1715 | 2935869523 | 2935864058 | Bacteria | 9784707 |
| 1716 | 2935879852 | 2935873716 | Bacteria | 9632195 |
| 1717 | 2935889215 | 2935883170 | Bacteria | 7964738 |
| 1718 | 2935914993 | 2935908558 | Bacteria | 8568796 |
| 1719 | 2935918841 | 2935916978 | Bacteria | 9113783 |
| 1720 | 2935931442 | 2935926038 | Bacteria | 8601059 |
| 1721 | 2935940039 | 2935934488 | Bacteria | 8602579 |
| 1722 | 2935947614 | 2935942939 | Bacteria | 8599779 |
| 1723 | 2935956385 | 2935951376 | Bacteria | 8602333 |
| 1724 | 2935966767 | 2935959822 | Bacteria | 7869783 |
| 1725 | 2935973179 | 2935967501 | Bacteria | 8603075 |
| 1726 | 2935980571 | 2935975950 | Bacteria | 8347125 |
| 1727 | 2935990074 | 2935984226 | Bacteria | 8302647 |
| 1728 | 2935997925 | 2935992306 | Bacteria | 9802711 |
| 1729 | 2936008810 | 2936002035 | Bacteria | 9362176 |
| 1730 | 2936017461 | 2936011229 | Bacteria | 8801034 |
| 1731 | 2936026038 | 2936019824 | Bacteria | 8804134 |
| 1732 | 2936034880 | 2936028420 | Bacteria | 8965941 |
| 1733 | 2936041137 | 2936037263 | Bacteria | 9446081 |
| 1734 | 2936052862 | 2936046547 | Bacteria | 8903709 |
| 1735 | 2936060282 | 2936055302 | Bacteria | 8785755 |
| 1736 | 2940558412 | 2940556831 | Bacteria | 9590747 |
| 1737 | 2941512603 | 2941507105 | Bacteria | 8166816 |
| 1738 | 2941520559 | 2941515067 | Bacteria | 8166720 |
| 1739 | 2941528573 | 2941523033 | Bacteria | 8169134 |
| 1740 | 2941535388 | 2941531003 | Bacteria | 7653939 |
| 1741 | 2941543349 | 2941538514 | Bacteria | 9402094 |
| 1742 | 3005475224 | 3005474847 | Bacteria | 9259049 |
| 1743 | 3005486723 | 3005483717 | Bacteria | 7877331 |
| 1744 | 3005509029 | 3005506211 | Bacteria | 6943378 |
| 1745 | 3005594085 | 3005587118 | Bacteria | 7794411 |
| 1746 | 3005595184 | 3005594810 | Bacteria | 8716512 |
| 1747 | 3005711130 | 3005710791 | Bacteria | 7622528 |
| 1748 | 3005718428 | 3005718088 | Bacteria | 8283608 |
| 1749 | 8006928174 | 8006926726 | Bacteria | 6749210 |
| 1750 | 8006936056 | 8006933436 | Bacteria | 10410654 |
| 1751 | 8006967590 | 8006964411 | Bacteria | 8966052 |
| 1752 | 8006975820 | 8006973647 | Bacteria | 10679141 |
| 1753 | 8006991059 | 8006984368 | Bacteria | 9651211 |
| 1754 | 8007000390 | 8006994254 | Bacteria | 8309700 |
| 1755 | 8016518047 | 8016511872 | Bacteria | 9921665 |
| 1756 | 8016526278 | 8016522445 | Bacteria | 8156687 |
| 1757 | 8016544556 | 8016539877 | Bacteria | 8155419 |
| 1758 | 8016557523 | 8016548790 | Bacteria | 8155074 |
| 1759 | 8016565879 | 8016557553 | Bacteria | 8154380 |
| 1760 | 8016569604 | 8016566248 | Bacteria | 8158151 |
| 1761 | 8016582215 | 8016575299 | Bacteria | 8154085 |
| 1762 | 8016586240 | 8016583857 | Bacteria | 10421953 |
| 1763 | 8016603477 | 8016595262 | Bacteria | 8149947 |
| 1764 | 8016618321 | 8016613128 | Bacteria | 8794220 |
| 1765 | 8016622969 | 8016622563 | Bacteria | 7999408 |
| 1766 | 8016635477 | 8016630954 | Bacteria | 9217207 |
| 1767 | 8017058598 | 8017057580 | Bacteria | 10023680 |
| 1768 | 8019531172 | 8019530166 | Bacteria | 8155624 |
| 1769 | 8019540380 | 8019538911 | Bacteria | 7872763 |
| 1770 | 8019549973 | 8019547302 | Bacteria | 7996444 |
| 1771 | 8019562600 | 8019555841 | Bacteria | 9642137 |
| 1772 | 8019572678 | 8019565922 | Bacteria | 9639779 |
| 1773 | 8019577061 | 8019576017 | Bacteria | 10049540 |
| 1774 | 8019595133 | 8019586578 | Bacteria | 10212056 |
| 1775 | 8019606613 | 8019597564 | Bacteria | 10041141 |
| 1776 | 8019611901 | 8019608314 | Bacteria | 10042931 |
| 1777 | 8019623115 | 8019619141 | Bacteria | 9218857 |
| 1778 | 8019629983 | 8019629233 | Bacteria | 8687553 |
| 1779 | 8019640623 | 8019638758 | Bacteria | 9062356 |
| 1780 | 8019652331 | 8019648815 | Bacteria | 10014479 |
| 1781 | 8019666823 | 8019659431 | Bacteria | 8577854 |
| 1782 | 8019676581 | 8019668869 | Bacteria | 8791617 |
| 1783 | 8019679410 | 8019678201 | Bacteria | 8863603 |
| 1784 | 8019696102 | 8019687851 | Bacteria | 8712826 |
| 1785 | 8055742582 | 8055742211 | Bacteria | 9226248 |
| 1786 | 8056676095 | 8056673599 | Bacteria | 7871253 |
| 1787 | 8056682896 | 8056681323 | Bacteria | 8472857 |
| 1788 | 8056691099 | 8056689827 | Bacteria | 6712655 |
| 1789 | 8056971440 | 8056967851 | Bacteria | 9038162 |
| 1790 | Ga0501034_0099570 | |||
| 1791 | RicEn_C5253 | |||
| 1792 | JGI24736J21556_1015157 | |||
| 1793 | JGI24740J21852_10005020 | |||
| 1794 | JGI24739J22299_10011782 | |||
| 1795 | JGI24737J22298_10001303 | |||
| 1796 | JGI24738J21930_10019553 | |||
| 1797 | JGI25406J46586_10000915 | |||
| 1798 | JGI25406J46586_10001108 | |||
| 1799 | JGI25153J46596_10002773 | |||
| 1800 | JGI25153J46596_10035478 | |||
| 1801 | JGI25153J46596_10042611 | |||
| 1802 | JGI25160J50197_1022345 | |||
| 1803 | JGI25161J50226_1012969 | |||
| 1804 | JGI25404J52841_10016932 | |||
| 1805 | JGI25404J52841_10027307 | |||
| 1806 | JGI25404J52841_10029378 | |||
| 1807 | Ga0055524_1063574 | |||
| 1808 | Ga0055531_10014320 | |||
| 1809 | Ga0065165_1003849 | |||
| 1810 | Ga0065712_10310656 | |||
| 1811 | Ga0070658_10063913 | |||
| 1812 | Ga0070658_10087834 | |||
| 1813 | Ga0070658_10160418 | |||
| 1814 | Ga0070658_10442291 | |||
| 1815 | Ga0070676_10173494 | |||
| 1816 | Ga0070683_100003459 | |||
| 1817 | Ga0070683_100019475 | |||
| 1818 | Ga0070683_100517072 | |||
| 1819 | Ga0070670_100091679 | |||
| 1820 | Ga0068869_100256572 | |||
| 1821 | Ga0070666_10152374 | |||
| 1822 | Ga0070666_10465026 | |||
| 1823 | Ga0070680_100070610 | |||
| 1824 | Ga0070680_100095019 | |||
| 1825 | Ga0068868_100126102 | |||
| 1826 | Ga0070660_100001075 | |||
| 1827 | Ga0070660_100237712 | |||
| 1828 | Ga0070689_100069435 | |||
| 1829 | Ga0070689_100240294 | |||
| 1830 | Ga0070689_100472744 | |||
| 1831 | Ga0070689_100708273 | |||
| 1832 | Ga0070691_10020941 | |||
| 1833 | Ga0070661_100035628 | |||
| 1834 | Ga0070661_100098519 | |||
| 1835 | Ga0070661_100149531 | |||
| 1836 | Ga0070668_100148724 | |||
| 1837 | Ga0070668_100304066 | |||
| 1838 | Ga0070668_100316121 | |||
| 1839 | Ga0070668_100437999 | |||
| 1840 | Ga0070669_100256611 | |||
| 1841 | Ga0070669_100353386 | |||
| 1842 | Ga0070669_100511051 | |||
| 1843 | Ga0070671_100014330 | |||
| 1844 | Ga0070671_100144815 | |||
| 1845 | Ga0070674_100392047 | |||
| 1846 | Ga0070674_100707807 | |||
| 1847 | Ga0070673_100195488 | |||
| 1848 | Ga0070673_100394240 | |||
| 1849 | Ga0070659_100140179 | |||
| 1850 | Ga0070659_100498025 | |||
| 1851 | Ga0070659_100650783 | |||
| 1852 | Ga0070667_100190323 | |||
| 1853 | Ga0070667_100374381 | |||
| 1854 | Ga0070667_100843003 | |||
| 1855 | Ga0070709_10007523 | |||
| 1856 | Ga0070709_10010268 | |||
| 1857 | Ga0070709_10015617 | |||
| 1858 | Ga0070714_100006699 | |||
| 1859 | Ga0070714_100065772 | |||
| 1860 | Ga0070714_100253140 | |||
| 1861 | Ga0070713_100016372 | |||
| 1862 | Ga0070713_100019605 | |||
| 1863 | Ga0070713_100053638 | |||
| 1864 | Ga0070713_100248034 | |||
| 1865 | Ga0070713_100843365 | |||
| 1866 | Ga0070710_10000802 | |||
| 1867 | Ga0070710_10121265 | |||
| 1868 | Ga0070701_10222776 | |||
| 1869 | Ga0070711_100017892 | |||
| 1870 | Ga0070711_100020415 | |||
| 1871 | Ga0070711_100055881 | |||
| 1872 | Ga0070711_100076565 | |||
| 1873 | Ga0070711_100137440 | |||
| 1874 | Ga0070711_100356657 | |||
| 1875 | Ga0070711_100493047 | |||
| 1876 | Ga0070700_100251139 | |||
| 1877 | Ga0070663_100066899 | |||
| 1878 | Ga0070663_100104953 | |||
| 1879 | Ga0070663_100105112 | |||
| 1880 | Ga0070678_100129896 | |||
| 1881 | Ga0070678_100172405 | |||
| 1882 | Ga0070678_100354954 | |||
| 1883 | Ga0070678_100594137 | |||
| 1884 | Ga0070662_100037993 | |||
| 1885 | Ga0070662_100327014 | |||
| 1886 | Ga0070681_10009671 | |||
| 1887 | Ga0070681_10025343 | |||
| 1888 | Ga0070681_10195696 | |||
| 1889 | Ga0070681_10638533 | |||
| 1890 | Ga0068867_100102312 | |||
| 1891 | Ga0068867_100144706 | |||
| 1892 | Ga0070685_10374239 | |||
| 1893 | Ga0070706_100350976 | |||
| 1894 | Ga0070706_100774025 | |||
| 1895 | Ga0070707_100078821 | |||
| 1896 | Ga0070699_100616597 | |||
| 1897 | Ga0070679_100048159 | |||
| 1898 | Ga0070679_100109136 | |||
| 1899 | Ga0070684_100007076 | |||
| 1900 | Ga0070684_100046071 | |||
| 1901 | Ga0070697_100013361 | |||
| 1902 | Ga0068853_100037102 | |||
| 1903 | Ga0068853_100052993 | |||
| 1904 | Ga0068853_100526871 | |||
| 1905 | Ga0068853_100541794 | |||
| 1906 | Ga0070672_100562753 | |||
| 1907 | Ga0070672_100746402 | |||
| 1908 | Ga0070686_100314555 | |||
| 1909 | Ga0070693_100400440 | |||
| 1910 | Ga0070665_100019646 | |||
| 1911 | Ga0070665_100042207 | |||
| 1912 | Ga0070665_100061160 | |||
| 1913 | Ga0070665_100094748 | |||
| 1914 | Ga0070665_100273433 | |||
| 1915 | Ga0070665_100407722 | |||
| 1916 | Ga0070665_100547367 | |||
| 1917 | Ga0070665_100607495 | |||
| 1918 | Ga0070704_100255708 | |||
| 1919 | Ga0068855_100044373 | |||
| 1920 | Ga0068855_100075096 | |||
| 1921 | Ga0068855_100082985 | |||
| 1922 | Ga0068855_100084323 | |||
| 1923 | Ga0068855_100155703 | |||
| 1924 | Ga0068855_100240979 | |||
| 1925 | Ga0068855_100386058 | |||
| 1926 | Ga0070664_100231974 | |||
| 1927 | Ga0068857_100008930 | |||
| 1928 | Ga0068857_100022226 | |||
| 1929 | Ga0068857_100064498 | |||
| 1930 | Ga0068857_100071907 | |||
| 1931 | Ga0068857_100541391 | |||
| 1932 | Ga0068854_100028179 | |||
| 1933 | Ga0068854_100147734 | |||
| 1934 | Ga0068854_100206859 | |||
| 1935 | Ga0068854_100232479 | |||
| 1936 | Ga0068854_100441631 | |||
| 1937 | Ga0068856_100013958 | |||
| 1938 | Ga0068856_100042359 | |||
| 1939 | Ga0068856_100050282 | |||
| 1940 | Ga0068856_100105736 | |||
| 1941 | Ga0068856_100328008 | |||
| 1942 | Ga0068856_100343963 | |||
| 1943 | Ga0068856_100572280 | |||
| 1944 | Ga0068856_100765277 | |||
| 1945 | Ga0068856_100872328 | |||
| 1946 | Ga0070702_100291029 | |||
| 1947 | Ga0068852_100017184 | |||
| 1948 | Ga0068852_100048394 | |||
| 1949 | Ga0068852_100076112 | |||
| 1950 | Ga0068852_100198957 | |||
| 1951 | Ga0068852_100445913 | |||
| 1952 | Ga0068852_100488403 | |||
| 1953 | Ga0068852_100587897 | |||
| 1954 | Ga0068852_100806567 | |||
| 1955 | Ga0068859_100113514 | |||
| 1956 | Ga0068859_100281859 | |||
| 1957 | Ga0068859_100583019 | |||
| 1958 | Ga0068859_100776293 | |||
| 1959 | Ga0068864_100106658 | |||
| 1960 | Ga0068864_100665701 | |||
| 1961 | Ga0068866_10161358 | |||
| 1962 | Ga0068861_100089459 | |||
| 1963 | Ga0068861_100226997 | |||
| 1964 | Ga0068861_100265120 | |||
| 1965 | Ga0068851_10006622 | |||
| 1966 | Ga0068851_10026964 | |||
| 1967 | Ga0068870_10278445 | |||
| 1968 | Ga0068863_100262320 | |||
| 1969 | Ga0068858_100082051 | |||
| 1970 | Ga0068860_100000477 | |||
| 1971 | Ga0068860_100193755 | |||
| 1972 | Ga0068860_100300493 | |||
| 1973 | Ga0068860_100469711 | |||
| 1974 | Ga0068860_101113883 | |||
| 1975 | Ga0068862_100087301 | |||
| 1976 | Ga0068862_100109043 | |||
| 1977 | Ga0068862_100138409 | |||
| 1978 | Ga0068862_100490597 | |||
| 1979 | Ga0068862_100493133 | |||
| 1980 | Ga0081455_10011031 | |||
| 1981 | Ga0081455_10023057 | |||
| 1982 | Ga0081455_10028111 | |||
| 1983 | Ga0081455_10059467 | |||
| 1984 | Ga0081538_10014581 | |||
| 1985 | Ga0081538_10018074 | |||
| 1986 | Ga0081540_1001247 | |||
| 1987 | Ga0081540_1006252 | |||
| 1988 | Ga0081540_1007349 | |||
| 1989 | Ga0081540_1011012 | |||
| 1990 | Ga0081540_1011793 | |||
| 1991 | Ga0081540_1020406 | |||
| 1992 | Ga0081540_1023508 | |||
| 1993 | Ga0081540_1090817 | |||
| 1994 | Ga0081540_1108981 | |||
| 1995 | Ga0081539_10000265 | |||
| 1996 | Ga0081539_10000371 | |||
| 1997 | Ga0081539_10012180 | |||
| 1998 | Ga0070717_10007759 | |||
| 1999 | Ga0070717_10010181 | |||
| 2000 | Ga0070717_10029710 | |||
| 2001 | Ga0070717_10588910 | |||
| 2002 | Ga0075365_10008765 | |||
| 2003 | Ga0075365_10023785 | |||
| 2004 | Ga0075365_10038902 | |||
| 2005 | Ga0075365_10061500 | |||
| 2006 | Ga0075365_10154659 | |||
| 2007 | Ga0075365_10477978 | |||
| 2008 | Ga0075368_10015416 | |||
| 2009 | Ga0075368_10028027 | |||
| 2010 | Ga0075363_100008349 | |||
| 2011 | Ga0075363_100047253 | |||
| 2012 | Ga0075363_100196507 | |||
| 2013 | Ga0075363_100298469 | |||
| 2014 | Ga0075363_100365837 | |||
| 2015 | Ga0075364_10034975 | |||
| 2016 | Ga0075364_10041445 | |||
| 2017 | Ga0075364_10152333 | |||
| 2018 | Ga0075364_10509677 | |||
| 2019 | Ga0075364_10583863 | |||
| 2020 | Ga0070715_10000872 | |||
| 2021 | Ga0070715_10246234 | |||
| 2022 | Ga0070716_100019142 | |||
| 2023 | Ga0070716_100051216 | |||
| 2024 | Ga0070716_100089432 | |||
| 2025 | Ga0070716_100456401 | |||
| 2026 | Ga0070716_100535237 | |||
| 2027 | Ga0070716_100549528 | |||
| 2028 | Ga0070712_100012131 | |||
| 2029 | Ga0070712_100023475 | |||
| 2030 | Ga0070712_100042188 | |||
| 2031 | Ga0070712_100092434 | |||
| 2032 | Ga0070712_100094994 | |||
| 2033 | Ga0070712_100100219 | |||
| 2034 | Ga0070712_100148078 | |||
| 2035 | Ga0075367_10005815 | |||
| 2036 | Ga0075367_10016144 | |||
| 2037 | Ga0075367_10043731 | |||
| 2038 | Ga0075367_10045040 | |||
| 2039 | Ga0075367_10045943 | |||
| 2040 | Ga0075367_10192270 | |||
| 2041 | Ga0075369_10011258 | |||
| 2042 | Ga0075369_10124756 | |||
| 2043 | Ga0075369_10205780 | |||
| 2044 | Ga0075366_10050660 | |||
| 2045 | Ga0075366_10097799 | |||
| 2046 | Ga0097621_100573771 | |||
| 2047 | Ga0075370_10182744 | |||
| 2048 | Ga0075370_10184224 | |||
| 2049 | Ga0075370_10286595 | |||
| 2050 | Ga0075370_10349089 | |||
| 2051 | Ga0068871_100121609 | |||
| 2052 | Ga0068871_100488421 | |||
| 2053 | Ga0075428_100167202 | |||
| 2054 | Ga0075433_10246735 | |||
| 2055 | Ga0075433_10538565 | |||
| 2056 | Ga0075434_100098208 | |||
| 2057 | Ga0075434_100159055 | |||
| 2058 | Ga0068865_100134104 | |||
| 2059 | Ga0068865_100207434 | |||
| 2060 | Ga0075436_100200900 | |||
| 2061 | Ga0075436_100615442 | |||
| 2062 | Ga0097620_100113524 | |||
| 2063 | Ga0097620_100281862 | |||
| 2064 | Ga0097620_100582996 | |||
| 2065 | Ga0097620_100776279 | |||
| 2066 | Ga0099825_1014654 | |||
| 2067 | Ga0099825_1034410 | |||
| 2068 | Ga0099824_1009377 | |||
| 2069 | Ga0099822_1000918 | |||
| 2070 | Ga0099823_1092027 | |||
| 2071 | Ga0075435_100317550 | |||
| 2072 | Ga0099795_10003456 | |||
| 2073 | Ga0099795_10089479 | |||
| 2074 | Ga0099795_10139209 | |||
| 2075 | Ga0105244_10247152 | |||
| 2076 | Ga0105250_10086965 | |||
| 2077 | Ga0105240_10014175 | |||
| 2078 | Ga0105240_10015716 | |||
| 2079 | Ga0105240_10067208 | |||
| 2080 | Ga0105240_10078467 | |||
| 2081 | Ga0105240_10159656 | |||
| 2082 | Ga0105240_10258968 | |||
| 2083 | Ga0105240_10406693 | |||
| 2084 | Ga0105240_10655452 | |||
| 2085 | Ga0111539_10103107 | |||
| 2086 | Ga0111539_10466201 | |||
| 2087 | Ga0105245_10091504 | |||
| 2088 | Ga0105245_10259834 | |||
| 2089 | Ga0105245_10355126 | |||
| 2090 | Ga0105247_10026096 | |||
| 2091 | Ga0105247_10033576 | |||
| 2092 | Ga0105247_10046601 | |||
| 2093 | Ga0105247_10059759 | |||
| 2094 | Ga0105247_10222365 | |||
| 2095 | Ga0105247_10256530 | |||
| 2096 | Ga0105247_10377197 | |||
| 2097 | Ga0114129_10094360 | |||
| 2098 | Ga0105243_10022131 | |||
| 2099 | Ga0105243_10148449 | |||
| 2100 | Ga0105243_10635806 | |||
| 2101 | Ga0105241_10000249 | |||
| 2102 | Ga0105241_10045364 | |||
| 2103 | Ga0105241_10082928 | |||
| 2104 | Ga0105241_10120371 | |||
| 2105 | Ga0105241_10184541 | |||
| 2106 | Ga0105241_10285018 | |||
| 2107 | Ga0105241_10587520 | |||
| 2108 | Ga0105241_10681981 | |||
| 2109 | Ga0105242_10486081 | |||
| 2110 | Ga0105248_10075762 | |||
| 2111 | Ga0105248_10185622 | |||
| 2112 | Ga0105248_10372892 | |||
| 2113 | Ga0105237_10010653 | |||
| 2114 | Ga0105237_10014068 | |||
| 2115 | Ga0105237_10031484 | |||
| 2116 | Ga0105237_10090906 | |||
| 2117 | Ga0105237_10133438 | |||
| 2118 | Ga0105237_10148701 | |||
| 2119 | Ga0105237_10225036 | |||
| 2120 | Ga0105237_10264422 | |||
| 2121 | Ga0105237_10342475 | |||
| 2122 | Ga0105237_10410021 | |||
| 2123 | Ga0105237_10616920 | |||
| 2124 | Ga0105237_10897912 | |||
| 2125 | Ga0105238_10012601 | |||
| 2126 | Ga0105238_10013147 | |||
| 2127 | Ga0105238_10045519 | |||
| 2128 | Ga0105238_10122350 | |||
| 2129 | Ga0105238_10134900 | |||
| 2130 | Ga0105238_10375515 | |||
| 2131 | Ga0105238_10863820 | |||
| 2132 | Ga0105238_10873018 | |||
| 2133 | Ga0099796_10006620 | |||
| 2134 | Ga0105239_10012784 | |||
| 2135 | Ga0105239_10014648 | |||
| 2136 | Ga0105239_10043484 | |||
| 2137 | Ga0105239_10252509 | |||
| 2138 | Ga0105239_10275967 | |||
| 2139 | Ga0105239_10403086 | |||
| 2140 | Ga0105239_10705601 | |||
| 2141 | Ga0105246_10030977 | |||
| 2142 | Ga0105246_10683328 | |||
| 2143 | Ga0105246_10823378 | |||
| 2144 | Ga0157326_1017363 | |||
| 2145 | Ga0157371_10098485 | |||
| 2146 | Ga0157370_10115412 | |||
| 2147 | Ga0157370_10217796 | |||
| 2148 | Ga0157369_10004221 | |||
| 2149 | Ga0157369_10032586 | |||
| 2150 | Ga0157369_10072902 | |||
| 2151 | Ga0157369_10352990 | |||
| 2152 | Ga0157369_10916204 | |||
| 2153 | Ga0157378_10209003 | |||
| 2154 | Ga0163162_10080261 | |||
| 2155 | Ga0163162_10323885 | |||
| 2156 | Ga0163162_10499188 | |||
| 2157 | Ga0157372_10317616 | |||
| 2158 | Ga0157372_10651143 | |||
| 2159 | Ga0157372_10751246 | |||
| 2160 | Ga0157372_10931895 | |||
| 2161 | Ga0157375_10050169 | |||
| 2162 | Ga0157375_10055933 | |||
| 2163 | Ga0157375_10317851 | |||
| 2164 | Ga0157375_10353089 | |||
| 2165 | Ga0157375_10729935 | |||
| 2166 | Ga0157375_10875242 | |||
| 2167 | Ga0157375_11631355 | |||
| 2168 | Ga0163163_10024457 | |||
| 2169 | Ga0163163_10062893 | |||
| 2170 | Ga0163163_10084364 | |||
| 2171 | Ga0163163_10098316 | |||
| 2172 | Ga0163163_10983136 | |||
| 2173 | Ga0157380_10122416 | |||
| 2174 | Ga0157380_10489307 | |||
| 2175 | Ga0157380_10681912 | |||
| 2176 | Ga0157380_10921319 | |||
| 2177 | Ga0182008_10081970 | |||
| 2178 | Ga0182008_10196222 | |||
| 2179 | Ga0157377_10417280 | |||
| 2180 | Ga0157377_10597971 | |||
| 2181 | Ga0157379_10111718 | |||
| 2182 | Ga0157379_10299945 | |||
| 2183 | Ga0157379_10422882 | |||
| 2184 | Ga0157376_10068910 | |||
| 2185 | Ga0157376_10449819 | |||
| 2186 | Ga0157376_10581389 | |||
| 2187 | Ga0157376_11025595 | |||
| 2188 | Ga0163161_10042345 | |||
| 2189 | Ga0206350_10581160 | |||
| 2190 | Ga0214544_1000056 | |||
| 2191 | Ga0214544_1023817 | |||
| 2192 | Ga0214542_1000071 | |||
| 2193 | Ga0214545_1000033 | |||
| 2194 | Ga0214543_1000105 | |||
| 2195 | Ga0214543_1025733 | |||
| 2196 | Ga0213872_10133386 | |||
| 2197 | Ga0213876_10011834 | |||
| 2198 | Ga0213876_10074857 | |||
| 2199 | Ga0213876_10351938 | |||
| 2200 | Ga0213875_10078334 | |||
| 2201 | Ga0213871_10008728 | |||
| 2202 | Ga0224712_10026527 | |||
| 2203 | Ga0224712_10116748 | |||
| 2204 | Ga0209563_108510 | |||
| 2205 | Ga0209677_100170 | |||
| 2206 | Ga0209677_102931 | |||
| 2207 | Ga0209148_1000295 | |||
| 2208 | Ga0209233_1017816 | |||
| 2209 | Ga0209233_1029177 | |||
| 2210 | Ga0209233_1029207 | |||
| 2211 | Ga0209455_1001656 | |||
| 2212 | Ga0209455_1004571 | |||
| 2213 | Ga0209455_1008507 | |||
| 2214 | Ga0209673_1052348 | |||
| 2215 | Ga0209025_1068889 | |||
| 2216 | Ga0209564_1006432 | |||
| 2217 | Ga0209564_1012927 | |||
| 2218 | Ga0209758_1000069 | |||
| 2219 | Ga0209758_1000253 | |||
| 2220 | Ga0209758_1000397 | |||
| 2221 | Ga0209758_1001436 | |||
| 2222 | Ga0209758_1013802 | |||
| 2223 | Ga0209758_1017963 | |||
| 2224 | Ga0209758_1021734 | |||
| 2225 | Ga0209758_1046585 | |||
| 2226 | Ga0209256_1020904 | |||
| 2227 | Ga0207426_1001927 | |||
| 2228 | Ga0207426_1035148 | |||
| 2229 | Ga0209257_1005744 | |||
| 2230 | Ga0207697_10040913 | |||
| 2231 | Ga0207697_10069070 | |||
| 2232 | Ga0207656_10004553 | |||
| 2233 | Ga0207656_10066142 | |||
| 2234 | Ga0207656_10090068 | |||
| 2235 | Ga0207656_10190896 | |||
| 2236 | Ga0207653_10025862 | |||
| 2237 | Ga0207682_10140169 | |||
| 2238 | Ga0207692_10027705 | |||
| 2239 | Ga0207692_10048558 | |||
| 2240 | Ga0207710_10093199 | |||
| 2241 | Ga0207710_10185266 | |||
| 2242 | Ga0207710_10289226 | |||
| 2243 | Ga0207688_10071971 | |||
| 2244 | Ga0207688_10076837 | |||
| 2245 | Ga0207688_10082681 | |||
| 2246 | Ga0207688_10097379 | |||
| 2247 | Ga0207680_10095610 | |||
| 2248 | Ga0207680_10277501 | |||
| 2249 | Ga0207680_10579454 | |||
| 2250 | Ga0207647_10003295 | |||
| 2251 | Ga0207647_10016684 | |||
| 2252 | Ga0207685_10000480 | |||
| 2253 | Ga0207699_10005583 | |||
| 2254 | Ga0207699_10150422 | |||
| 2255 | Ga0207699_10225105 | |||
| 2256 | Ga0207699_10405283 | |||
| 2257 | Ga0207645_10225378 | |||
| 2258 | Ga0207705_10412280 | |||
| 2259 | Ga0207705_10430754 | |||
| 2260 | Ga0207684_10649857 | |||
| 2261 | Ga0207654_10000083 | |||
| 2262 | Ga0207654_10029560 | |||
| 2263 | Ga0207654_10097456 | |||
| 2264 | Ga0207654_10128503 | |||
| 2265 | Ga0207654_10255148 | |||
| 2266 | Ga0207707_10000445 | |||
| 2267 | Ga0207707_10001947 | |||
| 2268 | Ga0207707_10004159 | |||
| 2269 | Ga0207707_10046091 | |||
| 2270 | Ga0207707_10105824 | |||
| 2271 | Ga0207695_10000148 | |||
| 2272 | Ga0207695_10000387 | |||
| 2273 | Ga0207695_10033885 | |||
| 2274 | Ga0207695_10322626 | |||
| 2275 | Ga0207695_10854830 | |||
| 2276 | Ga0207671_10011727 | |||
| 2277 | Ga0207671_10022076 | |||
| 2278 | Ga0207671_10092220 | |||
| 2279 | Ga0207671_10110957 | |||
| 2280 | Ga0207671_10599549 | |||
| 2281 | Ga0207671_10709443 | |||
| 2282 | Ga0207693_10003401 | |||
| 2283 | Ga0207693_10020364 | |||
| 2284 | Ga0207693_10033227 | |||
| 2285 | Ga0207693_10040625 | |||
| 2286 | Ga0207693_10560558 | |||
| 2287 | Ga0207693_10647952 | |||
| 2288 | Ga0207663_10000246 | |||
| 2289 | Ga0207663_10015460 | |||
| 2290 | Ga0207663_10022999 | |||
| 2291 | Ga0207663_10049403 | |||
| 2292 | Ga0207663_10101555 | |||
| 2293 | Ga0207663_10178832 | |||
| 2294 | Ga0207663_10337414 | |||
| 2295 | Ga0207660_10001773 | |||
| 2296 | Ga0207660_10048372 | |||
| 2297 | Ga0207660_10098973 | |||
| 2298 | Ga0207660_10811179 | |||
| 2299 | Ga0207657_10003784 | |||
| 2300 | Ga0207657_10147964 | |||
| 2301 | Ga0207657_10148515 | |||
| 2302 | Ga0207657_10309041 | |||
| 2303 | Ga0207649_10032393 | |||
| 2304 | Ga0207649_10108820 | |||
| 2305 | Ga0207652_10011651 | |||
| 2306 | Ga0207652_10139161 | |||
| 2307 | Ga0207652_10166123 | |||
| 2308 | Ga0207652_10228683 | |||
| 2309 | Ga0207681_10279713 | |||
| 2310 | Ga0207681_10305018 | |||
| 2311 | Ga0207681_10346780 | |||
| 2312 | Ga0207694_10000121 | |||
| 2313 | Ga0207694_10026270 | |||
| 2314 | Ga0207694_10083167 | |||
| 2315 | Ga0207694_10092611 | |||
| 2316 | Ga0207694_10100769 | |||
| 2317 | Ga0207650_10171033 | |||
| 2318 | Ga0207650_10201559 | |||
| 2319 | Ga0207687_10079093 | |||
| 2320 | Ga0207687_10155075 | |||
| 2321 | Ga0207687_10703327 | |||
| 2322 | Ga0207700_10072422 | |||
| 2323 | Ga0207700_10251740 | |||
| 2324 | Ga0207664_10010393 | |||
| 2325 | Ga0207664_10182205 | |||
| 2326 | Ga0207664_10204329 | |||
| 2327 | Ga0207664_10547262 | |||
| 2328 | Ga0207644_10063880 | |||
| 2329 | Ga0207644_10261401 | |||
| 2330 | Ga0207644_10412647 | |||
| 2331 | Ga0207644_10839471 | |||
| 2332 | Ga0207690_10356032 | |||
| 2333 | Ga0207706_10176050 | |||
| 2334 | Ga0207706_10241977 | |||
| 2335 | Ga0207686_10132978 | |||
| 2336 | Ga0207686_10178699 | |||
| 2337 | Ga0207686_10232711 | |||
| 2338 | Ga0207686_10452097 | |||
| 2339 | Ga0207709_10170416 | |||
| 2340 | Ga0207709_10355602 | |||
| 2341 | Ga0207670_10129044 | |||
| 2342 | Ga0207670_10631456 | |||
| 2343 | Ga0207669_10022383 | |||
| 2344 | Ga0207669_10077747 | |||
| 2345 | Ga0207704_10362022 | |||
| 2346 | Ga0207665_10000883 | |||
| 2347 | Ga0207665_10012221 | |||
| 2348 | Ga0207665_10022858 | |||
| 2349 | Ga0207665_10115534 | |||
| 2350 | Ga0207691_10536158 | |||
| 2351 | Ga0207711_10053689 | |||
| 2352 | Ga0207711_10159713 | |||
| 2353 | Ga0207711_10193091 | |||
| 2354 | Ga0207711_10274003 | |||
| 2355 | Ga0207689_10027093 | |||
| 2356 | Ga0207689_10154733 | |||
| 2357 | Ga0207661_10005672 | |||
| 2358 | Ga0207661_10011706 | |||
| 2359 | Ga0207661_10030324 | |||
| 2360 | Ga0207679_10194024 | |||
| 2361 | Ga0207679_10325726 | |||
| 2362 | Ga0207679_10795778 | |||
| 2363 | Ga0207667_10013785 | |||
| 2364 | Ga0207667_10076007 | |||
| 2365 | Ga0207667_10116122 | |||
| 2366 | Ga0207667_10186019 | |||
| 2367 | Ga0207667_10287329 | |||
| 2368 | Ga0207667_10363976 | |||
| 2369 | Ga0207667_10446067 | |||
| 2370 | Ga0207667_10569218 | |||
| 2371 | Ga0207651_10401057 | |||
| 2372 | Ga0207712_10029029 | |||
| 2373 | Ga0207712_10415076 | |||
| 2374 | Ga0207668_10166618 | |||
| 2375 | Ga0207668_10171153 | |||
| 2376 | Ga0207668_10184220 | |||
| 2377 | Ga0207668_10191691 | |||
| 2378 | Ga0207668_10691793 | |||
| 2379 | Ga0207640_10037366 | |||
| 2380 | Ga0207640_10043166 | |||
| 2381 | Ga0207640_10127987 | |||
| 2382 | Ga0207640_10313514 | |||
| 2383 | Ga0207640_10692248 | |||
| 2384 | Ga0207658_10201278 | |||
| 2385 | Ga0207658_10382859 | |||
| 2386 | Ga0207677_10082113 | |||
| 2387 | Ga0207677_10109588 | |||
| 2388 | Ga0207677_10650593 | |||
| 2389 | Ga0207703_10664426 | |||
| 2390 | Ga0207703_10711093 | |||
| 2391 | Ga0207639_10005857 | |||
| 2392 | Ga0207639_10071612 | |||
| 2393 | Ga0207639_10071905 | |||
| 2394 | Ga0207639_10148092 | |||
| 2395 | Ga0207639_10398839 | |||
| 2396 | Ga0207639_11156156 | |||
| 2397 | Ga0207678_10070411 | |||
| 2398 | Ga0207678_10122679 | |||
| 2399 | Ga0207678_10191437 | |||
| 2400 | Ga0207678_10289410 | |||
| 2401 | Ga0207708_10274520 | |||
| 2402 | Ga0207702_10000004 | |||
| 2403 | Ga0207702_10010411 | |||
| 2404 | Ga0207702_10119063 | |||
| 2405 | Ga0207702_10165491 | |||
| 2406 | Ga0207702_10269383 | |||
| 2407 | Ga0207702_10596896 | |||
| 2408 | Ga0207702_10671654 | |||
| 2409 | Ga0207702_10860770 | |||
| 2410 | Ga0207641_10109214 | |||
| 2411 | Ga0207641_10921228 | |||
| 2412 | Ga0207648_10043666 | |||
| 2413 | Ga0207648_10718355 | |||
| 2414 | Ga0207676_10721106 | |||
| 2415 | Ga0207674_10004725 | |||
| 2416 | Ga0207674_10005754 | |||
| 2417 | Ga0207674_10051030 | |||
| 2418 | Ga0207674_10054515 | |||
| 2419 | Ga0207674_10253984 | |||
| 2420 | Ga0207674_10570540 | |||
| 2421 | Ga0207675_100066332 | |||
| 2422 | Ga0207675_100103203 | |||
| 2423 | Ga0207675_100256940 | |||
| 2424 | Ga0207675_100320949 | |||
| 2425 | Ga0207675_100431583 | |||
| 2426 | Ga0207683_10042727 | |||
| 2427 | Ga0207683_10100679 | |||
| 2428 | Ga0207683_10216139 | |||
| 2429 | Ga0207683_10315563 | |||
| 2430 | Ga0207683_10319671 | |||
| 2431 | Ga0207683_10564394 | |||
| 2432 | Ga0207698_10020218 | |||
| 2433 | Ga0207698_10062251 | |||
| 2434 | Ga0207698_10105572 | |||
| 2435 | Ga0207698_10188168 | |||
| 2436 | Ga0207698_10214105 | |||
| 2437 | Ga0207698_10775302 | |||
| 2438 | Ga0209389_1000157 | |||
| 2439 | Ga0209389_1002628 | |||
| 2440 | Ga0209589_1000035 | |||
| 2441 | Ga0209589_1010054 | |||
| 2442 | Ga0209489_100079 | |||
| 2443 | Ga0209489_101111 | |||
| 2444 | Ga0209489_108314 | |||
| 2445 | Ga0209700_100011 | |||
| 2446 | Ga0209700_100077 | |||
| 2447 | Ga0209179_1025672 | |||
| 2448 | Ga0209588_1021388 | |||
| 2449 | Ga0209813_10017597 | |||
| 2450 | Ga0207428_10116488 | |||
| 2451 | Ga0268266_10001236 | |||
| 2452 | Ga0268266_10004650 | |||
| 2453 | Ga0268266_10023413 | |||
| 2454 | Ga0268266_11101644 | |||
| 2455 | Ga0268265_10181291 | |||
| 2456 | Ga0268264_10000062 | |||
| 2457 | Ga0265326_10042825 | |||
| 2458 | Ga0265319_1012209 | |||
| 2459 | Ga0265334_10018421 | |||
| 2460 | Ga0265318_10113347 | |||
| 2461 | Ga0265323_10002052 | |||
| 2462 | Ga0265322_10019902 | |||
| 2463 | Ga0265336_10006935 | |||
| 2464 | Ga0307517_10000175 | |||
| 2465 | Ga0307517_10154848 | |||
| 2466 | Ga0307517_10184938 | |||
| 2467 | Ga0307515_10153519 | |||
| 2468 | Ga0307515_10256125 | |||
| 2469 | Ga0265338_10001066 | |||
| 2470 | Ga0265324_10006962 | |||
| 2471 | Ga0307511_10248289 | |||
| 2472 | Ga0307512_10264446 | |||
| 2473 | Ga0265330_10029574 | |||
| 2474 | Ga0265330_10041820 | |||
| 2475 | Ga0265332_10064907 | |||
| 2476 | Ga0265325_10014735 | |||
| 2477 | Ga0265340_10014954 | |||
| 2478 | Ga0265339_10012660 | |||
| 2479 | Ga0265331_10069792 | |||
| 2480 | Ga0265331_10191712 | |||
| 2481 | Ga0307513_10333874 | |||
| 2482 | Ga0307509_10038191 | |||
| 2483 | Ga0307509_10143590 | |||
| 2484 | Ga0307509_10500397 | |||
| 2485 | Ga0307408_100800975 | |||
| 2486 | Ga0307508_10000045 | |||
| 2487 | Ga0307508_10139575 | |||
| 2488 | Ga0307508_10147259 | |||
| 2489 | Ga0307508_10553802 | |||
| 2490 | Ga0265314_10005887 | |||
| 2491 | Ga0265314_10050484 | |||
| 2492 | Ga0265314_10071752 | |||
| 2493 | Ga0265342_10008380 | |||
| 2494 | Ga0265342_10288626 | |||
| 2495 | Ga0265342_10293897 | |||
| 2496 | Ga0307516_10016686 | |||
| 2497 | Ga0307516_10117042 | |||
| 2498 | Ga0307405_10056708 | |||
| 2499 | Ga0307410_10307002 | |||
| 2500 | Ga0307406_10269253 | |||
| 2501 | Ga0307407_10734445 | |||
| 2502 | Ga0307412_10065283 | |||
| 2503 | Ga0307416_100145455 | |||
| 2504 | Ga0307416_100631037 | |||
| 2505 | Ga0307411_10515635 | |||
| 2506 | Ga0307411_10758544 | |||
| 2507 | Ga0307415_100412418 | |||
| 2508 | Ga0307507_10148703 | |||
| 2509 | Ga0307510_10013138 | |||
| 2510 | Ga0307510_10014518 | |||
| 2511 | Ga0315911_1000008 | |||
| 2512 | Ga0373926_0004776 | |||
| 2513 | Ga0373926_0028267 | |||
| 2514 | Ga0373928_0038806 | |||
| 2515 | Ga0373934_0000780 | |||
| 2516 | Ga0373934_0026919 | |||
| 2517 | Ga0373944_0052814 | |||
| 2518 | Ga0373923_0008412 | |||
| 2519 | Ga0373923_0076584 | |||
| 2520 | Ga0373923_0083745 | |||
| 2521 | Ga0373923_0172575 | |||
| 2522 | Ga0373936_0021610 | |||
| 2523 | Ga0373936_0027809 | |||
| 2524 | Ga0373936_0043664 | |||
| 2525 | Ga0373936_0076313 | |||
| 2526 | Ga0373945_0002845 | |||
| 2527 | Ga0373945_0061846 | |||
| 2528 | Ga0373953_0092119 | |||
| 2529 | Ga0373956_0001732 | |||
| 2530 | Ga0373956_0061422 | |||
| 2531 | Ga0373956_0090808 | |||
| 2532 | Ga0373957_0001309 | |||
| 2533 | Ga0373957_0012503 | |||
| 2534 | Ga0373957_0033998 | |||
| 2535 | Ga0373960_0050314 | |||
| 2536 | Ga0373943_0037844 | |||
| 2537 | Ga0373943_0037978 | |||
| 2538 | Ga0373943_0140321 | |||
| 2539 | Ga0373943_0241441 | |||
| 2540 | Ga0373943_0325905 | |||
| 2541 | Ga0373946_0001716 | |||
| 2542 | Ga0373955_0126352 | |||
| 2543 | Ga0373962_0047155 | |||
| 2544 | Ga0373924_0005291 | |||
| 2545 | Ga0373924_0021215 | |||
| 2546 | Ga0373931_0153079 | |||
| 2547 | Ga0373931_0179829 | |||
| 2548 | Ga0373935_0001046 | |||
| 2549 | Ga0373935_0413110 | |||
| 2550 | Ga0373935_0417320 | |||
| 2551 | Ga0373927_0001064 | |||
| 2552 | Ga0373927_0001972 | |||
| 2553 | Ga0373927_0008017 | |||
| 2554 | Ga0373927_0010444 | |||
| 2555 | Ga0373927_0021518 | |||
| 2556 | Ga0373927_0052332 | |||
| 2557 | Ga0373927_0068391 | |||
| 2558 | Ga0373933_0000068 | |||
| 2559 | Ga0373933_0057503 | |||
| 2560 | Ga0373933_0085973 | |||
| 2561 | Ga0373933_0356621 | |||
| 2562 | Ga0373933_0449094 | |||
| 2563 | Ga0373947_0002167 | |||
| 2564 | Ga0373947_0019455 | |||
| 2565 | Ga0373947_0030529 | |||
| 2566 | Ga0373947_0058446 | |||
| 2567 | Ga0373947_0150565 | |||
| 2568 | Ga0373947_0151038 | |||
| 2569 | Ga0373947_0252253 | |||
| 2570 | Ga0373937_0043074 | |||
| 2571 | Ga0373937_0075202 | |||
| 2572 | Ga0373925_0005141 | |||
| 2573 | Ga0373925_0024532 | |||
| 2574 | Ga0373925_0040045 | |||
| 2575 | Ga0373925_0056601 | |||
| 2576 | Ga0373925_0105266 | |||
| 2577 | Ga0373925_0286126 | |||
| 2578 | Ga0373925_0597686 | |||
| 2579 | Ga0373925_0783684 | |||
| 2580 | Ga0395899_0262652 | |||
| 2581 | Ga0395900_0006757 | |||
| 2582 | Ga0395900_0015450 | |||
| 2583 | Ga0395900_0137229 | |||
| 2584 | Ga0395900_0298834 | |||
| 2585 | Ga0395900_0860627 | |||
| 2586 | Ga0395898_0011951 | |||
| 2587 | Ga0395898_0016369 | |||
| 2588 | Ga0395898_0052957 | |||
| 2589 | Ga0395898_0090210 | |||
| 2590 | Ga0395905_0001948 | |||
| 2591 | Ga0395905_0023265 | |||
| 2592 | Ga0395905_0312554 | |||
| 2593 | Ga0436364_0617141 | |||
| 2594 | Ga0436364_0976416 | |||
| 2595 | Ga0436364_1015631 | |||
| 2596 | Ga0436364_1444289 | |||
| 2597 | Ga0395901_0165896 | |||
| 2598 | Ga0395901_0305186 | |||
| 2599 | Ga0436365_0112616 | |||
| 2600 | Ga0436365_0469659 | |||
| 2601 | Ga0436365_0671443 | |||
| 2602 | Ga0436365_1040719 | |||
| 2603 | Ga0436365_1629119 | |||
| 2604 | Ga0436365_1908508 | |||
| 2605 | Ga0436360_0233780 | |||
| 2606 | Ga0436360_1049680 | |||
| 2607 | Ga0436361_0364288 | |||
| 2608 | Ga0436361_0750635 | |||
| 2609 | Ga0436361_1013106 | |||
| 2610 | Ga0436363_0426668 | |||
| 2611 | Ga0436363_0779766 | |||
| 2612 | Ga0436363_0977790 | |||
| 2613 | Ga0436363_1376007 | |||
| 2614 | Ga0436362_0251519 | |||
| 2615 | Ga0436362_0570020 | |||
| 2616 | Ga0436362_0987028 | |||
| 2617 | Ga0451787_220816 | |||
| 2618 | Ga0451789_0350437 | |||
| 2619 | Ga0451791_1697094 | |||
| 2620 | Ga0451795_0375601 | |||
| 2621 | Ga0451843_0148428 | |||
| 2622 | Ga0466969_0016565 | |||
| 2623 | Ga0466972_0002927 | |||
| 2624 | Ga0466972_0012390 | |||
| 2625 | Ga0466972_0126517 | |||
| 2626 | Ga0466965_0011930 | |||
| 2627 | Ga0466965_0071960 | |||
| 2628 | Ga0466965_0119356 | |||
| 2629 | Ga0466966_0022780 | |||
| 2630 | Ga0466966_0051085 | |||
| 2631 | Ga0466961_0000709 | |||
| 2632 | Ga0466961_0273462 | |||
| 2633 | Ga0466963_0087882 | |||
| 2634 | Ga0466963_0438665 | |||
| 2635 | Ga0466963_0475982 | |||
| 2636 | Ga0466964_0221722 | |||
| 2637 | Ga0466968_0056766 | |||
| 2638 | Ga0466968_0157130 | |||
| 2639 | Ga0466970_0081759 | |||
| 2640 | Ga0466957_0037744 | |||
| 2641 | Ga0466957_0094669 | |||
| 2642 | Ga0466957_0395161 | |||
| 2643 | Ga0466959_0009693 | |||
| 2644 | Ga0466959_0013890 | |||
| 2645 | Ga0466959_0147742 | |||
| 2646 | Ga0466958_0156277 | |||
| 2647 | Ga0466967_0052224 | |||
| 2648 | Ga0466967_0060911 | |||
| 2649 | Ga0466967_0068756 | |||
| 2650 | Ga0466967_0140103 | |||
| 2651 | Ga0466967_0145430 | |||
| 2652 | Ga0466967_0178275 | |||
| 2653 | Ga0495617_007858 | |||
| 2654 | Ga0495592_0017770 | |||
| 2655 | Ga0495592_0032666 | |||
| 2656 | Ga0495592_0057120 | |||
| 2657 | Ga0495592_0077436 | |||
| 2658 | Ga0495603_0002438 | |||
| 2659 | Ga0495603_0036471 | |||
| 2660 | Ga0495603_0097607 | |||
| 2661 | Ga0495603_0119907 | |||
| 2662 | Ga0495603_0156802 | |||
| 2663 | Ga0495603_0193120 | |||
| 2664 | Ga0495590_0048632 | |||
| 2665 | Ga0495629_0003619 | |||
| 2666 | Ga0495629_0008023 | |||
| 2667 | Ga0495629_0085166 | |||
| 2668 | Ga0495629_0091272 | |||
| 2669 | Ga0495629_0191718 | |||
| 2670 | Ga0495629_0676205 | |||
| 2671 | Ga0495638_0080061 | |||
| 2672 | Ga0495638_0098501 | |||
| 2673 | Ga0495638_0163579 | |||
| 2674 | Ga0495641_0002985 | |||
| 2675 | Ga0495641_0219236 | |||
| 2676 | Ga0495651_0029728 | |||
| 2677 | Ga0495651_0051549 | |||
| 2678 | Ga0495651_0216124 | |||
| 2679 | Ga0495651_0222108 | |||
| 2680 | Ga0495653_0001635 | |||
| 2681 | Ga0495653_0019937 | |||
| 2682 | Ga0495653_0193389 | |||
| 2683 | Ga0495650_0066621 | |||
| 2684 | Ga0495580_0001546 | |||
| 2685 | Ga0495580_0022982 | |||
| 2686 | Ga0495580_0075302 | |||
| 2687 | Ga0495580_0119762 | |||
| 2688 | Ga0495582_0000535 | |||
| 2689 | Ga0495582_0015124 | |||
| 2690 | Ga0495582_0236394 | |||
| 2691 | Ga0495639_0001501 | |||
| 2692 | Ga0495639_0060279 | |||
| 2693 | Ga0495639_0078492 | |||
| 2694 | Ga0495639_0225122 | |||
| 2695 | Ga0495662_0000510 | |||
| 2696 | Ga0495664_0006101 | |||
| 2697 | Ga0495664_0082524 | |||
| 2698 | Ga0495664_0152430 | |||
| 2699 | Ga0495664_0189099 | |||
| 2700 | Ga0495664_0371466 | |||
| 2701 | Ga0495664_0398054 | |||
| 2702 | Ga0495585_0059571 | |||
| 2703 | Ga0495585_0188504 | |||
| 2704 | Ga0495585_0214663 | |||
| 2705 | Ga0495594_0000467 | |||
| 2706 | Ga0495594_0037377 | |||
| 2707 | Ga0495594_0064308 | |||
| 2708 | Ga0495594_0087032 | |||
| 2709 | Ga0495594_0274512 | |||
| 2710 | Ga0495596_0067988 | |||
| 2711 | Ga0495596_0103078 | |||
| 2712 | Ga0495596_0158952 | |||
| 2713 | Ga0495583_0035839 | |||
| 2714 | Ga0495606_0000831 | |||
| 2715 | Ga0495606_0080287 | |||
| 2716 | Ga0495606_0107909 | |||
| 2717 | Ga0495606_0153961 | |||
| 2718 | Ga0495608_0018999 | |||
| 2719 | Ga0495608_0035295 | |||
| 2720 | Ga0495610_0035434 | |||
| 2721 | Ga0495616_0060651 | |||
| 2722 | Ga0495616_0081206 | |||
| 2723 | Ga0495618_0035312 | |||
| 2724 | Ga0495618_0322370 | |||
| 2725 | Ga0495618_0471414 | |||
| 2726 | Ga0495620_0048269 | |||
| 2727 | Ga0495620_0087635 | |||
| 2728 | Ga0495628_0043951 | |||
| 2729 | Ga0495628_0223081 | |||
| 2730 | Ga0495628_0297867 | |||
| 2731 | Ga0495628_0570056 | |||
| 2732 | Ga0495630_0009913 | |||
| 2733 | Ga0495631_0024014 | |||
| 2734 | Ga0495631_0106620 | |||
| 2735 | Ga0495632_0049014 | |||
| 2736 | Ga0495632_0083902 | |||
| 2737 | Ga0495632_0108892 | |||
| 2738 | Ga0495637_0142636 | |||
| 2739 | Ga0495643_0097652 | |||
| 2740 | Ga0495643_0117498 | |||
| 2741 | Ga0495644_0023987 | |||
| 2742 | Ga0495644_0070904 | |||
| 2743 | Ga0495648_0002812 | |||
| 2744 | Ga0495648_0027211 | |||
| 2745 | Ga0495666_0057156 | |||
| 2746 | Ga0495666_0142311 | |||
| 2747 | Ga0495652_0059360 | |||
| 2748 | Ga0495652_0068112 | |||
| 2749 | Ga0495652_0070098 | |||
| 2750 | Ga0495652_0165886 | |||
| 2751 | Ga0495652_0167037 | |||
| 2752 | Ga0495652_0258866 | |||
| 2753 | Ga0495654_0015350 | |||
| 2754 | Ga0495654_0112650 | |||
| 2755 | Ga0495654_0236238 | |||
| 2756 | Ga0495665_0001927 | |||
| 2757 | Ga0495665_0022232 | |||
| 2758 | Ga0495665_0139778 | |||
| 2759 | Ga0495640_0007295 | |||
| 2760 | Ga0495640_0015412 | |||
| 2761 | Ga0495640_0023272 | |||
| 2762 | Ga0495640_0064128 | |||
| 2763 | Ga0495640_0138819 | |||
| 2764 | Ga0495640_0431526 | |||
| 2765 | Ga0495586_0064230 | |||
| 2766 | Ga0495586_0125755 | |||
| 2767 | Ga0495587_0005610 | |||
| 2768 | Ga0495587_0110680 | |||
| 2769 | Ga0495598_0053475 | |||
| 2770 | Ga0495597_0123966 | |||
| 2771 | Ga0495645_0045402 | |||
| 2772 | Ga0495645_0052602 | |||
| 2773 | Ga0495645_0245387 | |||
| 2774 | Ga0495622_0008565 | |||
| 2775 | Ga0495622_0008650 | |||
| 2776 | Ga0495622_0011328 | |||
| 2777 | Ga0495622_0014834 | |||
| 2778 | Ga0495622_0055608 | |||
| 2779 | Ga0495622_0123865 | |||
| 2780 | Ga0495667_0010575 | |||
| 2781 | Ga0495667_0018500 | |||
| 2782 | Ga0495667_0025319 | |||
| 2783 | Ga0495667_0036607 | |||
| 2784 | Ga0495667_0158642 | |||
| 2785 | Ga0495667_0170067 | |||
| 2786 | Ga0495667_0299273 | |||
| 2787 | Ga0495656_0012319 | |||
| 2788 | Ga0495656_0048289 | |||
| 2789 | Ga0495668_0065348 | |||
| 2790 | Ga0495668_0115910 | |||
| 2791 | Ga0495668_0116320 | |||
| 2792 | Ga0495668_0148055 | |||
| 2793 | Ga0495634_0011829 | |||
| 2794 | Ga0495634_0013239 | |||
| 2795 | Ga0495634_0036690 | |||
| 2796 | Ga0495634_0036827 | |||
| 2797 | Ga0495634_0120863 | |||
| 2798 | Ga0495634_0457594 | |||
| 2799 | Ga0495625_0231521 | |||
| 2800 | Ga0495625_0544764 | |||
| 2801 | Ga0495635_0017402 | |||
| 2802 | Ga0495635_0052925 | |||
| 2803 | Ga0495635_0088614 | |||
| 2804 | Ga0495635_0100102 | |||
| 2805 | Ga0495635_0292186 | |||
| 2806 | Ga0495659_0047094 | |||
| 2807 | Ga0495661_0022644 | |||
| 2808 | Ga0495661_0221179 | |||
| 2809 | Ga0495588_0002722 | |||
| 2810 | Ga0495588_0045412 | |||
| 2811 | Ga0495588_0063663 | |||
| 2812 | Ga0495588_0114666 | |||
| 2813 | Ga0495588_0210595 | |||
| 2814 | Ga0495588_0309897 | |||
| 2815 | Ga0495657_0013439 | |||
| 2816 | Ga0495657_0062004 | |||
| 2817 | Ga0495657_0072896 | |||
| 2818 | Ga0495657_0099160 | |||
| 2819 | Ga0495599_0000562 | |||
| 2820 | Ga0495599_0083667 | |||
| 2821 | Ga0495599_0163328 | |||
| 2822 | Ga0495623_0028554 | |||
| 2823 | Ga0495623_0062253 | |||
| 2824 | Ga0495646_0056073 | |||
| 2825 | Ga0495647_0000600 | |||
| 2826 | Ga0495647_0052850 | |||
| 2827 | Ga0495647_0060656 | |||
| 2828 | Ga0495647_0094038 | |||
| 2829 | Ga0495658_0001083 | |||
| 2830 | Ga0495658_0058586 | |||
| 2831 | Ga0495658_0442412 | |||
| 2832 | Ga0495669_0016067 | |||
| 2833 | Ga0495669_0172151 | |||
| 2834 | Ga0495669_0299933 | |||
| 2835 | Ga0495613_0005438 | |||
| 2836 | Ga0495613_0031723 | |||
| 2837 | Ga0495613_0045965 | |||
| 2838 | Ga0495613_0094203 | |||
| 2839 | Ga0495613_0133484 | |||
| 2840 | Ga0495624_0005136 | |||
| 2841 | Ga0495624_0110305 | |||
| 2842 | Ga0495624_0174956 | |||
| 2843 | Ga0495624_0194110 | |||
| 2844 | Ga0495670_0156078 | |||
| 2845 | Ga0495671_0145537 | |||
| 2846 | Ga0495649_0333587 | |||
| 2847 | Ga0495589_0106446 | |||
| 2848 | Ga0495589_0173069 | |||
| 2849 | Ga0495589_0314973 | |||
| 2850 | Ga0495600_0016680 | |||
| 2851 | Ga0495600_0040589 | |||
| 2852 | Ga0495600_0135105 | |||
| 2853 | Ga0495600_0135335 | |||
| 2854 | Ga0495660_0125536 | |||
| 2855 | Ga0495660_0228576 | |||
| 2856 | Ga0495581_0003213 | |||
| 2857 | Ga0495581_0083551 | |||
| 2858 | Ga0495581_0094681 | |||
| 2859 | Ga0495581_0150796 | |||
| 2860 | Ga0495581_0204030 | |||
| 2861 | Ga0495581_0219225 | |||
| 2862 | Ga0495581_0306475 | |||
| 2863 | Ga0495604_0006935 | |||
| 2864 | Ga0495604_0043593 | |||
| 2865 | Ga0495604_0052890 | |||
| 2866 | Ga0495604_0081771 | |||
| 2867 | Ga0495604_0096764 | |||
| 2868 | Ga0495604_0407825 | |||
| 2869 | Ga0495636_0141303 | |||
| 2870 | Ga0495674_0010035 | |||
| 2871 | Ga0495674_0023287 | |||
| 2872 | Ga0495674_0034718 | |||
| 2873 | Ga0495674_0036341 | |||
| 2874 | Ga0495672_0056579 | |||
| 2875 | Ga0495672_0076637 | |||
| 2876 | Ga0495672_0112047 | |||
| 2877 | Ga0495676_0007949 | |||
| 2878 | Ga0495676_0030366 | |||
| 2879 | Ga0495676_0075768 | |||
| 2880 | Ga0495676_0154352 | |||
| 2881 | Ga0495680_0009468 | |||
| 2882 | Ga0495680_0108926 | |||
| 2883 | Ga0495680_0142242 | |||
| 2884 | Ga0495687_031149 | |||
| 2885 | Ga0495675_0003041 | |||
| 2886 | Ga0495675_0024619 | |||
| 2887 | Ga0495677_0109489 | |||
| 2888 | Ga0495677_0134387 | |||
| 2889 | Ga0495685_031546 | |||
| 2890 | Ga0495685_050130 | |||
| 2891 | Ga0495681_0217698 | |||
| 2892 | Ga0495684_0005455 | |||
| 2893 | Ga0495684_0008298 | |||
| 2894 | Ga0495684_0016579 | |||
| 2895 | Ga0495684_0103944 | |||
| 2896 | Ga0495686_0023297 | |||
| 2897 | Ga0495686_0117418 | |||
| 2898 | Ga0495593_0005017 | |||
| 2899 | Ga0495593_0006937 | |||
| 2900 | Ga0495593_0246952 | |||
| 2901 | Ga0495602_0014209 | |||
| 2902 | Ga0495602_0056225 | |||
| 2903 | Ga0495602_0083756 | |||
| 2904 | Ga0495614_0045529 | |||
| 2905 | Ga0495614_0116556 | |||
| 2906 | Ga0495615_0066073 | |||
| 2907 | Ga0495626_0062128 | |||
| 2908 | Ga0496100_0062747 | |||
| 2909 | Ga0496100_0089284 | |||
| 2910 | Ga0496100_0143565 | |||
| 2911 | Ga0496100_0442803 | |||
| 2912 | Ga0496100_0460513 | |||
| 2913 | Ga0496101_0008819 | |||
| 2914 | Ga0496101_0067232 | |||
| 2915 | Ga0496101_0186034 | |||
| 2916 | Ga0496101_0190630 | |||
| 2917 | Ga0496101_0247327 | |||
| 2918 | Ga0496101_0814301 | |||
| 2919 | Ga0496102_0047085 | |||
| 2920 | Ga0496102_0239155 | |||
| 2921 | Ga0496102_0287108 | |||
| 2922 | Ga0496102_0291410 | |||
| 2923 | Ga0496102_0389582 | |||
| 2924 | Ga0496102_0391795 | |||
| 2925 | Ga0496102_0527933 | |||
| 2926 | Ga0496102_0927540 | |||
| 2927 | Ga0496103_0020714 | |||
| 2928 | Ga0496103_0025116 | |||
| 2929 | Ga0496103_0043006 | |||
| 2930 | Ga0496103_0108597 | |||
| 2931 | Ga0496103_0315427 | |||
| 2932 | Ga0496104_0015949 | |||
| 2933 | Ga0496104_0060516 | |||
| 2934 | Ga0496104_0063253 | |||
| 2935 | Ga0496104_0063908 | |||
| 2936 | Ga0496104_0121670 | |||
| 2937 | Ga0496104_0454660 | |||
| 2938 | Ga0496105_0035046 | |||
| 2939 | Ga0496105_0125522 | |||
| 2940 | Ga0496105_0132833 | |||
| 2941 | Ga0496105_0144798 | |||
| 2942 | Ga0496105_0185145 | |||
| 2943 | Ga0496105_0319146 | |||
| 2944 | Ga0496105_0503361 | |||
| 2945 | Ga0496106_0001075 | |||
| 2946 | Ga0496106_0006134 | |||
| 2947 | Ga0496106_0033686 | |||
| 2948 | Ga0496106_0034614 | |||
| 2949 | Ga0496106_0078180 | |||
| 2950 | Ga0496106_0089316 | |||
| 2951 | Ga0496106_0125167 | |||
| 2952 | Ga0496106_0164580 | |||
| 2953 | Ga0496106_0233168 | |||
| 2954 | Ga0496106_0233297 | |||
| 2955 | Ga0496106_0963860 | |||
| 2956 | Ga0496107_0002790 | |||
| 2957 | Ga0496107_0016231 | |||
| 2958 | Ga0496107_0068417 | |||
| 2959 | Ga0496107_0103174 | |||
| 2960 | Ga0496107_0162297 | |||
| 2961 | Ga0496107_0168553 | |||
| 2962 | Ga0496108_0000309 | |||
| 2963 | Ga0496108_0016858 | |||
| 2964 | Ga0496108_0028705 | |||
| 2965 | Ga0496108_0051538 | |||
| 2966 | Ga0496108_0063183 | |||
| 2967 | Ga0496108_0121642 | |||
| 2968 | Ga0496108_0189426 | |||
| 2969 | Ga0496108_0604487 | |||
| 2970 | Ga0496109_0000229 | |||
| 2971 | Ga0496109_0032621 | |||
| 2972 | Ga0496109_0077882 | |||
| 2973 | Ga0496109_0170106 | |||
| 2974 | Ga0496109_0313659 | |||
| 2975 | Ga0496109_0416058 | |||
| 2976 | Ga0496109_0516448 | |||
| 2977 | Ga0496110_0006428 | |||
| 2978 | Ga0496110_0011598 | |||
| 2979 | Ga0496110_0054776 | |||
| 2980 | Ga0496110_0062128 | |||
| 2981 | Ga0496110_0074112 | |||
| 2982 | Ga0496110_0205482 | |||
| 2983 | Ga0496110_0208458 | |||
| 2984 | Ga0496110_0662554 | |||
| 2985 | Ga0496110_0772862 | |||
| 2986 | Ga0496111_0083463 | |||
| 2987 | Ga0496111_0101763 | |||
| 2988 | Ga0496112_0000018 | |||
| 2989 | Ga0496112_0004329 | |||
| 2990 | Ga0496112_0109234 | |||
| 2991 | Ga0496112_0115294 | |||
| 2992 | Ga0496112_0146630 | |||
| 2993 | Ga0496112_0149444 | |||
| 2994 | Ga0496112_0769298 | |||
| 2995 | Ga0496112_0809407 | |||
| 2996 | Ga0496112_0912388 | |||
| 2997 | Ga0496113_0033720 | |||
| 2998 | Ga0496113_0085981 | |||
| 2999 | Ga0496113_0090910 | |||
| 3000 | Ga0496113_0103971 | |||
| 3001 | Ga0496113_0119404 | |||
| 3002 | Ga0496113_0196200 | |||
| 3003 | Ga0496113_0502883 | |||
| 3004 | Ga0496114_0135739 | |||
| 3005 | Ga0496114_0144988 | |||
| 3006 | Ga0496114_0176135 | |||
| 3007 | Ga0496114_0505154 | |||
| 3008 | Ga0496114_0556609 | |||
| 3009 | Ga0496114_0623241 | |||
| 3010 | Ga0496114_0635180 | |||
| 3011 | Ga0496115_0011619 | |||
| 3012 | Ga0496115_0036077 | |||
| 3013 | Ga0496115_0042915 | |||
| 3014 | Ga0496115_0057694 | |||
| 3015 | Ga0496115_0094397 | |||
| 3016 | Ga0496115_0162644 | |||
| 3017 | Ga0496115_0243978 | |||
| 3018 | Ga0496116_0007008 | |||
| 3019 | Ga0496116_0023038 | |||
| 3020 | Ga0496116_0159763 | |||
| 3021 | Ga0496117_0019265 | |||
| 3022 | Ga0496117_0066469 | |||
| 3023 | Ga0496117_0076623 | |||
| 3024 | Ga0496117_0095389 | |||
| 3025 | Ga0496117_0195937 | |||
| 3026 | Ga0496117_0217508 | |||
| 3027 | Ga0496118_0001623 | |||
| 3028 | Ga0496118_0036906 | |||
| 3029 | Ga0496118_0040080 | |||
| 3030 | Ga0496118_0079139 | |||
| 3031 | Ga0496118_0124268 | |||
| 3032 | Ga0496118_0136255 | |||
| 3033 | Ga0496119_0020608 | |||
| 3034 | Ga0496119_0062296 | |||
| 3035 | Ga0496119_0102194 | |||
| 3036 | Ga0496119_0106419 | |||
| 3037 | Ga0496119_0106789 | |||
| 3038 | Ga0496119_0114762 | |||
| 3039 | Ga0496120_0033680 | |||
| 3040 | Ga0496120_0210876 | |||
| 3041 | Ga0496121_0000278 | |||
| 3042 | Ga0496121_0001257 | |||
| 3043 | Ga0496121_0001616 | |||
| 3044 | Ga0496121_0007162 | |||
| 3045 | Ga0496121_0015944 | |||
| 3046 | Ga0496121_0018665 | |||
| 3047 | Ga0496121_0023428 | |||
| 3048 | Ga0496121_0056238 | |||
| 3049 | Ga0496121_0079961 | |||
| 3050 | Ga0496121_0080084 | |||
| 3051 | Ga0496121_0093322 | |||
| 3052 | Ga0496121_0185204 | |||
| 3053 | Ga0496121_0190564 | |||
| 3054 | Ga0496121_0190901 | |||
| 3055 | Ga0496121_0217736 | |||
| 3056 | Ga0496121_0221531 | |||
| 3057 | Ga0496121_0228696 | |||
| 3058 | Ga0496121_0406186 | |||
| 3059 | Ga0496122_0039152 | |||
| 3060 | Ga0496122_0084029 | |||
| 3061 | Ga0496122_0097485 | |||
| 3062 | Ga0496123_0030316 | |||
| 3063 | Ga0496123_0054034 | |||
| 3064 | Ga0496123_0113666 | |||
| 3065 | Ga0496123_0244904 | |||
| 3066 | Ga0496124_0003470 | |||
| 3067 | Ga0496124_0119785 | |||
| 3068 | Ga0496124_0260355 | |||
| 3069 | Ga0496125_0000407 | |||
| 3070 | Ga0496125_0000516 | |||
| 3071 | Ga0496125_0063468 | |||
| 3072 | Ga0496125_0065510 | |||
| 3073 | Ga0496125_0198579 | |||
| 3074 | Ga0496126_0003267 | |||
| 3075 | Ga0496126_0003347 | |||
| 3076 | Ga0496126_0013009 | |||
| 3077 | Ga0496126_0022484 | |||
| 3078 | Ga0496126_0036990 | |||
| 3079 | Ga0496126_0056455 | |||
| 3080 | Ga0496126_0085105 | |||
| 3081 | Ga0496126_0095786 | |||
| 3082 | Ga0496126_0151402 | |||
| 3083 | Ga0496126_0169916 | |||
| 3084 | Ga0496126_0177574 | |||
| 3085 | Ga0496126_0186810 | |||
| 3086 | Ga0496126_0271210 | |||
| 3087 | Ga0496126_0322405 | |||
| 3088 | Ga0496126_0342420 | |||
| 3089 | Ga0496126_0355671 | |||
| 3090 | Ga0496126_0384659 | |||
| 3091 | Ga0496126_0510452 | |||
| 3092 | Ga0495678_080281 | |||
| 3093 | Ga0495682_0150731 | |||
| 3094 | Ga0501031_0006376 | |||
| 3095 | Ga0501031_0016900 | |||
| 3096 | Ga0501031_0037027 | |||
| 3097 | Ga0501031_0247488 | |||
| 3098 | Ga0501031_0327285 | |||
| 3099 | Ga0501032_0001063 | |||
| 3100 | Ga0501032_0058641 | |||
| 3101 | Ga0501032_0142644 | |||
| 3102 | Ga0501032_0160872 | |||
| 3103 | Ga0501032_0222461 | |||
| 3104 | Ga0501033_0000082 | |||
| 3105 | Ga0501033_0001708 | |||
| 3106 | Ga0501033_0035311 | |||
| 3107 | Ga0501034_0000198 | |||
| 3108 | Ga0501034_0091995 | |||
| 3109 | Ga0501034_0166246 | |||
| 3110 | Ga0501034_0489493 | |||
| 3111 | Ga0501034_0592677 | |||
| 3112 | Ga0501034_0694792 | |||
| 3113 | Ga0501036_0001033 | |||
| 3114 | Ga0501036_0021624 | |||
| 3115 | Ga0501036_0078034 | |||
| 3116 | Ga0501036_0296898 | |||
| 3117 | Ga0501036_0320776 | |||
| 3118 | Ga0501036_0403881 | |||
| 3119 | Ga0501037_0000050 | |||
| 3120 | Ga0501037_0008923 | |||
| 3121 | Ga0501037_0080378 | |||
| 3122 | Ga0501037_0415273 | |||
| 3123 | Ga0501038_0004264 | |||
| 3124 | Ga0501038_0010520 | |||
| 3125 | Ga0501038_0023661 | |||
| 3126 | Ga0501038_0035664 | |||
| 3127 | Ga0501038_0055066 | |||
| 3128 | Ga0501038_0143438 | |||
| 3129 | Ga0501038_0166075 | |||
| 3130 | Ga0501039_0000366 | |||
| 3131 | Ga0501039_0078556 | |||
| 3132 | Ga0501039_0079837 | |||
| 3133 | Ga0501039_0154373 | |||
| 3134 | Ga0501039_0156867 | |||
| 3135 | Ga0501039_0258789 | |||
| 3136 | Ga0501039_0487024 | |||
| 3137 | Ga0501041_0286756 | |||
| 3138 | Ga0501042_0061835 | |||
| 3139 | Ga0501042_0110747 | |||
| 3140 | Ga0501043_0001664 | |||
| 3141 | Ga0501043_0008468 | |||
| 3142 | Ga0501043_0028438 | |||
| 3143 | Ga0501043_0195154 | |||
| 3144 | Ga0501043_0669817 | |||
| 3145 | Ga0501046_0003642 | |||
| 3146 | Ga0501046_0005790 | |||
| 3147 | Ga0501046_0046637 | |||
| 3148 | Ga0501046_0082240 | |||
| 3149 | Ga0501047_0000131 | |||
| 3150 | Ga0501047_0006910 | |||
| 3151 | Ga0501047_0025713 | |||
| 3152 | Ga0501047_0030818 | |||
| 3153 | Ga0501047_0167451 | |||
| 3154 | Ga0501048_0000531 | |||
| 3155 | Ga0501048_0233544 | |||
| 3156 | Ga0501067_0000101 | |||
| 3157 | Ga0501067_0108255 | |||
| 3158 | Ga0501068_0000988 | |||
| 3159 | Ga0501068_0433160 | |||
| 3160 | Ga0501069_0000565 | |||
| 3161 | Ga0501070_0004413 | |||
| 3162 | Ga0501070_0013834 | |||
| 3163 | Ga0501070_0030097 | |||
| 3164 | Ga0501070_0047792 | |||
| 3165 | Ga0501070_0212624 | |||
| 3166 | Ga0501070_0227802 | |||
| 3167 | Ga0501070_0372460 | |||
| 3168 | Ga0501072_0734565 | |||
| 3169 | Ga0501073_0000230 | |||
| 3170 | Ga0501073_0158573 | |||
| 3171 | Ga0501073_0229530 | |||
| 3172 | Ga0501074_0000141 | |||
| 3173 | Ga0501074_0041688 | |||
| 3174 | Ga0501079_0069255 | |||
| 3175 | Ga0501079_0654753 | |||
| 3176 | Ga0501080_0000093 | |||
| 3177 | Ga0501080_0128172 | |||
| 3178 | Ga0501080_0369499 | |||
| 3179 | Ga0501083_0000341 | |||
| 3180 | Ga0501035_0005747 | |||
| 3181 | Ga0501035_0018523 | |||
| 3182 | Ga0501035_0050826 | |||
| 3183 | Ga0501035_0304426 | |||
| 3184 | Ga0501044_0000100 | |||
| 3185 | Ga0501044_0151247 | |||
| 3186 | Ga0501044_0208205 | |||
| 3187 | Ga0501044_0365010 | |||
| 3188 | Ga0501044_0381750 | |||
| 3189 | Ga0501044_0426579 | |||
| 3190 | Ga0501044_0594789 | |||
| 3191 | Ga0501044_0644912 | |||
| 3192 | Ga0501045_0010802 | |||
| 3193 | nmdc:mga03683_55008_c1 | |||
| 3194 | nmdc:mga03683_55598_c1 | |||
| 3195 | nmdc:mga03n38_10224_c1 | |||
| 3196 | nmdc:mga03n38_142092_c1 | |||
| 3197 | nmdc:mga03n38_191436_c1 | |||
| 3198 | nmdc:mga03n38_442925_c1 | |||
| 3199 | nmdc:mga03n38_58333_c1 | |||
| 3200 | nmdc:mga00v17_245180_c1 | |||
| 3201 | nmdc:mga00v17_26711_c1 | |||
| 3202 | nmdc:mga0yw44_122406_c1 | |||
| 3203 | nmdc:mga0yw44_137756_c1 | |||
| 3204 | nmdc:mga0yw44_234700_c1 | |||
| 3205 | nmdc:mga0yw44_270253_c1 | |||
| 3206 | nmdc:mga0yw44_28542_c1 | |||
| 3207 | nmdc:mga0yw44_39867_c1 | |||
| 3208 | nmdc:mga0yw44_458341_c1 | |||
| 3209 | nmdc:mga0k408_33226_c2 | |||
| 3210 | nmdc:mga06z11_260162_c1 | |||
| 3211 | nmdc:mga06z11_435041_c1 | |||
| 3212 | nmdc:mga06z11_97958_c1 | |||
| 3213 | nmdc:mga04h51_14508_c1 | |||
| 3214 | nmdc:mga07m45_13705_c1 | |||
| 3215 | nmdc:mga07m45_35028_c1 | |||
| 3216 | nmdc:mga08y16_384673_c1 | |||
| 3217 | nmdc:mga0n895_17771_c1 | |||
| 3218 | nmdc:mga0n895_181515_c1 | |||
| 3219 | nmdc:mga0n895_31488_c1 | |||
| 3220 | nmdc:mga0rr50_346913_c1 | |||
| 3221 | nmdc:mga0rr50_375527_c1 | |||
| 3222 | nmdc:mga08x19_486796_c1 | |||
| 3223 | nmdc:mga0a205_554655_c1 | |||
| 3224 | nmdc:mga0a205_835376_c1 | |||
| 3225 | nmdc:mga0sz30_16062_c1 | |||
| 3226 | nmdc:mga0sz30_28046_c1 | |||
| 3227 | nmdc:mga0sz30_5780_c2 | |||
| 3228 | Ga0495601_0000392 | |||
| 3229 | Ga0495601_0054488 | |||
| 3230 | Ga0495601_0215628 | |||
| 3231 | Ga0495601_0338167 | |||
| 3232 | Ga0495601_0525539 | |||
| 3233 | Ga0495612_0008868 | |||
| 3234 | Ga0495612_0153126 | |||
| 3235 | Ga0500610_0147797 | |||
| 3236 | Ga0500610_0163685 | |||
| 3237 | Ga0495655_0044956 | |||
| 3238 | Ga0495655_0127737 | |||
| 3239 | Ga0495595_0003205 | |||
| 3240 | Ga0495595_0118623 | |||
| 3241 | Ga0495619_0014255 | |||
| 3242 | Ga0495619_0014580 | |||
| 3243 | Ga0495619_0027133 | |||
| 3244 | Ga0500578_0218103 | |||
| 3245 | Ga0500643_000076 | |||
| 3246 | Ga0500643_043764 | |||
| 3247 | Ga0500644_0308840 | |||
| 3248 | Ga0500581_052772 | |||
| 3249 | Ga0500647_0018897 | |||
| 3250 | Ga0500583_0173565 | |||
| 3251 | Ga0500651_0038112 | |||
| 3252 | Ga0500651_0078589 | |||
| 3253 | Ga0500566_0000107 | |||
| 3254 | Ga0500566_0000277 | |||
| 3255 | Ga0500566_0009047 | |||
| 3256 | Ga0500566_0084678 | |||
| 3257 | Ga0500566_0219786 | |||
| 3258 | Ga0500641_0045694 | |||
| 3259 | Ga0500641_0066694 | |||
| 3260 | Ga0500650_0048502 | |||
| 3261 | Ga0500554_004326 | |||
| 3262 | Ga0500555_020273 | |||
| 3263 | Ga0500556_0000081 | |||
| 3264 | Ga0500556_0008699 | |||
| 3265 | Ga0500557_000102 | |||
| 3266 | Ga0500562_019322 | |||
| 3267 | Ga0500572_000551 | |||
| 3268 | Ga0500572_066946 | |||
| 3269 | Ga0500591_030555 | |||
| 3270 | Ga0500592_011263 | |||
| 3271 | Ga0500592_021433 | |||
| 3272 | Ga0500594_0024035 | |||
| 3273 | Ga0500594_0065760 | |||
| 3274 | Ga0500595_001181 | |||
| 3275 | Ga0500595_007372 | |||
| 3276 | Ga0500595_014778 | |||
| 3277 | Ga0500595_022824 | |||
| 3278 | Ga0500595_025522 | |||
| 3279 | Ga0500595_026407 | |||
| 3280 | Ga0500595_041399 | |||
| 3281 | Ga0500595_086467 | |||
| 3282 | Ga0500608_021321 | |||
| 3283 | Ga0500608_044035 | |||
| 3284 | Ga0500628_044666 | |||
| 3285 | Ga0500642_0000042 | |||
| 3286 | Ga0500642_0000225 | |||
| 3287 | Ga0500652_001540 | |||
| 3288 | Ga0500658_0027327 | |||
| 3289 | Ga0500658_0089989 | |||
| 3290 | Ga0500658_0140101 | |||
| 3291 | Ga0500559_0000857 | |||
| 3292 | Ga0500559_0001081 | |||
| 3293 | Ga0500559_0019840 | |||
| 3294 | Ga0500559_0028884 | |||
| 3295 | Ga0500561_0047514 | |||
| 3296 | Ga0500568_0002631 | |||
| 3297 | Ga0500568_0006224 | |||
| 3298 | Ga0500568_0026198 | |||
| 3299 | Ga0500573_0084823 | |||
| 3300 | Ga0500577_0001501 | |||
| 3301 | Ga0500577_0199001 | |||
| 3302 | Ga0500579_217814 | |||
| 3303 | Ga0500585_151812 | |||
| 3304 | Ga0500589_166450 | |||
| 3305 | Ga0500590_023202 | |||
| 3306 | Ga0500590_151556 | |||
| 3307 | Ga0500603_002896 | |||
| 3308 | Ga0500603_010161 | |||
| 3309 | Ga0500603_054382 | |||
| 3310 | Ga0500603_056077 | |||
| 3311 | Ga0500604_0005100 | |||
| 3312 | Ga0500616_0000227 | |||
| 3313 | Ga0500616_0000244 | |||
| 3314 | Ga0500616_0017169 | |||
| 3315 | Ga0500619_044245 | |||
| 3316 | Ga0500620_051856 | |||
| 3317 | Ga0500622_0002743 | |||
| 3318 | Ga0500622_0004369 | |||
| 3319 | Ga0500624_035402 | |||
| 3320 | Ga0500627_0165099 | |||
| 3321 | Ga0500627_0237262 | |||
| 3322 | Ga0500633_0047836 | |||
| 3323 | Ga0500638_000149 | |||
| 3324 | Ga0500638_036029 | |||
| 3325 | Ga0500639_093771 | |||
| 3326 | Ga0500636_0001169 | |||
| 3327 | Ga0500636_0003600 | |||
| 3328 | Ga0500636_0083689 | |||
| 3329 | Ga0500636_0100367 | |||
| 3330 | Ga0500637_0001223 | |||
| 3331 | Ga0500637_0002162 | |||
| 3332 | Ga0500637_0186371 | |||
| 3333 | Ga0500649_183161 | |||
| 3334 | Ga0500576_024107 | |||
| 3335 | Ga0500552_016468 | |||
| 3336 | Ga0500596_002382 | |||
| 3337 | Ga0500596_006512 | |||
| 3338 | Ga0500601_001128 | |||
| 3339 | Ga0500601_005258 | |||
| 3340 | Ga0501084_0003619 | |||
| 3341 | Ga0500661_005511 | |||
| 3342 | Ga0500661_009014 | |||
| 3343 | Ga0501082_0005938 | |||
| 3344 | Ga0466962_0077292 | |||
| 3345 | Ga0530510_0504883 | |||
| 3346 | 2507505402 | |||
| 3347 | 2508539291 | |||
| 3348 | 2508695614 | |||
| 3349 | 2509151963 | |||
| 3350 | 2511394505 | |||
| 3351 | 2513623970 | |||
| 3352 | 2513642143 | |||
| 3353 | 2513651384 | |||
| 3354 | 2513661433 | |||
| 3355 | 2513675005 | |||
| 3356 | 2513695245 | |||
| 3357 | 2513705567 | |||
| 3358 | 2513718191 | |||
| 3359 | 2513859430 | |||
| 3360 | 2513873396 | |||
| 3361 | 2513888621 | |||
| 3362 | 2513923129 | |||
| 3363 | 2514014725 | |||
| 3364 | 2515627601 | |||
| 3365 | 2517106331 | |||
| 3366 | 2517889002 | |||
| 3367 | 2524442480 | |||
| 3368 | 2524467023 | |||
| 3369 | 2524537430 | |||
| 3370 | 2528855063 | |||
| 3371 | 2603858332 | |||
| 3372 | 2617352106 | |||
| 3373 | 2617373577 | |||
| 3374 | 2644291052 | |||
| 3375 | 2671122599 | |||
| 3376 | 2723841770 | |||
| 3377 | 2728748477 | |||
| 3378 | 2745077523 | |||
| 3379 | 2793062183 | |||
| 3380 | 2793073692 | |||
| 3381 | 2793078354 | |||
| 3382 | 2805920744 | |||
| 3383 | 2818237807 | |||
| 3384 | 2824607315 | |||
| 3385 | 2824616879 | |||
| 3386 | 2824624409 | |||
| 3387 | 2824632778 | |||
| 3388 | 2824642050 | |||
| 3389 | 2824649494 | |||
| 3390 | 2824659699 | |||
| 3391 | 2824669406 | |||
| 3392 | 2824677372 | |||
| 3393 | 2824686313 | |||
| 3394 | 2824694108 | |||
| 3395 | 2824702718 | |||
| 3396 | 2824711440 | |||
| 3397 | 2824719379 | |||
| 3398 | 2824729884 | |||
| 3399 | 2824738921 | |||
| 3400 | 2824751649 | |||
| 3401 | 2824762546 | |||
| 3402 | 2824771880 | |||
| 3403 | 2824780787 | |||
| 3404 | 2838124649 | |||
| 3405 | 2841945340 | |||
| 3406 | 2841952125 | |||
| 3407 | 2841965462 | |||
| 3408 | 2841970487 | |||
| 3409 | 2841981735 | |||
| 3410 | 2841985016 | |||
| 3411 | 2842043374 | |||
| 3412 | 2842052636 | |||
| 3413 | 2844315493 | |||
| 3414 | 2847931202 | |||
| 3415 | 2847942291 | |||
| 3416 | 2849083161 | |||
| 3417 | 2857516405 | |||
| 3418 | 2857526569 | |||
| 3419 | 2874591677 | |||
| 3420 | 2874607933 | |||
| 3421 | 2874619107 | |||
| 3422 | 2874621250 | |||
| 3423 | 2874628656 | |||
| 3424 | 2874646162 | |||
| 3425 | 2876769592 | |||
| 3426 | 2876771778 | |||
| 3427 | 2876819122 | |||
| 3428 | 2879075631 | |||
| 3429 | 2879085541 | |||
| 3430 | 2879105888 | |||
| 3431 | 2879113359 | |||
| 3432 | 2879128440 | |||
| 3433 | 2879143582 | |||
| 3434 | 2881369272 | |||
| 3435 | 2881669949 | |||
| 3436 | 2885369381 | |||
| 3437 | 2885382790 | |||
| 3438 | 2885388544 | |||
| 3439 | 2885411832 | |||
| 3440 | 2888379452 | |||
| 3441 | 2888390549 | |||
| 3442 | 2888420174 | |||
| 3443 | 2889035349 | |||
| 3444 | 2893067185 | |||
| 3445 | 2903733446 | |||
| 3446 | 2903758962 | |||
| 3447 | 2903775477 | |||
| 3448 | 2904667795 | |||
| 3449 | 2904691054 | |||
| 3450 | 2904708458 | |||
| 3451 | 2904716376 | |||
| 3452 | 2906608582 | |||
| 3453 | 2906613628 | |||
| 3454 | 2906628553 | |||
| 3455 | 2906641628 | |||
| 3456 | 2906651392 | |||
| 3457 | 2906668156 | |||
| 3458 | 2908747600 | |||
| 3459 | 2908756448 | |||
| 3460 | 2908776050 | |||
| 3461 | 2919073612 | |||
| 3462 | 2922363162 | |||
| 3463 | 2922369438 | |||
| 3464 | 2922388534 | |||
| 3465 | 2922398125 | |||
| 3466 | 2922434063 | |||
| 3467 | 2929618733 | |||
| 3468 | 2929628582 | |||
| 3469 | 2932790914 | |||
| 3470 | 2932794191 | |||
| 3471 | 2932808214 | |||
| 3472 | 2932812033 | |||
| 3473 | 2932825516 | |||
| 3474 | 2932833630 | |||
| 3475 | 2933580557 | |||
| 3476 | 2935615571 | |||
| 3477 | 2935623156 | |||
| 3478 | 2935636093 | |||
| 3479 | 2935644231 | |||
| 3480 | 2935654500 | |||
| 3481 | 2935663380 | |||
| 3482 | 2935672187 | |||
| 3483 | 2935679291 | |||
| 3484 | 2935686533 | |||
| 3485 | 2935700316 | |||
| 3486 | 2935710264 | |||
| 3487 | 2935716221 | |||
| 3488 | 2935723655 | |||
| 3489 | 2935735210 | |||
| 3490 | 2935743999 | |||
| 3491 | 2935752499 | |||
| 3492 | 2935763367 | |||
| 3493 | 2935772910 | |||
| 3494 | 2935783299 | |||
| 3495 | 2935788102 | |||
| 3496 | 2935796322 | |||
| 3497 | 2935808255 | |||
| 3498 | 2935816132 | |||
| 3499 | 2935825628 | |||
| 3500 | 2935833525 | |||
| 3501 | 2935844478 | |||
| 3502 | 2935853392 | |||
| 3503 | 2935861404 | |||
| 3504 | 2935869523 | |||
| 3505 | 2935879852 | |||
| 3506 | 2935889215 | |||
| 3507 | 2935914993 | |||
| 3508 | 2935918841 | |||
| 3509 | 2935931442 | |||
| 3510 | 2935940039 | |||
| 3511 | 2935947614 | |||
| 3512 | 2935956385 | |||
| 3513 | 2935966767 | |||
| 3514 | 2935973179 | |||
| 3515 | 2935980571 | |||
| 3516 | 2935990074 | |||
| 3517 | 2935997925 | |||
| 3518 | 2936008810 | |||
| 3519 | 2936017461 | |||
| 3520 | 2936026038 | |||
| 3521 | 2936034880 | |||
| 3522 | 2936041137 | |||
| 3523 | 2936052862 | |||
| 3524 | 2936060282 | |||
| 3525 | 2940558412 | |||
| 3526 | 2941512603 | |||
| 3527 | 2941520559 | |||
| 3528 | 2941528573 | |||
| 3529 | 2941535388 | |||
| 3530 | 2941543349 | |||
| 3531 | 3005475224 | |||
| 3532 | 3005486723 | |||
| 3533 | 3005509029 | |||
| 3534 | 3005594085 | |||
| 3535 | 3005595184 | |||
| 3536 | 3005711130 | |||
| 3537 | 3005718428 | |||
| 3538 | 8006928174 | |||
| 3539 | 8006936056 | |||
| 3540 | 8006967590 | |||
| 3541 | 8006975820 | |||
| 3542 | 8006991059 | |||
| 3543 | 8007000390 | |||
| 3544 | 8016518047 | |||
| 3545 | 8016526278 | |||
| 3546 | 8016544556 | |||
| 3547 | 8016557523 | |||
| 3548 | 8016565879 | |||
| 3549 | 8016569604 | |||
| 3550 | 8016582215 | |||
| 3551 | 8016586240 | |||
| 3552 | 8016603477 | |||
| 3553 | 8016618321 | |||
| 3554 | 8016622969 | |||
| 3555 | 8016635477 | |||
| 3556 | 8017058598 | |||
| 3557 | 8019531172 | |||
| 3558 | 8019540380 | |||
| 3559 | 8019549973 | |||
| 3560 | 8019562600 | |||
| 3561 | 8019572678 | |||
| 3562 | 8019577061 | |||
| 3563 | 8019595133 | |||
| 3564 | 8019606613 | |||
| 3565 | 8019611901 | |||
| 3566 | 8019623115 | |||
| 3567 | 8019629983 | |||
| 3568 | 8019640623 | |||
| 3569 | 8019652331 | |||
| 3570 | 8019666823 | |||
| 3571 | 8019676581 | |||
| 3572 | 8019679410 | |||
| 3573 | 8019696102 | |||
| 3574 | 8055742582 | |||
| 3575 | 8056676095 | |||
| 3576 | 8056682896 | |||
| 3577 | 8056691099 | |||
| 3578 | 8056971440 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5swc-assembly1.cif.gz_D | the structure of the beta-carbonic anhydrase ccaa | 0.8406 | 6 | 209 |
| 5swc-assembly1.cif.gz_E | the structure of the beta-carbonic anhydrase ccaa | 0.8338 | 6 | 212 |
| 5swc-assembly1.cif.gz_D | the structure of the beta-carbonic anhydrase ccaa | 0.8218 | 6 | 209 |
| 1ekj-assembly2.cif.gz_G | the x-ray crystallographic structure of beta carbonic anhydrase from the c3 dicot pisum sativum | 0.8195 | 6 | 209 |
| 3e24-assembly1.cif.gz_A | h. influenzae beta-carbonic anhydrase, variant w39f | 0.819 | 37 | 197 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0ABE9_1_202_3.40.1050.10 | Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase | 0.8568 | 5 | 209 | 3.40.1050.10 |
| af_P0ABE9_1_202_3.40.1050.10 | Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase | 0.8491 | 5 | 209 | 3.40.1050.10 |
| 5swcF00 | Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase | 0.848 | 6 | 209 | 3.40.1050.10 |
| af_A0A1D6NHQ1_7_236_3.40.1050.10 | Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase | 0.8238 | 8 | 201 | 3.40.1050.10 |
| 4o1jB00 | Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase | 0.8225 | 6 | 200 | 3.40.1050.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3S0FDP6-F1-model_v4 | deleted | 0.9526 | 57 | 212 |
|
| AF-A0A3S0FDP6-F1-model_v4 | deleted | 0.9408 | 57 | 212 |
|
| AF-A0A440G2B3-F1-model_v4 | deleted | 0.9173 | 40 | 209 |
|
| AF-A0A3C1SQ75-F1-model_v4 | Carbonic anhydrase (EC 4.2.1.1) (Carbonate dehydratase) | 0.9149 | 33 | 211 |
GO:0004089
GO:0008270 GO:0015976 |
| AF-A0A849E693-F1-model_v4 | carbonic anhydrase (EC 4.2.1.1) | 0.9143 | 40 | 212 |
GO:0004089
GO:0008270 |