F495715

General Info

Members Datasets Scaffolds Average Seq Length
1789 775 3578 216

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0099570|Ga0501034_0099570_1951_2727
Length 258
Sequence MFRHLPPRDEFGLPLFWLASDDPGVIDGRHRTNAMTFPTQLINGYRAFLYARLRLEQGRYRELSEAGQSPEVMVIGCADSRVSPEVIFDAGPGELFVARNVASLVPPYTPDGATRAVSAALEFAVQALRVKHIVVLGHAQCGGIRAYAEQSKPLSPGDFIGRWMELLAPGADKLGGPDKFASFADYVVALEHQSVATTIDNLMTFPCVKVLVERGKLQLHGAYFGVATGQLSVRNETTGKFEPVAAEDHARLFAKPRF

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
12 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
80 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
84 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
85 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
86 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
87 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
88 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
89 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
90 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
91 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
92 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
97 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
98 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
103 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
104 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
105 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
106 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
107 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
108 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
109 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
110 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
111 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
113 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
114 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
116 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
117 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
118 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
119 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
120 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
121 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
122 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
123 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
124 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
125 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
126 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
127 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
128 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
129 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
130 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
131 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
132 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
133 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
134 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
135 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
136 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
137 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
138 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
139 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
141 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
142 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
143 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
144 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
145 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
146 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
147 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
148 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
149 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
153 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
156 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
158 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
160 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
225 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
226 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
227 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
228 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
231 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
232 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
236 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
237 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
238 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
239 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
240 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
241 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
242 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
243 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
244 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
245 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
246 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
247 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
248 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
249 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
250 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
251 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
252 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
253 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
254 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
255 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
256 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
257 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
258 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
259 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
260 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
261 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
262 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
263 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
264 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
265 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
266 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
267 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
268 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
269 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
270 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
271 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
272 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
273 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
274 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
275 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
276 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
277 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
278 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
279 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
280 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
281 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
282 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
283 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
284 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
285 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
286 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
287 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
288 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
289 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
290 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
291 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
292 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
293 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
294 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
295 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
296 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
297 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
298 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
299 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
300 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
301 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
302 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
303 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
304 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
305 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
306 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
307 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
308 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
309 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
310 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
311 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
312 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
313 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
314 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
315 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
316 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
317 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
318 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
319 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
320 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
321 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
322 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
323 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
324 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
325 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
326 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
327 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
328 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
329 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
330 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
331 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
332 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
333 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
334 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
335 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
336 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
337 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
338 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
339 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
340 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
341 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
342 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
343 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
344 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
345 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
346 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
347 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
348 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
349 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
350 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
351 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
352 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
353 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
354 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
355 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
356 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
357 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
358 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
359 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
360 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
361 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
362 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
363 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
364 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
365 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
366 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
367 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
368 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
369 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
370 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
371 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
372 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
373 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
374 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
375 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
376 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
377 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
378 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
379 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
380 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
381 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
382 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
383 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
384 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
385 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
386 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
387 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
388 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
389 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
390 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
391 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
392 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
393 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
394 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
395 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
396 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
397 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
398 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
399 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
400 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
401 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
402 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
403 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
404 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
405 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
406 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
407 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
408 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
409 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
410 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
411 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
412 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
413 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
414 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
415 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
416 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
417 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
418 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
419 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
420 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
421 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
422 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
423 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
424 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
425 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
426 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
427 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
428 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
429 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
430 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
431 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
432 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
433 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
434 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
435 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
436 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
437 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
438 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
439 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
440 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
441 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
442 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
443 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
444 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
445 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
446 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
447 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
448 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
449 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
450 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
451 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
452 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
453 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
454 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
455 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
456 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
457 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
458 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
459 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
460 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
461 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
462 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
463 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
464 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
465 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
466 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
467 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
468 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
469 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
470 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
471 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
472 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
473 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
474 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
475 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
476 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
477 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
478 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
479 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
480 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
481 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
482 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
483 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
484 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
485 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
486 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
487 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
488 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
489 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
490 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
491 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
492 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
493 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
494 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
495 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
496 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
497 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
498 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
499 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
500 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
501 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
502 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
503 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
504 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
505 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
506 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
507 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
508 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
509 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
510 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
511 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
512 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
513 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
514 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
515 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
516 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
517 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
518 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
519 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
520 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
521 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
522 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
523 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
524 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
525 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
526 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
527 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
528 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
529 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
530 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
531 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
532 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
533 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
534 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
535 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
536 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
537 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
538 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
539 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
540 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
541 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
542 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
543 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
544 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
545 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
546 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
547 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
548 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
549 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
550 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
551 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
552 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
553 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
554 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
555 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
556 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
557 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
558 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
559 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
560 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
561 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
562 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
563 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
564 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
565 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
566 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
567 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
568 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
569 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
570 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
571 2643221651 Afipia sp. Root123D2 Isolate Unclassified
572 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
573 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
574 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
575 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
576 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
577 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
578 2791355199
579 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
580 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
581 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
582 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
583 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
584 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
585 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
586 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
587 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
588 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
589 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
590 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
591 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
592 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
593 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
594 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
595 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
596 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
597 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
598 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
599 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
600 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
601 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
602 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
603 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
604 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
605 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
606 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
607 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
608 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
609 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
610 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
611 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
612 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
613 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
614 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
615 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
616 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
617 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
618 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
619 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
620 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
621 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
622 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
623 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
624 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
625 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
626 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
627 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
628 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
629 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
630 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
631 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
632 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
633 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
634 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
635 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
636 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
637 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
638 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
639 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
640 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
641 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
642 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
643 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
644 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
645 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
646 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
647 2904699407
648 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
649 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
650 2906610324
651 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
652 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
653 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
654 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
655 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
656 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
657 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
658 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
659 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
660 2922368715
661 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
662 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
663 2922425934
664 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
665 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
666 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
667 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
668 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
669 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
670 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
671 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
672 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
673 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
674 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
675 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
676 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
677 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
678 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
679 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
680 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
681 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
682 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
683 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
684 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
685 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
686 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
687 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
688 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
689 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
690 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
691 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
692 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
693 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
694 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
695 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
696 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
697 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
698 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
699 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
700 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
701 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
702 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
703 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
704 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
705 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
706 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
707 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
708 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
709 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
710 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
711 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
712 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
713 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
714 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
715 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
716 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
717 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
718 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
719 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
720 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
721 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
722 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
723 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
724 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
725 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
726 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
727 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
728 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
729 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
730 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
731 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
732 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
733 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
734 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
735 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
736 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
737 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
738 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
739 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
740 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
741 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
742 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
743 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
744 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
745 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
746 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
747 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
748 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
749 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
750 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
751 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
752 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
753 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
754 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
755 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
756 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
757 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
758 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
759 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
760 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
761 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
762 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
763 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
764 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
765 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
766 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
767 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
768 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
769 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
770 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
771 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
772 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
773 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
774 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
775 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.05
Metatranscriptomes 0.17
Isolates 12.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.9
Nodule 10.45
Rhizoplane 6.48
Rhizosphere 62.27
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0099570 3300049571 Bacteria 2901
2 RicEn_C5253 2010549000 Bacteria 2664
3 JGI24736J21556_1015157 3300001904 Bacteria 1236
4 JGI24740J21852_10005020 3300001979 Bacteria 5618
5 JGI24739J22299_10011782 3300001989 Bacteria 3222
6 JGI24737J22298_10001303 3300001990 Bacteria 8838
7 JGI24738J21930_10019553 3300002075 Bacteria 1411
8 JGI25406J46586_10000915 3300003203 Bacteria 13864
9 JGI25406J46586_10001108 3300003203 Bacteria 12622
10 JGI25153J46596_10002773 3300003215 Bacteria 9963
11 JGI25153J46596_10035478 3300003215 Bacteria 1615
12 JGI25153J46596_10042611 3300003215 Bacteria 1383
13 JGI25160J50197_1022345 3300003354 Bacteria 1856
14 JGI25161J50226_1012969 3300003374 Bacteria 980
15 JGI25404J52841_10016932 3300003659 Bacteria 1581
16 JGI25404J52841_10027307 3300003659 Bacteria 1228
17 JGI25404J52841_10029378 3300003659 Bacteria 1179
18 Ga0055524_1063574 3300003775 Bacteria 750
19 Ga0055531_10014320 3300003794 Bacteria 3577
20 Ga0065165_1003849 3300005262 Bacteria 9980
21 Ga0065712_10310656 3300005290 Bacteria 844
22 Ga0070658_10063913 3300005327 Bacteria 3001
23 Ga0070658_10087834 3300005327 Bacteria 2559
24 Ga0070658_10160418 3300005327 Bacteria 1886
25 Ga0070658_10442291 3300005327 Bacteria 1120
26 Ga0070676_10173494 3300005328 Bacteria 1397
27 Ga0070683_100003459 3300005329 Bacteria 12827
28 Ga0070683_100019475 3300005329 Bacteria 6027
29 Ga0070683_100517072 3300005329 Bacteria 1141
30 Ga0070670_100091679 3300005331 Bacteria 2613
31 Ga0068869_100256572 3300005334 Bacteria 1398
32 Ga0070666_10152374 3300005335 Bacteria 1613
33 Ga0070666_10465026 3300005335 Bacteria 915
34 Ga0070680_100070610 3300005336 Bacteria 2868
35 Ga0070680_100095019 3300005336 Bacteria 2470
36 Ga0068868_100126102 3300005338 Bacteria 2091
37 Ga0070660_100001075 3300005339 Bacteria 18360
38 Ga0070660_100237712 3300005339 Bacteria 1483
39 Ga0070689_100069435 3300005340 Bacteria 2749
40 Ga0070689_100240294 3300005340 Bacteria 1491
41 Ga0070689_100472744 3300005340 Bacteria 1070
42 Ga0070689_100708273 3300005340 Bacteria 879
43 Ga0070691_10020941 3300005341 Bacteria 3024
44 Ga0070661_100035628 3300005344 Bacteria 3614
45 Ga0070661_100098519 3300005344 Bacteria 2171
46 Ga0070661_100149531 3300005344 Bacteria 1764
47 Ga0070668_100148724 3300005347 Bacteria 1892
48 Ga0070668_100304066 3300005347 Bacteria 1338
49 Ga0070668_100316121 3300005347 Bacteria 1313
50 Ga0070668_100437999 3300005347 Bacteria 1121
51 Ga0070669_100256611 3300005353 Bacteria 1394
52 Ga0070669_100353386 3300005353 Bacteria 1193
53 Ga0070669_100511051 3300005353 Bacteria 997
54 Ga0070671_100014330 3300005355 Bacteria 6404
55 Ga0070671_100144815 3300005355 Bacteria 2005
56 Ga0070674_100392047 3300005356 Bacteria 1132
57 Ga0070674_100707807 3300005356 Bacteria 862
58 Ga0070673_100195488 3300005364 Bacteria 1739
59 Ga0070673_100394240 3300005364 Bacteria 1237
60 Ga0070659_100140179 3300005366 Bacteria 1968
61 Ga0070659_100498025 3300005366 Bacteria 1038
62 Ga0070659_100650783 3300005366 Bacteria 909
63 Ga0070667_100190323 3300005367 Bacteria 1818
64 Ga0070667_100374381 3300005367 Bacteria 1293
65 Ga0070667_100843003 3300005367 Bacteria 852
66 Ga0070709_10007523 3300005434 Bacteria 5974
67 Ga0070709_10010268 3300005434 Bacteria 5176
68 Ga0070709_10015617 3300005434 Bacteria 4324
69 Ga0070714_100006699 3300005435 Bacteria 8921
70 Ga0070714_100065772 3300005435 Bacteria 3123
71 Ga0070714_100253140 3300005435 Bacteria 1629
72 Ga0070713_100016372 3300005436 Bacteria 5574
73 Ga0070713_100019605 3300005436 Bacteria 5169
74 Ga0070713_100053638 3300005436 Bacteria 3341
75 Ga0070713_100248034 3300005436 Bacteria 1623
76 Ga0070713_100843365 3300005436 Bacteria 880
77 Ga0070710_10000802 3300005437 Bacteria 15088
78 Ga0070710_10121265 3300005437 Bacteria 1583
79 Ga0070701_10222776 3300005438 Bacteria 1126
80 Ga0070711_100017892 3300005439 Bacteria 4517
81 Ga0070711_100020415 3300005439 Bacteria 4269
82 Ga0070711_100055881 3300005439 Bacteria 2728
83 Ga0070711_100076565 3300005439 Bacteria 2372
84 Ga0070711_100137440 3300005439 Bacteria 1828
85 Ga0070711_100356657 3300005439 Bacteria 1177
86 Ga0070711_100493047 3300005439 Bacteria 1009
87 Ga0070700_100251139 3300005441 Bacteria 1269
88 Ga0070663_100066899 3300005455 Bacteria 2605
89 Ga0070663_100104953 3300005455 Bacteria 2114
90 Ga0070663_100105112 3300005455 Bacteria 2113
91 Ga0070678_100129896 3300005456 Bacteria 2000
92 Ga0070678_100172405 3300005456 Bacteria 1763
93 Ga0070678_100354954 3300005456 Bacteria 1262
94 Ga0070678_100594137 3300005456 Bacteria 987
95 Ga0070662_100037993 3300005457 Bacteria 3417
96 Ga0070662_100327014 3300005457 Bacteria 1251
97 Ga0070681_10009671 3300005458 Bacteria 9485
98 Ga0070681_10025343 3300005458 Bacteria 5966
99 Ga0070681_10195696 3300005458 Bacteria 1941
100 Ga0070681_10638533 3300005458 Bacteria 979
101 Ga0068867_100102312 3300005459 Bacteria 2189
102 Ga0068867_100144706 3300005459 Bacteria 1861
103 Ga0070685_10374239 3300005466 Bacteria 980
104 Ga0070706_100350976 3300005467 Bacteria 1375
105 Ga0070706_100774025 3300005467 Bacteria 889
106 Ga0070707_100078821 3300005468 Bacteria 3179
107 Ga0070699_100616597 3300005518 Bacteria 990
108 Ga0070679_100048159 3300005530 Bacteria 4248
109 Ga0070679_100109136 3300005530 Bacteria 2753
110 Ga0070684_100007076 3300005535 Bacteria 8722
111 Ga0070684_100046071 3300005535 Bacteria 3778
112 Ga0070697_100013361 3300005536 Bacteria 6440
113 Ga0068853_100037102 3300005539 Bacteria 4145
114 Ga0068853_100052993 3300005539 Bacteria 3494
115 Ga0068853_100526871 3300005539 Bacteria 1117
116 Ga0068853_100541794 3300005539 Bacteria 1102
117 Ga0070672_100562753 3300005543 Bacteria 991
118 Ga0070672_100746402 3300005543 Bacteria 859
119 Ga0070686_100314555 3300005544 Bacteria 1165
120 Ga0070693_100400440 3300005547 Bacteria 951
121 Ga0070665_100019646 3300005548 Bacteria 6780
122 Ga0070665_100042207 3300005548 Bacteria 4584
123 Ga0070665_100061160 3300005548 Bacteria 3775
124 Ga0070665_100094748 3300005548 Bacteria 2990
125 Ga0070665_100273433 3300005548 Bacteria 1691
126 Ga0070665_100407722 3300005548 Bacteria 1367
127 Ga0070665_100547367 3300005548 Bacteria 1169
128 Ga0070665_100607495 3300005548 Bacteria 1107
129 Ga0070704_100255708 3300005549 Bacteria 1441
130 Ga0068855_100044373 3300005563 Bacteria 5261
131 Ga0068855_100075096 3300005563 Bacteria 3925
132 Ga0068855_100082985 3300005563 Bacteria 3713
133 Ga0068855_100084323 3300005563 Bacteria 3679
134 Ga0068855_100155703 3300005563 Bacteria 2596
135 Ga0068855_100240979 3300005563 Bacteria 2021
136 Ga0068855_100386058 3300005563 Bacteria 1537
137 Ga0070664_100231974 3300005564 Bacteria 1654
138 Ga0068857_100008930 3300005577 Bacteria 8683
139 Ga0068857_100022226 3300005577 Bacteria 5580
140 Ga0068857_100064498 3300005577 Bacteria 3257
141 Ga0068857_100071907 3300005577 Bacteria 3083
142 Ga0068857_100541391 3300005577 Bacteria 1096
143 Ga0068854_100028179 3300005578 Bacteria 3878
144 Ga0068854_100147734 3300005578 Bacteria 1810
145 Ga0068854_100206859 3300005578 Bacteria 1546
146 Ga0068854_100232479 3300005578 Bacteria 1464
147 Ga0068854_100441631 3300005578 Bacteria 1085
148 Ga0068856_100013958 3300005614 Bacteria 7767
149 Ga0068856_100042359 3300005614 Bacteria 4478
150 Ga0068856_100050282 3300005614 Bacteria 4109
151 Ga0068856_100105736 3300005614 Bacteria 2808
152 Ga0068856_100328008 3300005614 Bacteria 1548
153 Ga0068856_100343963 3300005614 Bacteria 1510
154 Ga0068856_100572280 3300005614 Bacteria 1151
155 Ga0068856_100765277 3300005614 Bacteria 986
156 Ga0068856_100872328 3300005614 Bacteria 919
157 Ga0070702_100291029 3300005615 Bacteria 1126
158 Ga0068852_100017184 3300005616 Bacteria 5670
159 Ga0068852_100048394 3300005616 Bacteria 3632
160 Ga0068852_100076112 3300005616 Bacteria 2962
161 Ga0068852_100198957 3300005616 Bacteria 1895
162 Ga0068852_100445913 3300005616 Bacteria 1280
163 Ga0068852_100488403 3300005616 Bacteria 1225
164 Ga0068852_100587897 3300005616 Bacteria 1117
165 Ga0068852_100806567 3300005616 Bacteria 953
166 Ga0068859_100113514 3300005617 Bacteria 2773
167 Ga0068859_100281859 3300005617 Bacteria 1755
168 Ga0068859_100583019 3300005617 Bacteria 1212
169 Ga0068859_100776293 3300005617 Bacteria 1046
170 Ga0068864_100106658 3300005618 Bacteria 2491
171 Ga0068864_100665701 3300005618 Bacteria 1015
172 Ga0068866_10161358 3300005718 Bacteria 1307
173 Ga0068861_100089459 3300005719 Bacteria 2427
174 Ga0068861_100226997 3300005719 Bacteria 1581
175 Ga0068861_100265120 3300005719 Bacteria 1472
176 Ga0068851_10006622 3300005834 Bacteria 5301
177 Ga0068851_10026964 3300005834 Bacteria 2828
178 Ga0068870_10278445 3300005840 Bacteria 1048
179 Ga0068863_100262320 3300005841 Bacteria 1670
180 Ga0068858_100082051 3300005842 Bacteria 2996
181 Ga0068860_100000477 3300005843 Bacteria 49839
182 Ga0068860_100193755 3300005843 Bacteria 1967
183 Ga0068860_100300493 3300005843 Bacteria 1572
184 Ga0068860_100469711 3300005843 Bacteria 1253
185 Ga0068860_101113883 3300005843 Bacteria 809
186 Ga0068862_100087301 3300005844 Bacteria 2713
187 Ga0068862_100109043 3300005844 Bacteria 2428
188 Ga0068862_100138409 3300005844 Bacteria 2159
189 Ga0068862_100490597 3300005844 Bacteria 1164
190 Ga0068862_100493133 3300005844 Bacteria 1161
191 Ga0081455_10011031 3300005937 Bacteria 9101
192 Ga0081455_10023057 3300005937 Bacteria 5800
193 Ga0081455_10028111 3300005937 Bacteria 5141
194 Ga0081455_10059467 3300005937 Bacteria 3227
195 Ga0081538_10014581 3300005981 Bacteria 6145
196 Ga0081538_10018074 3300005981 Bacteria 5318
197 Ga0081540_1001247 3300005983 Bacteria 22221
198 Ga0081540_1006252 3300005983 Bacteria 8720
199 Ga0081540_1007349 3300005983 Bacteria 7874
200 Ga0081540_1011012 3300005983 Bacteria 6074
201 Ga0081540_1011793 3300005983 Bacteria 5811
202 Ga0081540_1020406 3300005983 Bacteria 3987
203 Ga0081540_1023508 3300005983 Bacteria 3602
204 Ga0081540_1090817 3300005983 Bacteria 1344
205 Ga0081540_1108981 3300005983 Bacteria 1176
206 Ga0081539_10000265 3300005985 Bacteria 120457
207 Ga0081539_10000371 3300005985 Bacteria 98455
208 Ga0081539_10012180 3300005985 Bacteria 6673
209 Ga0070717_10007759 3300006028 Bacteria 7984
210 Ga0070717_10010181 3300006028 Bacteria 7080
211 Ga0070717_10029710 3300006028 Bacteria 4388
212 Ga0070717_10588910 3300006028 Bacteria 1009
213 Ga0075365_10008765 3300006038 Bacteria 5768
214 Ga0075365_10023785 3300006038 Bacteria 3857
215 Ga0075365_10038902 3300006038 Bacteria 3094
216 Ga0075365_10061500 3300006038 Bacteria 2508
217 Ga0075365_10154659 3300006038 Bacteria 1596
218 Ga0075365_10477978 3300006038 Bacteria 880
219 Ga0075368_10015416 3300006042 Bacteria 2835
220 Ga0075368_10028027 3300006042 Bacteria 2174
221 Ga0075363_100008349 3300006048 Bacteria 4818
222 Ga0075363_100047253 3300006048 Bacteria 2285
223 Ga0075363_100196507 3300006048 Bacteria 1151
224 Ga0075363_100298469 3300006048 Bacteria 935
225 Ga0075363_100365837 3300006048 Bacteria 844
226 Ga0075364_10034975 3300006051 Bacteria 3245
227 Ga0075364_10041445 3300006051 Bacteria 2990
228 Ga0075364_10152333 3300006051 Bacteria 1558
229 Ga0075364_10509677 3300006051 Bacteria 822
230 Ga0075364_10583863 3300006051 Bacteria 764
231 Ga0070715_10000872 3300006163 Bacteria 8336
232 Ga0070715_10246234 3300006163 Bacteria 932
233 Ga0070716_100019142 3300006173 Bacteria 3575
234 Ga0070716_100051216 3300006173 Bacteria 2346
235 Ga0070716_100089432 3300006173 Bacteria 1860
236 Ga0070716_100456401 3300006173 Bacteria 933
237 Ga0070716_100535237 3300006173 Bacteria 871
238 Ga0070716_100549528 3300006173 Bacteria 861
239 Ga0070712_100012131 3300006175 Bacteria 5476
240 Ga0070712_100023475 3300006175 Bacteria 4076
241 Ga0070712_100042188 3300006175 Bacteria 3137
242 Ga0070712_100092434 3300006175 Bacteria 2219
243 Ga0070712_100094994 3300006175 Bacteria 2192
244 Ga0070712_100100219 3300006175 Bacteria 2140
245 Ga0070712_100148078 3300006175 Bacteria 1799
246 Ga0075367_10005815 3300006178 Bacteria 6174
247 Ga0075367_10016144 3300006178 Bacteria 4074
248 Ga0075367_10043731 3300006178 Bacteria 2623
249 Ga0075367_10045040 3300006178 Bacteria 2588
250 Ga0075367_10045943 3300006178 Bacteria 2564
251 Ga0075367_10192270 3300006178 Bacteria 1273
252 Ga0075369_10011258 3300006186 Bacteria 3517
253 Ga0075369_10124756 3300006186 Bacteria 1167
254 Ga0075369_10205780 3300006186 Bacteria 909
255 Ga0075366_10050660 3300006195 Bacteria 2466
256 Ga0075366_10097799 3300006195 Bacteria 1760
257 Ga0097621_100573771 3300006237 Bacteria 1029
258 Ga0075370_10182744 3300006353 Bacteria 1234
259 Ga0075370_10184224 3300006353 Bacteria 1229
260 Ga0075370_10286595 3300006353 Bacteria 978
261 Ga0075370_10349089 3300006353 Bacteria 884
262 Ga0068871_100121609 3300006358 Bacteria 2205
263 Ga0068871_100488421 3300006358 Bacteria 1108
264 Ga0075428_100167202 3300006844 Bacteria 2385
265 Ga0075433_10246735 3300006852 Bacteria 1585
266 Ga0075433_10538565 3300006852 Bacteria 1027
267 Ga0075434_100098208 3300006871 Bacteria 2933
268 Ga0075434_100159055 3300006871 Bacteria 2279
269 Ga0068865_100134104 3300006881 Bacteria 1858
270 Ga0068865_100207434 3300006881 Bacteria 1525
271 Ga0075436_100200900 3300006914 Bacteria 1412
272 Ga0075436_100615442 3300006914 Bacteria 801
273 Ga0097620_100113524 3300006931 Bacteria 2773
274 Ga0097620_100281862 3300006931 Bacteria 1755
275 Ga0097620_100582996 3300006931 Bacteria 1212
276 Ga0097620_100776279 3300006931 Bacteria 1046
277 Ga0099825_1014654 3300006941 Bacteria 7264
278 Ga0099825_1034410 3300006941 Bacteria 1886
279 Ga0099824_1009377 3300006942 Bacteria 12072
280 Ga0099822_1000918 3300006943 Bacteria 31646
281 Ga0099823_1092027 3300006944 Bacteria 1020
282 Ga0075435_100317550 3300007076 Bacteria 1333
283 Ga0099795_10003456 3300007788 Bacteria 3911
284 Ga0099795_10089479 3300007788 Bacteria 1191
285 Ga0099795_10139209 3300007788 Bacteria 986
286 Ga0105244_10247152 3300009036 Bacteria 832
287 Ga0105250_10086965 3300009092 Bacteria 1269
288 Ga0105240_10014175 3300009093 Bacteria 10888
289 Ga0105240_10015716 3300009093 Bacteria 10272
290 Ga0105240_10067208 3300009093 Bacteria 4443
291 Ga0105240_10078467 3300009093 Bacteria 4066
292 Ga0105240_10159656 3300009093 Bacteria 2679
293 Ga0105240_10258968 3300009093 Bacteria 2008
294 Ga0105240_10406693 3300009093 Bacteria 1532
295 Ga0105240_10655452 3300009093 Bacteria 1150
296 Ga0111539_10103107 3300009094 Bacteria 3348
297 Ga0111539_10466201 3300009094 Bacteria 1471
298 Ga0105245_10091504 3300009098 Bacteria 2800
299 Ga0105245_10259834 3300009098 Bacteria 1690
300 Ga0105245_10355126 3300009098 Bacteria 1453
301 Ga0105247_10026096 3300009101 Bacteria 3527
302 Ga0105247_10033576 3300009101 Bacteria 3121
303 Ga0105247_10046601 3300009101 Bacteria 2661
304 Ga0105247_10059759 3300009101 Bacteria 2361
305 Ga0105247_10222365 3300009101 Bacteria 1278
306 Ga0105247_10256530 3300009101 Bacteria 1197
307 Ga0105247_10377197 3300009101 Bacteria 1004
308 Ga0114129_10094360 3300009147 Bacteria 4144
309 Ga0105243_10022131 3300009148 Bacteria 4831
310 Ga0105243_10148449 3300009148 Bacteria 2009
311 Ga0105243_10635806 3300009148 Bacteria 1032
312 Ga0105241_10000249 3300009174 Bacteria 40643
313 Ga0105241_10045364 3300009174 Bacteria 3335
314 Ga0105241_10082928 3300009174 Bacteria 2514
315 Ga0105241_10120371 3300009174 Bacteria 2113
316 Ga0105241_10184541 3300009174 Bacteria 1733
317 Ga0105241_10285018 3300009174 Bacteria 1412
318 Ga0105241_10587520 3300009174 Bacteria 1004
319 Ga0105241_10681981 3300009174 Bacteria 936
320 Ga0105242_10486081 3300009176 Bacteria 1171
321 Ga0105248_10075762 3300009177 Bacteria 3781
322 Ga0105248_10185622 3300009177 Bacteria 2343
323 Ga0105248_10372892 3300009177 Bacteria 1607
324 Ga0105237_10010653 3300009545 Bacteria 9769
325 Ga0105237_10014068 3300009545 Bacteria 8372
326 Ga0105237_10031484 3300009545 Bacteria 5378
327 Ga0105237_10090906 3300009545 Bacteria 3042
328 Ga0105237_10133438 3300009545 Bacteria 2478
329 Ga0105237_10148701 3300009545 Bacteria 2338
330 Ga0105237_10225036 3300009545 Bacteria 1876
331 Ga0105237_10264422 3300009545 Bacteria 1723
332 Ga0105237_10342475 3300009545 Bacteria 1499
333 Ga0105237_10410021 3300009545 Bacteria 1360
334 Ga0105237_10616920 3300009545 Bacteria 1091
335 Ga0105237_10897912 3300009545 Bacteria 893
336 Ga0105238_10012601 3300009551 Bacteria 8535
337 Ga0105238_10013147 3300009551 Bacteria 8352
338 Ga0105238_10045519 3300009551 Bacteria 4432
339 Ga0105238_10122350 3300009551 Bacteria 2581
340 Ga0105238_10134900 3300009551 Bacteria 2446
341 Ga0105238_10375515 3300009551 Bacteria 1412
342 Ga0105238_10863820 3300009551 Bacteria 922
343 Ga0105238_10873018 3300009551 Bacteria 917
344 Ga0099796_10006620 3300010159 Bacteria 2979
345 Ga0105239_10012784 3300010375 Bacteria 9339
346 Ga0105239_10014648 3300010375 Bacteria 8695
347 Ga0105239_10043484 3300010375 Bacteria 4924
348 Ga0105239_10252509 3300010375 Bacteria 1981
349 Ga0105239_10275967 3300010375 Bacteria 1891
350 Ga0105239_10403086 3300010375 Bacteria 1548
351 Ga0105239_10705601 3300010375 Bacteria 1154
352 Ga0105246_10030977 3300011119 Bacteria 3537
353 Ga0105246_10683328 3300011119 Bacteria 897
354 Ga0105246_10823378 3300011119 Bacteria 826
355 Ga0157326_1017363 3300012513 Bacteria 860
356 Ga0157371_10098485 3300013102 Bacteria 2073
357 Ga0157370_10115412 3300013104 Bacteria 2508
358 Ga0157370_10217796 3300013104 Bacteria 1769
359 Ga0157369_10004221 3300013105 Bacteria 17017
360 Ga0157369_10032586 3300013105 Bacteria 5729
361 Ga0157369_10072902 3300013105 Bacteria 3684
362 Ga0157369_10352990 3300013105 Bacteria 1527
363 Ga0157369_10916204 3300013105 Bacteria 899
364 Ga0157378_10209003 3300013297 Bacteria 1850
365 Ga0163162_10080261 3300013306 Bacteria 3330
366 Ga0163162_10323885 3300013306 Bacteria 1673
367 Ga0163162_10499188 3300013306 Bacteria 1347
368 Ga0157372_10317616 3300013307 Bacteria 1813
369 Ga0157372_10651143 3300013307 Bacteria 1227
370 Ga0157372_10751246 3300013307 Bacteria 1134
371 Ga0157372_10931895 3300013307 Bacteria 1007
372 Ga0157375_10050169 3300013308 Bacteria 4093
373 Ga0157375_10055933 3300013308 Bacteria 3892
374 Ga0157375_10317851 3300013308 Bacteria 1721
375 Ga0157375_10353089 3300013308 Bacteria 1636
376 Ga0157375_10729935 3300013308 Bacteria 1143
377 Ga0157375_10875242 3300013308 Bacteria 1043
378 Ga0157375_11631355 3300013308 Bacteria 763
379 Ga0163163_10024457 3300014325 Bacteria 5749
380 Ga0163163_10062893 3300014325 Bacteria 3679
381 Ga0163163_10084364 3300014325 Bacteria 3183
382 Ga0163163_10098316 3300014325 Bacteria 2948
383 Ga0163163_10983136 3300014325 Bacteria 907
384 Ga0157380_10122416 3300014326 Bacteria 2206
385 Ga0157380_10489307 3300014326 Bacteria 1192
386 Ga0157380_10681912 3300014326 Bacteria 1030
387 Ga0157380_10921319 3300014326 Bacteria 901
388 Ga0182008_10081970 3300014497 Bacteria 1588
389 Ga0182008_10196222 3300014497 Bacteria 1026
390 Ga0157377_10417280 3300014745 Bacteria 918
391 Ga0157377_10597971 3300014745 Bacteria 786
392 Ga0157379_10111718 3300014968 Bacteria 2455
393 Ga0157379_10299945 3300014968 Bacteria 1464
394 Ga0157379_10422882 3300014968 Bacteria 1227
395 Ga0157376_10068910 3300014969 Bacteria 2997
396 Ga0157376_10449819 3300014969 Bacteria 1256
397 Ga0157376_10581389 3300014969 Bacteria 1112
398 Ga0157376_11025595 3300014969 Bacteria 848
399 Ga0163161_10042345 3300017792 Bacteria 3275
400 Ga0206350_10581160 3300020080 Bacteria 1434
401 Ga0214544_1000056 3300021320 Bacteria 132760
402 Ga0214544_1023817 3300021320 Bacteria 3325
403 Ga0214542_1000071 3300021321 Bacteria 124568
404 Ga0214545_1000033 3300021324 Bacteria 124568
405 Ga0214543_1000105 3300021327 Bacteria 108404
406 Ga0214543_1025733 3300021327 Bacteria 3324
407 Ga0213872_10133386 3300021361 Bacteria 1093
408 Ga0213876_10011834 3300021384 Bacteria 4651
409 Ga0213876_10074857 3300021384 Bacteria 1789
410 Ga0213876_10351938 3300021384 Bacteria 783
411 Ga0213875_10078334 3300021388 Bacteria 1542
412 Ga0213871_10008728 3300021441 Bacteria 2247
413 Ga0224712_10026527 3300022467 Bacteria 2049
414 Ga0224712_10116748 3300022467 Bacteria 1151
415 Ga0209563_108510 3300025230 Bacteria 1612
416 Ga0209677_100170 3300025253 Bacteria 55896
417 Ga0209677_102931 3300025253 Bacteria 5964
418 Ga0209148_1000295 3300025254 Bacteria 73660
419 Ga0209233_1017816 3300025261 Bacteria 1925
420 Ga0209233_1029177 3300025261 Bacteria 1315
421 Ga0209233_1029207 3300025261 Bacteria 1314
422 Ga0209455_1001656 3300025272 Bacteria 9651
423 Ga0209455_1004571 3300025272 Bacteria 4489
424 Ga0209455_1008507 3300025272 Bacteria 2784
425 Ga0209673_1052348 3300025273 Bacteria 1072
426 Ga0209025_1068889 3300025294 Bacteria 1268
427 Ga0209564_1006432 3300025295 Bacteria 6337
428 Ga0209564_1012927 3300025295 Bacteria 3593
429 Ga0209758_1000069 3300025297 Bacteria 286161
430 Ga0209758_1000253 3300025297 Bacteria 107937
431 Ga0209758_1000397 3300025297 Bacteria 75408
432 Ga0209758_1001436 3300025297 Bacteria 28156
433 Ga0209758_1013802 3300025297 Bacteria 4366
434 Ga0209758_1017963 3300025297 Bacteria 3492
435 Ga0209758_1021734 3300025297 Bacteria 2978
436 Ga0209758_1046585 3300025297 Bacteria 1561
437 Ga0209256_1020904 3300025299 Bacteria 2028
438 Ga0207426_1001927 3300025302 Bacteria 14934
439 Ga0207426_1035148 3300025302 Bacteria 1601
440 Ga0209257_1005744 3300025304 Bacteria 8484
441 Ga0207697_10040913 3300025315 Bacteria 1903
442 Ga0207697_10069070 3300025315 Bacteria 1478
443 Ga0207656_10004553 3300025321 Bacteria 4851
444 Ga0207656_10066142 3300025321 Bacteria 1597
445 Ga0207656_10090068 3300025321 Bacteria 1391
446 Ga0207656_10190896 3300025321 Bacteria 986
447 Ga0207653_10025862 3300025885 Bacteria 1879
448 Ga0207682_10140169 3300025893 Bacteria 1085
449 Ga0207692_10027705 3300025898 Bacteria 2672
450 Ga0207692_10048558 3300025898 Bacteria 2137
451 Ga0207710_10093199 3300025900 Bacteria 1413
452 Ga0207710_10185266 3300025900 Bacteria 1023
453 Ga0207710_10289226 3300025900 Bacteria 826
454 Ga0207688_10071971 3300025901 Bacteria 1964
455 Ga0207688_10076837 3300025901 Bacteria 1902
456 Ga0207688_10082681 3300025901 Bacteria 1835
457 Ga0207688_10097379 3300025901 Bacteria 1695
458 Ga0207680_10095610 3300025903 Bacteria 1899
459 Ga0207680_10277501 3300025903 Bacteria 1164
460 Ga0207680_10579454 3300025903 Bacteria 802
461 Ga0207647_10003295 3300025904 Bacteria 12129
462 Ga0207647_10016684 3300025904 Bacteria 5006
463 Ga0207685_10000480 3300025905 Bacteria 6752
464 Ga0207699_10005583 3300025906 Bacteria 6034
465 Ga0207699_10150422 3300025906 Bacteria 1540
466 Ga0207699_10225105 3300025906 Bacteria 1282
467 Ga0207699_10405283 3300025906 Bacteria 972
468 Ga0207645_10225378 3300025907 Bacteria 1236
469 Ga0207705_10412280 3300025909 Bacteria 1045
470 Ga0207705_10430754 3300025909 Bacteria 1022
471 Ga0207684_10649857 3300025910 Bacteria 899
472 Ga0207654_10000083 3300025911 Bacteria 62205
473 Ga0207654_10029560 3300025911 Bacteria 3002
474 Ga0207654_10097456 3300025911 Bacteria 1806
475 Ga0207654_10128503 3300025911 Bacteria 1601
476 Ga0207654_10255148 3300025911 Bacteria 1177
477 Ga0207707_10000445 3300025912 Bacteria 42982
478 Ga0207707_10001947 3300025912 Bacteria 18789
479 Ga0207707_10004159 3300025912 Bacteria 12822
480 Ga0207707_10046091 3300025912 Bacteria 3796
481 Ga0207707_10105824 3300025912 Bacteria 2459
482 Ga0207695_10000148 3300025913 Bacteria 208344
483 Ga0207695_10000387 3300025913 Bacteria 99734
484 Ga0207695_10033885 3300025913 Bacteria 5560
485 Ga0207695_10322626 3300025913 Bacteria 1434
486 Ga0207695_10854830 3300025913 Bacteria 790
487 Ga0207671_10011727 3300025914 Bacteria 7101
488 Ga0207671_10022076 3300025914 Bacteria 4818
489 Ga0207671_10092220 3300025914 Bacteria 2284
490 Ga0207671_10110957 3300025914 Bacteria 2087
491 Ga0207671_10599549 3300025914 Bacteria 878
492 Ga0207671_10709443 3300025914 Bacteria 800
493 Ga0207693_10003401 3300025915 Bacteria 13595
494 Ga0207693_10020364 3300025915 Bacteria 5277
495 Ga0207693_10033227 3300025915 Bacteria 4071
496 Ga0207693_10040625 3300025915 Bacteria 3663
497 Ga0207693_10560558 3300025915 Bacteria 891
498 Ga0207693_10647952 3300025915 Bacteria 821
499 Ga0207663_10000246 3300025916 Bacteria 23915
500 Ga0207663_10015460 3300025916 Bacteria 4211
501 Ga0207663_10022999 3300025916 Bacteria 3571
502 Ga0207663_10049403 3300025916 Bacteria 2609
503 Ga0207663_10101555 3300025916 Bacteria 1933
504 Ga0207663_10178832 3300025916 Bacteria 1513
505 Ga0207663_10337414 3300025916 Bacteria 1137
506 Ga0207660_10001773 3300025917 Bacteria 14441
507 Ga0207660_10048372 3300025917 Bacteria 3009
508 Ga0207660_10098973 3300025917 Bacteria 2175
509 Ga0207660_10811179 3300025917 Bacteria 764
510 Ga0207657_10003784 3300025919 Bacteria 16083
511 Ga0207657_10147964 3300025919 Bacteria 1914
512 Ga0207657_10148515 3300025919 Bacteria 1910
513 Ga0207657_10309041 3300025919 Bacteria 1252
514 Ga0207649_10032393 3300025920 Bacteria 3116
515 Ga0207649_10108820 3300025920 Bacteria 1848
516 Ga0207652_10011651 3300025921 Bacteria 7094
517 Ga0207652_10139161 3300025921 Bacteria 2169
518 Ga0207652_10166123 3300025921 Bacteria 1979
519 Ga0207652_10228683 3300025921 Bacteria 1676
520 Ga0207681_10279713 3300025923 Bacteria 1313
521 Ga0207681_10305018 3300025923 Bacteria 1261
522 Ga0207681_10346780 3300025923 Bacteria 1188
523 Ga0207694_10000121 3300025924 Bacteria 83123
524 Ga0207694_10026270 3300025924 Bacteria 4428
525 Ga0207694_10083167 3300025924 Bacteria 2517
526 Ga0207694_10092611 3300025924 Bacteria 2386
527 Ga0207694_10100769 3300025924 Bacteria 2288
528 Ga0207650_10171033 3300025925 Bacteria 1727
529 Ga0207650_10201559 3300025925 Bacteria 1594
530 Ga0207687_10079093 3300025927 Bacteria 2370
531 Ga0207687_10155075 3300025927 Bacteria 1751
532 Ga0207687_10703327 3300025927 Bacteria 858
533 Ga0207700_10072422 3300025928 Bacteria 2657
534 Ga0207700_10251740 3300025928 Bacteria 1509
535 Ga0207664_10010393 3300025929 Bacteria 6574
536 Ga0207664_10182205 3300025929 Bacteria 1804
537 Ga0207664_10204329 3300025929 Bacteria 1707
538 Ga0207664_10547262 3300025929 Bacteria 1038
539 Ga0207644_10063880 3300025931 Bacteria 2674
540 Ga0207644_10261401 3300025931 Bacteria 1384
541 Ga0207644_10412647 3300025931 Bacteria 1105
542 Ga0207644_10839471 3300025931 Bacteria 769
543 Ga0207690_10356032 3300025932 Bacteria 1158
544 Ga0207706_10176050 3300025933 Bacteria 1879
545 Ga0207706_10241977 3300025933 Bacteria 1577
546 Ga0207686_10132978 3300025934 Bacteria 1709
547 Ga0207686_10178699 3300025934 Bacteria 1503
548 Ga0207686_10232711 3300025934 Bacteria 1337
549 Ga0207686_10452097 3300025934 Bacteria 988
550 Ga0207709_10170416 3300025935 Bacteria 1527
551 Ga0207709_10355602 3300025935 Bacteria 1107
552 Ga0207670_10129044 3300025936 Bacteria 1849
553 Ga0207670_10631456 3300025936 Bacteria 882
554 Ga0207669_10022383 3300025937 Bacteria 3356
555 Ga0207669_10077747 3300025937 Bacteria 2112
556 Ga0207704_10362022 3300025938 Bacteria 1133
557 Ga0207665_10000883 3300025939 Bacteria 20232
558 Ga0207665_10012221 3300025939 Bacteria 5639
559 Ga0207665_10022858 3300025939 Bacteria 4116
560 Ga0207665_10115534 3300025939 Bacteria 1891
561 Ga0207691_10536158 3300025940 Bacteria 993
562 Ga0207711_10053689 3300025941 Bacteria 3456
563 Ga0207711_10159713 3300025941 Bacteria 2039
564 Ga0207711_10193091 3300025941 Bacteria 1856
565 Ga0207711_10274003 3300025941 Bacteria 1553
566 Ga0207689_10027093 3300025942 Bacteria 4798
567 Ga0207689_10154733 3300025942 Bacteria 1890
568 Ga0207661_10005672 3300025944 Bacteria 8808
569 Ga0207661_10011706 3300025944 Bacteria 6367
570 Ga0207661_10030324 3300025944 Bacteria 4165
571 Ga0207679_10194024 3300025945 Bacteria 1691
572 Ga0207679_10325726 3300025945 Bacteria 1332
573 Ga0207679_10795778 3300025945 Bacteria 862
574 Ga0207667_10013785 3300025949 Bacteria 9237
575 Ga0207667_10076007 3300025949 Bacteria 3486
576 Ga0207667_10116122 3300025949 Bacteria 2758
577 Ga0207667_10186019 3300025949 Bacteria 2132
578 Ga0207667_10287329 3300025949 Bacteria 1680
579 Ga0207667_10363976 3300025949 Bacteria 1475
580 Ga0207667_10446067 3300025949 Bacteria 1315
581 Ga0207667_10569218 3300025949 Bacteria 1145
582 Ga0207651_10401057 3300025960 Bacteria 1167
583 Ga0207712_10029029 3300025961 Bacteria 3707
584 Ga0207712_10415076 3300025961 Bacteria 1134
585 Ga0207668_10166618 3300025972 Bacteria 1723
586 Ga0207668_10171153 3300025972 Bacteria 1703
587 Ga0207668_10184220 3300025972 Bacteria 1649
588 Ga0207668_10191691 3300025972 Bacteria 1620
589 Ga0207668_10691793 3300025972 Bacteria 895
590 Ga0207640_10037366 3300025981 Bacteria 3054
591 Ga0207640_10043166 3300025981 Bacteria 2880
592 Ga0207640_10127987 3300025981 Bacteria 1831
593 Ga0207640_10313514 3300025981 Bacteria 1246
594 Ga0207640_10692248 3300025981 Bacteria 873
595 Ga0207658_10201278 3300025986 Bacteria 1663
596 Ga0207658_10382859 3300025986 Bacteria 1232
597 Ga0207677_10082113 3300026023 Bacteria 2315
598 Ga0207677_10109588 3300026023 Bacteria 2053
599 Ga0207677_10650593 3300026023 Bacteria 930
600 Ga0207703_10664426 3300026035 Bacteria 989
601 Ga0207703_10711093 3300026035 Bacteria 956
602 Ga0207639_10005857 3300026041 Bacteria 8325
603 Ga0207639_10071612 3300026041 Bacteria 2712
604 Ga0207639_10071905 3300026041 Bacteria 2707
605 Ga0207639_10148092 3300026041 Bacteria 1963
606 Ga0207639_10398839 3300026041 Bacteria 1239
607 Ga0207639_11156156 3300026041 Bacteria 726
608 Ga0207678_10070411 3300026067 Bacteria 2999
609 Ga0207678_10122679 3300026067 Bacteria 2217
610 Ga0207678_10191437 3300026067 Bacteria 1748
611 Ga0207678_10289410 3300026067 Bacteria 1407
612 Ga0207708_10274520 3300026075 Bacteria 1364
613 Ga0207702_10000004 3300026078 Bacteria 422182
614 Ga0207702_10010411 3300026078 Bacteria 7783
615 Ga0207702_10119063 3300026078 Bacteria 2360
616 Ga0207702_10165491 3300026078 Bacteria 2023
617 Ga0207702_10269383 3300026078 Bacteria 1606
618 Ga0207702_10596896 3300026078 Bacteria 1083
619 Ga0207702_10671654 3300026078 Bacteria 1020
620 Ga0207702_10860770 3300026078 Bacteria 897
621 Ga0207641_10109214 3300026088 Bacteria 2450
622 Ga0207641_10921228 3300026088 Bacteria 868
623 Ga0207648_10043666 3300026089 Bacteria 3935
624 Ga0207648_10718355 3300026089 Bacteria 927
625 Ga0207676_10721106 3300026095 Bacteria 968
626 Ga0207674_10004725 3300026116 Bacteria 16330
627 Ga0207674_10005754 3300026116 Bacteria 14710
628 Ga0207674_10051030 3300026116 Bacteria 4223
629 Ga0207674_10054515 3300026116 Bacteria 4070
630 Ga0207674_10253984 3300026116 Bacteria 1705
631 Ga0207674_10570540 3300026116 Bacteria 1093
632 Ga0207675_100066332 3300026118 Bacteria 3373
633 Ga0207675_100103203 3300026118 Bacteria 2687
634 Ga0207675_100256940 3300026118 Bacteria 1692
635 Ga0207675_100320949 3300026118 Bacteria 1512
636 Ga0207675_100431583 3300026118 Bacteria 1303
637 Ga0207683_10042727 3300026121 Bacteria 3959
638 Ga0207683_10100679 3300026121 Bacteria 2580
639 Ga0207683_10216139 3300026121 Bacteria 1746
640 Ga0207683_10315563 3300026121 Bacteria 1431
641 Ga0207683_10319671 3300026121 Bacteria 1422
642 Ga0207683_10564394 3300026121 Bacteria 1053
643 Ga0207698_10020218 3300026142 Bacteria 4577
644 Ga0207698_10062251 3300026142 Bacteria 2913
645 Ga0207698_10105572 3300026142 Bacteria 2347
646 Ga0207698_10188168 3300026142 Bacteria 1836
647 Ga0207698_10214105 3300026142 Bacteria 1736
648 Ga0207698_10775302 3300026142 Bacteria 959
649 Ga0209389_1000157 3300027296 Bacteria 56696
650 Ga0209389_1002628 3300027296 Bacteria 13948
651 Ga0209589_1000035 3300027357 Bacteria 134091
652 Ga0209589_1010054 3300027357 Bacteria 13948
653 Ga0209489_100079 3300027361 Bacteria 134091
654 Ga0209489_101111 3300027361 Bacteria 54702
655 Ga0209489_108314 3300027361 Bacteria 14326
656 Ga0209700_100011 3300027363 Bacteria 362159
657 Ga0209700_100077 3300027363 Bacteria 134091
658 Ga0209179_1025672 3300027512 Bacteria 1177
659 Ga0209588_1021388 3300027671 Bacteria 2032
660 Ga0209813_10017597 3300027866 Bacteria 1964
661 Ga0207428_10116488 3300027907 Bacteria 2052
662 Ga0268266_10001236 3300028379 Bacteria 31292
663 Ga0268266_10004650 3300028379 Bacteria 13084
664 Ga0268266_10023413 3300028379 Bacteria 5260
665 Ga0268266_11101644 3300028379 Bacteria 768
666 Ga0268265_10181291 3300028380 Bacteria 1809
667 Ga0268264_10000062 3300028381 Bacteria 302110
668 Ga0265326_10042825 3300028558 Bacteria 1285
669 Ga0265319_1012209 3300028563 Bacteria 3481
670 Ga0265334_10018421 3300028573 Bacteria 2879
671 Ga0265318_10113347 3300028577 Bacteria 997
672 Ga0265323_10002052 3300028653 Bacteria 9454
673 Ga0265322_10019902 3300028654 Bacteria 1924
674 Ga0265336_10006935 3300028666 Bacteria 4057
675 Ga0307517_10000175 3300028786 Bacteria 105567
676 Ga0307517_10154848 3300028786 Bacteria 1559
677 Ga0307517_10184938 3300028786 Bacteria 1336
678 Ga0307515_10153519 3300028794 Bacteria 2392
679 Ga0307515_10256125 3300028794 Bacteria 1494
680 Ga0265338_10001066 3300028800 Bacteria 45588
681 Ga0265324_10006962 3300029957 Bacteria 4653
682 Ga0307511_10248289 3300030521 Bacteria 859
683 Ga0307512_10264446 3300030522 Bacteria 841
684 Ga0265330_10029574 3300031235 Bacteria 2463
685 Ga0265330_10041820 3300031235 Bacteria 2031
686 Ga0265332_10064907 3300031238 Bacteria 1559
687 Ga0265325_10014735 3300031241 Bacteria 4411
688 Ga0265340_10014954 3300031247 Bacteria 4041
689 Ga0265339_10012660 3300031249 Bacteria 5138
690 Ga0265331_10069792 3300031250 Bacteria 1645
691 Ga0265331_10191712 3300031250 Bacteria 922
692 Ga0307513_10333874 3300031456 Bacteria 1269
693 Ga0307509_10038191 3300031507 Bacteria 5240
694 Ga0307509_10143590 3300031507 Bacteria 2317
695 Ga0307509_10500397 3300031507 Bacteria 900
696 Ga0307408_100800975 3300031548 Bacteria 855
697 Ga0307508_10000045 3300031616 Bacteria 142824
698 Ga0307508_10139575 3300031616 Bacteria 2027
699 Ga0307508_10147259 3300031616 Bacteria 1959
700 Ga0307508_10553802 3300031616 Bacteria 748
701 Ga0265314_10005887 3300031711 Bacteria 10968
702 Ga0265314_10050484 3300031711 Bacteria 2905
703 Ga0265314_10071752 3300031711 Bacteria 2316
704 Ga0265342_10008380 3300031712 Bacteria 7418
705 Ga0265342_10288626 3300031712 Bacteria 867
706 Ga0265342_10293897 3300031712 Bacteria 857
707 Ga0307516_10016686 3300031730 Bacteria 7667
708 Ga0307516_10117042 3300031730 Bacteria 2459
709 Ga0307405_10056708 3300031731 Bacteria 2458
710 Ga0307410_10307002 3300031852 Bacteria 1254
711 Ga0307406_10269253 3300031901 Bacteria 1293
712 Ga0307407_10734445 3300031903 Bacteria 746
713 Ga0307412_10065283 3300031911 Bacteria 2463
714 Ga0307416_100145455 3300032002 Bacteria 2163
715 Ga0307416_100631037 3300032002 Bacteria 1154
716 Ga0307411_10515635 3300032005 Bacteria 1014
717 Ga0307411_10758544 3300032005 Bacteria 851
718 Ga0307415_100412418 3300032126 Bacteria 1156
719 Ga0307507_10148703 3300033179 Bacteria 1770
720 Ga0307510_10013138 3300033180 Bacteria 9823
721 Ga0307510_10014518 3300033180 Bacteria 9322
722 Ga0315911_1000008 3300033442 Bacteria 381285
723 Ga0373926_0004776 3300035083 Bacteria 4455
724 Ga0373926_0028267 3300035083 Bacteria 1968
725 Ga0373928_0038806 3300035084 Bacteria 1086
726 Ga0373934_0000780 3300035086 Bacteria 11447
727 Ga0373934_0026919 3300035086 Bacteria 2232
728 Ga0373944_0052814 3300035089 Bacteria 1285
729 Ga0373923_0008412 3300035111 Bacteria 3677
730 Ga0373923_0076584 3300035111 Bacteria 1445
731 Ga0373923_0083745 3300035111 Bacteria 1386
732 Ga0373923_0172575 3300035111 Bacteria 991
733 Ga0373936_0021610 3300035113 Bacteria 2503
734 Ga0373936_0027809 3300035113 Bacteria 2219
735 Ga0373936_0043664 3300035113 Bacteria 1802
736 Ga0373936_0076313 3300035113 Bacteria 1389
737 Ga0373945_0002845 3300035116 Bacteria 5442
738 Ga0373945_0061846 3300035116 Bacteria 1399
739 Ga0373953_0092119 3300035117 Bacteria 1268
740 Ga0373956_0001732 3300035119 Bacteria 8991
741 Ga0373956_0061422 3300035119 Bacteria 1702
742 Ga0373956_0090808 3300035119 Bacteria 1409
743 Ga0373957_0001309 3300035120 Bacteria 6685
744 Ga0373957_0012503 3300035120 Bacteria 2860
745 Ga0373957_0033998 3300035120 Bacteria 1885
746 Ga0373960_0050314 3300035121 Bacteria 1235
747 Ga0373943_0037844 3300035170 Bacteria 2317
748 Ga0373943_0037978 3300035170 Bacteria 2313
749 Ga0373943_0140321 3300035170 Bacteria 1301
750 Ga0373943_0241441 3300035170 Bacteria 1012
751 Ga0373943_0325905 3300035170 Bacteria 876
752 Ga0373946_0001716 3300035171 Bacteria 7640
753 Ga0373955_0126352 3300035172 Bacteria 1490
754 Ga0373962_0047155 3300035242 Bacteria 1232
755 Ga0373924_0005291 3300035410 Bacteria 4561
756 Ga0373924_0021215 3300035410 Bacteria 2533
757 Ga0373931_0153079 3300035691 Bacteria 1346
758 Ga0373931_0179829 3300035691 Bacteria 1252
759 Ga0373935_0001046 3300035692 Bacteria 15076
760 Ga0373935_0413110 3300035692 Bacteria 970
761 Ga0373935_0417320 3300035692 Bacteria 966
762 Ga0373927_0001064 3300035695 Bacteria 20972
763 Ga0373927_0001972 3300035695 Bacteria 15136
764 Ga0373927_0008017 3300035695 Bacteria 7129
765 Ga0373927_0010444 3300035695 Bacteria 6189
766 Ga0373927_0021518 3300035695 Bacteria 4227
767 Ga0373927_0052332 3300035695 Bacteria 2641
768 Ga0373927_0068391 3300035695 Bacteria 2298
769 Ga0373933_0000068 3300035724 Bacteria 63195
770 Ga0373933_0057503 3300035724 Bacteria 2337
771 Ga0373933_0085973 3300035724 Bacteria 1934
772 Ga0373933_0356621 3300035724 Bacteria 950
773 Ga0373933_0449094 3300035724 Bacteria 843
774 Ga0373947_0002167 3300035725 Bacteria 11925
775 Ga0373947_0019455 3300035725 Bacteria 3915
776 Ga0373947_0030529 3300035725 Bacteria 3167
777 Ga0373947_0058446 3300035725 Bacteria 2337
778 Ga0373947_0150565 3300035725 Bacteria 1498
779 Ga0373947_0151038 3300035725 Bacteria 1496
780 Ga0373947_0252253 3300035725 Bacteria 1167
781 Ga0373937_0043074 3300036401 Bacteria 4120
782 Ga0373937_0075202 3300036401 Bacteria 3117
783 Ga0373925_0005141 3300037068 Bacteria 9804
784 Ga0373925_0024532 3300037068 Bacteria 4402
785 Ga0373925_0040045 3300037068 Bacteria 3468
786 Ga0373925_0056601 3300037068 Bacteria 2937
787 Ga0373925_0105266 3300037068 Bacteria 2174
788 Ga0373925_0286126 3300037068 Bacteria 1328
789 Ga0373925_0597686 3300037068 Bacteria 909
790 Ga0373925_0783684 3300037068 Bacteria 786
791 Ga0395899_0262652 3300037312 Bacteria 1180
792 Ga0395900_0006757 3300037418 Bacteria 11904
793 Ga0395900_0015450 3300037418 Bacteria 7783
794 Ga0395900_0137229 3300037418 Bacteria 2506
795 Ga0395900_0298834 3300037418 Bacteria 1597
796 Ga0395900_0860627 3300037418 Bacteria 832
797 Ga0395898_0011951 3300037466 Bacteria 8989
798 Ga0395898_0016369 3300037466 Bacteria 7589
799 Ga0395898_0052957 3300037466 Bacteria 3964
800 Ga0395898_0090210 3300037466 Bacteria 2950
801 Ga0395905_0001948 3300037471 Bacteria 23653
802 Ga0395905_0023265 3300037471 Bacteria 5858
803 Ga0395905_0312554 3300037471 Bacteria 1460
804 Ga0436364_0617141 3300037853 Bacteria 1769
805 Ga0436364_0976416 3300037853 Bacteria 7958
806 Ga0436364_1015631 3300037853 Bacteria 1261
807 Ga0436364_1444289 3300037853 Bacteria 3251
808 Ga0395901_0165896 3300038443 Bacteria 2319
809 Ga0395901_0305186 3300038443 Bacteria 1650
810 Ga0436365_0112616 3300039437 Bacteria 4886
811 Ga0436365_0469659 3300039437 Bacteria 1474
812 Ga0436365_0671443 3300039437 Bacteria 806
813 Ga0436365_1040719 3300039437 Bacteria 1321
814 Ga0436365_1629119 3300039437 Bacteria 1772
815 Ga0436365_1908508 3300039437 Bacteria 1698
816 Ga0436360_0233780 3300039438 Bacteria 747
817 Ga0436360_1049680 3300039438 Bacteria 1204
818 Ga0436361_0364288 3300039447 Bacteria 989
819 Ga0436361_0750635 3300039447 Bacteria 2353
820 Ga0436361_1013106 3300039447 Bacteria 2298
821 Ga0436363_0426668 3300039450 Bacteria 750
822 Ga0436363_0779766 3300039450 Bacteria 2350
823 Ga0436363_0977790 3300039450 Bacteria 7072
824 Ga0436363_1376007 3300039450 Bacteria 1039
825 Ga0436362_0251519 3300039453 Bacteria 1080
826 Ga0436362_0570020 3300039453 Bacteria 1022
827 Ga0436362_0987028 3300039453 Bacteria 2211
828 Ga0451787_220816 3300041441 Bacteria 1321
829 Ga0451789_0350437 3300041443 Bacteria 1244
830 Ga0451791_1697094 3300041451 Bacteria 1060
831 Ga0451795_0375601 3300041456 Bacteria 1300
832 Ga0451843_0148428 3300041509 Bacteria 1584
833 Ga0466969_0016565 3300044656 Bacteria 3855
834 Ga0466972_0002927 3300044658 Bacteria 8463
835 Ga0466972_0012390 3300044658 Bacteria 4284
836 Ga0466972_0126517 3300044658 Bacteria 1204
837 Ga0466965_0011930 3300044683 Bacteria 4079
838 Ga0466965_0071960 3300044683 Bacteria 1740
839 Ga0466965_0119356 3300044683 Bacteria 1361
840 Ga0466966_0022780 3300044684 Bacteria 4106
841 Ga0466966_0051085 3300044684 Bacteria 2629
842 Ga0466961_0000709 3300044693 Bacteria 20961
843 Ga0466961_0273462 3300044693 Bacteria 1035
844 Ga0466963_0087882 3300044694 Bacteria 2114
845 Ga0466963_0438665 3300044694 Bacteria 921
846 Ga0466963_0475982 3300044694 Bacteria 881
847 Ga0466964_0221722 3300044706 Bacteria 919
848 Ga0466968_0056766 3300044735 Bacteria 1682
849 Ga0466968_0157130 3300044735 Bacteria 1048
850 Ga0466970_0081759 3300044765 Bacteria 1747
851 Ga0466957_0037744 3300044842 Bacteria 2909
852 Ga0466957_0094669 3300044842 Bacteria 1876
853 Ga0466957_0395161 3300044842 Bacteria 945
854 Ga0466959_0009693 3300045049 Bacteria 6858
855 Ga0466959_0013890 3300045049 Bacteria 5846
856 Ga0466959_0147742 3300045049 Bacteria 1658
857 Ga0466958_0156277 3300045836 Bacteria 1440
858 Ga0466967_0052224 3300045976 Bacteria 3587
859 Ga0466967_0060911 3300045976 Bacteria 3346
860 Ga0466967_0068756 3300045976 Bacteria 3164
861 Ga0466967_0140103 3300045976 Bacteria 2252
862 Ga0466967_0145430 3300045976 Bacteria 2211
863 Ga0466967_0178275 3300045976 Bacteria 2003
864 Ga0495617_007858 3300046452 Bacteria 3690
865 Ga0495592_0017770 3300046454 Bacteria 5405
866 Ga0495592_0032666 3300046454 Bacteria 3925
867 Ga0495592_0057120 3300046454 Bacteria 2881
868 Ga0495592_0077436 3300046454 Bacteria 2411
869 Ga0495603_0002438 3300046455 Bacteria 10936
870 Ga0495603_0036471 3300046455 Bacteria 2952
871 Ga0495603_0097607 3300046455 Bacteria 1716
872 Ga0495603_0119907 3300046455 Bacteria 1533
873 Ga0495603_0156802 3300046455 Bacteria 1321
874 Ga0495603_0193120 3300046455 Bacteria 1177
875 Ga0495590_0048632 3300046457 Bacteria 1480
876 Ga0495629_0003619 3300046459 Bacteria 11680
877 Ga0495629_0008023 3300046459 Bacteria 7770
878 Ga0495629_0085166 3300046459 Bacteria 2205
879 Ga0495629_0091272 3300046459 Bacteria 2125
880 Ga0495629_0191718 3300046459 Bacteria 1415
881 Ga0495629_0676205 3300046459 Bacteria 686
882 Ga0495638_0080061 3300046460 Bacteria 1985
883 Ga0495638_0098501 3300046460 Bacteria 1751
884 Ga0495638_0163579 3300046460 Bacteria 1282
885 Ga0495641_0002985 3300046461 Bacteria 12986
886 Ga0495641_0219236 3300046461 Bacteria 853
887 Ga0495651_0029728 3300046462 Bacteria 4260
888 Ga0495651_0051549 3300046462 Bacteria 3171
889 Ga0495651_0216124 3300046462 Bacteria 1330
890 Ga0495651_0222108 3300046462 Bacteria 1307
891 Ga0495653_0001635 3300046463 Bacteria 17593
892 Ga0495653_0019937 3300046463 Bacteria 5435
893 Ga0495653_0193389 3300046463 Bacteria 1386
894 Ga0495650_0066621 3300046471 Bacteria 1425
895 Ga0495580_0001546 3300046472 Bacteria 20242
896 Ga0495580_0022982 3300046472 Bacteria 4585
897 Ga0495580_0075302 3300046472 Bacteria 2355
898 Ga0495580_0119762 3300046472 Bacteria 1828
899 Ga0495582_0000535 3300046473 Bacteria 20995
900 Ga0495582_0015124 3300046473 Bacteria 4244
901 Ga0495582_0236394 3300046473 Bacteria 1047
902 Ga0495639_0001501 3300046475 Bacteria 10399
903 Ga0495639_0060279 3300046475 Bacteria 1738
904 Ga0495639_0078492 3300046475 Bacteria 1534
905 Ga0495639_0225122 3300046475 Bacteria 923
906 Ga0495662_0000510 3300046476 Bacteria 17683
907 Ga0495664_0006101 3300046477 Bacteria 6651
908 Ga0495664_0082524 3300046477 Bacteria 1928
909 Ga0495664_0152430 3300046477 Bacteria 1402
910 Ga0495664_0189099 3300046477 Bacteria 1248
911 Ga0495664_0371466 3300046477 Bacteria 860
912 Ga0495664_0398054 3300046477 Bacteria 827
913 Ga0495585_0059571 3300046492 Bacteria 2103
914 Ga0495585_0188504 3300046492 Bacteria 1056
915 Ga0495585_0214663 3300046492 Bacteria 973
916 Ga0495594_0000467 3300046499 Bacteria 20554
917 Ga0495594_0037377 3300046499 Bacteria 2649
918 Ga0495594_0064308 3300046499 Bacteria 2034
919 Ga0495594_0087032 3300046499 Bacteria 1748
920 Ga0495594_0274512 3300046499 Bacteria 960
921 Ga0495596_0067988 3300046500 Bacteria 1385
922 Ga0495596_0103078 3300046500 Bacteria 1108
923 Ga0495596_0158952 3300046500 Bacteria 878
924 Ga0495583_0035839 3300046506 Bacteria 2364
925 Ga0495606_0000831 3300046507 Bacteria 46699
926 Ga0495606_0080287 3300046507 Bacteria 2030
927 Ga0495606_0107909 3300046507 Bacteria 1683
928 Ga0495606_0153961 3300046507 Bacteria 1347
929 Ga0495608_0018999 3300046511 Bacteria 4736
930 Ga0495608_0035295 3300046511 Bacteria 3373
931 Ga0495610_0035434 3300046512 Bacteria 2562
932 Ga0495616_0060651 3300046513 Bacteria 1857
933 Ga0495616_0081206 3300046513 Bacteria 1551
934 Ga0495618_0035312 3300046514 Bacteria 3138
935 Ga0495618_0322370 3300046514 Bacteria 957
936 Ga0495618_0471414 3300046514 Bacteria 760
937 Ga0495620_0048269 3300046515 Bacteria 1828
938 Ga0495620_0087635 3300046515 Bacteria 1252
939 Ga0495628_0043951 3300046516 Bacteria 3556
940 Ga0495628_0223081 3300046516 Bacteria 1415
941 Ga0495628_0297867 3300046516 Bacteria 1194
942 Ga0495628_0570056 3300046516 Bacteria 811
943 Ga0495630_0009913 3300046517 Bacteria 6861
944 Ga0495631_0024014 3300046518 Bacteria 2820
945 Ga0495631_0106620 3300046518 Bacteria 1205
946 Ga0495632_0049014 3300046519 Bacteria 2089
947 Ga0495632_0083902 3300046519 Bacteria 1517
948 Ga0495632_0108892 3300046519 Bacteria 1302
949 Ga0495637_0142636 3300046520 Bacteria 908
950 Ga0495643_0097652 3300046522 Bacteria 1509
951 Ga0495643_0117498 3300046522 Bacteria 1346
952 Ga0495644_0023987 3300046523 Bacteria 2321
953 Ga0495644_0070904 3300046523 Bacteria 1309
954 Ga0495648_0002812 3300046524 Bacteria 15664
955 Ga0495648_0027211 3300046524 Bacteria 3833
956 Ga0495666_0057156 3300046526 Bacteria 1868
957 Ga0495666_0142311 3300046526 Bacteria 1117
958 Ga0495652_0059360 3300046529 Bacteria 3236
959 Ga0495652_0068112 3300046529 Bacteria 2982
960 Ga0495652_0070098 3300046529 Bacteria 2932
961 Ga0495652_0165886 3300046529 Bacteria 1709
962 Ga0495652_0167037 3300046529 Bacteria 1702
963 Ga0495652_0258866 3300046529 Bacteria 1285
964 Ga0495654_0015350 3300046530 Bacteria 4068
965 Ga0495654_0112650 3300046530 Bacteria 1240
966 Ga0495654_0236238 3300046530 Bacteria 767
967 Ga0495665_0001927 3300046531 Bacteria 11189
968 Ga0495665_0022232 3300046531 Bacteria 3409
969 Ga0495665_0139778 3300046531 Bacteria 1266
970 Ga0495640_0007295 3300046533 Bacteria 8711
971 Ga0495640_0015412 3300046533 Bacteria 5753
972 Ga0495640_0023272 3300046533 Bacteria 4517
973 Ga0495640_0064128 3300046533 Bacteria 2485
974 Ga0495640_0138819 3300046533 Bacteria 1568
975 Ga0495640_0431526 3300046533 Bacteria 806
976 Ga0495586_0064230 3300046535 Bacteria 2000
977 Ga0495586_0125755 3300046535 Bacteria 1434
978 Ga0495587_0005610 3300046536 Bacteria 8189
979 Ga0495587_0110680 3300046536 Bacteria 1578
980 Ga0495598_0053475 3300046537 Bacteria 1223
981 Ga0495597_0123966 3300046542 Bacteria 1075
982 Ga0495645_0045402 3300046543 Bacteria 3205
983 Ga0495645_0052602 3300046543 Bacteria 2962
984 Ga0495645_0245387 3300046543 Bacteria 1193
985 Ga0495622_0008565 3300046557 Bacteria 4740
986 Ga0495622_0008650 3300046557 Bacteria 4717
987 Ga0495622_0011328 3300046557 Bacteria 4118
988 Ga0495622_0014834 3300046557 Bacteria 3623
989 Ga0495622_0055608 3300046557 Bacteria 1835
990 Ga0495622_0123865 3300046557 Bacteria 1179
991 Ga0495667_0010575 3300046559 Bacteria 6244
992 Ga0495667_0018500 3300046559 Bacteria 4707
993 Ga0495667_0025319 3300046559 Bacteria 3998
994 Ga0495667_0036607 3300046559 Bacteria 3274
995 Ga0495667_0158642 3300046559 Bacteria 1455
996 Ga0495667_0170067 3300046559 Bacteria 1400
997 Ga0495667_0299273 3300046559 Bacteria 1019
998 Ga0495656_0012319 3300046615 Bacteria 3152
999 Ga0495656_0048289 3300046615 Bacteria 1808
1000 Ga0495668_0065348 3300046616 Bacteria 2002
1001 Ga0495668_0115910 3300046616 Bacteria 1465
1002 Ga0495668_0116320 3300046616 Bacteria 1462
1003 Ga0495668_0148055 3300046616 Bacteria 1285
1004 Ga0495634_0011829 3300046642 Bacteria 6346
1005 Ga0495634_0013239 3300046642 Bacteria 5964
1006 Ga0495634_0036690 3300046642 Bacteria 3351
1007 Ga0495634_0036827 3300046642 Bacteria 3344
1008 Ga0495634_0120863 3300046642 Bacteria 1677
1009 Ga0495634_0457594 3300046642 Bacteria 752
1010 Ga0495625_0231521 3300046660 Bacteria 1206
1011 Ga0495625_0544764 3300046660 Bacteria 703
1012 Ga0495635_0017402 3300046663 Bacteria 5021
1013 Ga0495635_0052925 3300046663 Bacteria 2796
1014 Ga0495635_0088614 3300046663 Bacteria 2117
1015 Ga0495635_0100102 3300046663 Bacteria 1981
1016 Ga0495635_0292186 3300046663 Bacteria 1093
1017 Ga0495659_0047094 3300046664 Bacteria 1558
1018 Ga0495661_0022644 3300046665 Bacteria 4086
1019 Ga0495661_0221179 3300046665 Bacteria 981
1020 Ga0495588_0002722 3300046674 Bacteria 7577
1021 Ga0495588_0045412 3300046674 Bacteria 2252
1022 Ga0495588_0063663 3300046674 Bacteria 1912
1023 Ga0495588_0114666 3300046674 Bacteria 1420
1024 Ga0495588_0210595 3300046674 Bacteria 1026
1025 Ga0495588_0309897 3300046674 Bacteria 831
1026 Ga0495657_0013439 3300046675 Bacteria 6042
1027 Ga0495657_0062004 3300046675 Bacteria 2472
1028 Ga0495657_0072896 3300046675 Bacteria 2238
1029 Ga0495657_0099160 3300046675 Bacteria 1858
1030 Ga0495599_0000562 3300046678 Bacteria 21198
1031 Ga0495599_0083667 3300046678 Bacteria 1993
1032 Ga0495599_0163328 3300046678 Bacteria 1376
1033 Ga0495623_0028554 3300046679 Bacteria 3588
1034 Ga0495623_0062253 3300046679 Bacteria 2339
1035 Ga0495646_0056073 3300046680 Bacteria 2363
1036 Ga0495647_0000600 3300046681 Bacteria 10656
1037 Ga0495647_0052850 3300046681 Bacteria 1583
1038 Ga0495647_0060656 3300046681 Bacteria 1492
1039 Ga0495647_0094038 3300046681 Bacteria 1233
1040 Ga0495658_0001083 3300046683 Bacteria 14340
1041 Ga0495658_0058586 3300046683 Bacteria 2203
1042 Ga0495658_0442412 3300046683 Bacteria 830
1043 Ga0495669_0016067 3300046684 Bacteria 3205
1044 Ga0495669_0172151 3300046684 Bacteria 1030
1045 Ga0495669_0299933 3300046684 Bacteria 774
1046 Ga0495613_0005438 3300046689 Bacteria 9568
1047 Ga0495613_0031723 3300046689 Bacteria 3925
1048 Ga0495613_0045965 3300046689 Bacteria 3229
1049 Ga0495613_0094203 3300046689 Bacteria 2167
1050 Ga0495613_0133484 3300046689 Bacteria 1777
1051 Ga0495624_0005136 3300046690 Bacteria 9454
1052 Ga0495624_0110305 3300046690 Bacteria 1692
1053 Ga0495624_0174956 3300046690 Bacteria 1309
1054 Ga0495624_0194110 3300046690 Bacteria 1234
1055 Ga0495670_0156078 3300046691 Bacteria 1198
1056 Ga0495671_0145537 3300046692 Bacteria 1154
1057 Ga0495649_0333587 3300046694 Bacteria 768
1058 Ga0495589_0106446 3300046794 Bacteria 1355
1059 Ga0495589_0173069 3300046794 Bacteria 1026
1060 Ga0495589_0314973 3300046794 Bacteria 724
1061 Ga0495600_0016680 3300046809 Bacteria 4666
1062 Ga0495600_0040589 3300046809 Bacteria 3031
1063 Ga0495600_0135105 3300046809 Bacteria 1602
1064 Ga0495600_0135335 3300046809 Bacteria 1601
1065 Ga0495660_0125536 3300046810 Bacteria 1293
1066 Ga0495660_0228576 3300046810 Bacteria 873
1067 Ga0495581_0003213 3300047315 Bacteria 9361
1068 Ga0495581_0083551 3300047315 Bacteria 1850
1069 Ga0495581_0094681 3300047315 Bacteria 1734
1070 Ga0495581_0150796 3300047315 Bacteria 1357
1071 Ga0495581_0204030 3300047315 Bacteria 1156
1072 Ga0495581_0219225 3300047315 Bacteria 1112
1073 Ga0495581_0306475 3300047315 Bacteria 928
1074 Ga0495604_0006935 3300047317 Bacteria 8979
1075 Ga0495604_0043593 3300047317 Bacteria 3511
1076 Ga0495604_0052890 3300047317 Bacteria 3142
1077 Ga0495604_0081771 3300047317 Bacteria 2417
1078 Ga0495604_0096764 3300047317 Bacteria 2177
1079 Ga0495604_0407825 3300047317 Bacteria 894
1080 Ga0495636_0141303 3300047318 Bacteria 1075
1081 Ga0495674_0010035 3300047319 Bacteria 8975
1082 Ga0495674_0023287 3300047319 Bacteria 5710
1083 Ga0495674_0034718 3300047319 Bacteria 4557
1084 Ga0495674_0036341 3300047319 Bacteria 4434
1085 Ga0495672_0056579 3300047320 Bacteria 2281
1086 Ga0495672_0076637 3300047320 Bacteria 1877
1087 Ga0495672_0112047 3300047320 Bacteria 1463
1088 Ga0495676_0007949 3300047321 Bacteria 9724
1089 Ga0495676_0030366 3300047321 Bacteria 4588
1090 Ga0495676_0075768 3300047321 Bacteria 2571
1091 Ga0495676_0154352 3300047321 Bacteria 1630
1092 Ga0495680_0009468 3300047322 Bacteria 8758
1093 Ga0495680_0108926 3300047322 Bacteria 2055
1094 Ga0495680_0142242 3300047322 Bacteria 1754
1095 Ga0495687_031149 3300047443 Bacteria 2449
1096 Ga0495675_0003041 3300047444 Bacteria 10085
1097 Ga0495675_0024619 3300047444 Bacteria 3838
1098 Ga0495677_0109489 3300047445 Bacteria 1049
1099 Ga0495677_0134387 3300047445 Bacteria 948
1100 Ga0495685_031546 3300047447 Bacteria 1821
1101 Ga0495685_050130 3300047447 Bacteria 1417
1102 Ga0495681_0217698 3300047470 Bacteria 767
1103 Ga0495684_0005455 3300047471 Bacteria 9899
1104 Ga0495684_0008298 3300047471 Bacteria 8046
1105 Ga0495684_0016579 3300047471 Bacteria 5675
1106 Ga0495684_0103944 3300047471 Bacteria 2147
1107 Ga0495686_0023297 3300047472 Bacteria 4086
1108 Ga0495686_0117418 3300047472 Bacteria 1589
1109 Ga0495593_0005017 3300047673 Bacteria 7832
1110 Ga0495593_0006937 3300047673 Bacteria 6634
1111 Ga0495593_0246952 3300047673 Bacteria 894
1112 Ga0495602_0014209 3300048088 Bacteria 8091
1113 Ga0495602_0056225 3300048088 Bacteria 3461
1114 Ga0495602_0083756 3300048088 Bacteria 2670
1115 Ga0495614_0045529 3300048089 Bacteria 1881
1116 Ga0495614_0116556 3300048089 Bacteria 1176
1117 Ga0495615_0066073 3300048090 Bacteria 965
1118 Ga0495626_0062128 3300048091 Bacteria 1697
1119 Ga0496100_0062747 3300048903 Bacteria 2453
1120 Ga0496100_0089284 3300048903 Bacteria 2099
1121 Ga0496100_0143565 3300048903 Bacteria 1695
1122 Ga0496100_0442803 3300048903 Bacteria 995
1123 Ga0496100_0460513 3300048903 Bacteria 976
1124 Ga0496101_0008819 3300048904 Bacteria 6598
1125 Ga0496101_0067232 3300048904 Bacteria 2616
1126 Ga0496101_0186034 3300048904 Bacteria 1601
1127 Ga0496101_0190630 3300048904 Bacteria 1582
1128 Ga0496101_0247327 3300048904 Bacteria 1389
1129 Ga0496101_0814301 3300048904 Bacteria 736
1130 Ga0496102_0047085 3300048905 Bacteria 3917
1131 Ga0496102_0239155 3300048905 Bacteria 1712
1132 Ga0496102_0287108 3300048905 Bacteria 1551
1133 Ga0496102_0291410 3300048905 Bacteria 1538
1134 Ga0496102_0389582 3300048905 Bacteria 1311
1135 Ga0496102_0391795 3300048905 Bacteria 1307
1136 Ga0496102_0527933 3300048905 Bacteria 1103
1137 Ga0496102_0927540 3300048905 Bacteria 792
1138 Ga0496103_0020714 3300048906 Bacteria 3953
1139 Ga0496103_0025116 3300048906 Bacteria 3599
1140 Ga0496103_0043006 3300048906 Bacteria 2781
1141 Ga0496103_0108597 3300048906 Bacteria 1761
1142 Ga0496103_0315427 3300048906 Bacteria 1006
1143 Ga0496104_0015949 3300048907 Bacteria 6820
1144 Ga0496104_0060516 3300048907 Bacteria 3587
1145 Ga0496104_0063253 3300048907 Bacteria 3509
1146 Ga0496104_0063908 3300048907 Bacteria 3491
1147 Ga0496104_0121670 3300048907 Bacteria 2506
1148 Ga0496104_0454660 3300048907 Bacteria 1192
1149 Ga0496105_0035046 3300048908 Bacteria 4129
1150 Ga0496105_0125522 3300048908 Bacteria 2115
1151 Ga0496105_0132833 3300048908 Bacteria 2051
1152 Ga0496105_0144798 3300048908 Bacteria 1954
1153 Ga0496105_0185145 3300048908 Bacteria 1704
1154 Ga0496105_0319146 3300048908 Bacteria 1245
1155 Ga0496105_0503361 3300048908 Bacteria 951
1156 Ga0496106_0001075 3300048909 Bacteria 20159
1157 Ga0496106_0006134 3300048909 Bacteria 8889
1158 Ga0496106_0033686 3300048909 Bacteria 3823
1159 Ga0496106_0034614 3300048909 Bacteria 3774
1160 Ga0496106_0078180 3300048909 Bacteria 2538
1161 Ga0496106_0089316 3300048909 Bacteria 2376
1162 Ga0496106_0125167 3300048909 Bacteria 2012
1163 Ga0496106_0164580 3300048909 Bacteria 1755
1164 Ga0496106_0233168 3300048909 Bacteria 1470
1165 Ga0496106_0233297 3300048909 Bacteria 1469
1166 Ga0496106_0963860 3300048909 Bacteria 672
1167 Ga0496107_0002790 3300048910 Bacteria 11524
1168 Ga0496107_0016231 3300048910 Bacteria 5227
1169 Ga0496107_0068417 3300048910 Bacteria 2577
1170 Ga0496107_0103174 3300048910 Bacteria 2092
1171 Ga0496107_0162297 3300048910 Bacteria 1656
1172 Ga0496107_0168553 3300048910 Bacteria 1624
1173 Ga0496108_0000309 3300048911 Bacteria 41957
1174 Ga0496108_0016858 3300048911 Bacteria 5971
1175 Ga0496108_0028705 3300048911 Bacteria 4603
1176 Ga0496108_0051538 3300048911 Bacteria 3448
1177 Ga0496108_0063183 3300048911 Bacteria 3118
1178 Ga0496108_0121642 3300048911 Bacteria 2239
1179 Ga0496108_0189426 3300048911 Bacteria 1783
1180 Ga0496108_0604487 3300048911 Bacteria 955
1181 Ga0496109_0000229 3300048912 Bacteria 54733
1182 Ga0496109_0032621 3300048912 Bacteria 4682
1183 Ga0496109_0077882 3300048912 Bacteria 3051
1184 Ga0496109_0170106 3300048912 Bacteria 2044
1185 Ga0496109_0313659 3300048912 Bacteria 1479
1186 Ga0496109_0416058 3300048912 Bacteria 1270
1187 Ga0496109_0516448 3300048912 Bacteria 1127
1188 Ga0496110_0006428 3300048913 Bacteria 9306
1189 Ga0496110_0011598 3300048913 Bacteria 7224
1190 Ga0496110_0054776 3300048913 Bacteria 3508
1191 Ga0496110_0062128 3300048913 Bacteria 3298
1192 Ga0496110_0074112 3300048913 Bacteria 3022
1193 Ga0496110_0205482 3300048913 Bacteria 1790
1194 Ga0496110_0208458 3300048913 Bacteria 1776
1195 Ga0496110_0662554 3300048913 Bacteria 944
1196 Ga0496110_0772862 3300048913 Bacteria 864
1197 Ga0496111_0083463 3300048914 Bacteria 2334
1198 Ga0496111_0101763 3300048914 Bacteria 2111
1199 Ga0496112_0000018 3300048915 Bacteria 188820
1200 Ga0496112_0004329 3300048915 Bacteria 12004
1201 Ga0496112_0109234 3300048915 Bacteria 2736
1202 Ga0496112_0115294 3300048915 Bacteria 2657
1203 Ga0496112_0146630 3300048915 Bacteria 2328
1204 Ga0496112_0149444 3300048915 Bacteria 2303
1205 Ga0496112_0769298 3300048915 Bacteria 888
1206 Ga0496112_0809407 3300048915 Bacteria 861
1207 Ga0496112_0912388 3300048915 Bacteria 800
1208 Ga0496113_0033720 3300048916 Bacteria 3730
1209 Ga0496113_0085981 3300048916 Bacteria 2416
1210 Ga0496113_0090910 3300048916 Bacteria 2352
1211 Ga0496113_0103971 3300048916 Bacteria 2203
1212 Ga0496113_0119404 3300048916 Bacteria 2060
1213 Ga0496113_0196200 3300048916 Bacteria 1603
1214 Ga0496113_0502883 3300048916 Bacteria 973
1215 Ga0496114_0135739 3300048917 Bacteria 2127
1216 Ga0496114_0144988 3300048917 Bacteria 2058
1217 Ga0496114_0176135 3300048917 Bacteria 1866
1218 Ga0496114_0505154 3300048917 Bacteria 1069
1219 Ga0496114_0556609 3300048917 Bacteria 1013
1220 Ga0496114_0623241 3300048917 Bacteria 950
1221 Ga0496114_0635180 3300048917 Bacteria 940
1222 Ga0496115_0011619 3300048918 Bacteria 6606
1223 Ga0496115_0036077 3300048918 Bacteria 3913
1224 Ga0496115_0042915 3300048918 Bacteria 3605
1225 Ga0496115_0057694 3300048918 Bacteria 3123
1226 Ga0496115_0094397 3300048918 Bacteria 2447
1227 Ga0496115_0162644 3300048918 Bacteria 1845
1228 Ga0496115_0243978 3300048918 Bacteria 1480
1229 Ga0496116_0007008 3300048919 Bacteria 10091
1230 Ga0496116_0023038 3300048919 Bacteria 4647
1231 Ga0496116_0159763 3300048919 Bacteria 1238
1232 Ga0496117_0019265 3300048920 Bacteria 5612
1233 Ga0496117_0066469 3300048920 Bacteria 2445
1234 Ga0496117_0076623 3300048920 Bacteria 2216
1235 Ga0496117_0095389 3300048920 Bacteria 1901
1236 Ga0496117_0195937 3300048920 Bacteria 1146
1237 Ga0496117_0217508 3300048920 Bacteria 1066
1238 Ga0496118_0001623 3300048921 Bacteria 33200
1239 Ga0496118_0036906 3300048921 Bacteria 3943
1240 Ga0496118_0040080 3300048921 Bacteria 3728
1241 Ga0496118_0079139 3300048921 Bacteria 2321
1242 Ga0496118_0124268 3300048921 Bacteria 1674
1243 Ga0496118_0136255 3300048921 Bacteria 1566
1244 Ga0496119_0020608 3300048922 Bacteria 4802
1245 Ga0496119_0062296 3300048922 Bacteria 2223
1246 Ga0496119_0102194 3300048922 Bacteria 1607
1247 Ga0496119_0106419 3300048922 Bacteria 1565
1248 Ga0496119_0106789 3300048922 Bacteria 1562
1249 Ga0496119_0114762 3300048922 Bacteria 1489
1250 Ga0496120_0033680 3300048923 Bacteria 3076
1251 Ga0496120_0210876 3300048923 Bacteria 934
1252 Ga0496121_0000278 3300048924 Bacteria 106838
1253 Ga0496121_0001257 3300048924 Bacteria 43906
1254 Ga0496121_0001616 3300048924 Bacteria 37413
1255 Ga0496121_0007162 3300048924 Bacteria 13519
1256 Ga0496121_0015944 3300048924 Bacteria 7801
1257 Ga0496121_0018665 3300048924 Bacteria 6980
1258 Ga0496121_0023428 3300048924 Bacteria 5945
1259 Ga0496121_0056238 3300048924 Bacteria 3269
1260 Ga0496121_0079961 3300048924 Bacteria 2593
1261 Ga0496121_0080084 3300048924 Bacteria 2591
1262 Ga0496121_0093322 3300048924 Bacteria 2344
1263 Ga0496121_0185204 3300048924 Bacteria 1498
1264 Ga0496121_0190564 3300048924 Bacteria 1470
1265 Ga0496121_0190901 3300048924 Bacteria 1468
1266 Ga0496121_0217736 3300048924 Bacteria 1347
1267 Ga0496121_0221531 3300048924 Bacteria 1332
1268 Ga0496121_0228696 3300048924 Bacteria 1304
1269 Ga0496121_0406186 3300048924 Bacteria 890
1270 Ga0496122_0039152 3300048925 Bacteria 3784
1271 Ga0496122_0084029 3300048925 Bacteria 2204
1272 Ga0496122_0097485 3300048925 Bacteria 1979
1273 Ga0496123_0030316 3300048926 Bacteria 3961
1274 Ga0496123_0054034 3300048926 Bacteria 2648
1275 Ga0496123_0113666 3300048926 Bacteria 1541
1276 Ga0496123_0244904 3300048926 Bacteria 888
1277 Ga0496124_0003470 3300048927 Bacteria 19250
1278 Ga0496124_0119785 3300048927 Bacteria 2105
1279 Ga0496124_0260355 3300048927 Bacteria 1277
1280 Ga0496125_0000407 3300048928 Bacteria 80570
1281 Ga0496125_0000516 3300048928 Bacteria 67232
1282 Ga0496125_0063468 3300048928 Bacteria 2945
1283 Ga0496125_0065510 3300048928 Bacteria 2878
1284 Ga0496125_0198579 3300048928 Bacteria 1316
1285 Ga0496126_0003267 3300048929 Bacteria 20694
1286 Ga0496126_0003347 3300048929 Bacteria 20346
1287 Ga0496126_0013009 3300048929 Bacteria 8491
1288 Ga0496126_0022484 3300048929 Bacteria 6134
1289 Ga0496126_0036990 3300048929 Bacteria 4560
1290 Ga0496126_0056455 3300048929 Bacteria 3549
1291 Ga0496126_0085105 3300048929 Bacteria 2788
1292 Ga0496126_0095786 3300048929 Bacteria 2603
1293 Ga0496126_0151402 3300048929 Bacteria 1988
1294 Ga0496126_0169916 3300048929 Bacteria 1858
1295 Ga0496126_0177574 3300048929 Bacteria 1810
1296 Ga0496126_0186810 3300048929 Bacteria 1757
1297 Ga0496126_0271210 3300048929 Bacteria 1408
1298 Ga0496126_0322405 3300048929 Bacteria 1269
1299 Ga0496126_0342420 3300048929 Bacteria 1224
1300 Ga0496126_0355671 3300048929 Bacteria 1197
1301 Ga0496126_0384659 3300048929 Bacteria 1141
1302 Ga0496126_0510452 3300048929 Bacteria 959
1303 Ga0495678_080281 3300049459 Bacteria 1173
1304 Ga0495682_0150731 3300049460 Bacteria 829
1305 Ga0501031_0006376 3300049568 Bacteria 7696
1306 Ga0501031_0016900 3300049568 Bacteria 4739
1307 Ga0501031_0037027 3300049568 Bacteria 3183
1308 Ga0501031_0247488 3300049568 Bacteria 1159
1309 Ga0501031_0327285 3300049568 Bacteria 992
1310 Ga0501032_0001063 3300049569 Bacteria 21964
1311 Ga0501032_0058641 3300049569 Bacteria 2584
1312 Ga0501032_0142644 3300049569 Bacteria 1577
1313 Ga0501032_0160872 3300049569 Bacteria 1474
1314 Ga0501032_0222461 3300049569 Bacteria 1228
1315 Ga0501033_0000082 3300049570 Bacteria 89837
1316 Ga0501033_0001708 3300049570 Bacteria 19234
1317 Ga0501033_0035311 3300049570 Bacteria 3748
1318 Ga0501034_0000198 3300049571 Bacteria 113672
1319 Ga0501034_0091995 3300049571 Bacteria 3031
1320 Ga0501034_0166246 3300049571 Bacteria 2174
1321 Ga0501034_0489493 3300049571 Bacteria 1144
1322 Ga0501034_0592677 3300049571 Bacteria 1015
1323 Ga0501034_0694792 3300049571 Bacteria 916
1324 Ga0501036_0001033 3300049572 Bacteria 21031
1325 Ga0501036_0021624 3300049572 Bacteria 5408
1326 Ga0501036_0078034 3300049572 Bacteria 2802
1327 Ga0501036_0296898 3300049572 Bacteria 1351
1328 Ga0501036_0320776 3300049572 Bacteria 1294
1329 Ga0501036_0403881 3300049572 Bacteria 1140
1330 Ga0501037_0000050 3300049573 Bacteria 112824
1331 Ga0501037_0008923 3300049573 Bacteria 7345
1332 Ga0501037_0080378 3300049573 Bacteria 2365
1333 Ga0501037_0415273 3300049573 Bacteria 921
1334 Ga0501038_0004264 3300049574 Bacteria 13298
1335 Ga0501038_0010520 3300049574 Bacteria 8462
1336 Ga0501038_0023661 3300049574 Bacteria 5488
1337 Ga0501038_0035664 3300049574 Bacteria 4366
1338 Ga0501038_0055066 3300049574 Bacteria 3418
1339 Ga0501038_0143438 3300049574 Bacteria 1952
1340 Ga0501038_0166075 3300049574 Bacteria 1790
1341 Ga0501039_0000366 3300049575 Bacteria 32333
1342 Ga0501039_0078556 3300049575 Bacteria 2567
1343 Ga0501039_0079837 3300049575 Bacteria 2545
1344 Ga0501039_0154373 3300049575 Bacteria 1803
1345 Ga0501039_0156867 3300049575 Bacteria 1788
1346 Ga0501039_0258789 3300049575 Bacteria 1368
1347 Ga0501039_0487024 3300049575 Bacteria 968
1348 Ga0501041_0286756 3300049577 Bacteria 1036
1349 Ga0501042_0061835 3300049578 Bacteria 2674
1350 Ga0501042_0110747 3300049578 Bacteria 1977
1351 Ga0501043_0001664 3300049579 Bacteria 19297
1352 Ga0501043_0008468 3300049579 Bacteria 8095
1353 Ga0501043_0028438 3300049579 Bacteria 4388
1354 Ga0501043_0195154 3300049579 Bacteria 1573
1355 Ga0501043_0669817 3300049579 Bacteria 760
1356 Ga0501046_0003642 3300049580 Bacteria 14115
1357 Ga0501046_0005790 3300049580 Bacteria 11029
1358 Ga0501046_0046637 3300049580 Bacteria 3438
1359 Ga0501046_0082240 3300049580 Bacteria 2487
1360 Ga0501047_0000131 3300049581 Bacteria 91079
1361 Ga0501047_0006910 3300049581 Bacteria 10662
1362 Ga0501047_0025713 3300049581 Bacteria 5661
1363 Ga0501047_0030818 3300049581 Bacteria 5170
1364 Ga0501047_0167451 3300049581 Bacteria 2068
1365 Ga0501048_0000531 3300049582 Bacteria 26809
1366 Ga0501048_0233544 3300049582 Bacteria 1305
1367 Ga0501067_0000101 3300049583 Bacteria 49019
1368 Ga0501067_0108255 3300049583 Bacteria 1545
1369 Ga0501068_0000988 3300049584 Bacteria 14949
1370 Ga0501068_0433160 3300049584 Bacteria 850
1371 Ga0501069_0000565 3300049585 Bacteria 17071
1372 Ga0501070_0004413 3300049586 Bacteria 12077
1373 Ga0501070_0013834 3300049586 Bacteria 6796
1374 Ga0501070_0030097 3300049586 Bacteria 4549
1375 Ga0501070_0047792 3300049586 Bacteria 3555
1376 Ga0501070_0212624 3300049586 Bacteria 1587
1377 Ga0501070_0227802 3300049586 Bacteria 1527
1378 Ga0501070_0372460 3300049586 Bacteria 1157
1379 Ga0501072_0734565 3300049588 Bacteria 775
1380 Ga0501073_0000230 3300049589 Bacteria 36799
1381 Ga0501073_0158573 3300049589 Bacteria 1568
1382 Ga0501073_0229530 3300049589 Bacteria 1282
1383 Ga0501074_0000141 3300049590 Bacteria 37729
1384 Ga0501074_0041688 3300049590 Bacteria 3323
1385 Ga0501079_0069255 3300049741 Bacteria 2723
1386 Ga0501079_0654753 3300049741 Bacteria 827
1387 Ga0501080_0000093 3300049742 Bacteria 60276
1388 Ga0501080_0128172 3300049742 Bacteria 2349
1389 Ga0501080_0369499 3300049742 Bacteria 1293
1390 Ga0501083_0000341 3300049744 Bacteria 29641
1391 Ga0501035_0005747 3300049822 Bacteria 11700
1392 Ga0501035_0018523 3300049822 Bacteria 6414
1393 Ga0501035_0050826 3300049822 Bacteria 3713
1394 Ga0501035_0304426 3300049822 Bacteria 1342
1395 Ga0501044_0000100 3300049823 Bacteria 106729
1396 Ga0501044_0151247 3300049823 Bacteria 2303
1397 Ga0501044_0208205 3300049823 Bacteria 1911
1398 Ga0501044_0365010 3300049823 Bacteria 1361
1399 Ga0501044_0381750 3300049823 Bacteria 1324
1400 Ga0501044_0426579 3300049823 Bacteria 1235
1401 Ga0501044_0594789 3300049823 Bacteria 1000
1402 Ga0501044_0644912 3300049823 Bacteria 948
1403 Ga0501045_0010802 3300049824 Bacteria 6400
1404 nmdc:mga03683_55008_c1 3300050489 Bacteria 1670
1405 nmdc:mga03683_55598_c1 3300050489 Bacteria 1663
1406 nmdc:mga03n38_10224_c1 3300050490 Bacteria 3444
1407 nmdc:mga03n38_142092_c1 3300050490 Bacteria 1200
1408 nmdc:mga03n38_191436_c1 3300050490 Bacteria 1054
1409 nmdc:mga03n38_442925_c1 3300050490 Bacteria 721
1410 nmdc:mga03n38_58333_c1 3300050490 Bacteria 1748
1411 nmdc:mga00v17_245180_c1 3300050491 Bacteria 1162
1412 nmdc:mga00v17_26711_c1 3300050491 Bacteria 3366
1413 nmdc:mga0yw44_122406_c1 3300050492 Bacteria 1677
1414 nmdc:mga0yw44_137756_c1 3300050492 Bacteria 1584
1415 nmdc:mga0yw44_234700_c1 3300050492 Bacteria 1218
1416 nmdc:mga0yw44_270253_c1 3300050492 Bacteria 1135
1417 nmdc:mga0yw44_28542_c1 3300050492 Bacteria 3211
1418 nmdc:mga0yw44_39867_c1 3300050492 Bacteria 2787
1419 nmdc:mga0yw44_458341_c1 3300050492 Bacteria 864
1420 nmdc:mga0k408_33226_c2 3300050493 Bacteria 2521
1421 nmdc:mga06z11_260162_c1 3300050494 Bacteria 1024
1422 nmdc:mga06z11_435041_c1 3300050494 Bacteria 792
1423 nmdc:mga06z11_97958_c1 3300050494 Bacteria 1604
1424 nmdc:mga04h51_14508_c1 3300050495 Bacteria 2253
1425 nmdc:mga07m45_13705_c1 3300050496 Bacteria 4306
1426 nmdc:mga07m45_35028_c1 3300050496 Bacteria 2792
1427 nmdc:mga08y16_384673_c1 3300050511 Bacteria 1438
1428 nmdc:mga0n895_17771_c1 3300050512 Bacteria 6564
1429 nmdc:mga0n895_181515_c1 3300050512 Bacteria 2136
1430 nmdc:mga0n895_31488_c1 3300050512 Bacteria 5079
1431 nmdc:mga0rr50_346913_c1 3300050513 Bacteria 1248
1432 nmdc:mga0rr50_375527_c1 3300050513 Bacteria 1198
1433 nmdc:mga08x19_486796_c1 3300050514 Bacteria 870
1434 nmdc:mga0a205_554655_c1 3300050515 Bacteria 1004
1435 nmdc:mga0a205_835376_c1 3300050515 Bacteria 768
1436 nmdc:mga0sz30_16062_c1 3300050516 Bacteria 2966
1437 nmdc:mga0sz30_28046_c1 3300050516 Bacteria 2315
1438 nmdc:mga0sz30_5780_c2 3300050516 Bacteria 4146
1439 Ga0495601_0000392 3300053077 Bacteria 23195
1440 Ga0495601_0054488 3300053077 Bacteria 2530
1441 Ga0495601_0215628 3300053077 Bacteria 1254
1442 Ga0495601_0338167 3300053077 Bacteria 979
1443 Ga0495601_0525539 3300053077 Bacteria 762
1444 Ga0495612_0008868 3300053078 Bacteria 4074
1445 Ga0495612_0153126 3300053078 Bacteria 1004
1446 Ga0500610_0147797 3300053079 Bacteria 1181
1447 Ga0500610_0163685 3300053079 Bacteria 1104
1448 Ga0495655_0044956 3300053083 Bacteria 1145
1449 Ga0495655_0127737 3300053083 Bacteria 780
1450 Ga0495595_0003205 3300053084 Bacteria 6493
1451 Ga0495595_0118623 3300053084 Bacteria 1288
1452 Ga0495619_0014255 3300053085 Bacteria 5021
1453 Ga0495619_0014580 3300053085 Bacteria 4965
1454 Ga0495619_0027133 3300053085 Bacteria 3689
1455 Ga0500578_0218103 3300053086 Bacteria 1161
1456 Ga0500643_000076 3300053087 Bacteria 106911
1457 Ga0500643_043764 3300053087 Bacteria 1304
1458 Ga0500644_0308840 3300053088 Bacteria 678
1459 Ga0500581_052772 3300053089 Bacteria 2070
1460 Ga0500647_0018897 3300053091 Bacteria 3197
1461 Ga0500583_0173565 3300053092 Bacteria 1073
1462 Ga0500651_0038112 3300053093 Bacteria 3028
1463 Ga0500651_0078589 3300053093 Bacteria 2046
1464 Ga0500566_0000107 3300053094 Bacteria 42130
1465 Ga0500566_0000277 3300053094 Bacteria 27736
1466 Ga0500566_0009047 3300053094 Bacteria 5890
1467 Ga0500566_0084678 3300053094 Bacteria 1759
1468 Ga0500566_0219786 3300053094 Bacteria 945
1469 Ga0500641_0045694 3300053096 Bacteria 1784
1470 Ga0500641_0066694 3300053096 Bacteria 1508
1471 Ga0500650_0048502 3300053098 Bacteria 1969
1472 Ga0500554_004326 3300053102 Bacteria 3000
1473 Ga0500555_020273 3300053103 Bacteria 1915
1474 Ga0500556_0000081 3300053104 Bacteria 90508
1475 Ga0500556_0008699 3300053104 Bacteria 2933
1476 Ga0500557_000102 3300053105 Bacteria 26497
1477 Ga0500562_019322 3300053108 Bacteria 1762
1478 Ga0500572_000551 3300053111 Bacteria 12753
1479 Ga0500572_066946 3300053111 Bacteria 1102
1480 Ga0500591_030555 3300053115 Bacteria 2599
1481 Ga0500592_011263 3300053116 Bacteria 1430
1482 Ga0500592_021433 3300053116 Bacteria 1040
1483 Ga0500594_0024035 3300053118 Bacteria 1549
1484 Ga0500594_0065760 3300053118 Bacteria 1055
1485 Ga0500595_001181 3300053119 Bacteria 14424
1486 Ga0500595_007372 3300053119 Bacteria 4567
1487 Ga0500595_014778 3300053119 Bacteria 2951
1488 Ga0500595_022824 3300053119 Bacteria 2208
1489 Ga0500595_025522 3300053119 Bacteria 2047
1490 Ga0500595_026407 3300053119 Bacteria 2001
1491 Ga0500595_041399 3300053119 Bacteria 1480
1492 Ga0500595_086467 3300053119 Bacteria 912
1493 Ga0500608_021321 3300053122 Bacteria 2992
1494 Ga0500608_044035 3300053122 Bacteria 2143
1495 Ga0500628_044666 3300053129 Bacteria 1027
1496 Ga0500642_0000042 3300053130 Bacteria 86476
1497 Ga0500642_0000225 3300053130 Bacteria 22158
1498 Ga0500652_001540 3300053131 Bacteria 7053
1499 Ga0500658_0027327 3300053134 Bacteria 2205
1500 Ga0500658_0089989 3300053134 Bacteria 1326
1501 Ga0500658_0140101 3300053134 Bacteria 1084
1502 Ga0500559_0000857 3300053136 Bacteria 19581
1503 Ga0500559_0001081 3300053136 Bacteria 16536
1504 Ga0500559_0019840 3300053136 Bacteria 2840
1505 Ga0500559_0028884 3300053136 Bacteria 2371
1506 Ga0500561_0047514 3300053137 Bacteria 1159
1507 Ga0500568_0002631 3300053139 Bacteria 10435
1508 Ga0500568_0006224 3300053139 Bacteria 6025
1509 Ga0500568_0026198 3300053139 Bacteria 2449
1510 Ga0500573_0084823 3300053140 Bacteria 1796
1511 Ga0500577_0001501 3300053142 Bacteria 5949
1512 Ga0500577_0199001 3300053142 Bacteria 864
1513 Ga0500579_217814 3300053143 Bacteria 672
1514 Ga0500585_151812 3300053144 Bacteria 808
1515 Ga0500589_166450 3300053147 Bacteria 881
1516 Ga0500590_023202 3300053148 Bacteria 3224
1517 Ga0500590_151556 3300053148 Bacteria 1045
1518 Ga0500603_002896 3300053150 Bacteria 3716
1519 Ga0500603_010161 3300053150 Bacteria 2119
1520 Ga0500603_054382 3300053150 Bacteria 1104
1521 Ga0500603_056077 3300053150 Bacteria 1091
1522 Ga0500604_0005100 3300053151 Bacteria 3472
1523 Ga0500616_0000227 3300053153 Bacteria 88098
1524 Ga0500616_0000244 3300053153 Bacteria 85079
1525 Ga0500616_0017169 3300053153 Bacteria 4111
1526 Ga0500619_044245 3300053154 Bacteria 1418
1527 Ga0500620_051856 3300053155 Bacteria 1377
1528 Ga0500622_0002743 3300053156 Bacteria 12429
1529 Ga0500622_0004369 3300053156 Bacteria 8919
1530 Ga0500624_035402 3300053157 Bacteria 877
1531 Ga0500627_0165099 3300053158 Bacteria 998
1532 Ga0500627_0237262 3300053158 Bacteria 810
1533 Ga0500633_0047836 3300053160 Bacteria 1465
1534 Ga0500638_000149 3300053162 Bacteria 13453
1535 Ga0500638_036029 3300053162 Bacteria 2399
1536 Ga0500639_093771 3300053163 Bacteria 1490
1537 Ga0500636_0001169 3300053177 Bacteria 14139
1538 Ga0500636_0003600 3300053177 Bacteria 8736
1539 Ga0500636_0083689 3300053177 Bacteria 1835
1540 Ga0500636_0100367 3300053177 Bacteria 1646
1541 Ga0500637_0001223 3300053178 Bacteria 10739
1542 Ga0500637_0002162 3300053178 Bacteria 8644
1543 Ga0500637_0186371 3300053178 Bacteria 1187
1544 Ga0500649_183161 3300053722 Bacteria 704
1545 Ga0500576_024107 3300053725 Bacteria 2776
1546 Ga0500552_016468 3300053733 Bacteria 1000
1547 Ga0500596_002382 3300053735 Bacteria 3706
1548 Ga0500596_006512 3300053735 Bacteria 1969
1549 Ga0500601_001128 3300053737 Bacteria 3018
1550 Ga0500601_005258 3300053737 Bacteria 1416
1551 Ga0501084_0003619 3300054114 Bacteria 12549
1552 Ga0500661_005511 3300055283 Bacteria 2362
1553 Ga0500661_009014 3300055283 Bacteria 1832
1554 Ga0501082_0005938 3300060353 Bacteria 10588
1555 Ga0466962_0077292 3300061719 Bacteria 1591
1556 Ga0530510_0504883 3300061734 Bacteria 917
1557 2507505402 2507262055 Bacteria 8048963
1558 2508539291 2508501009 Bacteria 7784016
1559 2508695614 2508501042 Bacteria 8719808
1560 2509151963 2508501128 Bacteria 8613869
1561 2511394505 2511231028 Bacteria 8046582
1562 2513623970 2513237092 Bacteria 8341956
1563 2513642143 2513237094 Bacteria 8789602
1564 2513651384 2513237095 Bacteria 8976980
1565 2513661433 2513237096 Bacteria 8722461
1566 2513675005 2513237098 Bacteria 9902361
1567 2513695245 2513237101 Bacteria 7952346
1568 2513705567 2513237102 Bacteria 7703324
1569 2513718191 2513237104 Bacteria 10034502
1570 2513859430 2513237137 Bacteria 9558895
1571 2513873396 2513237139 Bacteria 8737671
1572 2513888621 2513237141 Bacteria 8496279
1573 2513923129 2513237145 Bacteria 8979722
1574 2514014725 2513237161 Bacteria 8871253
1575 2515627601 2515154112 Bacteria 8294334
1576 2517106331 2517093001 Bacteria 9002274
1577 2517889002 2517572143 Bacteria 9484767
1578 2524442480 2524023205 Bacteria 8918781
1579 2524467023 2524023210 Bacteria 9029266
1580 2524537430 2524023228 Bacteria 10118060
1581 2528855063 2528768022 Bacteria 10457665
1582 2603858332 2602042107 Bacteria 6226103
1583 2617352106 2617270735 Bacteria 9163226
1584 2617373577 2617270741 Bacteria 8201522
1585 2644291052 2643221651 Bacteria 4798932
1586 2671122599 2667528175 Bacteria 7532676
1587 2723841770 2721755755 Bacteria 8322773
1588 2728748477 2728368998 Bacteria 8720350
1589 2745077523 2744054633 Bacteria 8678936
1590 2793062183 2791355196 Bacteria 7323613
1591 2793073692 2791355197 Bacteria 8420563
1592 2793078354
1593 2805920744 2802429603 Bacteria 8777136
1594 2818237807 2816332527 Bacteria 8933356
1595 2824607315 2824600985 Bacteria 8488197
1596 2824616879 2824609381 Bacteria 8672835
1597 2824624409 2824617872 Bacteria 8814715
1598 2824632778 2824626560 Bacteria 8813858
1599 2824642050 2824635225 Bacteria 8785348
1600 2824649494 2824644064 Bacteria 8743947
1601 2824659699 2824653114 Bacteria 8493680
1602 2824669406 2824661429 Bacteria 9877870
1603 2824677372 2824671348 Bacteria 8369588
1604 2824686313 2824679649 Bacteria 8248951
1605 2824694108 2824687955 Bacteria 8360029
1606 2824702718 2824696289 Bacteria 8335049
1607 2824711440 2824704595 Bacteria 9667483
1608 2824719379 2824714736 Bacteria 8717648
1609 2824729884 2824723954 Bacteria 8758240
1610 2824738921 2824732956 Bacteria 7810675
1611 2824751649 2824746037 Bacteria 7911610
1612 2824762546 2824753945 Bacteria 9787441
1613 2824771880 2824763712 Bacteria 9792355
1614 2824780787 2824773399 Bacteria 8360218
1615 2838124649 2838122688 Bacteria 8803140
1616 2841945340 2841941048 Bacteria 8688029
1617 2841952125 2841949485 Bacteria 8680857
1618 2841965462 2841957949 Bacteria 8652217
1619 2841970487 2841966195 Bacteria 8673214
1620 2841981735 2841974524 Bacteria 8931498
1621 2841985016 2841983080 Bacteria 8395090
1622 2842043374 2842038055 Bacteria 8002051
1623 2842052636 2842045827 Bacteria 8006841
1624 2844315493 2844315083 Bacteria 8138177
1625 2847931202 2847930680 Bacteria 9342022
1626 2847942291 2847939898 Bacteria 8606328
1627 2849083161 2849076700 Bacteria 7039503
1628 2857516405 2857509624 Bacteria 7472071
1629 2857526569 2857524615 Bacteria 6615449
1630 2874591677 2874590934 Bacteria 8299676
1631 2874607933 2874604998 Bacteria 7834745
1632 2874619107 2874612657 Bacteria 8252029
1633 2874621250 2874620515 Bacteria 8290088
1634 2874628656 2874628541 Bacteria 8630250
1635 2874646162 2874645413 Bacteria 8214782
1636 2876769592 2876761206 Bacteria 10111113
1637 2876771778 2876771140 Bacteria 8287509
1638 2876819122 2876818435 Bacteria 8274608
1639 2879075631 2879074833 Bacteria 8279565
1640 2879085541 2879083081 Bacteria 8587928
1641 2879105888 2879099564 Bacteria 10442239
1642 2879113359 2879110137 Bacteria 8907982
1643 2879128440 2879127579 Bacteria 8294491
1644 2879143582 2879142872 Bacteria 8267021
1645 2881369272 2881364244 Bacteria 7710352
1646 2881669949 2881665667 Bacteria 8175609
1647 2885369381 2885366525 Bacteria 8326213
1648 2885382790 2885374607 Bacteria 8927485
1649 2885388544 2885383462 Bacteria 9473874
1650 2885411832 2885409591 Bacteria 9235467
1651 2888379452 2888378607 Bacteria 9652610
1652 2888390549 2888388044 Bacteria 7304136
1653 2888420174 2888419890 Bacteria 7857137
1654 2889035349 2889033259 Bacteria 9099371
1655 2893067185 2893066018 Bacteria 6158120
1656 2903733446 2903727486 Bacteria 8281579
1657 2903758962 2903748898 Bacteria 9972761
1658 2903775477 2903768456 Bacteria 9749579
1659 2904667795 2904666416 Bacteria 8226587
1660 2904691054 2904690495 Bacteria 9412302
1661 2904708458
1662 2904716376 2904711408 Bacteria 9771557
1663 2906608582 2906602504 Bacteria 8295279
1664 2906613628
1665 2906628553 2906626472 Bacteria 8826946
1666 2906641628 2906635258 Bacteria 8601019
1667 2906651392 2906643746 Bacteria 8722424
1668 2906668156 2906660503 Bacteria 8595048
1669 2908747600 2908739725 Bacteria 8628932
1670 2908756448 2908756301 Bacteria 8864324
1671 2908776050 2908775508 Bacteria 8092255
1672 2919073612 2919073203 Bacteria 6531949
1673 2922363162 2922361189 Bacteria 7436256
1674 2922369438
1675 2922388534 2922386360 Bacteria 7017218
1676 2922398125 2922393267 Bacteria 8285685
1677 2922434063
1678 2929618733 2929615660 Bacteria 9193770
1679 2929628582 2929624759 Bacteria 9339455
1680 2932790914 2932784394 Bacteria 9704911
1681 2932794191 2932794094 Bacteria 7915132
1682 2932808214 2932801729 Bacteria 7987968
1683 2932812033 2932809354 Bacteria 9135765
1684 2932825516 2932818245 Bacteria 9955613
1685 2932833630 2932828146 Bacteria 9745859
1686 2933580557 2933577622 Bacteria 9116884
1687 2935615571 2935608549 Bacteria 8203142
1688 2935623156 2935616580 Bacteria 9032984
1689 2935636093 2935630451 Bacteria 8169952
1690 2935644231 2935638405 Bacteria 10015038
1691 2935654500 2935648319 Bacteria 8801166
1692 2935663380 2935656913 Bacteria 8965014
1693 2935672187 2935665750 Bacteria 9571747
1694 2935679291 2935675223 Bacteria 9928132
1695 2935686533 2935684952 Bacteria 9590419
1696 2935700316 2935694250 Bacteria 9291695
1697 2935710264 2935703347 Bacteria 10242284
1698 2935716221 2935713505 Bacteria 9608509
1699 2935723655 2935722832 Bacteria 9608746
1700 2935735210 2935732158 Bacteria 9706831
1701 2935743999 2935741537 Bacteria 9707219
1702 2935752499 2935750917 Bacteria 9590372
1703 2935763367 2935760218 Bacteria 9817913
1704 2935772910 2935769743 Bacteria 7878163
1705 2935783299 2935777560 Bacteria 8077691
1706 2935788102 2935785616 Bacteria 7962367
1707 2935796322 2935793552 Bacteria 8012592
1708 2935808255 2935801545 Bacteria 9301974
1709 2935816132 2935810662 Bacteria 9401221
1710 2935825628 2935819856 Bacteria 8261050
1711 2935833525 2935827899 Bacteria 10038562
1712 2935844478 2935837841 Bacteria 9454360
1713 2935853392 2935847175 Bacteria 8228321
1714 2935861404 2935855204 Bacteria 9035059
1715 2935869523 2935864058 Bacteria 9784707
1716 2935879852 2935873716 Bacteria 9632195
1717 2935889215 2935883170 Bacteria 7964738
1718 2935914993 2935908558 Bacteria 8568796
1719 2935918841 2935916978 Bacteria 9113783
1720 2935931442 2935926038 Bacteria 8601059
1721 2935940039 2935934488 Bacteria 8602579
1722 2935947614 2935942939 Bacteria 8599779
1723 2935956385 2935951376 Bacteria 8602333
1724 2935966767 2935959822 Bacteria 7869783
1725 2935973179 2935967501 Bacteria 8603075
1726 2935980571 2935975950 Bacteria 8347125
1727 2935990074 2935984226 Bacteria 8302647
1728 2935997925 2935992306 Bacteria 9802711
1729 2936008810 2936002035 Bacteria 9362176
1730 2936017461 2936011229 Bacteria 8801034
1731 2936026038 2936019824 Bacteria 8804134
1732 2936034880 2936028420 Bacteria 8965941
1733 2936041137 2936037263 Bacteria 9446081
1734 2936052862 2936046547 Bacteria 8903709
1735 2936060282 2936055302 Bacteria 8785755
1736 2940558412 2940556831 Bacteria 9590747
1737 2941512603 2941507105 Bacteria 8166816
1738 2941520559 2941515067 Bacteria 8166720
1739 2941528573 2941523033 Bacteria 8169134
1740 2941535388 2941531003 Bacteria 7653939
1741 2941543349 2941538514 Bacteria 9402094
1742 3005475224 3005474847 Bacteria 9259049
1743 3005486723 3005483717 Bacteria 7877331
1744 3005509029 3005506211 Bacteria 6943378
1745 3005594085 3005587118 Bacteria 7794411
1746 3005595184 3005594810 Bacteria 8716512
1747 3005711130 3005710791 Bacteria 7622528
1748 3005718428 3005718088 Bacteria 8283608
1749 8006928174 8006926726 Bacteria 6749210
1750 8006936056 8006933436 Bacteria 10410654
1751 8006967590 8006964411 Bacteria 8966052
1752 8006975820 8006973647 Bacteria 10679141
1753 8006991059 8006984368 Bacteria 9651211
1754 8007000390 8006994254 Bacteria 8309700
1755 8016518047 8016511872 Bacteria 9921665
1756 8016526278 8016522445 Bacteria 8156687
1757 8016544556 8016539877 Bacteria 8155419
1758 8016557523 8016548790 Bacteria 8155074
1759 8016565879 8016557553 Bacteria 8154380
1760 8016569604 8016566248 Bacteria 8158151
1761 8016582215 8016575299 Bacteria 8154085
1762 8016586240 8016583857 Bacteria 10421953
1763 8016603477 8016595262 Bacteria 8149947
1764 8016618321 8016613128 Bacteria 8794220
1765 8016622969 8016622563 Bacteria 7999408
1766 8016635477 8016630954 Bacteria 9217207
1767 8017058598 8017057580 Bacteria 10023680
1768 8019531172 8019530166 Bacteria 8155624
1769 8019540380 8019538911 Bacteria 7872763
1770 8019549973 8019547302 Bacteria 7996444
1771 8019562600 8019555841 Bacteria 9642137
1772 8019572678 8019565922 Bacteria 9639779
1773 8019577061 8019576017 Bacteria 10049540
1774 8019595133 8019586578 Bacteria 10212056
1775 8019606613 8019597564 Bacteria 10041141
1776 8019611901 8019608314 Bacteria 10042931
1777 8019623115 8019619141 Bacteria 9218857
1778 8019629983 8019629233 Bacteria 8687553
1779 8019640623 8019638758 Bacteria 9062356
1780 8019652331 8019648815 Bacteria 10014479
1781 8019666823 8019659431 Bacteria 8577854
1782 8019676581 8019668869 Bacteria 8791617
1783 8019679410 8019678201 Bacteria 8863603
1784 8019696102 8019687851 Bacteria 8712826
1785 8055742582 8055742211 Bacteria 9226248
1786 8056676095 8056673599 Bacteria 7871253
1787 8056682896 8056681323 Bacteria 8472857
1788 8056691099 8056689827 Bacteria 6712655
1789 8056971440 8056967851 Bacteria 9038162
1790 Ga0501034_0099570
1791 RicEn_C5253
1792 JGI24736J21556_1015157
1793 JGI24740J21852_10005020
1794 JGI24739J22299_10011782
1795 JGI24737J22298_10001303
1796 JGI24738J21930_10019553
1797 JGI25406J46586_10000915
1798 JGI25406J46586_10001108
1799 JGI25153J46596_10002773
1800 JGI25153J46596_10035478
1801 JGI25153J46596_10042611
1802 JGI25160J50197_1022345
1803 JGI25161J50226_1012969
1804 JGI25404J52841_10016932
1805 JGI25404J52841_10027307
1806 JGI25404J52841_10029378
1807 Ga0055524_1063574
1808 Ga0055531_10014320
1809 Ga0065165_1003849
1810 Ga0065712_10310656
1811 Ga0070658_10063913
1812 Ga0070658_10087834
1813 Ga0070658_10160418
1814 Ga0070658_10442291
1815 Ga0070676_10173494
1816 Ga0070683_100003459
1817 Ga0070683_100019475
1818 Ga0070683_100517072
1819 Ga0070670_100091679
1820 Ga0068869_100256572
1821 Ga0070666_10152374
1822 Ga0070666_10465026
1823 Ga0070680_100070610
1824 Ga0070680_100095019
1825 Ga0068868_100126102
1826 Ga0070660_100001075
1827 Ga0070660_100237712
1828 Ga0070689_100069435
1829 Ga0070689_100240294
1830 Ga0070689_100472744
1831 Ga0070689_100708273
1832 Ga0070691_10020941
1833 Ga0070661_100035628
1834 Ga0070661_100098519
1835 Ga0070661_100149531
1836 Ga0070668_100148724
1837 Ga0070668_100304066
1838 Ga0070668_100316121
1839 Ga0070668_100437999
1840 Ga0070669_100256611
1841 Ga0070669_100353386
1842 Ga0070669_100511051
1843 Ga0070671_100014330
1844 Ga0070671_100144815
1845 Ga0070674_100392047
1846 Ga0070674_100707807
1847 Ga0070673_100195488
1848 Ga0070673_100394240
1849 Ga0070659_100140179
1850 Ga0070659_100498025
1851 Ga0070659_100650783
1852 Ga0070667_100190323
1853 Ga0070667_100374381
1854 Ga0070667_100843003
1855 Ga0070709_10007523
1856 Ga0070709_10010268
1857 Ga0070709_10015617
1858 Ga0070714_100006699
1859 Ga0070714_100065772
1860 Ga0070714_100253140
1861 Ga0070713_100016372
1862 Ga0070713_100019605
1863 Ga0070713_100053638
1864 Ga0070713_100248034
1865 Ga0070713_100843365
1866 Ga0070710_10000802
1867 Ga0070710_10121265
1868 Ga0070701_10222776
1869 Ga0070711_100017892
1870 Ga0070711_100020415
1871 Ga0070711_100055881
1872 Ga0070711_100076565
1873 Ga0070711_100137440
1874 Ga0070711_100356657
1875 Ga0070711_100493047
1876 Ga0070700_100251139
1877 Ga0070663_100066899
1878 Ga0070663_100104953
1879 Ga0070663_100105112
1880 Ga0070678_100129896
1881 Ga0070678_100172405
1882 Ga0070678_100354954
1883 Ga0070678_100594137
1884 Ga0070662_100037993
1885 Ga0070662_100327014
1886 Ga0070681_10009671
1887 Ga0070681_10025343
1888 Ga0070681_10195696
1889 Ga0070681_10638533
1890 Ga0068867_100102312
1891 Ga0068867_100144706
1892 Ga0070685_10374239
1893 Ga0070706_100350976
1894 Ga0070706_100774025
1895 Ga0070707_100078821
1896 Ga0070699_100616597
1897 Ga0070679_100048159
1898 Ga0070679_100109136
1899 Ga0070684_100007076
1900 Ga0070684_100046071
1901 Ga0070697_100013361
1902 Ga0068853_100037102
1903 Ga0068853_100052993
1904 Ga0068853_100526871
1905 Ga0068853_100541794
1906 Ga0070672_100562753
1907 Ga0070672_100746402
1908 Ga0070686_100314555
1909 Ga0070693_100400440
1910 Ga0070665_100019646
1911 Ga0070665_100042207
1912 Ga0070665_100061160
1913 Ga0070665_100094748
1914 Ga0070665_100273433
1915 Ga0070665_100407722
1916 Ga0070665_100547367
1917 Ga0070665_100607495
1918 Ga0070704_100255708
1919 Ga0068855_100044373
1920 Ga0068855_100075096
1921 Ga0068855_100082985
1922 Ga0068855_100084323
1923 Ga0068855_100155703
1924 Ga0068855_100240979
1925 Ga0068855_100386058
1926 Ga0070664_100231974
1927 Ga0068857_100008930
1928 Ga0068857_100022226
1929 Ga0068857_100064498
1930 Ga0068857_100071907
1931 Ga0068857_100541391
1932 Ga0068854_100028179
1933 Ga0068854_100147734
1934 Ga0068854_100206859
1935 Ga0068854_100232479
1936 Ga0068854_100441631
1937 Ga0068856_100013958
1938 Ga0068856_100042359
1939 Ga0068856_100050282
1940 Ga0068856_100105736
1941 Ga0068856_100328008
1942 Ga0068856_100343963
1943 Ga0068856_100572280
1944 Ga0068856_100765277
1945 Ga0068856_100872328
1946 Ga0070702_100291029
1947 Ga0068852_100017184
1948 Ga0068852_100048394
1949 Ga0068852_100076112
1950 Ga0068852_100198957
1951 Ga0068852_100445913
1952 Ga0068852_100488403
1953 Ga0068852_100587897
1954 Ga0068852_100806567
1955 Ga0068859_100113514
1956 Ga0068859_100281859
1957 Ga0068859_100583019
1958 Ga0068859_100776293
1959 Ga0068864_100106658
1960 Ga0068864_100665701
1961 Ga0068866_10161358
1962 Ga0068861_100089459
1963 Ga0068861_100226997
1964 Ga0068861_100265120
1965 Ga0068851_10006622
1966 Ga0068851_10026964
1967 Ga0068870_10278445
1968 Ga0068863_100262320
1969 Ga0068858_100082051
1970 Ga0068860_100000477
1971 Ga0068860_100193755
1972 Ga0068860_100300493
1973 Ga0068860_100469711
1974 Ga0068860_101113883
1975 Ga0068862_100087301
1976 Ga0068862_100109043
1977 Ga0068862_100138409
1978 Ga0068862_100490597
1979 Ga0068862_100493133
1980 Ga0081455_10011031
1981 Ga0081455_10023057
1982 Ga0081455_10028111
1983 Ga0081455_10059467
1984 Ga0081538_10014581
1985 Ga0081538_10018074
1986 Ga0081540_1001247
1987 Ga0081540_1006252
1988 Ga0081540_1007349
1989 Ga0081540_1011012
1990 Ga0081540_1011793
1991 Ga0081540_1020406
1992 Ga0081540_1023508
1993 Ga0081540_1090817
1994 Ga0081540_1108981
1995 Ga0081539_10000265
1996 Ga0081539_10000371
1997 Ga0081539_10012180
1998 Ga0070717_10007759
1999 Ga0070717_10010181
2000 Ga0070717_10029710
2001 Ga0070717_10588910
2002 Ga0075365_10008765
2003 Ga0075365_10023785
2004 Ga0075365_10038902
2005 Ga0075365_10061500
2006 Ga0075365_10154659
2007 Ga0075365_10477978
2008 Ga0075368_10015416
2009 Ga0075368_10028027
2010 Ga0075363_100008349
2011 Ga0075363_100047253
2012 Ga0075363_100196507
2013 Ga0075363_100298469
2014 Ga0075363_100365837
2015 Ga0075364_10034975
2016 Ga0075364_10041445
2017 Ga0075364_10152333
2018 Ga0075364_10509677
2019 Ga0075364_10583863
2020 Ga0070715_10000872
2021 Ga0070715_10246234
2022 Ga0070716_100019142
2023 Ga0070716_100051216
2024 Ga0070716_100089432
2025 Ga0070716_100456401
2026 Ga0070716_100535237
2027 Ga0070716_100549528
2028 Ga0070712_100012131
2029 Ga0070712_100023475
2030 Ga0070712_100042188
2031 Ga0070712_100092434
2032 Ga0070712_100094994
2033 Ga0070712_100100219
2034 Ga0070712_100148078
2035 Ga0075367_10005815
2036 Ga0075367_10016144
2037 Ga0075367_10043731
2038 Ga0075367_10045040
2039 Ga0075367_10045943
2040 Ga0075367_10192270
2041 Ga0075369_10011258
2042 Ga0075369_10124756
2043 Ga0075369_10205780
2044 Ga0075366_10050660
2045 Ga0075366_10097799
2046 Ga0097621_100573771
2047 Ga0075370_10182744
2048 Ga0075370_10184224
2049 Ga0075370_10286595
2050 Ga0075370_10349089
2051 Ga0068871_100121609
2052 Ga0068871_100488421
2053 Ga0075428_100167202
2054 Ga0075433_10246735
2055 Ga0075433_10538565
2056 Ga0075434_100098208
2057 Ga0075434_100159055
2058 Ga0068865_100134104
2059 Ga0068865_100207434
2060 Ga0075436_100200900
2061 Ga0075436_100615442
2062 Ga0097620_100113524
2063 Ga0097620_100281862
2064 Ga0097620_100582996
2065 Ga0097620_100776279
2066 Ga0099825_1014654
2067 Ga0099825_1034410
2068 Ga0099824_1009377
2069 Ga0099822_1000918
2070 Ga0099823_1092027
2071 Ga0075435_100317550
2072 Ga0099795_10003456
2073 Ga0099795_10089479
2074 Ga0099795_10139209
2075 Ga0105244_10247152
2076 Ga0105250_10086965
2077 Ga0105240_10014175
2078 Ga0105240_10015716
2079 Ga0105240_10067208
2080 Ga0105240_10078467
2081 Ga0105240_10159656
2082 Ga0105240_10258968
2083 Ga0105240_10406693
2084 Ga0105240_10655452
2085 Ga0111539_10103107
2086 Ga0111539_10466201
2087 Ga0105245_10091504
2088 Ga0105245_10259834
2089 Ga0105245_10355126
2090 Ga0105247_10026096
2091 Ga0105247_10033576
2092 Ga0105247_10046601
2093 Ga0105247_10059759
2094 Ga0105247_10222365
2095 Ga0105247_10256530
2096 Ga0105247_10377197
2097 Ga0114129_10094360
2098 Ga0105243_10022131
2099 Ga0105243_10148449
2100 Ga0105243_10635806
2101 Ga0105241_10000249
2102 Ga0105241_10045364
2103 Ga0105241_10082928
2104 Ga0105241_10120371
2105 Ga0105241_10184541
2106 Ga0105241_10285018
2107 Ga0105241_10587520
2108 Ga0105241_10681981
2109 Ga0105242_10486081
2110 Ga0105248_10075762
2111 Ga0105248_10185622
2112 Ga0105248_10372892
2113 Ga0105237_10010653
2114 Ga0105237_10014068
2115 Ga0105237_10031484
2116 Ga0105237_10090906
2117 Ga0105237_10133438
2118 Ga0105237_10148701
2119 Ga0105237_10225036
2120 Ga0105237_10264422
2121 Ga0105237_10342475
2122 Ga0105237_10410021
2123 Ga0105237_10616920
2124 Ga0105237_10897912
2125 Ga0105238_10012601
2126 Ga0105238_10013147
2127 Ga0105238_10045519
2128 Ga0105238_10122350
2129 Ga0105238_10134900
2130 Ga0105238_10375515
2131 Ga0105238_10863820
2132 Ga0105238_10873018
2133 Ga0099796_10006620
2134 Ga0105239_10012784
2135 Ga0105239_10014648
2136 Ga0105239_10043484
2137 Ga0105239_10252509
2138 Ga0105239_10275967
2139 Ga0105239_10403086
2140 Ga0105239_10705601
2141 Ga0105246_10030977
2142 Ga0105246_10683328
2143 Ga0105246_10823378
2144 Ga0157326_1017363
2145 Ga0157371_10098485
2146 Ga0157370_10115412
2147 Ga0157370_10217796
2148 Ga0157369_10004221
2149 Ga0157369_10032586
2150 Ga0157369_10072902
2151 Ga0157369_10352990
2152 Ga0157369_10916204
2153 Ga0157378_10209003
2154 Ga0163162_10080261
2155 Ga0163162_10323885
2156 Ga0163162_10499188
2157 Ga0157372_10317616
2158 Ga0157372_10651143
2159 Ga0157372_10751246
2160 Ga0157372_10931895
2161 Ga0157375_10050169
2162 Ga0157375_10055933
2163 Ga0157375_10317851
2164 Ga0157375_10353089
2165 Ga0157375_10729935
2166 Ga0157375_10875242
2167 Ga0157375_11631355
2168 Ga0163163_10024457
2169 Ga0163163_10062893
2170 Ga0163163_10084364
2171 Ga0163163_10098316
2172 Ga0163163_10983136
2173 Ga0157380_10122416
2174 Ga0157380_10489307
2175 Ga0157380_10681912
2176 Ga0157380_10921319
2177 Ga0182008_10081970
2178 Ga0182008_10196222
2179 Ga0157377_10417280
2180 Ga0157377_10597971
2181 Ga0157379_10111718
2182 Ga0157379_10299945
2183 Ga0157379_10422882
2184 Ga0157376_10068910
2185 Ga0157376_10449819
2186 Ga0157376_10581389
2187 Ga0157376_11025595
2188 Ga0163161_10042345
2189 Ga0206350_10581160
2190 Ga0214544_1000056
2191 Ga0214544_1023817
2192 Ga0214542_1000071
2193 Ga0214545_1000033
2194 Ga0214543_1000105
2195 Ga0214543_1025733
2196 Ga0213872_10133386
2197 Ga0213876_10011834
2198 Ga0213876_10074857
2199 Ga0213876_10351938
2200 Ga0213875_10078334
2201 Ga0213871_10008728
2202 Ga0224712_10026527
2203 Ga0224712_10116748
2204 Ga0209563_108510
2205 Ga0209677_100170
2206 Ga0209677_102931
2207 Ga0209148_1000295
2208 Ga0209233_1017816
2209 Ga0209233_1029177
2210 Ga0209233_1029207
2211 Ga0209455_1001656
2212 Ga0209455_1004571
2213 Ga0209455_1008507
2214 Ga0209673_1052348
2215 Ga0209025_1068889
2216 Ga0209564_1006432
2217 Ga0209564_1012927
2218 Ga0209758_1000069
2219 Ga0209758_1000253
2220 Ga0209758_1000397
2221 Ga0209758_1001436
2222 Ga0209758_1013802
2223 Ga0209758_1017963
2224 Ga0209758_1021734
2225 Ga0209758_1046585
2226 Ga0209256_1020904
2227 Ga0207426_1001927
2228 Ga0207426_1035148
2229 Ga0209257_1005744
2230 Ga0207697_10040913
2231 Ga0207697_10069070
2232 Ga0207656_10004553
2233 Ga0207656_10066142
2234 Ga0207656_10090068
2235 Ga0207656_10190896
2236 Ga0207653_10025862
2237 Ga0207682_10140169
2238 Ga0207692_10027705
2239 Ga0207692_10048558
2240 Ga0207710_10093199
2241 Ga0207710_10185266
2242 Ga0207710_10289226
2243 Ga0207688_10071971
2244 Ga0207688_10076837
2245 Ga0207688_10082681
2246 Ga0207688_10097379
2247 Ga0207680_10095610
2248 Ga0207680_10277501
2249 Ga0207680_10579454
2250 Ga0207647_10003295
2251 Ga0207647_10016684
2252 Ga0207685_10000480
2253 Ga0207699_10005583
2254 Ga0207699_10150422
2255 Ga0207699_10225105
2256 Ga0207699_10405283
2257 Ga0207645_10225378
2258 Ga0207705_10412280
2259 Ga0207705_10430754
2260 Ga0207684_10649857
2261 Ga0207654_10000083
2262 Ga0207654_10029560
2263 Ga0207654_10097456
2264 Ga0207654_10128503
2265 Ga0207654_10255148
2266 Ga0207707_10000445
2267 Ga0207707_10001947
2268 Ga0207707_10004159
2269 Ga0207707_10046091
2270 Ga0207707_10105824
2271 Ga0207695_10000148
2272 Ga0207695_10000387
2273 Ga0207695_10033885
2274 Ga0207695_10322626
2275 Ga0207695_10854830
2276 Ga0207671_10011727
2277 Ga0207671_10022076
2278 Ga0207671_10092220
2279 Ga0207671_10110957
2280 Ga0207671_10599549
2281 Ga0207671_10709443
2282 Ga0207693_10003401
2283 Ga0207693_10020364
2284 Ga0207693_10033227
2285 Ga0207693_10040625
2286 Ga0207693_10560558
2287 Ga0207693_10647952
2288 Ga0207663_10000246
2289 Ga0207663_10015460
2290 Ga0207663_10022999
2291 Ga0207663_10049403
2292 Ga0207663_10101555
2293 Ga0207663_10178832
2294 Ga0207663_10337414
2295 Ga0207660_10001773
2296 Ga0207660_10048372
2297 Ga0207660_10098973
2298 Ga0207660_10811179
2299 Ga0207657_10003784
2300 Ga0207657_10147964
2301 Ga0207657_10148515
2302 Ga0207657_10309041
2303 Ga0207649_10032393
2304 Ga0207649_10108820
2305 Ga0207652_10011651
2306 Ga0207652_10139161
2307 Ga0207652_10166123
2308 Ga0207652_10228683
2309 Ga0207681_10279713
2310 Ga0207681_10305018
2311 Ga0207681_10346780
2312 Ga0207694_10000121
2313 Ga0207694_10026270
2314 Ga0207694_10083167
2315 Ga0207694_10092611
2316 Ga0207694_10100769
2317 Ga0207650_10171033
2318 Ga0207650_10201559
2319 Ga0207687_10079093
2320 Ga0207687_10155075
2321 Ga0207687_10703327
2322 Ga0207700_10072422
2323 Ga0207700_10251740
2324 Ga0207664_10010393
2325 Ga0207664_10182205
2326 Ga0207664_10204329
2327 Ga0207664_10547262
2328 Ga0207644_10063880
2329 Ga0207644_10261401
2330 Ga0207644_10412647
2331 Ga0207644_10839471
2332 Ga0207690_10356032
2333 Ga0207706_10176050
2334 Ga0207706_10241977
2335 Ga0207686_10132978
2336 Ga0207686_10178699
2337 Ga0207686_10232711
2338 Ga0207686_10452097
2339 Ga0207709_10170416
2340 Ga0207709_10355602
2341 Ga0207670_10129044
2342 Ga0207670_10631456
2343 Ga0207669_10022383
2344 Ga0207669_10077747
2345 Ga0207704_10362022
2346 Ga0207665_10000883
2347 Ga0207665_10012221
2348 Ga0207665_10022858
2349 Ga0207665_10115534
2350 Ga0207691_10536158
2351 Ga0207711_10053689
2352 Ga0207711_10159713
2353 Ga0207711_10193091
2354 Ga0207711_10274003
2355 Ga0207689_10027093
2356 Ga0207689_10154733
2357 Ga0207661_10005672
2358 Ga0207661_10011706
2359 Ga0207661_10030324
2360 Ga0207679_10194024
2361 Ga0207679_10325726
2362 Ga0207679_10795778
2363 Ga0207667_10013785
2364 Ga0207667_10076007
2365 Ga0207667_10116122
2366 Ga0207667_10186019
2367 Ga0207667_10287329
2368 Ga0207667_10363976
2369 Ga0207667_10446067
2370 Ga0207667_10569218
2371 Ga0207651_10401057
2372 Ga0207712_10029029
2373 Ga0207712_10415076
2374 Ga0207668_10166618
2375 Ga0207668_10171153
2376 Ga0207668_10184220
2377 Ga0207668_10191691
2378 Ga0207668_10691793
2379 Ga0207640_10037366
2380 Ga0207640_10043166
2381 Ga0207640_10127987
2382 Ga0207640_10313514
2383 Ga0207640_10692248
2384 Ga0207658_10201278
2385 Ga0207658_10382859
2386 Ga0207677_10082113
2387 Ga0207677_10109588
2388 Ga0207677_10650593
2389 Ga0207703_10664426
2390 Ga0207703_10711093
2391 Ga0207639_10005857
2392 Ga0207639_10071612
2393 Ga0207639_10071905
2394 Ga0207639_10148092
2395 Ga0207639_10398839
2396 Ga0207639_11156156
2397 Ga0207678_10070411
2398 Ga0207678_10122679
2399 Ga0207678_10191437
2400 Ga0207678_10289410
2401 Ga0207708_10274520
2402 Ga0207702_10000004
2403 Ga0207702_10010411
2404 Ga0207702_10119063
2405 Ga0207702_10165491
2406 Ga0207702_10269383
2407 Ga0207702_10596896
2408 Ga0207702_10671654
2409 Ga0207702_10860770
2410 Ga0207641_10109214
2411 Ga0207641_10921228
2412 Ga0207648_10043666
2413 Ga0207648_10718355
2414 Ga0207676_10721106
2415 Ga0207674_10004725
2416 Ga0207674_10005754
2417 Ga0207674_10051030
2418 Ga0207674_10054515
2419 Ga0207674_10253984
2420 Ga0207674_10570540
2421 Ga0207675_100066332
2422 Ga0207675_100103203
2423 Ga0207675_100256940
2424 Ga0207675_100320949
2425 Ga0207675_100431583
2426 Ga0207683_10042727
2427 Ga0207683_10100679
2428 Ga0207683_10216139
2429 Ga0207683_10315563
2430 Ga0207683_10319671
2431 Ga0207683_10564394
2432 Ga0207698_10020218
2433 Ga0207698_10062251
2434 Ga0207698_10105572
2435 Ga0207698_10188168
2436 Ga0207698_10214105
2437 Ga0207698_10775302
2438 Ga0209389_1000157
2439 Ga0209389_1002628
2440 Ga0209589_1000035
2441 Ga0209589_1010054
2442 Ga0209489_100079
2443 Ga0209489_101111
2444 Ga0209489_108314
2445 Ga0209700_100011
2446 Ga0209700_100077
2447 Ga0209179_1025672
2448 Ga0209588_1021388
2449 Ga0209813_10017597
2450 Ga0207428_10116488
2451 Ga0268266_10001236
2452 Ga0268266_10004650
2453 Ga0268266_10023413
2454 Ga0268266_11101644
2455 Ga0268265_10181291
2456 Ga0268264_10000062
2457 Ga0265326_10042825
2458 Ga0265319_1012209
2459 Ga0265334_10018421
2460 Ga0265318_10113347
2461 Ga0265323_10002052
2462 Ga0265322_10019902
2463 Ga0265336_10006935
2464 Ga0307517_10000175
2465 Ga0307517_10154848
2466 Ga0307517_10184938
2467 Ga0307515_10153519
2468 Ga0307515_10256125
2469 Ga0265338_10001066
2470 Ga0265324_10006962
2471 Ga0307511_10248289
2472 Ga0307512_10264446
2473 Ga0265330_10029574
2474 Ga0265330_10041820
2475 Ga0265332_10064907
2476 Ga0265325_10014735
2477 Ga0265340_10014954
2478 Ga0265339_10012660
2479 Ga0265331_10069792
2480 Ga0265331_10191712
2481 Ga0307513_10333874
2482 Ga0307509_10038191
2483 Ga0307509_10143590
2484 Ga0307509_10500397
2485 Ga0307408_100800975
2486 Ga0307508_10000045
2487 Ga0307508_10139575
2488 Ga0307508_10147259
2489 Ga0307508_10553802
2490 Ga0265314_10005887
2491 Ga0265314_10050484
2492 Ga0265314_10071752
2493 Ga0265342_10008380
2494 Ga0265342_10288626
2495 Ga0265342_10293897
2496 Ga0307516_10016686
2497 Ga0307516_10117042
2498 Ga0307405_10056708
2499 Ga0307410_10307002
2500 Ga0307406_10269253
2501 Ga0307407_10734445
2502 Ga0307412_10065283
2503 Ga0307416_100145455
2504 Ga0307416_100631037
2505 Ga0307411_10515635
2506 Ga0307411_10758544
2507 Ga0307415_100412418
2508 Ga0307507_10148703
2509 Ga0307510_10013138
2510 Ga0307510_10014518
2511 Ga0315911_1000008
2512 Ga0373926_0004776
2513 Ga0373926_0028267
2514 Ga0373928_0038806
2515 Ga0373934_0000780
2516 Ga0373934_0026919
2517 Ga0373944_0052814
2518 Ga0373923_0008412
2519 Ga0373923_0076584
2520 Ga0373923_0083745
2521 Ga0373923_0172575
2522 Ga0373936_0021610
2523 Ga0373936_0027809
2524 Ga0373936_0043664
2525 Ga0373936_0076313
2526 Ga0373945_0002845
2527 Ga0373945_0061846
2528 Ga0373953_0092119
2529 Ga0373956_0001732
2530 Ga0373956_0061422
2531 Ga0373956_0090808
2532 Ga0373957_0001309
2533 Ga0373957_0012503
2534 Ga0373957_0033998
2535 Ga0373960_0050314
2536 Ga0373943_0037844
2537 Ga0373943_0037978
2538 Ga0373943_0140321
2539 Ga0373943_0241441
2540 Ga0373943_0325905
2541 Ga0373946_0001716
2542 Ga0373955_0126352
2543 Ga0373962_0047155
2544 Ga0373924_0005291
2545 Ga0373924_0021215
2546 Ga0373931_0153079
2547 Ga0373931_0179829
2548 Ga0373935_0001046
2549 Ga0373935_0413110
2550 Ga0373935_0417320
2551 Ga0373927_0001064
2552 Ga0373927_0001972
2553 Ga0373927_0008017
2554 Ga0373927_0010444
2555 Ga0373927_0021518
2556 Ga0373927_0052332
2557 Ga0373927_0068391
2558 Ga0373933_0000068
2559 Ga0373933_0057503
2560 Ga0373933_0085973
2561 Ga0373933_0356621
2562 Ga0373933_0449094
2563 Ga0373947_0002167
2564 Ga0373947_0019455
2565 Ga0373947_0030529
2566 Ga0373947_0058446
2567 Ga0373947_0150565
2568 Ga0373947_0151038
2569 Ga0373947_0252253
2570 Ga0373937_0043074
2571 Ga0373937_0075202
2572 Ga0373925_0005141
2573 Ga0373925_0024532
2574 Ga0373925_0040045
2575 Ga0373925_0056601
2576 Ga0373925_0105266
2577 Ga0373925_0286126
2578 Ga0373925_0597686
2579 Ga0373925_0783684
2580 Ga0395899_0262652
2581 Ga0395900_0006757
2582 Ga0395900_0015450
2583 Ga0395900_0137229
2584 Ga0395900_0298834
2585 Ga0395900_0860627
2586 Ga0395898_0011951
2587 Ga0395898_0016369
2588 Ga0395898_0052957
2589 Ga0395898_0090210
2590 Ga0395905_0001948
2591 Ga0395905_0023265
2592 Ga0395905_0312554
2593 Ga0436364_0617141
2594 Ga0436364_0976416
2595 Ga0436364_1015631
2596 Ga0436364_1444289
2597 Ga0395901_0165896
2598 Ga0395901_0305186
2599 Ga0436365_0112616
2600 Ga0436365_0469659
2601 Ga0436365_0671443
2602 Ga0436365_1040719
2603 Ga0436365_1629119
2604 Ga0436365_1908508
2605 Ga0436360_0233780
2606 Ga0436360_1049680
2607 Ga0436361_0364288
2608 Ga0436361_0750635
2609 Ga0436361_1013106
2610 Ga0436363_0426668
2611 Ga0436363_0779766
2612 Ga0436363_0977790
2613 Ga0436363_1376007
2614 Ga0436362_0251519
2615 Ga0436362_0570020
2616 Ga0436362_0987028
2617 Ga0451787_220816
2618 Ga0451789_0350437
2619 Ga0451791_1697094
2620 Ga0451795_0375601
2621 Ga0451843_0148428
2622 Ga0466969_0016565
2623 Ga0466972_0002927
2624 Ga0466972_0012390
2625 Ga0466972_0126517
2626 Ga0466965_0011930
2627 Ga0466965_0071960
2628 Ga0466965_0119356
2629 Ga0466966_0022780
2630 Ga0466966_0051085
2631 Ga0466961_0000709
2632 Ga0466961_0273462
2633 Ga0466963_0087882
2634 Ga0466963_0438665
2635 Ga0466963_0475982
2636 Ga0466964_0221722
2637 Ga0466968_0056766
2638 Ga0466968_0157130
2639 Ga0466970_0081759
2640 Ga0466957_0037744
2641 Ga0466957_0094669
2642 Ga0466957_0395161
2643 Ga0466959_0009693
2644 Ga0466959_0013890
2645 Ga0466959_0147742
2646 Ga0466958_0156277
2647 Ga0466967_0052224
2648 Ga0466967_0060911
2649 Ga0466967_0068756
2650 Ga0466967_0140103
2651 Ga0466967_0145430
2652 Ga0466967_0178275
2653 Ga0495617_007858
2654 Ga0495592_0017770
2655 Ga0495592_0032666
2656 Ga0495592_0057120
2657 Ga0495592_0077436
2658 Ga0495603_0002438
2659 Ga0495603_0036471
2660 Ga0495603_0097607
2661 Ga0495603_0119907
2662 Ga0495603_0156802
2663 Ga0495603_0193120
2664 Ga0495590_0048632
2665 Ga0495629_0003619
2666 Ga0495629_0008023
2667 Ga0495629_0085166
2668 Ga0495629_0091272
2669 Ga0495629_0191718
2670 Ga0495629_0676205
2671 Ga0495638_0080061
2672 Ga0495638_0098501
2673 Ga0495638_0163579
2674 Ga0495641_0002985
2675 Ga0495641_0219236
2676 Ga0495651_0029728
2677 Ga0495651_0051549
2678 Ga0495651_0216124
2679 Ga0495651_0222108
2680 Ga0495653_0001635
2681 Ga0495653_0019937
2682 Ga0495653_0193389
2683 Ga0495650_0066621
2684 Ga0495580_0001546
2685 Ga0495580_0022982
2686 Ga0495580_0075302
2687 Ga0495580_0119762
2688 Ga0495582_0000535
2689 Ga0495582_0015124
2690 Ga0495582_0236394
2691 Ga0495639_0001501
2692 Ga0495639_0060279
2693 Ga0495639_0078492
2694 Ga0495639_0225122
2695 Ga0495662_0000510
2696 Ga0495664_0006101
2697 Ga0495664_0082524
2698 Ga0495664_0152430
2699 Ga0495664_0189099
2700 Ga0495664_0371466
2701 Ga0495664_0398054
2702 Ga0495585_0059571
2703 Ga0495585_0188504
2704 Ga0495585_0214663
2705 Ga0495594_0000467
2706 Ga0495594_0037377
2707 Ga0495594_0064308
2708 Ga0495594_0087032
2709 Ga0495594_0274512
2710 Ga0495596_0067988
2711 Ga0495596_0103078
2712 Ga0495596_0158952
2713 Ga0495583_0035839
2714 Ga0495606_0000831
2715 Ga0495606_0080287
2716 Ga0495606_0107909
2717 Ga0495606_0153961
2718 Ga0495608_0018999
2719 Ga0495608_0035295
2720 Ga0495610_0035434
2721 Ga0495616_0060651
2722 Ga0495616_0081206
2723 Ga0495618_0035312
2724 Ga0495618_0322370
2725 Ga0495618_0471414
2726 Ga0495620_0048269
2727 Ga0495620_0087635
2728 Ga0495628_0043951
2729 Ga0495628_0223081
2730 Ga0495628_0297867
2731 Ga0495628_0570056
2732 Ga0495630_0009913
2733 Ga0495631_0024014
2734 Ga0495631_0106620
2735 Ga0495632_0049014
2736 Ga0495632_0083902
2737 Ga0495632_0108892
2738 Ga0495637_0142636
2739 Ga0495643_0097652
2740 Ga0495643_0117498
2741 Ga0495644_0023987
2742 Ga0495644_0070904
2743 Ga0495648_0002812
2744 Ga0495648_0027211
2745 Ga0495666_0057156
2746 Ga0495666_0142311
2747 Ga0495652_0059360
2748 Ga0495652_0068112
2749 Ga0495652_0070098
2750 Ga0495652_0165886
2751 Ga0495652_0167037
2752 Ga0495652_0258866
2753 Ga0495654_0015350
2754 Ga0495654_0112650
2755 Ga0495654_0236238
2756 Ga0495665_0001927
2757 Ga0495665_0022232
2758 Ga0495665_0139778
2759 Ga0495640_0007295
2760 Ga0495640_0015412
2761 Ga0495640_0023272
2762 Ga0495640_0064128
2763 Ga0495640_0138819
2764 Ga0495640_0431526
2765 Ga0495586_0064230
2766 Ga0495586_0125755
2767 Ga0495587_0005610
2768 Ga0495587_0110680
2769 Ga0495598_0053475
2770 Ga0495597_0123966
2771 Ga0495645_0045402
2772 Ga0495645_0052602
2773 Ga0495645_0245387
2774 Ga0495622_0008565
2775 Ga0495622_0008650
2776 Ga0495622_0011328
2777 Ga0495622_0014834
2778 Ga0495622_0055608
2779 Ga0495622_0123865
2780 Ga0495667_0010575
2781 Ga0495667_0018500
2782 Ga0495667_0025319
2783 Ga0495667_0036607
2784 Ga0495667_0158642
2785 Ga0495667_0170067
2786 Ga0495667_0299273
2787 Ga0495656_0012319
2788 Ga0495656_0048289
2789 Ga0495668_0065348
2790 Ga0495668_0115910
2791 Ga0495668_0116320
2792 Ga0495668_0148055
2793 Ga0495634_0011829
2794 Ga0495634_0013239
2795 Ga0495634_0036690
2796 Ga0495634_0036827
2797 Ga0495634_0120863
2798 Ga0495634_0457594
2799 Ga0495625_0231521
2800 Ga0495625_0544764
2801 Ga0495635_0017402
2802 Ga0495635_0052925
2803 Ga0495635_0088614
2804 Ga0495635_0100102
2805 Ga0495635_0292186
2806 Ga0495659_0047094
2807 Ga0495661_0022644
2808 Ga0495661_0221179
2809 Ga0495588_0002722
2810 Ga0495588_0045412
2811 Ga0495588_0063663
2812 Ga0495588_0114666
2813 Ga0495588_0210595
2814 Ga0495588_0309897
2815 Ga0495657_0013439
2816 Ga0495657_0062004
2817 Ga0495657_0072896
2818 Ga0495657_0099160
2819 Ga0495599_0000562
2820 Ga0495599_0083667
2821 Ga0495599_0163328
2822 Ga0495623_0028554
2823 Ga0495623_0062253
2824 Ga0495646_0056073
2825 Ga0495647_0000600
2826 Ga0495647_0052850
2827 Ga0495647_0060656
2828 Ga0495647_0094038
2829 Ga0495658_0001083
2830 Ga0495658_0058586
2831 Ga0495658_0442412
2832 Ga0495669_0016067
2833 Ga0495669_0172151
2834 Ga0495669_0299933
2835 Ga0495613_0005438
2836 Ga0495613_0031723
2837 Ga0495613_0045965
2838 Ga0495613_0094203
2839 Ga0495613_0133484
2840 Ga0495624_0005136
2841 Ga0495624_0110305
2842 Ga0495624_0174956
2843 Ga0495624_0194110
2844 Ga0495670_0156078
2845 Ga0495671_0145537
2846 Ga0495649_0333587
2847 Ga0495589_0106446
2848 Ga0495589_0173069
2849 Ga0495589_0314973
2850 Ga0495600_0016680
2851 Ga0495600_0040589
2852 Ga0495600_0135105
2853 Ga0495600_0135335
2854 Ga0495660_0125536
2855 Ga0495660_0228576
2856 Ga0495581_0003213
2857 Ga0495581_0083551
2858 Ga0495581_0094681
2859 Ga0495581_0150796
2860 Ga0495581_0204030
2861 Ga0495581_0219225
2862 Ga0495581_0306475
2863 Ga0495604_0006935
2864 Ga0495604_0043593
2865 Ga0495604_0052890
2866 Ga0495604_0081771
2867 Ga0495604_0096764
2868 Ga0495604_0407825
2869 Ga0495636_0141303
2870 Ga0495674_0010035
2871 Ga0495674_0023287
2872 Ga0495674_0034718
2873 Ga0495674_0036341
2874 Ga0495672_0056579
2875 Ga0495672_0076637
2876 Ga0495672_0112047
2877 Ga0495676_0007949
2878 Ga0495676_0030366
2879 Ga0495676_0075768
2880 Ga0495676_0154352
2881 Ga0495680_0009468
2882 Ga0495680_0108926
2883 Ga0495680_0142242
2884 Ga0495687_031149
2885 Ga0495675_0003041
2886 Ga0495675_0024619
2887 Ga0495677_0109489
2888 Ga0495677_0134387
2889 Ga0495685_031546
2890 Ga0495685_050130
2891 Ga0495681_0217698
2892 Ga0495684_0005455
2893 Ga0495684_0008298
2894 Ga0495684_0016579
2895 Ga0495684_0103944
2896 Ga0495686_0023297
2897 Ga0495686_0117418
2898 Ga0495593_0005017
2899 Ga0495593_0006937
2900 Ga0495593_0246952
2901 Ga0495602_0014209
2902 Ga0495602_0056225
2903 Ga0495602_0083756
2904 Ga0495614_0045529
2905 Ga0495614_0116556
2906 Ga0495615_0066073
2907 Ga0495626_0062128
2908 Ga0496100_0062747
2909 Ga0496100_0089284
2910 Ga0496100_0143565
2911 Ga0496100_0442803
2912 Ga0496100_0460513
2913 Ga0496101_0008819
2914 Ga0496101_0067232
2915 Ga0496101_0186034
2916 Ga0496101_0190630
2917 Ga0496101_0247327
2918 Ga0496101_0814301
2919 Ga0496102_0047085
2920 Ga0496102_0239155
2921 Ga0496102_0287108
2922 Ga0496102_0291410
2923 Ga0496102_0389582
2924 Ga0496102_0391795
2925 Ga0496102_0527933
2926 Ga0496102_0927540
2927 Ga0496103_0020714
2928 Ga0496103_0025116
2929 Ga0496103_0043006
2930 Ga0496103_0108597
2931 Ga0496103_0315427
2932 Ga0496104_0015949
2933 Ga0496104_0060516
2934 Ga0496104_0063253
2935 Ga0496104_0063908
2936 Ga0496104_0121670
2937 Ga0496104_0454660
2938 Ga0496105_0035046
2939 Ga0496105_0125522
2940 Ga0496105_0132833
2941 Ga0496105_0144798
2942 Ga0496105_0185145
2943 Ga0496105_0319146
2944 Ga0496105_0503361
2945 Ga0496106_0001075
2946 Ga0496106_0006134
2947 Ga0496106_0033686
2948 Ga0496106_0034614
2949 Ga0496106_0078180
2950 Ga0496106_0089316
2951 Ga0496106_0125167
2952 Ga0496106_0164580
2953 Ga0496106_0233168
2954 Ga0496106_0233297
2955 Ga0496106_0963860
2956 Ga0496107_0002790
2957 Ga0496107_0016231
2958 Ga0496107_0068417
2959 Ga0496107_0103174
2960 Ga0496107_0162297
2961 Ga0496107_0168553
2962 Ga0496108_0000309
2963 Ga0496108_0016858
2964 Ga0496108_0028705
2965 Ga0496108_0051538
2966 Ga0496108_0063183
2967 Ga0496108_0121642
2968 Ga0496108_0189426
2969 Ga0496108_0604487
2970 Ga0496109_0000229
2971 Ga0496109_0032621
2972 Ga0496109_0077882
2973 Ga0496109_0170106
2974 Ga0496109_0313659
2975 Ga0496109_0416058
2976 Ga0496109_0516448
2977 Ga0496110_0006428
2978 Ga0496110_0011598
2979 Ga0496110_0054776
2980 Ga0496110_0062128
2981 Ga0496110_0074112
2982 Ga0496110_0205482
2983 Ga0496110_0208458
2984 Ga0496110_0662554
2985 Ga0496110_0772862
2986 Ga0496111_0083463
2987 Ga0496111_0101763
2988 Ga0496112_0000018
2989 Ga0496112_0004329
2990 Ga0496112_0109234
2991 Ga0496112_0115294
2992 Ga0496112_0146630
2993 Ga0496112_0149444
2994 Ga0496112_0769298
2995 Ga0496112_0809407
2996 Ga0496112_0912388
2997 Ga0496113_0033720
2998 Ga0496113_0085981
2999 Ga0496113_0090910
3000 Ga0496113_0103971
3001 Ga0496113_0119404
3002 Ga0496113_0196200
3003 Ga0496113_0502883
3004 Ga0496114_0135739
3005 Ga0496114_0144988
3006 Ga0496114_0176135
3007 Ga0496114_0505154
3008 Ga0496114_0556609
3009 Ga0496114_0623241
3010 Ga0496114_0635180
3011 Ga0496115_0011619
3012 Ga0496115_0036077
3013 Ga0496115_0042915
3014 Ga0496115_0057694
3015 Ga0496115_0094397
3016 Ga0496115_0162644
3017 Ga0496115_0243978
3018 Ga0496116_0007008
3019 Ga0496116_0023038
3020 Ga0496116_0159763
3021 Ga0496117_0019265
3022 Ga0496117_0066469
3023 Ga0496117_0076623
3024 Ga0496117_0095389
3025 Ga0496117_0195937
3026 Ga0496117_0217508
3027 Ga0496118_0001623
3028 Ga0496118_0036906
3029 Ga0496118_0040080
3030 Ga0496118_0079139
3031 Ga0496118_0124268
3032 Ga0496118_0136255
3033 Ga0496119_0020608
3034 Ga0496119_0062296
3035 Ga0496119_0102194
3036 Ga0496119_0106419
3037 Ga0496119_0106789
3038 Ga0496119_0114762
3039 Ga0496120_0033680
3040 Ga0496120_0210876
3041 Ga0496121_0000278
3042 Ga0496121_0001257
3043 Ga0496121_0001616
3044 Ga0496121_0007162
3045 Ga0496121_0015944
3046 Ga0496121_0018665
3047 Ga0496121_0023428
3048 Ga0496121_0056238
3049 Ga0496121_0079961
3050 Ga0496121_0080084
3051 Ga0496121_0093322
3052 Ga0496121_0185204
3053 Ga0496121_0190564
3054 Ga0496121_0190901
3055 Ga0496121_0217736
3056 Ga0496121_0221531
3057 Ga0496121_0228696
3058 Ga0496121_0406186
3059 Ga0496122_0039152
3060 Ga0496122_0084029
3061 Ga0496122_0097485
3062 Ga0496123_0030316
3063 Ga0496123_0054034
3064 Ga0496123_0113666
3065 Ga0496123_0244904
3066 Ga0496124_0003470
3067 Ga0496124_0119785
3068 Ga0496124_0260355
3069 Ga0496125_0000407
3070 Ga0496125_0000516
3071 Ga0496125_0063468
3072 Ga0496125_0065510
3073 Ga0496125_0198579
3074 Ga0496126_0003267
3075 Ga0496126_0003347
3076 Ga0496126_0013009
3077 Ga0496126_0022484
3078 Ga0496126_0036990
3079 Ga0496126_0056455
3080 Ga0496126_0085105
3081 Ga0496126_0095786
3082 Ga0496126_0151402
3083 Ga0496126_0169916
3084 Ga0496126_0177574
3085 Ga0496126_0186810
3086 Ga0496126_0271210
3087 Ga0496126_0322405
3088 Ga0496126_0342420
3089 Ga0496126_0355671
3090 Ga0496126_0384659
3091 Ga0496126_0510452
3092 Ga0495678_080281
3093 Ga0495682_0150731
3094 Ga0501031_0006376
3095 Ga0501031_0016900
3096 Ga0501031_0037027
3097 Ga0501031_0247488
3098 Ga0501031_0327285
3099 Ga0501032_0001063
3100 Ga0501032_0058641
3101 Ga0501032_0142644
3102 Ga0501032_0160872
3103 Ga0501032_0222461
3104 Ga0501033_0000082
3105 Ga0501033_0001708
3106 Ga0501033_0035311
3107 Ga0501034_0000198
3108 Ga0501034_0091995
3109 Ga0501034_0166246
3110 Ga0501034_0489493
3111 Ga0501034_0592677
3112 Ga0501034_0694792
3113 Ga0501036_0001033
3114 Ga0501036_0021624
3115 Ga0501036_0078034
3116 Ga0501036_0296898
3117 Ga0501036_0320776
3118 Ga0501036_0403881
3119 Ga0501037_0000050
3120 Ga0501037_0008923
3121 Ga0501037_0080378
3122 Ga0501037_0415273
3123 Ga0501038_0004264
3124 Ga0501038_0010520
3125 Ga0501038_0023661
3126 Ga0501038_0035664
3127 Ga0501038_0055066
3128 Ga0501038_0143438
3129 Ga0501038_0166075
3130 Ga0501039_0000366
3131 Ga0501039_0078556
3132 Ga0501039_0079837
3133 Ga0501039_0154373
3134 Ga0501039_0156867
3135 Ga0501039_0258789
3136 Ga0501039_0487024
3137 Ga0501041_0286756
3138 Ga0501042_0061835
3139 Ga0501042_0110747
3140 Ga0501043_0001664
3141 Ga0501043_0008468
3142 Ga0501043_0028438
3143 Ga0501043_0195154
3144 Ga0501043_0669817
3145 Ga0501046_0003642
3146 Ga0501046_0005790
3147 Ga0501046_0046637
3148 Ga0501046_0082240
3149 Ga0501047_0000131
3150 Ga0501047_0006910
3151 Ga0501047_0025713
3152 Ga0501047_0030818
3153 Ga0501047_0167451
3154 Ga0501048_0000531
3155 Ga0501048_0233544
3156 Ga0501067_0000101
3157 Ga0501067_0108255
3158 Ga0501068_0000988
3159 Ga0501068_0433160
3160 Ga0501069_0000565
3161 Ga0501070_0004413
3162 Ga0501070_0013834
3163 Ga0501070_0030097
3164 Ga0501070_0047792
3165 Ga0501070_0212624
3166 Ga0501070_0227802
3167 Ga0501070_0372460
3168 Ga0501072_0734565
3169 Ga0501073_0000230
3170 Ga0501073_0158573
3171 Ga0501073_0229530
3172 Ga0501074_0000141
3173 Ga0501074_0041688
3174 Ga0501079_0069255
3175 Ga0501079_0654753
3176 Ga0501080_0000093
3177 Ga0501080_0128172
3178 Ga0501080_0369499
3179 Ga0501083_0000341
3180 Ga0501035_0005747
3181 Ga0501035_0018523
3182 Ga0501035_0050826
3183 Ga0501035_0304426
3184 Ga0501044_0000100
3185 Ga0501044_0151247
3186 Ga0501044_0208205
3187 Ga0501044_0365010
3188 Ga0501044_0381750
3189 Ga0501044_0426579
3190 Ga0501044_0594789
3191 Ga0501044_0644912
3192 Ga0501045_0010802
3193 nmdc:mga03683_55008_c1
3194 nmdc:mga03683_55598_c1
3195 nmdc:mga03n38_10224_c1
3196 nmdc:mga03n38_142092_c1
3197 nmdc:mga03n38_191436_c1
3198 nmdc:mga03n38_442925_c1
3199 nmdc:mga03n38_58333_c1
3200 nmdc:mga00v17_245180_c1
3201 nmdc:mga00v17_26711_c1
3202 nmdc:mga0yw44_122406_c1
3203 nmdc:mga0yw44_137756_c1
3204 nmdc:mga0yw44_234700_c1
3205 nmdc:mga0yw44_270253_c1
3206 nmdc:mga0yw44_28542_c1
3207 nmdc:mga0yw44_39867_c1
3208 nmdc:mga0yw44_458341_c1
3209 nmdc:mga0k408_33226_c2
3210 nmdc:mga06z11_260162_c1
3211 nmdc:mga06z11_435041_c1
3212 nmdc:mga06z11_97958_c1
3213 nmdc:mga04h51_14508_c1
3214 nmdc:mga07m45_13705_c1
3215 nmdc:mga07m45_35028_c1
3216 nmdc:mga08y16_384673_c1
3217 nmdc:mga0n895_17771_c1
3218 nmdc:mga0n895_181515_c1
3219 nmdc:mga0n895_31488_c1
3220 nmdc:mga0rr50_346913_c1
3221 nmdc:mga0rr50_375527_c1
3222 nmdc:mga08x19_486796_c1
3223 nmdc:mga0a205_554655_c1
3224 nmdc:mga0a205_835376_c1
3225 nmdc:mga0sz30_16062_c1
3226 nmdc:mga0sz30_28046_c1
3227 nmdc:mga0sz30_5780_c2
3228 Ga0495601_0000392
3229 Ga0495601_0054488
3230 Ga0495601_0215628
3231 Ga0495601_0338167
3232 Ga0495601_0525539
3233 Ga0495612_0008868
3234 Ga0495612_0153126
3235 Ga0500610_0147797
3236 Ga0500610_0163685
3237 Ga0495655_0044956
3238 Ga0495655_0127737
3239 Ga0495595_0003205
3240 Ga0495595_0118623
3241 Ga0495619_0014255
3242 Ga0495619_0014580
3243 Ga0495619_0027133
3244 Ga0500578_0218103
3245 Ga0500643_000076
3246 Ga0500643_043764
3247 Ga0500644_0308840
3248 Ga0500581_052772
3249 Ga0500647_0018897
3250 Ga0500583_0173565
3251 Ga0500651_0038112
3252 Ga0500651_0078589
3253 Ga0500566_0000107
3254 Ga0500566_0000277
3255 Ga0500566_0009047
3256 Ga0500566_0084678
3257 Ga0500566_0219786
3258 Ga0500641_0045694
3259 Ga0500641_0066694
3260 Ga0500650_0048502
3261 Ga0500554_004326
3262 Ga0500555_020273
3263 Ga0500556_0000081
3264 Ga0500556_0008699
3265 Ga0500557_000102
3266 Ga0500562_019322
3267 Ga0500572_000551
3268 Ga0500572_066946
3269 Ga0500591_030555
3270 Ga0500592_011263
3271 Ga0500592_021433
3272 Ga0500594_0024035
3273 Ga0500594_0065760
3274 Ga0500595_001181
3275 Ga0500595_007372
3276 Ga0500595_014778
3277 Ga0500595_022824
3278 Ga0500595_025522
3279 Ga0500595_026407
3280 Ga0500595_041399
3281 Ga0500595_086467
3282 Ga0500608_021321
3283 Ga0500608_044035
3284 Ga0500628_044666
3285 Ga0500642_0000042
3286 Ga0500642_0000225
3287 Ga0500652_001540
3288 Ga0500658_0027327
3289 Ga0500658_0089989
3290 Ga0500658_0140101
3291 Ga0500559_0000857
3292 Ga0500559_0001081
3293 Ga0500559_0019840
3294 Ga0500559_0028884
3295 Ga0500561_0047514
3296 Ga0500568_0002631
3297 Ga0500568_0006224
3298 Ga0500568_0026198
3299 Ga0500573_0084823
3300 Ga0500577_0001501
3301 Ga0500577_0199001
3302 Ga0500579_217814
3303 Ga0500585_151812
3304 Ga0500589_166450
3305 Ga0500590_023202
3306 Ga0500590_151556
3307 Ga0500603_002896
3308 Ga0500603_010161
3309 Ga0500603_054382
3310 Ga0500603_056077
3311 Ga0500604_0005100
3312 Ga0500616_0000227
3313 Ga0500616_0000244
3314 Ga0500616_0017169
3315 Ga0500619_044245
3316 Ga0500620_051856
3317 Ga0500622_0002743
3318 Ga0500622_0004369
3319 Ga0500624_035402
3320 Ga0500627_0165099
3321 Ga0500627_0237262
3322 Ga0500633_0047836
3323 Ga0500638_000149
3324 Ga0500638_036029
3325 Ga0500639_093771
3326 Ga0500636_0001169
3327 Ga0500636_0003600
3328 Ga0500636_0083689
3329 Ga0500636_0100367
3330 Ga0500637_0001223
3331 Ga0500637_0002162
3332 Ga0500637_0186371
3333 Ga0500649_183161
3334 Ga0500576_024107
3335 Ga0500552_016468
3336 Ga0500596_002382
3337 Ga0500596_006512
3338 Ga0500601_001128
3339 Ga0500601_005258
3340 Ga0501084_0003619
3341 Ga0500661_005511
3342 Ga0500661_009014
3343 Ga0501082_0005938
3344 Ga0466962_0077292
3345 Ga0530510_0504883
3346 2507505402
3347 2508539291
3348 2508695614
3349 2509151963
3350 2511394505
3351 2513623970
3352 2513642143
3353 2513651384
3354 2513661433
3355 2513675005
3356 2513695245
3357 2513705567
3358 2513718191
3359 2513859430
3360 2513873396
3361 2513888621
3362 2513923129
3363 2514014725
3364 2515627601
3365 2517106331
3366 2517889002
3367 2524442480
3368 2524467023
3369 2524537430
3370 2528855063
3371 2603858332
3372 2617352106
3373 2617373577
3374 2644291052
3375 2671122599
3376 2723841770
3377 2728748477
3378 2745077523
3379 2793062183
3380 2793073692
3381 2793078354
3382 2805920744
3383 2818237807
3384 2824607315
3385 2824616879
3386 2824624409
3387 2824632778
3388 2824642050
3389 2824649494
3390 2824659699
3391 2824669406
3392 2824677372
3393 2824686313
3394 2824694108
3395 2824702718
3396 2824711440
3397 2824719379
3398 2824729884
3399 2824738921
3400 2824751649
3401 2824762546
3402 2824771880
3403 2824780787
3404 2838124649
3405 2841945340
3406 2841952125
3407 2841965462
3408 2841970487
3409 2841981735
3410 2841985016
3411 2842043374
3412 2842052636
3413 2844315493
3414 2847931202
3415 2847942291
3416 2849083161
3417 2857516405
3418 2857526569
3419 2874591677
3420 2874607933
3421 2874619107
3422 2874621250
3423 2874628656
3424 2874646162
3425 2876769592
3426 2876771778
3427 2876819122
3428 2879075631
3429 2879085541
3430 2879105888
3431 2879113359
3432 2879128440
3433 2879143582
3434 2881369272
3435 2881669949
3436 2885369381
3437 2885382790
3438 2885388544
3439 2885411832
3440 2888379452
3441 2888390549
3442 2888420174
3443 2889035349
3444 2893067185
3445 2903733446
3446 2903758962
3447 2903775477
3448 2904667795
3449 2904691054
3450 2904708458
3451 2904716376
3452 2906608582
3453 2906613628
3454 2906628553
3455 2906641628
3456 2906651392
3457 2906668156
3458 2908747600
3459 2908756448
3460 2908776050
3461 2919073612
3462 2922363162
3463 2922369438
3464 2922388534
3465 2922398125
3466 2922434063
3467 2929618733
3468 2929628582
3469 2932790914
3470 2932794191
3471 2932808214
3472 2932812033
3473 2932825516
3474 2932833630
3475 2933580557
3476 2935615571
3477 2935623156
3478 2935636093
3479 2935644231
3480 2935654500
3481 2935663380
3482 2935672187
3483 2935679291
3484 2935686533
3485 2935700316
3486 2935710264
3487 2935716221
3488 2935723655
3489 2935735210
3490 2935743999
3491 2935752499
3492 2935763367
3493 2935772910
3494 2935783299
3495 2935788102
3496 2935796322
3497 2935808255
3498 2935816132
3499 2935825628
3500 2935833525
3501 2935844478
3502 2935853392
3503 2935861404
3504 2935869523
3505 2935879852
3506 2935889215
3507 2935914993
3508 2935918841
3509 2935931442
3510 2935940039
3511 2935947614
3512 2935956385
3513 2935966767
3514 2935973179
3515 2935980571
3516 2935990074
3517 2935997925
3518 2936008810
3519 2936017461
3520 2936026038
3521 2936034880
3522 2936041137
3523 2936052862
3524 2936060282
3525 2940558412
3526 2941512603
3527 2941520559
3528 2941528573
3529 2941535388
3530 2941543349
3531 3005475224
3532 3005486723
3533 3005509029
3534 3005594085
3535 3005595184
3536 3005711130
3537 3005718428
3538 8006928174
3539 8006936056
3540 8006967590
3541 8006975820
3542 8006991059
3543 8007000390
3544 8016518047
3545 8016526278
3546 8016544556
3547 8016557523
3548 8016565879
3549 8016569604
3550 8016582215
3551 8016586240
3552 8016603477
3553 8016618321
3554 8016622969
3555 8016635477
3556 8017058598
3557 8019531172
3558 8019540380
3559 8019549973
3560 8019562600
3561 8019572678
3562 8019577061
3563 8019595133
3564 8019606613
3565 8019611901
3566 8019623115
3567 8019629983
3568 8019640623
3569 8019652331
3570 8019666823
3571 8019676581
3572 8019679410
3573 8019696102
3574 8055742582
3575 8056676095
3576 8056682896
3577 8056691099
3578 8056971440

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00484

Pro_CA

Carbonic anhydrase

72

231

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5swc-assembly1.cif.gz_D the structure of the beta-carbonic anhydrase ccaa 0.8406 6 209
5swc-assembly1.cif.gz_E the structure of the beta-carbonic anhydrase ccaa 0.8338 6 212
5swc-assembly1.cif.gz_D the structure of the beta-carbonic anhydrase ccaa 0.8218 6 209
1ekj-assembly2.cif.gz_G the x-ray crystallographic structure of beta carbonic anhydrase from the c3 dicot pisum sativum 0.8195 6 209
3e24-assembly1.cif.gz_A h. influenzae beta-carbonic anhydrase, variant w39f 0.819 37 197
ID Description Score Start End Superfamily
af_P0ABE9_1_202_3.40.1050.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.8568 5 209 3.40.1050.10
af_P0ABE9_1_202_3.40.1050.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.8491 5 209 3.40.1050.10
5swcF00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.848 6 209 3.40.1050.10
af_A0A1D6NHQ1_7_236_3.40.1050.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.8238 8 201 3.40.1050.10
4o1jB00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.8225 6 200 3.40.1050.10
ID Description Score Start End GO Terms
AF-A0A3S0FDP6-F1-model_v4 deleted 0.9526 57 212
AF-A0A3S0FDP6-F1-model_v4 deleted 0.9408 57 212
AF-A0A440G2B3-F1-model_v4 deleted 0.9173 40 209
AF-A0A3C1SQ75-F1-model_v4 Carbonic anhydrase (EC 4.2.1.1) (Carbonate dehydratase) 0.9149 33 211 GO:0004089
GO:0008270
GO:0015976
AF-A0A849E693-F1-model_v4 carbonic anhydrase (EC 4.2.1.1) 0.9143 40 212 GO:0004089
GO:0008270

Map