F495712

General Info

Members Datasets Scaffolds Average Seq Length
1789 663 1574 538

Family's Representative Sequence

Representative Sequence 3300025942|Ga0207689_10114769|Ga0207689_101147691
Length 624
Sequence MAQNPVVRAPVQLAQALAFYKASSRGSCDYNNRRPTYADVVCNDDQLGVMLYALFRNSGESLQRTPQNATAPYQLFYRREVRMNNGSYLIRLLCLVLIALCSVVLPIEVRAQGKPNIVFIMGDDIGWFNVGAYHRGIMAGRTPNLDQLASQGMMFTDYYAEASCTAGRANFITGEIPFRTGLTTVGQAGSPLGMPAEAPTIATVLKSMGYATGQFGKNHLGDLNSFLPTVHGFDEFFGYLYHLDAMEDPCHRNYPPAAKATVGPRNMLHSWATDKDDPTEQPRWGKIGKQKIEDAGPMCPDRMKTVDDEILANALKFVDKARADSKPFFLWLNPTRMHVVTHLSDKYEQLRTPENGWSIQEAGMAQLDDIVGEVMKYLKDNGLEDNTIIAFSTDNGAENFTWPDGGQTPFAGGKGTALEGGFRVPCIIRWPGRVPAGKVENAIISGLDWFPTLVAAAGDPNIVEELKKGKQLGGTTYKVHLDGYDQSDLITGKGLSKRHEIFYFTETTLSAVRIDDYKYRFTDQPTGWFGGTVKVDWPILTNIRLDPFERTGAYNGRDTGSIEYNNWFMYEFWRFVYVQQEIAKAAQTLLEFPPMQKGASFNLEALKAELERKMEAAKARGASQ

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
3 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
4 2511231008 Pseudomonas sp. GM21 Isolate Nodule
5 2511231012 Pseudomonas sp. GM33 Isolate Nodule
6 2511231014 Pseudomonas sp. GM48 Isolate Nodule
7 2511231015 Pseudomonas sp. GM49 Isolate Nodule
8 2511231017 Pseudomonas sp. GM55 Isolate Nodule
9 2511231020 Pseudomonas sp. GM74 Isolate Nodule
10 2511231021 Pseudomonas sp. GM78 Isolate Nodule
11 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
12 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
13 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
14 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
15 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
16 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
17 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
18 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
19 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
20 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
21 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
22 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
23 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
24 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
25 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
26 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
27 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
28 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
29 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
30 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
31 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
32 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
33 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
34 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
35 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
36 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
37 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
38 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
39 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
40 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
41 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
42 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
43 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
44 2643221718 Rhizobium sp. Root268 Isolate Unclassified
45 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
46 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
47 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
48 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
49 2791355267 Rhizobium sp. L18 Isolate Nodule
50 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
51 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
52 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
53 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
54 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
55 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
56 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
57 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
58 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
59 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
60 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
61 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
62 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
63 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
64 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
65 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
66 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
67 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
68 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
69 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
70 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
71 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
72 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
73 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
74 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
75 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
76 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
77 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
78 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
79 2904699407
80 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
81 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
82 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
83 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
84 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
85 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
86 2922368715
87 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
88 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
89 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
90 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
91 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
92 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
93 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
94 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
95 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
96 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
97 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
98 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
99 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
100 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
101 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
102 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
103 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
104 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
105 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
106 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
107 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
108 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
109 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
110 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
111 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
112 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
113 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
114 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
115 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
116 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
117 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
118 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
119 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
120 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
121 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
122 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
123 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
124 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
125 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
126 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
127 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
128 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
129 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
130 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
131 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
132 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
133 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
134 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
135 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
136 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
137 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
138 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
139 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
140 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
141 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
142 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
143 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
144 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
145 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
146 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
147 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
148 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
149 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
150 2996887358 Rhizobium sp. R711 Isolate Nodule
151 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
152 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
153 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
154 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
155 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
156 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
157 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
158 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
159 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
160 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
161 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
162 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
163 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
164 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
165 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
166 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
167 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
168 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
169 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
170 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
171 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
172 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
173 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
174 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
175 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
176 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
177 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
178 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
179 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
180 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
181 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
182 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
183 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
184 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
185 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
186 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
187 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
188 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
189 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
190 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
191 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
192 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
193 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
194 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
195 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
196 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
197 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
198 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
199 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
200 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
201 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
202 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
203 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
204 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
205 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
206 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
207 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
208 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
209 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
210 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
211 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
212 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
213 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
214 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
215 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
216 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
217 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
218 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
219 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
220 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
221 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
222 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
223 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
224 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
225 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
226 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
227 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
228 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
229 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
230 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
231 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
232 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
233 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
234 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
235 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
236 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
237 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
238 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
239 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
240 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
241 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
242 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
243 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
244 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
245 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
246 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
247 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
248 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
249 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
250 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
251 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
252 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
253 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
254 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
255 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
256 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
257 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
258 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
259 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
260 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
261 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
262 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
263 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
264 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
265 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
266 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
267 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
268 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
269 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
270 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
271 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
272 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
273 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
274 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
275 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
276 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
277 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
278 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
279 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
280 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
281 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
282 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
283 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
284 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
285 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
286 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
287 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
288 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
289 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
290 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
291 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
292 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
293 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
294 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
333 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
339 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
342 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
344 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
345 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
346 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
347 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
348 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
349 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
350 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
351 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
352 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
353 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
354 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
355 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
356 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
357 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
358 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
360 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
361 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
362 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
363 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
364 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
369 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
370 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
371 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
372 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
373 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
374 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
375 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
376 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
377 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
378 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
379 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
380 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
381 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
382 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
383 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
384 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
385 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
386 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
387 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
388 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
389 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
390 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
392 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
393 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
398 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
399 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
400 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
401 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
402 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
403 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
404 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
405 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
406 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
407 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
408 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
409 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
410 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
411 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
412 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
413 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
414 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
415 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
416 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
417 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
418 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
419 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
420 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
421 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
422 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
423 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
424 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
425 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
426 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
427 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
428 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
429 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
430 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
431 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
432 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
433 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
434 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
435 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
436 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
437 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
438 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
439 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
440 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
441 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
442 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
443 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
444 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
445 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
446 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
447 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
448 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
449 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
450 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
451 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
452 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
453 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
454 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
455 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
456 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
457 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
458 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
459 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
460 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
461 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
462 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
463 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
464 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
465 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
466 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
467 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
468 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
469 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
470 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
471 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
472 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
473 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
474 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
475 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
476 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
477 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
478 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
479 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
480 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
481 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
482 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
483 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
484 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
485 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
486 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
487 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
488 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
489 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
490 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
491 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
492 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
493 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
494 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
495 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
496 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
497 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
498 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
499 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
500 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
501 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
502 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
503 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
504 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
505 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
506 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
507 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
508 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
509 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
510 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
511 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
512 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
513 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
514 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
515 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
516 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
517 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
518 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
519 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
520 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
521 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
522 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
523 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
524 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
525 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
526 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
527 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
528 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
529 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
530 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
531 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
532 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
533 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
534 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
535 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
536 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
537 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
538 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
539 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
540 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
541 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
542 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
543 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
544 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
545 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
546 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
547 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
548 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
549 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
550 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
551 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
552 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
553 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
554 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
555 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
556 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
557 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
558 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
559 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
560 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
561 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
562 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
563 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
564 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
565 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
566 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
567 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
568 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
569 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
570 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
571 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
572 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
573 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
574 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
575 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
576 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
577 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
578 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
579 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
580 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
581 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
582 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
583 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
584 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
585 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
586 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
587 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
588 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
589 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
590 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
591 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
592 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
593 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
594 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
595 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
596 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
597 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
598 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
599 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
600 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
601 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
602 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
603 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
604 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
605 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
606 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
607 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
608 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
609 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
610 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
611 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
612 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
613 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
614 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
615 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
616 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
617 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
618 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
619 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
620 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
621 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
622 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
623 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
624 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
625 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
626 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
627 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
628 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
629 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
630 8005258706 Rhizobium sp. R693 Isolate Nodule
631 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
632 8005321885 Rhizobium sp. R72 Isolate Nodule
633 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
634 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
635 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
636 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
637 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
638 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
639 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
640 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
641 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
642 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
643 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
644 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
645 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
646 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
647 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
648 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
649 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
650 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
651 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
652 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
653 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
654 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
655 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
656 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
657 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
658 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
659 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
660 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
661 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
662 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
663 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.29
Metatranscriptomes 1.01
Isolates 11.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.25
Nodule 9.56
Rhizoplane 5.53
Rhizosphere 75.74
Stem 0
Stem Tuber 0
Unclassified 3.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_163 2124908027 Bacteria 31412
2 CNXas_1000056 3300000545 Bacteria 21836
3 LJQas_1003113 3300000549 Bacteria 2242
4 JGI25158J39367_1003658 3300002739 Bacteria 2356
5 JGI25159J45721_1000012 3300002987 Bacteria 149808
6 JGI25159J45721_1000051 3300002987 Bacteria 57197
7 JGI25160J50197_1000040 3300003354 Bacteria 154507
8 JGI25160J50197_1000042 3300003354 Bacteria 149808
9 JGI25161J50226_1000023 3300003374 Bacteria 154507
10 JGI25161J50226_1000305 3300003374 Bacteria 27361
11 JGI25404J52841_10006787 3300003659 Bacteria 2403
12 Ga0055526_1006244 3300003771 Bacteria 6533
13 Ga0055524_1000859 3300003775 Bacteria 19898
14 Ga0055524_1024916 3300003775 Bacteria 1884
15 Ga0055536_1003542 3300003781 Bacteria 8356
16 Ga0055528_1016939 3300003790 Bacteria 2549
17 Ga0055530_10011311 3300003791 Bacteria 3214
18 Ga0055531_10015903 3300003794 Bacteria 3281
19 JGI25405J52794_10001392 3300003911 Bacteria 3959
20 Ga0055543_1000044 3300004625 Bacteria 116282
21 Ga0055543_1000395 3300004625 Bacteria 27923
22 Ga0065165_1000174 3300005262 Bacteria 113769
23 Ga0065165_1000249 3300005262 Bacteria 93123
24 Ga0065714_10002753 3300005288 Bacteria 20330
25 Ga0065714_10098399 3300005288 Bacteria 1710
26 Ga0065712_10002859 3300005290 Bacteria 8339
27 Ga0065712_10011481 3300005290 Bacteria 2388
28 Ga0065715_10001699 3300005293 Bacteria 6967
29 Ga0065707_10014590 3300005295 Bacteria 2507
30 Ga0065707_10089715 3300005295 Bacteria 4295
31 Ga0070683_100002396 3300005329 Bacteria 14881
32 Ga0070683_100003410 3300005329 Bacteria 12889
33 Ga0070683_100063516 3300005329 Bacteria 3435
34 Ga0070683_100167707 3300005329 Bacteria 2084
35 Ga0070690_100027767 3300005330 Bacteria 3501
36 Ga0070670_100018462 3300005331 Bacteria 5984
37 Ga0070670_100071864 3300005331 Bacteria 2971
38 Ga0070670_100095976 3300005331 Bacteria 2550
39 Ga0068869_100110640 3300005334 Bacteria 2089
40 Ga0070666_10006038 3300005335 Bacteria 7443
41 Ga0070666_10010253 3300005335 Bacteria 5856
42 Ga0070666_10068220 3300005335 Bacteria 2416
43 Ga0070680_100013884 3300005336 Bacteria 6284
44 Ga0070680_100016668 3300005336 Bacteria 5786
45 Ga0070682_100002826 3300005337 Bacteria 9622
46 Ga0070682_100051022 3300005337 Bacteria 2584
47 Ga0068868_100028039 3300005338 Bacteria 4301
48 Ga0068868_100142672 3300005338 Bacteria 1967
49 Ga0070660_100004962 3300005339 Bacteria 9199
50 Ga0070660_100052126 3300005339 Bacteria 3153
51 Ga0070689_100019676 3300005340 Bacteria 4995
52 Ga0070669_100043457 3300005353 Bacteria 3273
53 Ga0070669_100059586 3300005353 Bacteria 2803
54 Ga0070675_100148689 3300005354 Bacteria 2007
55 Ga0070671_100029154 3300005355 Bacteria 4551
56 Ga0070671_100074369 3300005355 Bacteria 2839
57 Ga0070671_100084211 3300005355 Bacteria 2659
58 Ga0070671_100154189 3300005355 Bacteria 1940
59 Ga0070673_100006294 3300005364 Bacteria 7705
60 Ga0070673_100042106 3300005364 Bacteria 3518
61 Ga0070673_100057412 3300005364 Bacteria 3075
62 Ga0070673_100177643 3300005364 Bacteria 1821
63 Ga0070688_100023342 3300005365 Bacteria 3637
64 Ga0070688_100067500 3300005365 Bacteria 2278
65 Ga0070659_100016175 3300005366 Bacteria 5597
66 Ga0070667_100008416 3300005367 Bacteria 8558
67 Ga0070667_100010430 3300005367 Bacteria 7670
68 Ga0070667_100021384 3300005367 Bacteria 5373
69 Ga0070709_10006117 3300005434 Bacteria 6547
70 Ga0070714_100025184 3300005435 Bacteria 4908
71 Ga0070714_100081096 3300005435 Bacteria 2824
72 Ga0070713_100001505 3300005436 Bacteria 14853
73 Ga0070713_100012156 3300005436 Bacteria 6304
74 Ga0070713_100021323 3300005436 Bacteria 4980
75 Ga0070713_100033342 3300005436 Bacteria 4123
76 Ga0070713_100043189 3300005436 Bacteria 3684
77 Ga0070713_100066880 3300005436 Bacteria 3024
78 Ga0070713_100130357 3300005436 Bacteria 2216
79 Ga0070710_10003169 3300005437 Bacteria 7796
80 Ga0070710_10008566 3300005437 Bacteria 4979
81 Ga0070711_100015901 3300005439 Bacteria 4767
82 Ga0070711_100026588 3300005439 Bacteria 3793
83 Ga0070711_100027656 3300005439 Bacteria 3725
84 Ga0070711_100032989 3300005439 Bacteria 3446
85 Ga0070711_100087880 3300005439 Bacteria 2233
86 Ga0070711_100095190 3300005439 Bacteria 2155
87 Ga0070705_100039988 3300005440 Bacteria 2664
88 Ga0070694_100053939 3300005444 Bacteria 2722
89 Ga0070708_100000463 3300005445 Bacteria 30590
90 Ga0070663_100012170 3300005455 Bacteria 5431
91 Ga0070663_100032154 3300005455 Bacteria 3614
92 Ga0070663_100073906 3300005455 Bacteria 2488
93 Ga0070678_100005132 3300005456 Bacteria 7520
94 Ga0070678_100043974 3300005456 Bacteria 3186
95 Ga0070678_100046716 3300005456 Bacteria 3107
96 Ga0070678_100076054 3300005456 Bacteria 2528
97 Ga0070662_100001886 3300005457 Bacteria 12852
98 Ga0070662_100073534 3300005457 Bacteria 2526
99 Ga0070681_10072376 3300005458 Bacteria 3410
100 Ga0070681_10073047 3300005458 Bacteria 3392
101 Ga0070685_10009734 3300005466 Bacteria 4979
102 Ga0070685_10095147 3300005466 Bacteria 1810
103 Ga0070685_10112339 3300005466 Bacteria 1680
104 Ga0070706_100000310 3300005467 Bacteria 59185
105 Ga0070707_100063334 3300005468 Bacteria 3549
106 Ga0070698_100038520 3300005471 Bacteria 4926
107 Ga0070699_100000012 3300005518 Bacteria 246521
108 Ga0070679_100002450 3300005530 Bacteria 16820
109 Ga0070679_100040140 3300005530 Bacteria 4656
110 Ga0070679_100054212 3300005530 Bacteria 3992
111 Ga0070679_100070486 3300005530 Bacteria 3487
112 Ga0070679_100094825 3300005530 Bacteria 2972
113 Ga0070679_100221658 3300005530 Bacteria 1852
114 Ga0070684_100001303 3300005535 Bacteria 17864
115 Ga0070684_100001930 3300005535 Bacteria 15207
116 Ga0070684_100001996 3300005535 Bacteria 15009
117 Ga0070684_100004750 3300005535 Bacteria 10382
118 Ga0068853_100008160 3300005539 Bacteria 8405
119 Ga0068853_100071476 3300005539 Bacteria 3022
120 Ga0070672_100053897 3300005543 Bacteria 3146
121 Ga0070672_100098945 3300005543 Bacteria 2363
122 Ga0070672_100169802 3300005543 Bacteria 1813
123 Ga0070695_100000884 3300005545 Bacteria 16155
124 Ga0070696_100001705 3300005546 Bacteria 14405
125 Ga0070693_100026718 3300005547 Bacteria 3119
126 Ga0070693_100038833 3300005547 Bacteria 2664
127 Ga0070665_100007756 3300005548 Bacteria 10897
128 Ga0070665_100049731 3300005548 Bacteria 4206
129 Ga0070665_100051469 3300005548 Bacteria 4130
130 Ga0070665_100058904 3300005548 Bacteria 3850
131 Ga0070665_100076065 3300005548 Bacteria 3364
132 Ga0070665_100098056 3300005548 Bacteria 2935
133 Ga0070665_100194623 3300005548 Bacteria 2028
134 Ga0068855_100117720 3300005563 Bacteria 3043
135 Ga0068855_100177802 3300005563 Bacteria 2407
136 Ga0070664_100063518 3300005564 Bacteria 3148
137 Ga0068857_100070877 3300005577 Bacteria 3105
138 Ga0068856_100138031 3300005614 Bacteria 2444
139 Ga0068852_100007592 3300005616 Bacteria 7929
140 Ga0068852_100118306 3300005616 Bacteria 2421
141 Ga0068859_100030137 3300005617 Bacteria 5443
142 Ga0068864_100025157 3300005618 Bacteria 5011
143 Ga0068864_100053406 3300005618 Bacteria 3486
144 Ga0068864_100075872 3300005618 Bacteria 2936
145 Ga0068863_100018695 3300005841 Bacteria 6631
146 Ga0068863_100024543 3300005841 Bacteria 5750
147 Ga0068863_100039872 3300005841 Bacteria 4466
148 Ga0068863_100184827 3300005841 Bacteria 2001
149 Ga0068858_100022309 3300005842 Bacteria 5912
150 Ga0068858_100102687 3300005842 Bacteria 2667
151 Ga0068858_100144510 3300005842 Bacteria 2234
152 Ga0068858_100204515 3300005842 Bacteria 1868
153 Ga0068860_100004444 3300005843 Bacteria 14311
154 Ga0068862_100016711 3300005844 Bacteria 6110
155 Ga0068862_100023340 3300005844 Bacteria 5182
156 Ga0081455_10004202 3300005937 Bacteria 16231
157 Ga0081455_10009119 3300005937 Bacteria 10236
158 Ga0081455_10031557 3300005937 Bacteria 4790
159 Ga0081455_10095661 3300005937 Bacteria 2397
160 Ga0081455_10100287 3300005937 Bacteria 2327
161 Ga0081540_1000423 3300005983 Bacteria 41829
162 Ga0081540_1001568 3300005983 Bacteria 19543
163 Ga0081540_1002563 3300005983 Bacteria 14745
164 Ga0081540_1002982 3300005983 Bacteria 13564
165 Ga0081540_1007236 3300005983 Bacteria 7954
166 Ga0081540_1047470 3300005983 Bacteria 2159
167 Ga0081540_1050315 3300005983 Bacteria 2071
168 Ga0070717_10001594 3300006028 Bacteria 15701
169 Ga0070717_10008555 3300006028 Bacteria 7642
170 Ga0070717_10017148 3300006028 Bacteria 5627
171 Ga0070717_10021435 3300006028 Bacteria 5091
172 Ga0070717_10131315 3300006028 Bacteria 2154
173 Ga0075365_10026268 3300006038 Bacteria 3695
174 Ga0075365_10067034 3300006038 Bacteria 2409
175 Ga0075363_100032767 3300006048 Bacteria 2701
176 Ga0075364_10016787 3300006051 Bacteria 4560
177 Ga0075432_10025935 3300006058 Bacteria 2011
178 Ga0070712_100008029 3300006175 Bacteria 6620
179 Ga0070712_100013537 3300006175 Bacteria 5214
180 Ga0070712_100032593 3300006175 Bacteria 3519
181 Ga0070712_100042570 3300006175 Bacteria 3123
182 Ga0070712_100168320 3300006175 Bacteria 1698
183 Ga0075367_10002037 3300006178 Bacteria 9045
184 Ga0075367_10023742 3300006178 Bacteria 3453
185 Ga0075369_10001195 3300006186 Bacteria 8790
186 Ga0075369_10007849 3300006186 Bacteria 4083
187 Ga0075366_10007390 3300006195 Bacteria 6066
188 Ga0097621_100039475 3300006237 Bacteria 3792
189 Ga0097621_100061983 3300006237 Bacteria 3069
190 Ga0097621_100110778 3300006237 Bacteria 2319
191 Ga0097621_100178949 3300006237 Bacteria 1832
192 Ga0068871_100018242 3300006358 Bacteria 5329
193 Ga0068871_100110187 3300006358 Bacteria 2315
194 Ga0068871_100136399 3300006358 Bacteria 2084
195 Ga0075428_100004284 3300006844 Bacteria 15708
196 Ga0075428_100035212 3300006844 Bacteria 5519
197 Ga0075428_100052603 3300006844 Bacteria 4462
198 Ga0075428_100054495 3300006844 Bacteria 4382
199 Ga0075428_100154878 3300006844 Bacteria 2490
200 Ga0075430_100000100 3300006846 Bacteria 51326
201 Ga0075430_100009292 3300006846 Bacteria 8309
202 Ga0075430_100031534 3300006846 Bacteria 4499
203 Ga0075431_100001021 3300006847 Bacteria 24944
204 Ga0075431_100012268 3300006847 Bacteria 8649
205 Ga0075431_100023751 3300006847 Bacteria 6276
206 Ga0075431_100046225 3300006847 Bacteria 4488
207 Ga0075431_100051949 3300006847 Bacteria 4226
208 Ga0075431_100164933 3300006847 Bacteria 2277
209 Ga0075433_10019011 3300006852 Bacteria 5717
210 Ga0075433_10022534 3300006852 Bacteria 5287
211 Ga0075433_10023363 3300006852 Bacteria 5203
212 Ga0075433_10031390 3300006852 Bacteria 4541
213 Ga0075433_10044318 3300006852 Bacteria 3864
214 Ga0075433_10076404 3300006852 Bacteria 2949
215 Ga0075433_10105692 3300006852 Bacteria 2494
216 Ga0075434_100000694 3300006871 Bacteria 26302
217 Ga0075434_100006825 3300006871 Bacteria 10504
218 Ga0075434_100026284 3300006871 Bacteria 5701
219 Ga0075434_100032510 3300006871 Bacteria 5144
220 Ga0075434_100043275 3300006871 Bacteria 4465
221 Ga0075434_100044796 3300006871 Bacteria 4388
222 Ga0075434_100062795 3300006871 Bacteria 3698
223 Ga0075434_100075566 3300006871 Bacteria 3363
224 Ga0075434_100088633 3300006871 Bacteria 3095
225 Ga0075434_100139007 3300006871 Bacteria 2449
226 Ga0075429_100020283 3300006880 Bacteria 5765
227 Ga0075429_100022193 3300006880 Bacteria 5506
228 Ga0075429_100022239 3300006880 Bacteria 5501
229 Ga0075436_100010677 3300006914 Bacteria 6299
230 Ga0075436_100051101 3300006914 Bacteria 2853
231 Ga0097620_100030134 3300006931 Bacteria 5443
232 Ga0099824_1013845 3300006942 Bacteria 8232
233 Ga0079104_1001893 3300006946 Bacteria 12643
234 Ga0075435_100022091 3300007076 Bacteria 4905
235 Ga0075435_100024285 3300007076 Bacteria 4702
236 Ga0075435_100057508 3300007076 Bacteria 3146
237 Ga0075435_100064099 3300007076 Bacteria 2985
238 Ga0099794_10009713 3300007265 Bacteria 4060
239 Ga0105251_10028943 3300009011 Bacteria 2795
240 Ga0105251_10030386 3300009011 Bacteria 2714
241 Ga0111539_10023661 3300009094 Bacteria 7547
242 Ga0111539_10024754 3300009094 Bacteria 7362
243 Ga0111539_10033248 3300009094 Bacteria 6262
244 Ga0111539_10063046 3300009094 Bacteria 4387
245 Ga0111539_10107243 3300009094 Bacteria 3277
246 Ga0111539_10126996 3300009094 Bacteria 2987
247 Ga0105245_10003993 3300009098 Bacteria 13105
248 Ga0105245_10011822 3300009098 Bacteria 7592
249 Ga0105245_10024971 3300009098 Bacteria 5252
250 Ga0105245_10034338 3300009098 Bacteria 4498
251 Ga0105247_10042510 3300009101 Bacteria 2784
252 Ga0105247_10051406 3300009101 Bacteria 2538
253 Ga0114129_10003344 3300009147 Bacteria 22531
254 Ga0114129_10004588 3300009147 Bacteria 19490
255 Ga0114129_10060721 3300009147 Bacteria 5285
256 Ga0114129_10092943 3300009147 Bacteria 4179
257 Ga0114129_10121462 3300009147 Bacteria 3595
258 Ga0114129_10233336 3300009147 Bacteria 2477
259 Ga0114129_10336702 3300009147 Bacteria 2002
260 Ga0105243_10000121 3300009148 Bacteria 90206
261 Ga0105243_10041421 3300009148 Bacteria 3602
262 Ga0105241_10003528 3300009174 Bacteria 11634
263 Ga0105241_10014227 3300009174 Bacteria 5829
264 Ga0105241_10015209 3300009174 Bacteria 5636
265 Ga0105242_10000338 3300009176 Bacteria 37775
266 Ga0105242_10038780 3300009176 Bacteria 3833
267 Ga0105248_10002300 3300009177 Bacteria 21148
268 Ga0105248_10055273 3300009177 Bacteria 4452
269 Ga0105248_10058160 3300009177 Bacteria 4341
270 Ga0105248_10063106 3300009177 Bacteria 4158
271 Ga0105248_10064710 3300009177 Bacteria 4105
272 Ga0105248_10069841 3300009177 Bacteria 3944
273 Ga0105248_10093827 3300009177 Bacteria 3380
274 Ga0105248_10244859 3300009177 Bacteria 2018
275 Ga0105237_10016365 3300009545 Bacteria 7708
276 Ga0105237_10017752 3300009545 Bacteria 7377
277 Ga0105249_10165678 3300009553 Bacteria 2139
278 Ga0105249_10230118 3300009553 Bacteria 1828
279 Ga0123340_1000192 3300009763 Bacteria 32932
280 Ga0123341_1000928 3300009765 Bacteria 20507
281 Ga0123342_1024402 3300009766 Bacteria 3789
282 Ga0105239_10104102 3300010375 Bacteria 3142
283 Ga0105239_10123882 3300010375 Bacteria 2872
284 Ga0105246_10021563 3300011119 Bacteria 4147
285 Ga0105246_10028009 3300011119 Bacteria 3698
286 Ga0105246_10107186 3300011119 Bacteria 2046
287 Ga0157373_10001946 3300013100 Bacteria 15675
288 Ga0157371_10050902 3300013102 Bacteria 2944
289 Ga0157370_10025583 3300013104 Bacteria 5842
290 Ga0157370_10038345 3300013104 Bacteria 4636
291 Ga0157369_10032242 3300013105 Bacteria 5764
292 Ga0157369_10063426 3300013105 Bacteria 3981
293 Ga0157369_10160927 3300013105 Bacteria 2370
294 Ga0157374_10015802 3300013296 Bacteria 6630
295 Ga0157374_10055424 3300013296 Bacteria 3700
296 Ga0157374_10060397 3300013296 Bacteria 3547
297 Ga0157374_10089473 3300013296 Bacteria 2933
298 Ga0157374_10144723 3300013296 Bacteria 2309
299 Ga0157374_10158320 3300013296 Bacteria 2205
300 Ga0157374_10185977 3300013296 Bacteria 2031
301 Ga0157378_10040057 3300013297 Bacteria 4155
302 Ga0157378_10041405 3300013297 Bacteria 4086
303 Ga0157378_10117989 3300013297 Bacteria 2442
304 Ga0163162_10001487 3300013306 Bacteria 21848
305 Ga0163162_10014080 3300013306 Bacteria 7817
306 Ga0163162_10045638 3300013306 Bacteria 4390
307 Ga0163162_10055952 3300013306 Bacteria 3973
308 Ga0163162_10086261 3300013306 Bacteria 3217
309 Ga0163162_10126121 3300013306 Bacteria 2666
310 Ga0163162_10168074 3300013306 Bacteria 2317
311 Ga0163162_10205670 3300013306 Bacteria 2098
312 Ga0157372_10008562 3300013307 Bacteria 10866
313 Ga0157372_10044726 3300013307 Bacteria 4908
314 Ga0157372_10055454 3300013307 Bacteria 4426
315 Ga0157372_10094176 3300013307 Bacteria 3410
316 Ga0157372_10209520 3300013307 Bacteria 2259
317 Ga0157375_10002829 3300013308 Bacteria 15018
318 Ga0157375_10020553 3300013308 Bacteria 6034
319 Ga0157375_10025788 3300013308 Bacteria 5468
320 Ga0157375_10124439 3300013308 Bacteria 2692
321 Ga0157375_10179022 3300013308 Bacteria 2271
322 Ga0157375_10183349 3300013308 Bacteria 2246
323 Ga0157375_10238570 3300013308 Bacteria 1978
324 Ga0163163_10005914 3300014325 Bacteria 10642
325 Ga0163163_10027042 3300014325 Bacteria 5490
326 Ga0163163_10064190 3300014325 Bacteria 3643
327 Ga0163163_10074623 3300014325 Bacteria 3384
328 Ga0163163_10114177 3300014325 Bacteria 2731
329 Ga0182008_10022400 3300014497 Bacteria 3236
330 Ga0157379_10005055 3300014968 Bacteria 11315
331 Ga0157379_10120395 3300014968 Bacteria 2361
332 Ga0157379_10183694 3300014968 Bacteria 1889
333 Ga0157376_10009403 3300014969 Bacteria 7101
334 Ga0157376_10029854 3300014969 Bacteria 4346
335 Ga0157376_10041524 3300014969 Bacteria 3766
336 Ga0157376_10042270 3300014969 Bacteria 3736
337 Ga0157376_10052219 3300014969 Bacteria 3398
338 Ga0157376_10067466 3300014969 Bacteria 3026
339 Ga0157376_10102112 3300014969 Bacteria 2508
340 Ga0157376_10136647 3300014969 Bacteria 2194
341 Ga0157376_10161696 3300014969 Bacteria 2031
342 Ga0157376_10195448 3300014969 Bacteria 1858
343 Ga0182005_1000773 3300015265 Bacteria 14532
344 Ga0182005_1002102 3300015265 Bacteria 7407
345 Ga0182005_1016194 3300015265 Bacteria 2076
346 Ga0183362_10002 3300015683 Bacteria 1432711
347 Ga0213872_10001911 3300021361 Bacteria 12763
348 Ga0209436_100080 3300025208 Bacteria 48839
349 Ga0207425_1002741 3300025245 Bacteria 5994
350 Ga0209129_1000657 3300025258 Bacteria 23039
351 Ga0209129_1002282 3300025258 Bacteria 9556
352 Ga0209130_1000075 3300025284 Bacteria 171698
353 Ga0209130_1000142 3300025284 Bacteria 114724
354 Ga0209676_1006011 3300025292 Bacteria 6124
355 Ga0209676_1015160 3300025292 Bacteria 2853
356 Ga0209025_1001191 3300025294 Bacteria 36782
357 Ga0209025_1010036 3300025294 Bacteria 6482
358 Ga0209564_1006120 3300025295 Bacteria 6605
359 Ga0209758_1000399 3300025297 Bacteria 75022
360 Ga0209758_1000501 3300025297 Bacteria 63430
361 Ga0209758_1002240 3300025297 Bacteria 20068
362 Ga0209758_1017507 3300025297 Bacteria 3563
363 Ga0209050_1001809 3300025298 Bacteria 20913
364 Ga0209050_1008880 3300025298 Bacteria 5263
365 Ga0209050_1017332 3300025298 Bacteria 2880
366 Ga0209256_1000131 3300025299 Bacteria 162368
367 Ga0209256_1002274 3300025299 Bacteria 16265
368 Ga0207426_1000076 3300025302 Bacteria 320851
369 Ga0207426_1000163 3300025302 Bacteria 171698
370 Ga0209051_1000288 3300025303 Bacteria 80746
371 Ga0209051_1013677 3300025303 Bacteria 3844
372 Ga0209051_1017931 3300025303 Bacteria 3150
373 Ga0209257_1002287 3300025304 Bacteria 19495
374 Ga0207697_10011880 3300025315 Bacteria 3669
375 Ga0207655_1003046 3300025728 Bacteria 12790
376 Ga0207655_1034990 3300025728 Bacteria 2250
377 Ga0207713_1010124 3300025735 Bacteria 5243
378 Ga0207713_1024090 3300025735 Bacteria 2847
379 Ga0207692_10003382 3300025898 Bacteria 6228
380 Ga0207710_10022175 3300025900 Bacteria 2725
381 Ga0207710_10025285 3300025900 Bacteria 2563
382 Ga0207680_10007938 3300025903 Bacteria 5189
383 Ga0207685_10019543 3300025905 Bacteria 2234
384 Ga0207699_10007565 3300025906 Bacteria 5318
385 Ga0207699_10014082 3300025906 Bacteria 4111
386 Ga0207699_10033010 3300025906 Bacteria 2922
387 Ga0207699_10080477 3300025906 Bacteria 2019
388 Ga0207699_10090846 3300025906 Bacteria 1916
389 Ga0207645_10069302 3300025907 Bacteria 2256
390 Ga0207684_10000086 3300025910 Bacteria 173807
391 Ga0207684_10020319 3300025910 Bacteria 5673
392 Ga0207654_10005086 3300025911 Bacteria 6632
393 Ga0207654_10006185 3300025911 Bacteria 6020
394 Ga0207654_10007655 3300025911 Bacteria 5447
395 Ga0207654_10017513 3300025911 Bacteria 3747
396 Ga0207707_10010395 3300025912 Bacteria 8076
397 Ga0207707_10026782 3300025912 Bacteria 5039
398 Ga0207707_10029654 3300025912 Bacteria 4784
399 Ga0207707_10076561 3300025912 Bacteria 2920
400 Ga0207671_10073262 3300025914 Bacteria 2558
401 Ga0207671_10132401 3300025914 Bacteria 1915
402 Ga0207693_10003192 3300025915 Bacteria 14084
403 Ga0207693_10030417 3300025915 Bacteria 4264
404 Ga0207693_10044830 3300025915 Bacteria 3475
405 Ga0207693_10051842 3300025915 Bacteria 3218
406 Ga0207663_10034429 3300025916 Bacteria 3029
407 Ga0207663_10044694 3300025916 Bacteria 2720
408 Ga0207663_10079545 3300025916 Bacteria 2141
409 Ga0207660_10015781 3300025917 Bacteria 4992
410 Ga0207660_10061658 3300025917 Bacteria 2699
411 Ga0207657_10031994 3300025919 Bacteria 4758
412 Ga0207652_10009388 3300025921 Bacteria 7866
413 Ga0207652_10020941 3300025921 Bacteria 5392
414 Ga0207652_10041544 3300025921 Bacteria 3910
415 Ga0207652_10093974 3300025921 Bacteria 2640
416 Ga0207652_10165053 3300025921 Bacteria 1985
417 Ga0207694_10009805 3300025924 Bacteria 7230
418 Ga0207650_10042632 3300025925 Bacteria 3329
419 Ga0207659_10028351 3300025926 Bacteria 3804
420 Ga0207659_10033545 3300025926 Bacteria 3534
421 Ga0207659_10116317 3300025926 Bacteria 2041
422 Ga0207687_10015839 3300025927 Bacteria 4947
423 Ga0207687_10039689 3300025927 Bacteria 3224
424 Ga0207700_10002139 3300025928 Bacteria 11305
425 Ga0207700_10071207 3300025928 Bacteria 2676
426 Ga0207700_10104206 3300025928 Bacteria 2269
427 Ga0207700_10107274 3300025928 Bacteria 2241
428 Ga0207664_10014223 3300025929 Bacteria 5739
429 Ga0207664_10058867 3300025929 Bacteria 3058
430 Ga0207664_10117091 3300025929 Bacteria 2224
431 Ga0207644_10002999 3300025931 Bacteria 10858
432 Ga0207644_10057401 3300025931 Bacteria 2810
433 Ga0207644_10062466 3300025931 Bacteria 2702
434 Ga0207644_10126925 3300025931 Bacteria 1948
435 Ga0207690_10045274 3300025932 Bacteria 2906
436 Ga0207706_10053990 3300025933 Bacteria 3546
437 Ga0207706_10095544 3300025933 Bacteria 2614
438 Ga0207686_10001043 3300025934 Bacteria 16410
439 Ga0207686_10091385 3300025934 Bacteria 2010
440 Ga0207709_10000012 3300025935 Bacteria 552803
441 Ga0207670_10007628 3300025936 Bacteria 6054
442 Ga0207670_10082196 3300025936 Bacteria 2257
443 Ga0207665_10050370 3300025939 Bacteria 2801
444 Ga0207665_10084677 3300025939 Bacteria 2188
445 Ga0207691_10002696 3300025940 Bacteria 17370
446 Ga0207691_10008451 3300025940 Bacteria 9886
447 Ga0207691_10028500 3300025940 Bacteria 5229
448 Ga0207691_10041491 3300025940 Bacteria 4247
449 Ga0207711_10010984 3300025941 Bacteria 7523
450 Ga0207711_10011699 3300025941 Bacteria 7291
451 Ga0207711_10014649 3300025941 Bacteria 6516
452 Ga0207711_10048306 3300025941 Bacteria 3641
453 Ga0207711_10101509 3300025941 Bacteria 2546
454 Ga0207711_10139293 3300025941 Bacteria 2182
455 Ga0207689_10019759 3300025942 Bacteria 5675
456 Ga0207689_10023561 3300025942 Bacteria 5164
457 Ga0207689_10114769 3300025942 Bacteria 2214
458 Ga0207661_10000349 3300025944 Bacteria 29687
459 Ga0207661_10000875 3300025944 Bacteria 19806
460 Ga0207661_10034071 3300025944 Bacteria 3957
461 Ga0207661_10051096 3300025944 Bacteria 3297
462 Ga0207661_10058345 3300025944 Bacteria 3106
463 Ga0207661_10060493 3300025944 Bacteria 3056
464 Ga0207679_10050051 3300025945 Bacteria 3051
465 Ga0207679_10058830 3300025945 Bacteria 2850
466 Ga0207679_10109155 3300025945 Bacteria 2180
467 Ga0207651_10005907 3300025960 Bacteria 6336
468 Ga0207651_10008525 3300025960 Bacteria 5542
469 Ga0207651_10009178 3300025960 Bacteria 5392
470 Ga0207651_10099053 3300025960 Bacteria 2158
471 Ga0207658_10020305 3300025986 Bacteria 4600
472 Ga0207677_10007312 3300026023 Bacteria 6098
473 Ga0207703_10010145 3300026035 Bacteria 7384
474 Ga0207703_10087028 3300026035 Bacteria 2619
475 Ga0207703_10144182 3300026035 Bacteria 2070
476 Ga0207703_10158613 3300026035 Bacteria 1980
477 Ga0207639_10014630 3300026041 Bacteria 5525
478 Ga0207639_10032829 3300026041 Bacteria 3825
479 Ga0207639_10074047 3300026041 Bacteria 2673
480 Ga0207678_10004849 3300026067 Bacteria 12085
481 Ga0207678_10006575 3300026067 Bacteria 10305
482 Ga0207678_10027621 3300026067 Bacteria 4952
483 Ga0207678_10030173 3300026067 Bacteria 4733
484 Ga0207678_10042507 3300026067 Bacteria 3936
485 Ga0207678_10058717 3300026067 Bacteria 3310
486 Ga0207678_10066339 3300026067 Bacteria 3099
487 Ga0207678_10081380 3300026067 Bacteria 2772
488 Ga0207702_10003959 3300026078 Bacteria 13299
489 Ga0207641_10014367 3300026088 Bacteria 6489
490 Ga0207641_10029056 3300026088 Bacteria 4571
491 Ga0207648_10016679 3300026089 Bacteria 6702
492 Ga0207676_10004875 3300026095 Bacteria 9497
493 Ga0207674_10026659 3300026116 Bacteria 6131
494 Ga0207675_100102904 3300026118 Bacteria 2691
495 Ga0207675_100121044 3300026118 Bacteria 2476
496 Ga0207683_10021272 3300026121 Bacteria 5551
497 Ga0207683_10022372 3300026121 Bacteria 5426
498 Ga0207683_10032518 3300026121 Bacteria 4531
499 Ga0207683_10044274 3300026121 Bacteria 3891
500 Ga0207683_10132118 3300026121 Bacteria 2246
501 Ga0207683_10140419 3300026121 Bacteria 2176
502 Ga0209281_1000869 3300027111 Bacteria 26253
503 Ga0209389_1000035 3300027296 Bacteria 127089
504 Ga0209589_1000039 3300027357 Bacteria 127084
505 Ga0209489_100084 3300027361 Bacteria 127094
506 Ga0209981_1000803 3300027378 Bacteria 3960
507 Ga0209996_1000313 3300027395 Bacteria 6061
508 Ga0209995_1005989 3300027471 Bacteria 1957
509 Ga0209999_1000288 3300027543 Bacteria 7441
510 Ga0209970_1000625 3300027614 Bacteria 6121
511 Ga0209971_1000009 3300027682 Bacteria 101488
512 Ga0209966_1000203 3300027695 Bacteria 24628
513 Ga0209974_10002614 3300027876 Bacteria 6537
514 Ga0207428_10009544 3300027907 Bacteria 8694
515 Ga0207428_10011197 3300027907 Bacteria 7955
516 Ga0207428_10011716 3300027907 Bacteria 7732
517 Ga0207428_10024091 3300027907 Bacteria 5111
518 Ga0207428_10033992 3300027907 Bacteria 4181
519 Ga0207428_10051038 3300027907 Bacteria 3307
520 Ga0207428_10061985 3300027907 Bacteria 2958
521 Ga0207428_10065536 3300027907 Bacteria 2865
522 Ga0265354_1000120 3300028016 Bacteria 13725
523 Ga0265354_1000712 3300028016 Bacteria 5491
524 Ga0265356_1000097 3300028017 Bacteria 14726
525 Ga0268266_10000757 3300028379 Bacteria 43261
526 Ga0268266_10001600 3300028379 Bacteria 26414
527 Ga0268266_10003215 3300028379 Bacteria 16514
528 Ga0268266_10010853 3300028379 Bacteria 7934
529 Ga0268266_10028853 3300028379 Bacteria 4716
530 Ga0268266_10035975 3300028379 Bacteria 4212
531 Ga0268266_10037001 3300028379 Bacteria 4158
532 Ga0268266_10048510 3300028379 Bacteria 3640
533 Ga0268266_10083895 3300028379 Bacteria 2782
534 Ga0268266_10109987 3300028379 Bacteria 2441
535 Ga0268266_10135932 3300028379 Bacteria 2202
536 Ga0268265_10015962 3300028380 Bacteria 5153
537 Ga0268265_10016959 3300028380 Bacteria 5014
538 Ga0268264_10010707 3300028381 Bacteria 7575
539 Ga0265323_10000304 3300028653 Bacteria 28435
540 Ga0307517_10104731 3300028786 Bacteria 2201
541 Ga0265338_10001404 3300028800 Bacteria 39205
542 Ga0265338_10003401 3300028800 Bacteria 22465
543 Ga0265338_10083809 3300028800 Bacteria 2665
544 Ga0265762_1008929 3300030760 Bacteria 1785
545 Ga0265763_1000509 3300030763 Bacteria 2383
546 Ga0265770_1000422 3300030878 Bacteria 5799
547 Ga0265760_10000149 3300031090 Bacteria 18035
548 Ga0265760_10000586 3300031090 Bacteria 10354
549 Ga0265760_10002951 3300031090 Bacteria 4974
550 Ga0265760_10004126 3300031090 Bacteria 4183
551 Ga0265332_10007913 3300031238 Bacteria 4790
552 Ga0265328_10002438 3300031239 Bacteria 8345
553 Ga0265320_10001053 3300031240 Bacteria 20502
554 Ga0265320_10003188 3300031240 Bacteria 11127
555 Ga0265320_10030160 3300031240 Bacteria 2800
556 Ga0265320_10035331 3300031240 Bacteria 2535
557 Ga0265320_10045220 3300031240 Bacteria 2164
558 Ga0265325_10000048 3300031241 Bacteria 82899
559 Ga0265325_10000050 3300031241 Bacteria 80443
560 Ga0265325_10000149 3300031241 Bacteria 49348
561 Ga0265325_10012064 3300031241 Bacteria 4949
562 Ga0265329_10002251 3300031242 Bacteria 8868
563 Ga0265340_10001611 3300031247 Bacteria 12961
564 Ga0265339_10002783 3300031249 Bacteria 12430
565 Ga0265339_10018185 3300031249 Bacteria 4147
566 Ga0265339_10044271 3300031249 Bacteria 2456
567 Ga0265331_10000101 3300031250 Bacteria 115635
568 Ga0265331_10001354 3300031250 Bacteria 18014
569 Ga0265331_10055588 3300031250 Bacteria 1882
570 Ga0265327_10000463 3300031251 Bacteria 72345
571 Ga0307509_10076127 3300031507 Bacteria 3483
572 Ga0265313_10000030 3300031595 Bacteria 131161
573 Ga0265313_10000497 3300031595 Bacteria 41302
574 Ga0265313_10022719 3300031595 Bacteria 3395
575 Ga0265313_10032697 3300031595 Bacteria 2652
576 Ga0316575_10000520 3300031665 Bacteria 11225
577 Ga0316575_10000886 3300031665 Bacteria 9188
578 Ga0316575_10007029 3300031665 Bacteria 4071
579 Ga0316575_10011374 3300031665 Bacteria 3292
580 Ga0316575_10014690 3300031665 Bacteria 2943
581 Ga0316575_10020442 3300031665 Bacteria 2540
582 Ga0316575_10032222 3300031665 Bacteria 2052
583 Ga0316579_10004171 3300031691 Bacteria 5713
584 Ga0316579_10030384 3300031691 Bacteria 2468
585 Ga0316579_10032925 3300031691 Bacteria 2378
586 Ga0265314_10000308 3300031711 Bacteria 69876
587 Ga0265314_10025219 3300031711 Bacteria 4491
588 Ga0265342_10000031 3300031712 Bacteria 152577
589 Ga0265342_10000289 3300031712 Bacteria 56888
590 Ga0265342_10001993 3300031712 Bacteria 18189
591 Ga0265342_10013038 3300031712 Bacteria 5600
592 Ga0316576_10000338 3300031727 Bacteria 21141
593 Ga0316576_10014116 3300031727 Bacteria 5328
594 Ga0316576_10028912 3300031727 Bacteria 3912
595 Ga0316576_10033033 3300031727 Bacteria 3680
596 Ga0316576_10057390 3300031727 Bacteria 2844
597 Ga0316576_10064259 3300031727 Bacteria 2695
598 Ga0316576_10076859 3300031727 Bacteria 2471
599 Ga0316576_10109245 3300031727 Bacteria 2072
600 Ga0316578_10002173 3300031728 Bacteria 8466
601 Ga0316578_10004402 3300031728 Bacteria 6649
602 Ga0316578_10008151 3300031728 Bacteria 5310
603 Ga0316578_10010332 3300031728 Bacteria 4843
604 Ga0316578_10028344 3300031728 Bacteria 3170
605 Ga0316578_10029768 3300031728 Bacteria 3100
606 Ga0307516_10007923 3300031730 Bacteria 12100
607 Ga0307516_10095820 3300031730 Bacteria 2789
608 Ga0316577_10001908 3300031733 Bacteria 10077
609 Ga0316577_10006285 3300031733 Bacteria 6266
610 Ga0316577_10028365 3300031733 Bacteria 3122
611 Ga0316577_10041188 3300031733 Bacteria 2584
612 Ga0316583_10000281 3300032133 Bacteria 14168
613 Ga0316583_10006968 3300032133 Bacteria 4067
614 Ga0316583_10012004 3300032133 Bacteria 3125
615 Ga0316583_10018387 3300032133 Bacteria 2509
616 Ga0316585_10000433 3300032137 Bacteria 9777
617 Ga0316585_10001154 3300032137 Bacteria 6872
618 Ga0316585_10004497 3300032137 Bacteria 3886
619 Ga0316585_10006566 3300032137 Bacteria 3328
620 Ga0316585_10006640 3300032137 Bacteria 3311
621 Ga0316580_10010643 3300032139 Bacteria 2784
622 Ga0316580_10012120 3300032139 Bacteria 2623
623 Ga0316593_10007466 3300032168 Bacteria 3006
624 Ga0316593_10017562 3300032168 Bacteria 2184
625 Ga0307510_10022486 3300033180 Bacteria 7323
626 Ga0307510_10048587 3300033180 Bacteria 4525
627 Ga0307510_10067066 3300033180 Bacteria 3617
628 Ga0315911_1000022 3300033442 Bacteria 118114
629 Ga0316592_1003958 3300033524 Bacteria 2719
630 Ga0316592_1011908 3300033524 Bacteria 1776
631 Ga0316586_1004278 3300033527 Bacteria 1938
632 Ga0316588_1009974 3300033528 Bacteria 1991
633 Ga0316588_1012157 3300033528 Bacteria 1851
634 Ga0316596_1001227 3300033541 Bacteria 5064
635 Ga0316596_1001412 3300033541 Bacteria 4830
636 Ga0316596_1008937 3300033541 Bacteria 2398
637 Ga0316596_1012432 3300033541 Bacteria 2093
638 Ga0316212_1000415 3300033547 Bacteria 5160
639 Ga0373950_0000035 3300034818 Bacteria 143267
640 Ga0373926_0001282 3300035083 Bacteria 7563
641 Ga0373929_0012702 3300035085 Bacteria 1604
642 Ga0373934_0006196 3300035086 Bacteria 4432
643 Ga0373934_0024015 3300035086 Bacteria 2358
644 Ga0373944_0000567 3300035089 Bacteria 8733
645 Ga0373936_0002689 3300035113 Bacteria 6642
646 Ga0373936_0005453 3300035113 Bacteria 4799
647 Ga0373936_0011837 3300035113 Bacteria 3309
648 Ga0373945_0003130 3300035116 Bacteria 5194
649 Ga0373954_0003279 3300035118 Bacteria 6832
650 Ga0373954_0011766 3300035118 Bacteria 3882
651 Ga0373954_0017774 3300035118 Bacteria 3197
652 Ga0373956_0004360 3300035119 Bacteria 5672
653 Ga0373956_0007443 3300035119 Bacteria 4412
654 Ga0373956_0009618 3300035119 Bacteria 3937
655 Ga0373957_0001576 3300035120 Bacteria 6226
656 Ga0373943_0001172 3300035170 Bacteria 11700
657 Ga0373943_0006877 3300035170 Bacteria 5101
658 Ga0373943_0012367 3300035170 Bacteria 3841
659 Ga0373943_0014583 3300035170 Bacteria 3561
660 Ga0373946_0001631 3300035171 Bacteria 7824
661 Ga0373946_0001950 3300035171 Bacteria 7216
662 Ga0373946_0012853 3300035171 Bacteria 3140
663 Ga0373955_0000139 3300035172 Bacteria 28625
664 Ga0373955_0001143 3300035172 Bacteria 11266
665 Ga0373955_0003880 3300035172 Bacteria 6593
666 Ga0373955_0013751 3300035172 Bacteria 3923
667 Ga0373955_0026944 3300035172 Bacteria 2966
668 Ga0373955_0050565 3300035172 Bacteria 2261
669 Ga0373955_0050616 3300035172 Bacteria 2260
670 Ga0373962_0017427 3300035242 Bacteria 1862
671 Ga0316574_0001009 3300035398 Bacteria 12692
672 Ga0316574_0006476 3300035398 Bacteria 6331
673 Ga0316574_0016693 3300035398 Bacteria 4283
674 Ga0316574_0026664 3300035398 Bacteria 3476
675 Ga0316574_0028589 3300035398 Bacteria 3363
676 Ga0316574_0031300 3300035398 Bacteria 3227
677 Ga0316574_0035840 3300035398 Bacteria 3034
678 Ga0316574_0037785 3300035398 Bacteria 2962
679 Ga0316574_0058235 3300035398 Bacteria 2420
680 Ga0316574_0062661 3300035398 Bacteria 2337
681 Ga0316574_0069263 3300035398 Bacteria 2226
682 Ga0316574_0073667 3300035398 Bacteria 2160
683 Ga0373924_0001010 3300035410 Bacteria 8919
684 Ga0373924_0002062 3300035410 Bacteria 6706
685 Ga0373924_0025336 3300035410 Bacteria 2345
686 Ga0373931_0023742 3300035691 Bacteria 3098
687 Ga0373931_0034372 3300035691 Bacteria 2631
688 Ga0373935_0000307 3300035692 Bacteria 24397
689 Ga0373935_0000556 3300035692 Bacteria 19410
690 Ga0373935_0001033 3300035692 Bacteria 15137
691 Ga0373935_0011263 3300035692 Bacteria 5371
692 Ga0373935_0011416 3300035692 Bacteria 5334
693 Ga0373935_0120237 3300035692 Bacteria 1754
694 Ga0373935_0128386 3300035692 Bacteria 1701
695 Ga0373927_0001393 3300035695 Bacteria 18216
696 Ga0373927_0001508 3300035695 Bacteria 17535
697 Ga0373927_0002069 3300035695 Bacteria 14824
698 Ga0373927_0006813 3300035695 Bacteria 7773
699 Ga0373927_0012706 3300035695 Bacteria 5600
700 Ga0373927_0014738 3300035695 Bacteria 5168
701 Ga0373927_0016406 3300035695 Bacteria 4885
702 Ga0373927_0025713 3300035695 Bacteria 3848
703 Ga0373927_0028658 3300035695 Bacteria 3632
704 Ga0373927_0034840 3300035695 Bacteria 3274
705 Ga0373927_0116005 3300035695 Bacteria 1746
706 Ga0373933_0001653 3300035724 Bacteria 12973
707 Ga0373933_0003708 3300035724 Bacteria 8449
708 Ga0373933_0058116 3300035724 Bacteria 2325
709 Ga0373947_0000940 3300035725 Bacteria 17726
710 Ga0373947_0002568 3300035725 Bacteria 10914
711 Ga0373947_0002780 3300035725 Bacteria 10462
712 Ga0373947_0003947 3300035725 Bacteria 8720
713 Ga0373947_0005272 3300035725 Bacteria 7557
714 Ga0373947_0008033 3300035725 Bacteria 6087
715 Ga0373947_0009220 3300035725 Bacteria 5672
716 Ga0373947_0011627 3300035725 Bacteria 5048
717 Ga0373947_0026295 3300035725 Bacteria 3400
718 Ga0373947_0049733 3300035725 Bacteria 2518
719 Ga0373947_0058356 3300035725 Bacteria 2338
720 Ga0373947_0059381 3300035725 Bacteria 2319
721 Ga0373937_0000224 3300036401 Bacteria 54942
722 Ga0373937_0004731 3300036401 Bacteria 11578
723 Ga0373937_0004798 3300036401 Bacteria 11485
724 Ga0373937_0012255 3300036401 Bacteria 7534
725 Ga0373937_0015738 3300036401 Bacteria 6698
726 Ga0373937_0025387 3300036401 Bacteria 5349
727 Ga0373937_0033705 3300036401 Bacteria 4653
728 Ga0373937_0037613 3300036401 Bacteria 4410
729 Ga0373937_0038573 3300036401 Bacteria 4353
730 Ga0373937_0067881 3300036401 Bacteria 3287
731 Ga0373937_0082503 3300036401 Bacteria 2975
732 Ga0373937_0107675 3300036401 Bacteria 2591
733 Ga0373937_0107775 3300036401 Bacteria 2590
734 Ga0373937_0168867 3300036401 Bacteria 2052
735 Ga0316582_0000583 3300036647 Bacteria 14131
736 Ga0316582_0000721 3300036647 Bacteria 13123
737 Ga0316582_0008819 3300036647 Bacteria 5437
738 Ga0316582_0024726 3300036647 Bacteria 3597
739 Ga0316582_0035593 3300036647 Bacteria 3076
740 Ga0316582_0103124 3300036647 Bacteria 1891
741 Ga0316584_0002828 3300036712 Bacteria 11130
742 Ga0316584_0010976 3300036712 Bacteria 6348
743 Ga0316584_0013749 3300036712 Bacteria 5738
744 Ga0316584_0017510 3300036712 Bacteria 5154
745 Ga0316584_0034962 3300036712 Bacteria 3726
746 Ga0316584_0051408 3300036712 Bacteria 3081
747 Ga0373925_0000025 3300037068 Bacteria 154937
748 Ga0373925_0000137 3300037068 Bacteria 77893
749 Ga0373925_0001317 3300037068 Bacteria 21738
750 Ga0373925_0002823 3300037068 Bacteria 13701
751 Ga0373925_0006618 3300037068 Bacteria 8517
752 Ga0373925_0010908 3300037068 Bacteria 6593
753 Ga0373925_0021021 3300037068 Bacteria 4755
754 Ga0373925_0181582 3300037068 Bacteria 1666
755 Ga0395899_0003783 3300037312 Bacteria 11946
756 Ga0395900_0167712 3300037418 Bacteria 2237
757 Ga0395898_0050256 3300037466 Bacteria 4082
758 Ga0316581_0015797 3300037588 Bacteria 2162
759 Ga0395901_0005518 3300038443 Bacteria 12810
760 Ga0395901_0062723 3300038443 Bacteria 3868
761 Ga0436365_0956053 3300039437 Bacteria 4481
762 Ga0436360_0045408 3300039438 Bacteria 3858
763 Ga0436360_0947776 3300039438 Bacteria 2087
764 Ga0436361_0278774 3300039447 Bacteria 10486
765 Ga0436361_0455437 3300039447 Bacteria 25865
766 Ga0436361_0784419 3300039447 Bacteria 7662
767 Ga0436361_0853288 3300039447 Bacteria 22528
768 Ga0436361_0999240 3300039447 Bacteria 10707
769 Ga0436362_1259766 3300039453 Bacteria 8651
770 Ga0439453_0002170 3300041408 Bacteria 2666
771 Ga0451833_0239188 3300041491 Bacteria 3087
772 Ga0451833_0683236 3300041491 Bacteria 7530
773 Ga0451839_0468455 3300041496 Bacteria 3021
774 Ga0451839_0679937 3300041496 Bacteria 2737
775 Ga0451847_0845324 3300041503 Bacteria 2484
776 Ga0451849_1244665 3300041505 Bacteria 6217
777 Ga0451849_1483964 3300041505 Bacteria 2986
778 Ga0451851_0580182 3300041507 Bacteria 3023
779 Ga0451851_0817964 3300041507 Bacteria 3817
780 Ga0451843_0309713 3300041509 Bacteria 5289
781 Ga0451853_1703964 3300041512 Bacteria 3752
782 Ga0439451_001743 3300042009 Bacteria 4343
783 Ga0439452_002356 3300042010 Bacteria 7019
784 Ga0439456_001747 3300042013 Bacteria 4394
785 Ga0439463_007986 3300042016 Bacteria 2611
786 Ga0450902_000279 3300042137 Bacteria 6135
787 Ga0466963_0041175 3300044694 Bacteria 3029
788 Ga0453684_0035489 3300044712 Bacteria 6889
789 Ga0451576_0012760 3300045051 Bacteria 9430
790 Ga0451576_0124721 3300045051 Bacteria 2683
791 Ga0451576_0135724 3300045051 Bacteria 2565
792 Ga0451576_0137533 3300045051 Bacteria 2548
793 Ga0451576_0202829 3300045051 Bacteria 2071
794 Ga0466967_0090329 3300045976 Bacteria 2782
795 Ga0495617_001182 3300046452 Bacteria 11797
796 Ga0495617_001540 3300046452 Bacteria 10005
797 Ga0495617_001721 3300046452 Bacteria 9366
798 Ga0495617_003547 3300046452 Bacteria 5837
799 Ga0495617_010998 3300046452 Bacteria 3092
800 Ga0495617_016204 3300046452 Bacteria 2520
801 Ga0495592_0000351 3300046454 Bacteria 37502
802 Ga0495592_0002061 3300046454 Bacteria 14158
803 Ga0495592_0002690 3300046454 Bacteria 12574
804 Ga0495592_0007242 3300046454 Bacteria 8305
805 Ga0495592_0079377 3300046454 Bacteria 2375
806 Ga0495592_0095729 3300046454 Bacteria 2123
807 Ga0495603_0000079 3300046455 Bacteria 43171
808 Ga0495603_0000220 3300046455 Bacteria 29560
809 Ga0495603_0016588 3300046455 Bacteria 4456
810 Ga0495603_0022044 3300046455 Bacteria 3857
811 Ga0495603_0062943 3300046455 Bacteria 2189
812 Ga0495590_0000153 3300046457 Bacteria 41540
813 Ga0495590_0000286 3300046457 Bacteria 27212
814 Ga0495590_0003258 3300046457 Bacteria 6637
815 Ga0495590_0003622 3300046457 Bacteria 6292
816 Ga0495590_0021075 3300046457 Bacteria 2312
817 Ga0495591_000121 3300046458 Bacteria 84919
818 Ga0495591_000489 3300046458 Bacteria 31345
819 Ga0495591_003206 3300046458 Bacteria 8617
820 Ga0495591_006079 3300046458 Bacteria 5425
821 Ga0495629_0000315 3300046459 Bacteria 41389
822 Ga0495629_0002647 3300046459 Bacteria 13724
823 Ga0495629_0003668 3300046459 Bacteria 11605
824 Ga0495629_0005519 3300046459 Bacteria 9438
825 Ga0495629_0017056 3300046459 Bacteria 5209
826 Ga0495629_0026813 3300046459 Bacteria 4092
827 Ga0495629_0049390 3300046459 Bacteria 2948
828 Ga0495629_0112601 3300046459 Bacteria 1897
829 Ga0495638_0001881 3300046460 Bacteria 18158
830 Ga0495638_0002792 3300046460 Bacteria 14015
831 Ga0495638_0003494 3300046460 Bacteria 12344
832 Ga0495638_0008654 3300046460 Bacteria 7199
833 Ga0495638_0010941 3300046460 Bacteria 6274
834 Ga0495638_0016679 3300046460 Bacteria 4914
835 Ga0495638_0026955 3300046460 Bacteria 3722
836 Ga0495638_0040174 3300046460 Bacteria 2965
837 Ga0495638_0055082 3300046460 Bacteria 2470
838 Ga0495641_0003365 3300046461 Bacteria 12005
839 Ga0495641_0014631 3300046461 Bacteria 4236
840 Ga0495651_0005489 3300046462 Bacteria 9672
841 Ga0495651_0023232 3300046462 Bacteria 4822
842 Ga0495651_0072934 3300046462 Bacteria 2606
843 Ga0495651_0083152 3300046462 Bacteria 2414
844 Ga0495651_0099666 3300046462 Bacteria 2166
845 Ga0495653_0000254 3300046463 Bacteria 42832
846 Ga0495653_0002132 3300046463 Bacteria 15606
847 Ga0495653_0006285 3300046463 Bacteria 9745
848 Ga0495653_0010824 3300046463 Bacteria 7465
849 Ga0495653_0016386 3300046463 Bacteria 6037
850 Ga0495653_0018885 3300046463 Bacteria 5592
851 Ga0495650_0001142 3300046471 Bacteria 28785
852 Ga0495650_0001374 3300046471 Bacteria 24014
853 Ga0495650_0002584 3300046471 Bacteria 14258
854 Ga0495650_0004077 3300046471 Bacteria 10216
855 Ga0495580_0000434 3300046472 Bacteria 34511
856 Ga0495580_0000672 3300046472 Bacteria 29183
857 Ga0495580_0004108 3300046472 Bacteria 12272
858 Ga0495580_0004809 3300046472 Bacteria 11308
859 Ga0495580_0010811 3300046472 Bacteria 7086
860 Ga0495580_0023479 3300046472 Bacteria 4528
861 Ga0495580_0102051 3300046472 Bacteria 1995
862 Ga0495582_0000429 3300046473 Bacteria 22925
863 Ga0495582_0000528 3300046473 Bacteria 21108
864 Ga0495582_0001132 3300046473 Bacteria 15015
865 Ga0495582_0002204 3300046473 Bacteria 10907
866 Ga0495582_0050944 3300046473 Bacteria 2283
867 Ga0495605_0000976 3300046474 Bacteria 19449
868 Ga0495605_0001174 3300046474 Bacteria 17395
869 Ga0495605_0001455 3300046474 Bacteria 15479
870 Ga0495605_0001731 3300046474 Bacteria 13982
871 Ga0495605_0002999 3300046474 Bacteria 10193
872 Ga0495605_0024773 3300046474 Bacteria 3136
873 Ga0495605_0025096 3300046474 Bacteria 3108
874 Ga0495605_0031215 3300046474 Bacteria 2722
875 Ga0495639_0000044 3300046475 Bacteria 55019
876 Ga0495639_0003439 3300046475 Bacteria 6857
877 Ga0495639_0003660 3300046475 Bacteria 6618
878 Ga0495639_0011273 3300046475 Bacteria 3851
879 Ga0495639_0011804 3300046475 Bacteria 3768
880 Ga0495639_0012716 3300046475 Bacteria 3630
881 Ga0495639_0018012 3300046475 Bacteria 3071
882 Ga0495639_0018800 3300046475 Bacteria 3011
883 Ga0495662_0010688 3300046476 Bacteria 4489
884 Ga0495662_0014407 3300046476 Bacteria 3845
885 Ga0495662_0014663 3300046476 Bacteria 3810
886 Ga0495662_0034554 3300046476 Bacteria 2440
887 Ga0495662_0061940 3300046476 Bacteria 1808
888 Ga0495664_0000005 3300046477 Bacteria 439635
889 Ga0495664_0000425 3300046477 Bacteria 20678
890 Ga0495664_0016524 3300046477 Bacteria 4206
891 Ga0495664_0025157 3300046477 Bacteria 3465
892 Ga0495664_0084340 3300046477 Bacteria 1907
893 Ga0495584_0000286 3300046491 Bacteria 35701
894 Ga0495584_0000353 3300046491 Bacteria 31947
895 Ga0495584_0004818 3300046491 Bacteria 7209
896 Ga0495584_0006495 3300046491 Bacteria 6114
897 Ga0495584_0011850 3300046491 Bacteria 4460
898 Ga0495585_0000003 3300046492 Bacteria 406344
899 Ga0495585_0004037 3300046492 Bacteria 9664
900 Ga0495585_0007600 3300046492 Bacteria 6621
901 Ga0495585_0011017 3300046492 Bacteria 5369
902 Ga0495585_0012939 3300046492 Bacteria 4903
903 Ga0495585_0015211 3300046492 Bacteria 4472
904 Ga0495585_0048753 3300046492 Bacteria 2354
905 Ga0495594_0000174 3300046499 Bacteria 30955
906 Ga0495594_0000351 3300046499 Bacteria 23112
907 Ga0495594_0005048 3300046499 Bacteria 6792
908 Ga0495594_0007040 3300046499 Bacteria 5782
909 Ga0495594_0010621 3300046499 Bacteria 4773
910 Ga0495594_0011202 3300046499 Bacteria 4656
911 Ga0495594_0026265 3300046499 Bacteria 3132
912 Ga0495594_0064692 3300046499 Bacteria 2028
913 Ga0495596_0000056 3300046500 Bacteria 81755
914 Ga0495596_0009474 3300046500 Bacteria 4282
915 Ga0495596_0022274 3300046500 Bacteria 2579
916 Ga0495607_0000259 3300046501 Bacteria 56558
917 Ga0495607_0000449 3300046501 Bacteria 41464
918 Ga0495607_0022990 3300046501 Bacteria 3907
919 Ga0495607_0029407 3300046501 Bacteria 3381
920 Ga0495583_0000518 3300046506 Bacteria 54833
921 Ga0495583_0001807 3300046506 Bacteria 20185
922 Ga0495583_0021417 3300046506 Bacteria 3326
923 Ga0495583_0025710 3300046506 Bacteria 2935
924 Ga0495606_0003180 3300046507 Bacteria 17725
925 Ga0495606_0011364 3300046507 Bacteria 7270
926 Ga0495606_0019357 3300046507 Bacteria 5068
927 Ga0495606_0020300 3300046507 Bacteria 4903
928 Ga0495606_0099254 3300046507 Bacteria 1775
929 Ga0495608_0000003 3300046511 Bacteria 369831
930 Ga0495608_0007875 3300046511 Bacteria 7487
931 Ga0495608_0043928 3300046511 Bacteria 2985
932 Ga0495610_0004057 3300046512 Bacteria 10994
933 Ga0495610_0005508 3300046512 Bacteria 8970
934 Ga0495610_0013115 3300046512 Bacteria 4941
935 Ga0495610_0018364 3300046512 Bacteria 3954
936 Ga0495616_0000203 3300046513 Bacteria 49328
937 Ga0495616_0001046 3300046513 Bacteria 19755
938 Ga0495616_0003231 3300046513 Bacteria 10489
939 Ga0495616_0011335 3300046513 Bacteria 5117
940 Ga0495616_0025088 3300046513 Bacteria 3189
941 Ga0495616_0034697 3300046513 Bacteria 2616
942 Ga0495618_0000010 3300046514 Bacteria 189314
943 Ga0495618_0001813 3300046514 Bacteria 14122
944 Ga0495618_0004415 3300046514 Bacteria 8650
945 Ga0495618_0008537 3300046514 Bacteria 6190
946 Ga0495618_0017659 3300046514 Bacteria 4378
947 Ga0495618_0025220 3300046514 Bacteria 3689
948 Ga0495618_0068314 3300046514 Bacteria 2260
949 Ga0495620_0003842 3300046515 Bacteria 8562
950 Ga0495620_0004701 3300046515 Bacteria 7672
951 Ga0495620_0021197 3300046515 Bacteria 3159
952 Ga0495628_0000019 3300046516 Bacteria 154435
953 Ga0495628_0007407 3300046516 Bacteria 9500
954 Ga0495628_0020211 3300046516 Bacteria 5496
955 Ga0495628_0023763 3300046516 Bacteria 5026
956 Ga0495628_0032865 3300046516 Bacteria 4184
957 Ga0495628_0058547 3300046516 Bacteria 3027
958 Ga0495628_0151943 3300046516 Bacteria 1763
959 Ga0495630_0000507 3300046517 Bacteria 28733
960 Ga0495630_0002059 3300046517 Bacteria 13986
961 Ga0495630_0013985 3300046517 Bacteria 5839
962 Ga0495630_0015813 3300046517 Bacteria 5513
963 Ga0495630_0016923 3300046517 Bacteria 5335
964 Ga0495630_0035039 3300046517 Bacteria 3751
965 Ga0495630_0054673 3300046517 Bacteria 2991
966 Ga0495630_0107014 3300046517 Bacteria 2118
967 Ga0495631_0000457 3300046518 Bacteria 27703
968 Ga0495631_0008670 3300046518 Bacteria 5117
969 Ga0495631_0008779 3300046518 Bacteria 5079
970 Ga0495631_0018888 3300046518 Bacteria 3239
971 Ga0495631_0019585 3300046518 Bacteria 3172
972 Ga0495631_0045908 3300046518 Bacteria 1922
973 Ga0495632_0000487 3300046519 Bacteria 37602
974 Ga0495632_0005428 3300046519 Bacteria 8429
975 Ga0495632_0010913 3300046519 Bacteria 5335
976 Ga0495632_0016732 3300046519 Bacteria 4067
977 Ga0495637_0000619 3300046520 Bacteria 25098
978 Ga0495637_0006023 3300046520 Bacteria 6127
979 Ga0495637_0008234 3300046520 Bacteria 5127
980 Ga0495643_0002128 3300046522 Bacteria 16324
981 Ga0495643_0020063 3300046522 Bacteria 3860
982 Ga0495644_0011044 3300046523 Bacteria 3481
983 Ga0495644_0015212 3300046523 Bacteria 2946
984 Ga0495648_0000011 3300046524 Bacteria 299518
985 Ga0495648_0003029 3300046524 Bacteria 15043
986 Ga0495648_0007019 3300046524 Bacteria 9077
987 Ga0495648_0025277 3300046524 Bacteria 4023
988 Ga0495648_0035396 3300046524 Bacteria 3237
989 Ga0495648_0040031 3300046524 Bacteria 2976
990 Ga0495648_0044069 3300046524 Bacteria 2788
991 Ga0495666_0005038 3300046526 Bacteria 6682
992 Ga0495666_0028359 3300046526 Bacteria 2753
993 Ga0495642_0000030 3300046528 Bacteria 89032
994 Ga0495642_0000346 3300046528 Bacteria 25144
995 Ga0495642_0015541 3300046528 Bacteria 2960
996 Ga0495652_0000028 3300046529 Bacteria 157336
997 Ga0495652_0001396 3300046529 Bacteria 26842
998 Ga0495652_0014052 3300046529 Bacteria 7192
999 Ga0495652_0014422 3300046529 Bacteria 7095
1000 Ga0495652_0016715 3300046529 Bacteria 6557
1001 Ga0495652_0059529 3300046529 Bacteria 3231
1002 Ga0495652_0074915 3300046529 Bacteria 2814
1003 Ga0495652_0089117 3300046529 Bacteria 2527
1004 Ga0495654_0000270 3300046530 Bacteria 47176
1005 Ga0495654_0000843 3300046530 Bacteria 23209
1006 Ga0495654_0001431 3300046530 Bacteria 16424
1007 Ga0495654_0004211 3300046530 Bacteria 8602
1008 Ga0495654_0004237 3300046530 Bacteria 8573
1009 Ga0495654_0012283 3300046530 Bacteria 4604
1010 Ga0495654_0015436 3300046530 Bacteria 4054
1011 Ga0495654_0016274 3300046530 Bacteria 3935
1012 Ga0495654_0041521 3300046530 Bacteria 2287
1013 Ga0495665_0000397 3300046531 Bacteria 22124
1014 Ga0495665_0001539 3300046531 Bacteria 12297
1015 Ga0495665_0012864 3300046531 Bacteria 4529
1016 Ga0495665_0025293 3300046531 Bacteria 3189
1017 Ga0495665_0053738 3300046531 Bacteria 2129
1018 Ga0495640_0000014 3300046533 Bacteria 161741
1019 Ga0495640_0000946 3300046533 Bacteria 22440
1020 Ga0495640_0005274 3300046533 Bacteria 10273
1021 Ga0495640_0009393 3300046533 Bacteria 7616
1022 Ga0495640_0013870 3300046533 Bacteria 6118
1023 Ga0495640_0043708 3300046533 Bacteria 3119
1024 Ga0495640_0047507 3300046533 Bacteria 2970
1025 Ga0495586_0004881 3300046535 Bacteria 7172
1026 Ga0495586_0019777 3300046535 Bacteria 3585
1027 Ga0495586_0023236 3300046535 Bacteria 3310
1028 Ga0495587_0000026 3300046536 Bacteria 147819
1029 Ga0495587_0001942 3300046536 Bacteria 13769
1030 Ga0495587_0002573 3300046536 Bacteria 12126
1031 Ga0495587_0003831 3300046536 Bacteria 9975
1032 Ga0495587_0025604 3300046536 Bacteria 3606
1033 Ga0495587_0025624 3300046536 Bacteria 3603
1034 Ga0495587_0052094 3300046536 Bacteria 2416
1035 Ga0495598_0001479 3300046537 Bacteria 4676
1036 Ga0495598_0006473 3300046537 Bacteria 2648
1037 Ga0495598_0008146 3300046537 Bacteria 2429
1038 Ga0495609_0000211 3300046538 Bacteria 58163
1039 Ga0495609_0002631 3300046538 Bacteria 10901
1040 Ga0495609_0007663 3300046538 Bacteria 5364
1041 Ga0495597_0003836 3300046542 Bacteria 8539
1042 Ga0495597_0004597 3300046542 Bacteria 7529
1043 Ga0495597_0005069 3300046542 Bacteria 7039
1044 Ga0495597_0006900 3300046542 Bacteria 5827
1045 Ga0495597_0013611 3300046542 Bacteria 3892
1046 Ga0495645_0000005 3300046543 Bacteria 443917
1047 Ga0495645_0003891 3300046543 Bacteria 10175
1048 Ga0495645_0004826 3300046543 Bacteria 9214
1049 Ga0495645_0005342 3300046543 Bacteria 8802
1050 Ga0495645_0031814 3300046543 Bacteria 3846
1051 Ga0495645_0034571 3300046543 Bacteria 3686
1052 Ga0495645_0061732 3300046543 Bacteria 2715
1053 Ga0495622_0001127 3300046557 Bacteria 13952
1054 Ga0495622_0001316 3300046557 Bacteria 12733
1055 Ga0495622_0003112 3300046557 Bacteria 7860
1056 Ga0495622_0013860 3300046557 Bacteria 3741
1057 Ga0495622_0021882 3300046557 Bacteria 2978
1058 Ga0495633_0000784 3300046558 Bacteria 28455
1059 Ga0495633_0003005 3300046558 Bacteria 11515
1060 Ga0495667_0000003 3300046559 Bacteria 295404
1061 Ga0495667_0000359 3300046559 Bacteria 28998
1062 Ga0495667_0009553 3300046559 Bacteria 6572
1063 Ga0495667_0018690 3300046559 Bacteria 4680
1064 Ga0495667_0062609 3300046559 Bacteria 2437
1065 Ga0495667_0086708 3300046559 Bacteria 2030
1066 Ga0495668_0000176 3300046616 Bacteria 95098
1067 Ga0495668_0009665 3300046616 Bacteria 5898
1068 Ga0495668_0010271 3300046616 Bacteria 5681
1069 Ga0495668_0015572 3300046616 Bacteria 4436
1070 Ga0495668_0033893 3300046616 Bacteria 2868
1071 Ga0495668_0036170 3300046616 Bacteria 2767
1072 Ga0495634_0000252 3300046642 Bacteria 50709
1073 Ga0495634_0000563 3300046642 Bacteria 36335
1074 Ga0495634_0002662 3300046642 Bacteria 14687
1075 Ga0495634_0002863 3300046642 Bacteria 14152
1076 Ga0495634_0002977 3300046642 Bacteria 13815
1077 Ga0495634_0003233 3300046642 Bacteria 13162
1078 Ga0495634_0011929 3300046642 Bacteria 6308
1079 Ga0495634_0014854 3300046642 Bacteria 5599
1080 Ga0495634_0015780 3300046642 Bacteria 5416
1081 Ga0495634_0017164 3300046642 Bacteria 5169
1082 Ga0495634_0017853 3300046642 Bacteria 5058
1083 Ga0495634_0100303 3300046642 Bacteria 1871
1084 Ga0495611_0001643 3300046648 Bacteria 10844
1085 Ga0495611_0020307 3300046648 Bacteria 2858
1086 Ga0495625_0001628 3300046660 Bacteria 26468
1087 Ga0495625_0011521 3300046660 Bacteria 7203
1088 Ga0495625_0017154 3300046660 Bacteria 5672
1089 Ga0495625_0028940 3300046660 Bacteria 4148
1090 Ga0495625_0033583 3300046660 Bacteria 3792
1091 Ga0495625_0046019 3300046660 Bacteria 3150
1092 Ga0495625_0061503 3300046660 Bacteria 2657
1093 Ga0495635_0000024 3300046663 Bacteria 148235
1094 Ga0495635_0001753 3300046663 Bacteria 14629
1095 Ga0495635_0002143 3300046663 Bacteria 13395
1096 Ga0495635_0003414 3300046663 Bacteria 10983
1097 Ga0495635_0006871 3300046663 Bacteria 7951
1098 Ga0495635_0008099 3300046663 Bacteria 7344
1099 Ga0495635_0017329 3300046663 Bacteria 5033
1100 Ga0495635_0041766 3300046663 Bacteria 3168
1101 Ga0495635_0061813 3300046663 Bacteria 2572
1102 Ga0495661_0005553 3300046665 Bacteria 8946
1103 Ga0495661_0007276 3300046665 Bacteria 7717
1104 Ga0495661_0009681 3300046665 Bacteria 6601
1105 Ga0495588_0002475 3300046674 Bacteria 7914
1106 Ga0495588_0004155 3300046674 Bacteria 6380
1107 Ga0495588_0012575 3300046674 Bacteria 4005
1108 Ga0495588_0018957 3300046674 Bacteria 3364
1109 Ga0495657_0000034 3300046675 Bacteria 122360
1110 Ga0495657_0014963 3300046675 Bacteria 5690
1111 Ga0495657_0027029 3300046675 Bacteria 4056
1112 Ga0495599_0000017 3300046678 Bacteria 162507
1113 Ga0495599_0000305 3300046678 Bacteria 29662
1114 Ga0495599_0000638 3300046678 Bacteria 19791
1115 Ga0495599_0001563 3300046678 Bacteria 13184
1116 Ga0495599_0014781 3300046678 Bacteria 4833
1117 Ga0495599_0060141 3300046678 Bacteria 2375
1118 Ga0495623_0001642 3300046679 Bacteria 15029
1119 Ga0495623_0003465 3300046679 Bacteria 10444
1120 Ga0495623_0005243 3300046679 Bacteria 8501
1121 Ga0495623_0018109 3300046679 Bacteria 4549
1122 Ga0495623_0019295 3300046679 Bacteria 4407
1123 Ga0495646_0000015 3300046680 Bacteria 141718
1124 Ga0495646_0000160 3300046680 Bacteria 34238
1125 Ga0495646_0014838 3300046680 Bacteria 4949
1126 Ga0495646_0050298 3300046680 Bacteria 2527
1127 Ga0495646_0074804 3300046680 Bacteria 1987
1128 Ga0495647_0002303 3300046681 Bacteria 5990
1129 Ga0495647_0012317 3300046681 Bacteria 2943
1130 Ga0495658_0001461 3300046683 Bacteria 12436
1131 Ga0495658_0003275 3300046683 Bacteria 8050
1132 Ga0495658_0005325 3300046683 Bacteria 6331
1133 Ga0495658_0005911 3300046683 Bacteria 6006
1134 Ga0495669_0000415 3300046684 Bacteria 20580
1135 Ga0495669_0033253 3300046684 Bacteria 2269
1136 Ga0495613_0000495 3300046689 Bacteria 33286
1137 Ga0495613_0001312 3300046689 Bacteria 18985
1138 Ga0495613_0014036 3300046689 Bacteria 5946
1139 Ga0495613_0019404 3300046689 Bacteria 5067
1140 Ga0495613_0035712 3300046689 Bacteria 3687
1141 Ga0495613_0037230 3300046689 Bacteria 3607
1142 Ga0495613_0054514 3300046689 Bacteria 2939
1143 Ga0495624_0002092 3300046690 Bacteria 15220
1144 Ga0495624_0015686 3300046690 Bacteria 5109
1145 Ga0495624_0033713 3300046690 Bacteria 3316
1146 Ga0495624_0041562 3300046690 Bacteria 2940
1147 Ga0495670_0000564 3300046691 Bacteria 17685
1148 Ga0495670_0000610 3300046691 Bacteria 17083
1149 Ga0495670_0000871 3300046691 Bacteria 14645
1150 Ga0495670_0000914 3300046691 Bacteria 14240
1151 Ga0495670_0003857 3300046691 Bacteria 7364
1152 Ga0495670_0007190 3300046691 Bacteria 5477
1153 Ga0495670_0018283 3300046691 Bacteria 3451
1154 Ga0495671_0000287 3300046692 Bacteria 42290
1155 Ga0495671_0008774 3300046692 Bacteria 5678
1156 Ga0495671_0010949 3300046692 Bacteria 5008
1157 Ga0495671_0012748 3300046692 Bacteria 4581
1158 Ga0495671_0015459 3300046692 Bacteria 4088
1159 Ga0495671_0020545 3300046692 Bacteria 3478
1160 Ga0495671_0036998 3300046692 Bacteria 2470
1161 Ga0495649_0001392 3300046694 Bacteria 18265
1162 Ga0495649_0011583 3300046694 Bacteria 5167
1163 Ga0495649_0013121 3300046694 Bacteria 4789
1164 Ga0495649_0024381 3300046694 Bacteria 3373
1165 Ga0495649_0028858 3300046694 Bacteria 3075
1166 Ga0495589_0003145 3300046794 Bacteria 9032
1167 Ga0495589_0032983 3300046794 Bacteria 2601
1168 Ga0495600_0000289 3300046809 Bacteria 27139
1169 Ga0495600_0005965 3300046809 Bacteria 7374
1170 Ga0495600_0006184 3300046809 Bacteria 7260
1171 Ga0495600_0009800 3300046809 Bacteria 5925
1172 Ga0495600_0055557 3300046809 Bacteria 2586
1173 Ga0495660_0002760 3300046810 Bacteria 11073
1174 Ga0495660_0010447 3300046810 Bacteria 5400
1175 Ga0495660_0022082 3300046810 Bacteria 3636
1176 Ga0495660_0036217 3300046810 Bacteria 2753
1177 Ga0495660_0055469 3300046810 Bacteria 2145
1178 Ga0495581_0001351 3300047315 Bacteria 13558
1179 Ga0495581_0001735 3300047315 Bacteria 12140
1180 Ga0495581_0003589 3300047315 Bacteria 8923
1181 Ga0495581_0003813 3300047315 Bacteria 8669
1182 Ga0495581_0022666 3300047315 Bacteria 3638
1183 Ga0495604_0000021 3300047317 Bacteria 169432
1184 Ga0495604_0000613 3300047317 Bacteria 30609
1185 Ga0495604_0004953 3300047317 Bacteria 10558
1186 Ga0495604_0005631 3300047317 Bacteria 9935
1187 Ga0495604_0007389 3300047317 Bacteria 8707
1188 Ga0495604_0007393 3300047317 Bacteria 8706
1189 Ga0495604_0021272 3300047317 Bacteria 5178
1190 Ga0495604_0030854 3300047317 Bacteria 4254
1191 Ga0495604_0060496 3300047317 Bacteria 2900
1192 Ga0495604_0067631 3300047317 Bacteria 2714
1193 Ga0495604_0117196 3300047317 Bacteria 1932
1194 Ga0495674_0000005 3300047319 Bacteria 375129
1195 Ga0495674_0002976 3300047319 Bacteria 16489
1196 Ga0495674_0003317 3300047319 Bacteria 15641
1197 Ga0495674_0008248 3300047319 Bacteria 9939
1198 Ga0495674_0008920 3300047319 Bacteria 9538
1199 Ga0495674_0009276 3300047319 Bacteria 9350
1200 Ga0495674_0010069 3300047319 Bacteria 8963
1201 Ga0495674_0012764 3300047319 Bacteria 7911
1202 Ga0495674_0014927 3300047319 Bacteria 7269
1203 Ga0495674_0026422 3300047319 Bacteria 5312
1204 Ga0495674_0056383 3300047319 Bacteria 3441
1205 Ga0495674_0101314 3300047319 Bacteria 2450
1206 Ga0495672_0000841 3300047320 Bacteria 32658
1207 Ga0495672_0003472 3300047320 Bacteria 13474
1208 Ga0495672_0018041 3300047320 Bacteria 4699
1209 Ga0495672_0020479 3300047320 Bacteria 4334
1210 Ga0495672_0082975 3300047320 Bacteria 1781
1211 Ga0495676_0011110 3300047321 Bacteria 8136
1212 Ga0495676_0012818 3300047321 Bacteria 7540
1213 Ga0495676_0124685 3300047321 Bacteria 1868
1214 Ga0495680_0000283 3300047322 Bacteria 56876
1215 Ga0495680_0005251 3300047322 Bacteria 12226
1216 Ga0495680_0005491 3300047322 Bacteria 11919
1217 Ga0495680_0008669 3300047322 Bacteria 9229
1218 Ga0495680_0010331 3300047322 Bacteria 8332
1219 Ga0495680_0010619 3300047322 Bacteria 8210
1220 Ga0495680_0012449 3300047322 Bacteria 7486
1221 Ga0495680_0027773 3300047322 Bacteria 4644
1222 Ga0495680_0037696 3300047322 Bacteria 3871
1223 Ga0495680_0039281 3300047322 Bacteria 3777
1224 Ga0495680_0047851 3300047322 Bacteria 3361
1225 Ga0495680_0121025 3300047322 Bacteria 1932
1226 Ga0495683_0000156 3300047323 Bacteria 67301
1227 Ga0495683_0000436 3300047323 Bacteria 33126
1228 Ga0495683_0001897 3300047323 Bacteria 13072
1229 Ga0495683_0005278 3300047323 Bacteria 7180
1230 Ga0495683_0015750 3300047323 Bacteria 3926
1231 Ga0495683_0027592 3300047323 Bacteria 2903
1232 Ga0495683_0039208 3300047323 Bacteria 2395
1233 Ga0495683_0054011 3300047323 Bacteria 2003
1234 Ga0495687_001294 3300047443 Bacteria 23488
1235 Ga0495687_004526 3300047443 Bacteria 9337
1236 Ga0495675_0000863 3300047444 Bacteria 18516
1237 Ga0495675_0001997 3300047444 Bacteria 12188
1238 Ga0495675_0006795 3300047444 Bacteria 7017
1239 Ga0495675_0026442 3300047444 Bacteria 3701
1240 Ga0495675_0032694 3300047444 Bacteria 3319
1241 Ga0495675_0059182 3300047444 Bacteria 2429
1242 Ga0495677_0001361 3300047445 Bacteria 9768
1243 Ga0495677_0021301 3300047445 Bacteria 2349
1244 Ga0495679_000743 3300047446 Bacteria 20913
1245 Ga0495673_0000169 3300047469 Bacteria 107858
1246 Ga0495673_0001149 3300047469 Bacteria 22560
1247 Ga0495673_0001383 3300047469 Bacteria 19527
1248 Ga0495673_0012995 3300047469 Bacteria 4388
1249 Ga0495681_0000109 3300047470 Bacteria 71558
1250 Ga0495681_0000218 3300047470 Bacteria 47737
1251 Ga0495681_0000652 3300047470 Bacteria 26406
1252 Ga0495681_0001470 3300047470 Bacteria 17631
1253 Ga0495681_0002169 3300047470 Bacteria 14228
1254 Ga0495681_0035286 3300047470 Bacteria 2484
1255 Ga0495684_0000001 3300047471 Bacteria 369809
1256 Ga0495684_0000297 3300047471 Bacteria 40486
1257 Ga0495684_0000945 3300047471 Bacteria 23655
1258 Ga0495684_0005871 3300047471 Bacteria 9538
1259 Ga0495684_0013638 3300047471 Bacteria 6258
1260 Ga0495684_0023948 3300047471 Bacteria 4695
1261 Ga0495684_0054901 3300047471 Bacteria 3038
1262 Ga0495684_0061951 3300047471 Bacteria 2846
1263 Ga0495684_0073475 3300047471 Bacteria 2598
1264 Ga0495684_0081577 3300047471 Bacteria 2454
1265 Ga0495684_0088842 3300047471 Bacteria 2342
1266 Ga0495684_0094726 3300047471 Bacteria 2260
1267 Ga0495686_0008348 3300047472 Bacteria 7611
1268 Ga0495686_0044047 3300047472 Bacteria 2825
1269 Ga0495686_0066495 3300047472 Bacteria 2227
1270 Ga0495593_0000091 3300047673 Bacteria 40378
1271 Ga0495593_0002490 3300047673 Bacteria 11079
1272 Ga0495593_0008735 3300047673 Bacteria 5884
1273 Ga0495593_0009995 3300047673 Bacteria 5499
1274 Ga0495593_0014697 3300047673 Bacteria 4449
1275 Ga0495593_0016357 3300047673 Bacteria 4186
1276 Ga0495593_0031333 3300047673 Bacteria 2905
1277 Ga0495602_0000003 3300048088 Bacteria 357240
1278 Ga0495602_0020196 3300048088 Bacteria 6588
1279 Ga0495602_0032836 3300048088 Bacteria 4881
1280 Ga0495602_0065099 3300048088 Bacteria 3148
1281 Ga0495614_0027542 3300048089 Bacteria 2450
1282 Ga0495614_0050202 3300048089 Bacteria 1787
1283 Ga0495614_0062861 3300048089 Bacteria 1596
1284 Ga0495626_0000070 3300048091 Bacteria 137389
1285 Ga0495626_0000087 3300048091 Bacteria 122878
1286 Ga0495626_0000143 3300048091 Bacteria 90432
1287 Ga0495626_0000844 3300048091 Bacteria 27454
1288 Ga0495626_0004118 3300048091 Bacteria 9033
1289 Ga0496100_0003865 3300048903 Bacteria 7856
1290 Ga0496100_0013577 3300048903 Bacteria 4703
1291 Ga0496100_0048298 3300048903 Bacteria 2746
1292 Ga0496100_0147386 3300048903 Bacteria 1675
1293 Ga0496101_0009977 3300048904 Bacteria 6257
1294 Ga0496101_0019984 3300048904 Bacteria 4580
1295 Ga0496101_0099137 3300048904 Bacteria 2178
1296 Ga0496101_0183744 3300048904 Bacteria 1611
1297 Ga0496102_0000815 3300048905 Bacteria 30310
1298 Ga0496102_0010711 3300048905 Bacteria 7899
1299 Ga0496102_0024345 3300048905 Bacteria 5382
1300 Ga0496102_0085492 3300048905 Bacteria 2912
1301 Ga0496102_0113431 3300048905 Bacteria 2528
1302 Ga0496103_0000725 3300048906 Bacteria 24370
1303 Ga0496103_0006448 3300048906 Bacteria 7003
1304 Ga0496103_0017573 3300048906 Bacteria 4280
1305 Ga0496103_0025544 3300048906 Bacteria 3571
1306 Ga0496103_0044754 3300048906 Bacteria 2728
1307 Ga0496103_0087792 3300048906 Bacteria 1961
1308 Ga0496104_0000997 3300048907 Bacteria 24208
1309 Ga0496104_0003549 3300048907 Bacteria 13453
1310 Ga0496104_0003939 3300048907 Bacteria 12845
1311 Ga0496104_0005155 3300048907 Bacteria 11414
1312 Ga0496104_0012840 3300048907 Bacteria 7544
1313 Ga0496104_0016818 3300048907 Bacteria 6647
1314 Ga0496104_0034899 3300048907 Bacteria 4693
1315 Ga0496104_0035484 3300048907 Bacteria 4655
1316 Ga0496104_0041319 3300048907 Bacteria 4324
1317 Ga0496104_0054969 3300048907 Bacteria 3763
1318 Ga0496104_0077301 3300048907 Bacteria 3171
1319 Ga0496104_0107084 3300048907 Bacteria 2679
1320 Ga0496104_0177734 3300048907 Bacteria 2038
1321 Ga0496104_0189920 3300048907 Bacteria 1965
1322 Ga0496104_0355857 3300048907 Bacteria 1377
1323 Ga0496105_0000728 3300048908 Bacteria 22307
1324 Ga0496105_0002108 3300048908 Bacteria 14396
1325 Ga0496105_0012825 3300048908 Bacteria 6642
1326 Ga0496105_0026034 3300048908 Bacteria 4767
1327 Ga0496105_0027471 3300048908 Bacteria 4650
1328 Ga0496105_0039590 3300048908 Bacteria 3885
1329 Ga0496105_0041981 3300048908 Bacteria 3770
1330 Ga0496106_0007481 3300048909 Bacteria 8072
1331 Ga0496106_0007893 3300048909 Bacteria 7867
1332 Ga0496106_0014405 3300048909 Bacteria 5843
1333 Ga0496106_0102869 3300048909 Bacteria 2216
1334 Ga0496106_0119000 3300048909 Bacteria 2063
1335 Ga0496107_0006684 3300048910 Bacteria 7940
1336 Ga0496107_0007929 3300048910 Bacteria 7329
1337 Ga0496107_0060019 3300048910 Bacteria 2752
1338 Ga0496107_0115157 3300048910 Bacteria 1978
1339 Ga0496107_0125852 3300048910 Bacteria 1890
1340 Ga0496108_0002446 3300048911 Bacteria 14846
1341 Ga0496108_0008576 3300048911 Bacteria 8288
1342 Ga0496108_0022136 3300048911 Bacteria 5226
1343 Ga0496108_0023816 3300048911 Bacteria 5038
1344 Ga0496108_0111954 3300048911 Bacteria 2335
1345 Ga0496109_0000051 3300048912 Bacteria 126695
1346 Ga0496109_0001561 3300048912 Bacteria 19081
1347 Ga0496109_0007673 3300048912 Bacteria 9147
1348 Ga0496109_0025468 3300048912 Bacteria 5272
1349 Ga0496109_0054062 3300048912 Bacteria 3664
1350 Ga0496109_0067968 3300048912 Bacteria 3265
1351 Ga0496109_0116703 3300048912 Bacteria 2484
1352 Ga0496110_0014134 3300048913 Bacteria 6620
1353 Ga0496110_0017866 3300048913 Bacteria 5937
1354 Ga0496110_0037305 3300048913 Bacteria 4224
1355 Ga0496110_0039685 3300048913 Bacteria 4100
1356 Ga0496110_0088709 3300048913 Bacteria 2763
1357 Ga0496111_0021704 3300048914 Bacteria 4486
1358 Ga0496111_0038694 3300048914 Bacteria 3418
1359 Ga0496111_0072409 3300048914 Bacteria 2508
1360 Ga0496112_0001629 3300048915 Bacteria 17390
1361 Ga0496112_0008017 3300048915 Bacteria 9421
1362 Ga0496112_0023998 3300048915 Bacteria 5834
1363 Ga0496112_0025023 3300048915 Bacteria 5727
1364 Ga0496112_0025853 3300048915 Bacteria 5642
1365 Ga0496112_0052606 3300048915 Bacteria 3997
1366 Ga0496112_0057895 3300048915 Bacteria 3816
1367 Ga0496112_0068136 3300048915 Bacteria 3514
1368 Ga0496113_0002444 3300048916 Bacteria 10806
1369 Ga0496113_0011936 3300048916 Bacteria 5823
1370 Ga0496113_0012504 3300048916 Bacteria 5707
1371 Ga0496113_0041158 3300048916 Bacteria 3408
1372 Ga0496113_0070981 3300048916 Bacteria 2648
1373 Ga0496113_0102419 3300048916 Bacteria 2220
1374 Ga0496114_0004829 3300048917 Bacteria 10500
1375 Ga0496114_0006917 3300048917 Bacteria 8934
1376 Ga0496114_0007779 3300048917 Bacteria 8482
1377 Ga0496114_0055524 3300048917 Bacteria 3303
1378 Ga0496115_0019570 3300048918 Bacteria 5212
1379 Ga0496115_0025857 3300048918 Bacteria 4574
1380 Ga0496115_0046459 3300048918 Bacteria 3470
1381 Ga0496115_0063964 3300048918 Bacteria 2969
1382 Ga0496115_0078893 3300048918 Bacteria 2679
1383 Ga0496115_0088121 3300048918 Bacteria 2533
1384 Ga0496115_0093994 3300048918 Bacteria 2452
1385 Ga0496115_0129618 3300048918 Bacteria 2078
1386 Ga0496115_0211317 3300048918 Bacteria 1602
1387 Ga0496116_0010376 3300048919 Bacteria 7819
1388 Ga0496118_0005371 3300048921 Bacteria 14590
1389 Ga0496118_0016327 3300048921 Bacteria 6816
1390 Ga0496119_0002352 3300048922 Bacteria 20824
1391 Ga0496119_0019802 3300048922 Bacteria 4934
1392 Ga0496121_0009187 3300048924 Bacteria 11426
1393 Ga0496121_0025780 3300048924 Bacteria 5565
1394 Ga0496124_0020533 3300048927 Bacteria 6100
1395 Ga0496125_0006220 3300048928 Bacteria 13000
1396 Ga0496126_0008379 3300048929 Bacteria 11154
1397 Ga0496126_0027484 3300048929 Bacteria 5432
1398 Ga0496126_0041487 3300048929 Bacteria 4258
1399 Ga0496126_0111880 3300048929 Bacteria 2378
1400 Ga0495678_004735 3300049459 Bacteria 7761
1401 Ga0495678_005555 3300049459 Bacteria 6918
1402 Ga0495678_008577 3300049459 Bacteria 5139
1403 Ga0495678_010335 3300049459 Bacteria 4544
1404 Ga0495678_023099 3300049459 Bacteria 2710
1405 Ga0495678_039689 3300049459 Bacteria 1897
1406 Ga0495682_0000629 3300049460 Bacteria 23620
1407 Ga0495682_0002252 3300049460 Bacteria 9278
1408 Ga0495682_0005547 3300049460 Bacteria 5224
1409 Ga0495682_0034197 3300049460 Bacteria 1875
1410 Ga0501038_0069826 3300049574 Bacteria 2983
1411 Ga0501039_0017833 3300049575 Bacteria 5446
1412 Ga0501043_0121916 3300049579 Bacteria 2045
1413 Ga0501046_0000002 3300049580 Bacteria 526908
1414 Ga0501047_0097546 3300049581 Bacteria 2817
1415 Ga0501048_0013445 3300049582 Bacteria 6075
1416 Ga0501067_0000107 3300049583 Bacteria 47662
1417 Ga0501067_0015750 3300049583 Bacteria 4183
1418 Ga0501067_0056030 3300049583 Bacteria 2184
1419 Ga0501067_0068618 3300049583 Bacteria 1963
1420 Ga0501068_0000021 3300049584 Bacteria 59094
1421 Ga0501069_0008724 3300049585 Bacteria 5339
1422 Ga0501069_0024293 3300049585 Bacteria 3305
1423 Ga0501070_0000023 3300049586 Bacteria 164053
1424 Ga0501070_0073596 3300049586 Bacteria 2827
1425 Ga0501072_0000028 3300049588 Bacteria 136173
1426 Ga0501073_0000095 3300049589 Bacteria 56422
1427 Ga0501073_0006162 3300049589 Bacteria 8951
1428 Ga0501073_0012122 3300049589 Bacteria 6295
1429 Ga0501073_0017866 3300049589 Bacteria 5133
1430 Ga0501073_0063268 3300049589 Bacteria 2581
1431 Ga0501074_0031168 3300049590 Bacteria 3863
1432 Ga0501077_0001503 3300049593 Bacteria 14057
1433 Ga0501079_0011380 3300049741 Bacteria 6791
1434 Ga0501079_0031604 3300049741 Bacteria 4069
1435 Ga0501080_0057767 3300049742 Bacteria 3612
1436 Ga0501080_0079477 3300049742 Bacteria 3049
1437 Ga0501081_0018342 3300049743 Bacteria 4646
1438 Ga0501083_0006706 3300049744 Bacteria 8171
1439 Ga0501083_0010940 3300049744 Bacteria 6381
1440 Ga0501083_0025795 3300049744 Bacteria 4068
1441 Ga0501044_0068563 3300049823 Bacteria 3613
1442 Ga0501045_0016545 3300049824 Bacteria 5240
1443 nmdc:mga03683_48778_c1 3300050489 Bacteria 1761
1444 nmdc:mga00v17_15820_c1 3300050491 Bacteria 4242
1445 nmdc:mga00v17_4300_c1 3300050491 Bacteria 7395
1446 nmdc:mga0yw44_26570_c1 3300050492 Bacteria 3308
1447 nmdc:mga0yw44_65657_c1 3300050492 Bacteria 2237
1448 nmdc:mga0yw44_71755_c1 3300050492 Bacteria 2151
1449 nmdc:mga0k408_33924_c1 3300050493 Bacteria 2920
1450 nmdc:mga0k408_7563_c1 3300050493 Bacteria 5803
1451 nmdc:mga06z11_10278_c1 3300050494 Bacteria 3980
1452 nmdc:mga06z11_26407_c1 3300050494 Bacteria 2763
1453 nmdc:mga07m45_4799_c1 3300050496 Bacteria 6653
1454 nmdc:mga05p37_13322_c2 3300050507 Bacteria 3262
1455 nmdc:mga05p37_20084_c1 3300050507 Bacteria 8084
1456 nmdc:mga05p37_21883_c1 3300050507 Bacteria 7747
1457 nmdc:mga05p37_25397_c1 3300050507 Bacteria 7205
1458 nmdc:mga05p37_360698_c1 3300050507 Bacteria 1709
1459 nmdc:mga05p37_460_c1 3300050507 Bacteria 44414
1460 nmdc:mga05p37_63535_c1 3300050507 Bacteria 4543
1461 nmdc:mga05p37_70918_c1 3300050507 Bacteria 4286
1462 nmdc:mga05p37_77676_c1 3300050507 Bacteria 4088
1463 nmdc:mga05p37_81170_c1 3300050507 Bacteria 3994
1464 nmdc:mga09592_100936_c1 3300050508 Bacteria 2472
1465 nmdc:mga09592_54346_c1 3300050508 Bacteria 3384
1466 nmdc:mga0qj67_43766_c1 3300050509 Bacteria 3527
1467 nmdc:mga0qj67_45785_c1 3300050509 Bacteria 3451
1468 nmdc:mga0qj67_965_c1 3300050509 Bacteria 19791
1469 nmdc:mga06r32_11345_c1 3300050510 Bacteria 8023
1470 nmdc:mga06r32_183_c1 3300050510 Bacteria 49420
1471 nmdc:mga06r32_21124_c1 3300050510 Bacteria 6007
1472 nmdc:mga06r32_224563_c1 3300050510 Bacteria 1867
1473 nmdc:mga08y16_10345_c1 3300050511 Bacteria 9792
1474 nmdc:mga08y16_138038_c1 3300050511 Bacteria 2535
1475 nmdc:mga08y16_18071_c1 3300050511 Bacteria 7427
1476 nmdc:mga08y16_19765_c1 3300050511 Bacteria 7103
1477 nmdc:mga08y16_207829_c1 3300050511 Bacteria 2028
1478 nmdc:mga08y16_65751_c1 3300050511 Bacteria 3785
1479 nmdc:mga0n895_19623_c1 3300050512 Bacteria 6286
1480 nmdc:mga0n895_259788_c1 3300050512 Bacteria 1762
1481 nmdc:mga0n895_31844_c1 3300050512 Bacteria 5055
1482 nmdc:mga0n895_63852_c1 3300050512 Bacteria 3642
1483 nmdc:mga0n895_75070_c1 3300050512 Bacteria 3360
1484 nmdc:mga0n895_78660_c1 3300050512 Bacteria 3282
1485 nmdc:mga0n895_851_c1 3300050512 Bacteria 21931
1486 nmdc:mga0n895_8609_c1 3300050512 Bacteria 8851
1487 nmdc:mga0rr50_136180_c1 3300050513 Bacteria 1971
1488 nmdc:mga0rr50_16500_c1 3300050513 Bacteria 4908
1489 nmdc:mga0rr50_27607_c1 3300050513 Bacteria 3978
1490 nmdc:mga0rr50_33241_c1 3300050513 Bacteria 3683
1491 nmdc:mga0rr50_58264_c1 3300050513 Bacteria 2894
1492 nmdc:mga08x19_3551_c1 3300050514 Bacteria 9278
1493 nmdc:mga08x19_68068_c1 3300050514 Bacteria 2317
1494 nmdc:mga08x19_78843_c1 3300050514 Bacteria 2159
1495 nmdc:mga0a205_13992_c1 3300050515 Bacteria 7483
1496 nmdc:mga0a205_147153_c1 3300050515 Bacteria 2256
1497 nmdc:mga0a205_16466_c1 3300050515 Bacteria 6923
1498 nmdc:mga0a205_21551_c1 3300050515 Bacteria 6094
1499 nmdc:mga0a205_21834_c1 3300050515 Bacteria 6054
1500 nmdc:mga0a205_33836_c1 3300050515 Bacteria 4901
1501 nmdc:mga0a205_46371_c1 3300050515 Bacteria 4192
1502 nmdc:mga0a205_6488_c1 3300050515 Bacteria 10579
1503 Ga0495601_0000005 3300053077 Bacteria 387079
1504 Ga0495601_0000321 3300053077 Bacteria 25398
1505 Ga0495601_0000568 3300053077 Bacteria 19606
1506 Ga0495601_0000980 3300053077 Bacteria 15588
1507 Ga0495601_0002130 3300053077 Bacteria 11134
1508 Ga0495601_0002320 3300053077 Bacteria 10757
1509 Ga0495601_0004438 3300053077 Bacteria 8103
1510 Ga0495601_0008374 3300053077 Bacteria 6110
1511 Ga0495601_0018712 3300053077 Bacteria 4216
1512 Ga0495601_0021842 3300053077 Bacteria 3923
1513 Ga0495601_0025317 3300053077 Bacteria 3659
1514 Ga0495601_0082186 3300053077 Bacteria 2068
1515 Ga0495612_0000001 3300053078 Bacteria 418244
1516 Ga0495612_0000342 3300053078 Bacteria 18817
1517 Ga0495612_0002496 3300053078 Bacteria 7586
1518 Ga0495612_0003908 3300053078 Bacteria 6177
1519 Ga0495595_0000033 3300053084 Bacteria 86879
1520 Ga0495595_0001001 3300053084 Bacteria 10901
1521 Ga0495595_0002313 3300053084 Bacteria 7428
1522 Ga0495595_0003437 3300053084 Bacteria 6280
1523 Ga0495595_0010925 3300053084 Bacteria 3789
1524 Ga0495595_0023060 3300053084 Bacteria 2737
1525 Ga0495595_0037726 3300053084 Bacteria 2198
1526 Ga0495619_0000007 3300053085 Bacteria 369936
1527 Ga0495619_0000059 3300053085 Bacteria 92434
1528 Ga0495619_0000877 3300053085 Bacteria 19752
1529 Ga0495619_0001591 3300053085 Bacteria 14915
1530 Ga0495619_0002133 3300053085 Bacteria 13119
1531 Ga0495619_0002483 3300053085 Bacteria 12070
1532 Ga0495619_0006923 3300053085 Bacteria 7168
1533 Ga0495619_0019741 3300053085 Bacteria 4288
1534 Ga0495619_0020350 3300053085 Bacteria 4225
1535 Ga0495619_0021335 3300053085 Bacteria 4133
1536 Ga0495619_0045138 3300053085 Bacteria 2895
1537 Ga0495619_0099937 3300053085 Bacteria 1973
1538 Ga0500578_0045402 3300053086 Bacteria 2819
1539 Ga0500578_0092721 3300053086 Bacteria 1916
1540 Ga0500643_000025 3300053087 Bacteria 259605
1541 Ga0500651_0000454 3300053093 Bacteria 21894
1542 Ga0500651_0035428 3300053093 Bacteria 3145
1543 Ga0500554_000347 3300053102 Bacteria 9942
1544 Ga0500555_000954 3300053103 Bacteria 10062
1545 Ga0500556_0000184 3300053104 Bacteria 51248
1546 Ga0500562_002689 3300053108 Bacteria 4419
1547 Ga0500562_004887 3300053108 Bacteria 3376
1548 Ga0500569_008797 3300053109 Bacteria 2322
1549 Ga0500594_0001600 3300053118 Bacteria 4929
1550 Ga0500595_002419 3300053119 Bacteria 9317
1551 Ga0500658_0000064 3300053134 Bacteria 49390
1552 Ga0500658_0004485 3300053134 Bacteria 5211
1553 Ga0500559_0008794 3300053136 Bacteria 4399
1554 Ga0500561_0001087 3300053137 Bacteria 4379
1555 Ga0500568_0000059 3300053139 Bacteria 108096
1556 Ga0500568_0000738 3300053139 Bacteria 23375
1557 Ga0500590_008632 3300053148 Bacteria 5096
1558 Ga0500603_000375 3300053150 Bacteria 11694
1559 Ga0500616_0003045 3300053153 Bacteria 13190
1560 Ga0500616_0003400 3300053153 Bacteria 12210
1561 Ga0500616_0009246 3300053153 Bacteria 6007
1562 Ga0500616_0022352 3300053153 Bacteria 3532
1563 Ga0500622_0015306 3300053156 Bacteria 4108
1564 Ga0500622_0021626 3300053156 Bacteria 3414
1565 Ga0500637_0005499 3300053178 Bacteria 6140
1566 Ga0500645_012150 3300053730 Bacteria 2789
1567 Ga0500601_000244 3300053737 Bacteria 10578
1568 Ga0501084_0000056 3300054114 Bacteria 89249
1569 Ga0501084_0035292 3300054114 Bacteria 4180
1570 Ga0501082_0001835 3300060353 Bacteria 18697
1571 Ga0501082_0014422 3300060353 Bacteria 6801
1572 Ga0501082_0023725 3300060353 Bacteria 5289
1573 Ga0501082_0032090 3300060353 Bacteria 4531
1574 Ga0501082_0042038 3300060353 Bacteria 3941

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048907 Ga0496104_0355857 Ga0496104_0355857_25_1365 439
2 3300048906 Ga0496103_0087792 Ga0496103_0087792_10_1416 446
3 3300031090 Ga0265760_10000586 Ga0265760_100005864 448
4 3300031727 Ga0316576_10109245 Ga0316576_101092451 450
5 3300005436 Ga0070713_100001505 Ga0070713_10000150514 459
6 3300013308 Ga0157375_10238570 Ga0157375_102385702 461
7 3300048907 Ga0496104_0035484 Ga0496104_0035484_2130_3632 461
8 3300046663 Ga0495635_0061813 Ga0495635_0061813_1114_2562 468
9 3300009094 Ga0111539_10023661 Ga0111539_100236617 473
10 3300005937 Ga0081455_10031557 Ga0081455_100315572 478
11 3300009094 Ga0111539_10107243 Ga0111539_101072432 478
12 3300035085 Ga0373929_0012702 Ga0373929_0012702_35_1537 478
13 3300006852 Ga0075433_10023363 Ga0075433_100233635 479
14 3300006871 Ga0075434_100000694 Ga0075434_10000069427 479
15 3300047317 Ga0495604_0021272 Ga0495604_0021272_738_2345 479
16 3300013308 Ga0157375_10179022 Ga0157375_101790222 481
17 3300006846 Ga0075430_100009292 Ga0075430_1000092924 483
18 3300006847 Ga0075431_100001021 Ga0075431_10000102114 483
19 3300009094 Ga0111539_10024754 Ga0111539_100247544 483
20 3300009147 Ga0114129_10004588 Ga0114129_100045884 483
21 3300027907 Ga0207428_10033992 Ga0207428_100339923 483
22 3300027907 Ga0207428_10065536 Ga0207428_100655362 483
23 3300035691 Ga0373931_0034372 Ga0373931_0034372_293_2170 483
24 3300050507 nmdc:mga05p37_460_c1 nmdc:mga05p37_460_c1_27698_29326 483
25 3300050510 nmdc:mga06r32_183_c1 nmdc:mga06r32_183_c1_37552_39180 483
26 3300050511 nmdc:mga08y16_18071_c1 nmdc:mga08y16_18071_c1_4844_6472 483
27 3300050512 nmdc:mga0n895_851_c1 nmdc:mga0n895_851_c1_5003_6637 483
28 3300050515 nmdc:mga0a205_13992_c1 nmdc:mga0a205_13992_c1_2067_3701 483
29 3300025297 Ga0209758_1017507 Ga0209758_10175073 484
30 3300003775 Ga0055524_1000859 Ga0055524_100085914 485
31 iso_pu_bacteria 2996336353 2996336901 486
32 3300027907 Ga0207428_10011716 Ga0207428_100117163 487
33 3300035725 Ga0373947_0026295 Ga0373947_0026295_17_1540 487
34 3300046472 Ga0495580_0010811 Ga0495580_0010811_3380_4903 487
35 3300030763 Ga0265763_1000509 Ga0265763_10005092 488
36 3300035695 Ga0373927_0016406 Ga0373927_0016406_2208_3824 488
37 3300035725 Ga0373947_0058356 Ga0373947_0058356_144_1760 488
38 3300046455 Ga0495603_0062943 Ga0495603_0062943_313_1929 488
39 3300046459 Ga0495629_0049390 Ga0495629_0049390_258_1874 488
40 3300046473 Ga0495582_0050944 Ga0495582_0050944_455_2071 488
41 3300046499 Ga0495594_0026265 Ga0495594_0026265_156_1772 488
42 3300046642 Ga0495634_0100303 Ga0495634_0100303_227_1843 488
43 3300047321 Ga0495676_0124685 Ga0495676_0124685_45_1661 488
44 3300053085 Ga0495619_0045138 Ga0495619_0045138_431_2047 488
45 3300025910 Ga0207684_10020319 Ga0207684_100203192 489
46 3300035398 Ga0316574_0069263 Ga0316574_0069263_363_1874 489
47 3300036647 Ga0316582_0103124 Ga0316582_0103124_369_1880 489
48 3300050513 nmdc:mga0rr50_136180_c1 nmdc:mga0rr50_136180_c1_328_1875 489
49 3300005335 Ga0070666_10068220 Ga0070666_100682202 490
50 3300005355 Ga0070671_100154189 Ga0070671_1001541892 490
51 3300005548 Ga0070665_100194623 Ga0070665_1001946231 490
52 3300009101 Ga0105247_10051406 Ga0105247_100514063 490
53 3300013296 Ga0157374_10185977 Ga0157374_101859772 490
54 3300013297 Ga0157378_10041405 Ga0157378_100414054 490
55 3300013306 Ga0163162_10126121 Ga0163162_101261212 490
56 3300014969 Ga0157376_10161696 Ga0157376_101616962 490
57 3300025900 Ga0207710_10025285 Ga0207710_100252853 490
58 3300025931 Ga0207644_10126925 Ga0207644_101269251 490
59 3300025941 Ga0207711_10011699 Ga0207711_100116998 490
60 3300028379 Ga0268266_10048510 Ga0268266_100485105 490
61 3300048903 Ga0496100_0013577 Ga0496100_0013577_2807_4405 490
62 3300048905 Ga0496102_0024345 Ga0496102_0024345_301_1899 490
63 3300048906 Ga0496103_0017573 Ga0496103_0017573_329_1927 490
64 3300048907 Ga0496104_0189920 Ga0496104_0189920_60_1658 490
65 3300048909 Ga0496106_0102869 Ga0496106_0102869_444_2042 490
66 3300048910 Ga0496107_0060019 Ga0496107_0060019_1095_2693 490
67 3300048911 Ga0496108_0023816 Ga0496108_0023816_462_2060 490
68 3300048912 Ga0496109_0025468 Ga0496109_0025468_3485_5083 490
69 3300048915 Ga0496112_0025023 Ga0496112_0025023_2807_4405 490
70 3300048916 Ga0496113_0070981 Ga0496113_0070981_890_2488 490
71 3300031249 Ga0265339_10044271 Ga0265339_100442712 491
72 3300035242 Ga0373962_0017427 Ga0373962_0017427_42_1529 491
73 3300005355 Ga0070671_100084211 Ga0070671_1000842112 492
74 3300005434 Ga0070709_10006117 Ga0070709_100061171 492
75 3300005436 Ga0070713_100033342 Ga0070713_1000333421 492
76 3300005466 Ga0070685_10112339 Ga0070685_101123391 492
77 3300006028 Ga0070717_10021435 Ga0070717_100214354 492
78 3300006358 Ga0068871_100110187 Ga0068871_1001101872 492
79 3300014969 Ga0157376_10195448 Ga0157376_101954482 492
80 3300025928 Ga0207700_10104206 Ga0207700_101042061 492
81 3300025931 Ga0207644_10002999 Ga0207644_1000299912 492
82 3300025939 Ga0207665_10084677 Ga0207665_100846772 492
83 3300025941 Ga0207711_10139293 Ga0207711_101392932 492
84 3300026095 Ga0207676_10004875 Ga0207676_100048751 492
85 3300048903 Ga0496100_0003865 Ga0496100_0003865_3023_4621 492
86 3300048904 Ga0496101_0009977 Ga0496101_0009977_3236_4834 492
87 3300048905 Ga0496102_0085492 Ga0496102_0085492_1269_2867 492
88 3300048906 Ga0496103_0006448 Ga0496103_0006448_332_1930 492
89 3300048907 Ga0496104_0177734 Ga0496104_0177734_381_1979 492
90 3300048908 Ga0496105_0012825 Ga0496105_0012825_1795_3393 492
91 3300048909 Ga0496106_0014405 Ga0496106_0014405_332_1930 492
92 3300048910 Ga0496107_0115157 Ga0496107_0115157_321_1919 492
93 3300048911 Ga0496108_0002446 Ga0496108_0002446_7908_9506 492
94 3300048912 Ga0496109_0007673 Ga0496109_0007673_1424_3022 492
95 3300048913 Ga0496110_0017866 Ga0496110_0017866_1105_2703 492
96 3300048914 Ga0496111_0072409 Ga0496111_0072409_36_1634 492
97 3300048915 Ga0496112_0023998 Ga0496112_0023998_323_1921 492
98 3300048916 Ga0496113_0011936 Ga0496113_0011936_3914_5512 492
99 3300048917 Ga0496114_0007779 Ga0496114_0007779_6592_8190 492
100 3300048918 Ga0496115_0129618 Ga0496115_0129618_84_1682 492
101 3300005337 Ga0070682_100051022 Ga0070682_1000510221 493
102 3300006175 Ga0070712_100013537 Ga0070712_1000135374 493
103 3300046472 Ga0495580_0000672 Ga0495580_0000672_13338_14948 493
104 3300005444 Ga0070694_100053939 Ga0070694_1000539391 494
105 3300006358 Ga0068871_100136399 Ga0068871_1001363991 494
106 3300025258 Ga0209129_1000657 Ga0209129_100065720 494
107 3300025294 Ga0209025_1001191 Ga0209025_100119126 494
108 3300025297 Ga0209758_1000399 Ga0209758_100039921 494
109 3300035695 Ga0373927_0001393 Ga0373927_0001393_13000_14538 494
110 3300035725 Ga0373947_0002568 Ga0373947_0002568_8815_10353 494
111 3300046691 Ga0495670_0000610 Ga0495670_0000610_3919_5565 494
112 3300005331 Ga0070670_100018462 Ga0070670_1000184624 495
113 3300005336 Ga0070680_100013884 Ga0070680_1000138844 495
114 3300005337 Ga0070682_100002826 Ga0070682_1000028263 495
115 3300005339 Ga0070660_100052126 Ga0070660_1000521262 495
116 3300005366 Ga0070659_100016175 Ga0070659_1000161752 495
117 3300005440 Ga0070705_100039988 Ga0070705_1000399882 495
118 3300005456 Ga0070678_100046716 Ga0070678_1000467162 495
119 3300005577 Ga0068857_100070877 Ga0068857_1000708773 495
120 3300006186 Ga0075369_10007849 Ga0075369_100078495 495
121 3300006852 Ga0075433_10105692 Ga0075433_101056922 495
122 3300009545 Ga0105237_10016365 Ga0105237_100163656 495
123 3300013105 Ga0157369_10063426 Ga0157369_100634261 495
124 3300014969 Ga0157376_10067466 Ga0157376_100674661 495
125 3300025245 Ga0207425_1002741 Ga0207425_10027412 495
126 3300025258 Ga0209129_1002282 Ga0209129_10022824 495
127 3300025297 Ga0209758_1000501 Ga0209758_100050125 495
128 3300025912 Ga0207707_10029654 Ga0207707_100296545 495
129 3300025917 Ga0207660_10061658 Ga0207660_100616582 495
130 3300025921 Ga0207652_10093974 Ga0207652_100939741 495
131 3300026041 Ga0207639_10014630 Ga0207639_100146302 495
132 3300026067 Ga0207678_10006575 Ga0207678_100065753 495
133 3300035116 Ga0373945_0003130 Ga0373945_0003130_142_1749 495
134 3300035170 Ga0373943_0006877 Ga0373943_0006877_1868_3475 495
135 3300035171 Ga0373946_0012853 Ga0373946_0012853_660_2267 495
136 3300035692 Ga0373935_0011263 Ga0373935_0011263_3728_5335 495
137 3300035725 Ga0373947_0011627 Ga0373947_0011627_2399_4006 495
138 3300036401 Ga0373937_0033705 Ga0373937_0033705_1578_3185 495
139 3300037068 Ga0373925_0021021 Ga0373925_0021021_1043_2650 495
140 3300046459 Ga0495629_0017056 Ga0495629_0017056_2102_3709 495
141 3300046461 Ga0495641_0014631 Ga0495641_0014631_83_1690 495
142 3300046463 Ga0495653_0016386 Ga0495653_0016386_1397_3004 495
143 3300046499 Ga0495594_0005048 Ga0495594_0005048_3685_5292 495
144 3300046514 Ga0495618_0001813 Ga0495618_0001813_4149_5756 495
145 3300046517 Ga0495630_0016923 Ga0495630_0016923_2349_3956 495
146 3300046529 Ga0495652_0016715 Ga0495652_0016715_2863_4470 495
147 3300046533 Ga0495640_0000946 Ga0495640_0000946_18728_20335 495
148 3300046559 Ga0495667_0009553 Ga0495667_0009553_3386_4993 495
149 3300046642 Ga0495634_0002977 Ga0495634_0002977_3733_5340 495
150 3300046663 Ga0495635_0008099 Ga0495635_0008099_3444_5051 495
151 3300046683 Ga0495658_0003275 Ga0495658_0003275_4275_5882 495
152 3300046689 Ga0495613_0035712 Ga0495613_0035712_1003_2610 495
153 3300046809 Ga0495600_0005965 Ga0495600_0005965_2106_3713 495
154 3300047317 Ga0495604_0004953 Ga0495604_0004953_6057_7664 495
155 3300047319 Ga0495674_0009276 Ga0495674_0009276_4872_6479 495
156 3300047321 Ga0495676_0012818 Ga0495676_0012818_3828_5435 495
157 3300047322 Ga0495680_0010619 Ga0495680_0010619_4498_6105 495
158 3300047471 Ga0495684_0000945 Ga0495684_0000945_12091_13698 495
159 3300048905 Ga0496102_0010711 Ga0496102_0010711_4054_5739 495
160 3300048906 Ga0496103_0044754 Ga0496103_0044754_911_2596 495
161 3300048907 Ga0496104_0034899 Ga0496104_0034899_794_2479 495
162 3300053077 Ga0495601_0000980 Ga0495601_0000980_11876_13483 495
163 3300053078 Ga0495612_0003908 Ga0495612_0003908_49_1656 495
164 3300053084 Ga0495595_0002313 Ga0495595_0002313_2348_3955 495
165 3300053085 Ga0495619_0006923 Ga0495619_0006923_1699_3306 495
166 3300005353 Ga0070669_100043457 Ga0070669_1000434572 496
167 3300005365 Ga0070688_100023342 Ga0070688_1000233422 496
168 3300005467 Ga0070706_100000310 Ga0070706_10000031035 496
169 3300005471 Ga0070698_100038520 Ga0070698_1000385204 496
170 3300005842 Ga0068858_100204515 Ga0068858_1002045152 496
171 3300007076 Ga0075435_100022091 Ga0075435_1000220915 496
172 3300009177 Ga0105248_10064710 Ga0105248_100647105 496
173 3300013306 Ga0163162_10086261 Ga0163162_100862613 496
174 3300025910 Ga0207684_10000086 Ga0207684_10000086174 496
175 3300025936 Ga0207670_10007628 Ga0207670_100076283 496
176 3300025941 Ga0207711_10048306 Ga0207711_100483062 496
177 3300025960 Ga0207651_10099053 Ga0207651_100990531 496
178 3300026035 Ga0207703_10144182 Ga0207703_101441821 496
179 3300031727 Ga0316576_10076859 Ga0316576_100768592 496
180 3300005435 Ga0070714_100081096 Ga0070714_1000810962 497
181 3300005468 Ga0070707_100063334 Ga0070707_1000633341 497
182 3300006880 Ga0075429_100020283 Ga0075429_1000202835 497
183 3300014969 Ga0157376_10042270 Ga0157376_100422701 497
184 3300025929 Ga0207664_10117091 Ga0207664_101170911 497
185 3300028017 Ga0265356_1000097 Ga0265356_100009711 497
186 3300028800 Ga0265338_10001404 Ga0265338_1000140429 497
187 3300030760 Ga0265762_1008929 Ga0265762_10089292 497
188 3300031090 Ga0265760_10000149 Ga0265760_1000014911 497
189 3300031241 Ga0265325_10000050 Ga0265325_1000005028 497
190 3300031595 Ga0265313_10000030 Ga0265313_1000003028 497
191 3300031665 Ga0316575_10020442 Ga0316575_100204422 497
192 3300031728 Ga0316578_10029768 Ga0316578_100297682 497
193 3300031733 Ga0316577_10041188 Ga0316577_100411882 497
194 3300032133 Ga0316583_10018387 Ga0316583_100183871 497
195 3300032137 Ga0316585_10006566 Ga0316585_100065662 497
196 3300033524 Ga0316592_1011908 Ga0316592_10119081 497
197 3300033528 Ga0316588_1009974 Ga0316588_10099741 497
198 3300033541 Ga0316596_1012432 Ga0316596_10124321 497
199 3300035398 Ga0316574_0028589 Ga0316574_0028589_1530_3170 497
200 3300037588 Ga0316581_0015797 Ga0316581_0015797_58_1698 497
201 3300039447 Ga0436361_0455437 Ga0436361_0455437_13903_15426 497
202 3300039447 Ga0436361_0784419 Ga0436361_0784419_1097_2620 497
203 3300046689 Ga0495613_0054514 Ga0495613_0054514_788_2317 497
204 3300048907 Ga0496104_0041319 Ga0496104_0041319_1703_3232 497
205 3300048908 Ga0496105_0041981 Ga0496105_0041981_820_2349 497
206 3300048910 Ga0496107_0125852 Ga0496107_0125852_59_1588 497
207 3300048918 Ga0496115_0046459 Ga0496115_0046459_1263_2792 497
208 3300005983 Ga0081540_1050315 Ga0081540_10503151 498
209 3300006846 Ga0075430_100000100 Ga0075430_10000010013 498
210 3300006847 Ga0075431_100012268 Ga0075431_1000122684 498
211 3300006871 Ga0075434_100075566 Ga0075434_1000755662 498
212 3300009147 Ga0114129_10003344 Ga0114129_1000334413 498
213 3300009147 Ga0114129_10060721 Ga0114129_100607213 498
214 3300025299 Ga0209256_1000131 Ga0209256_1000131118 498
215 3300050507 nmdc:mga05p37_13322_c2 nmdc:mga05p37_13322_c2_776_2518 498
216 3300050507 nmdc:mga05p37_25397_c1 nmdc:mga05p37_25397_c1_874_2403 498
217 3300050507 nmdc:mga05p37_81170_c1 nmdc:mga05p37_81170_c1_2210_3838 498
218 3300050509 nmdc:mga0qj67_965_c1 nmdc:mga0qj67_965_c1_11339_12868 498
219 3300050510 nmdc:mga06r32_21124_c1 nmdc:mga06r32_21124_c1_2495_4024 498
220 3300050512 nmdc:mga0n895_31844_c1 nmdc:mga0n895_31844_c1_942_2684 498
221 3300050512 nmdc:mga0n895_75070_c1 nmdc:mga0n895_75070_c1_559_2358 498
222 3300050513 nmdc:mga0rr50_27607_c1 nmdc:mga0rr50_27607_c1_1760_3502 498
223 3300005530 Ga0070679_100040140 Ga0070679_1000401401 499
224 3300005842 Ga0068858_100144510 Ga0068858_1001445102 499
225 3300006871 Ga0075434_100139007 Ga0075434_1001390072 499
226 3300009177 Ga0105248_10093827 Ga0105248_100938272 499
227 3300013296 Ga0157374_10158320 Ga0157374_101583202 499
228 3300021361 Ga0213872_10001911 Ga0213872_100019114 499
229 3300025907 Ga0207645_10069302 Ga0207645_100693022 499
230 3300025941 Ga0207711_10101509 Ga0207711_101015091 499
231 3300031665 Ga0316575_10007029 Ga0316575_100070293 499
232 3300031665 Ga0316575_10011374 Ga0316575_100113743 499
233 3300031665 Ga0316575_10014690 Ga0316575_100146901 499
234 3300031665 Ga0316575_10032222 Ga0316575_100322222 499
235 3300031691 Ga0316579_10004171 Ga0316579_100041713 499
236 3300031691 Ga0316579_10030384 Ga0316579_100303841 499
237 3300031727 Ga0316576_10014116 Ga0316576_100141163 499
238 3300031727 Ga0316576_10057390 Ga0316576_100573901 499
239 3300031728 Ga0316578_10008151 Ga0316578_100081513 499
240 3300031728 Ga0316578_10010332 Ga0316578_100103323 499
241 3300031733 Ga0316577_10001908 Ga0316577_100019083 499
242 3300031733 Ga0316577_10028365 Ga0316577_100283652 499
243 3300032133 Ga0316583_10000281 Ga0316583_100002816 499
244 3300032133 Ga0316583_10006968 Ga0316583_100069681 499
245 3300032133 Ga0316583_10012004 Ga0316583_100120042 499
246 3300032137 Ga0316585_10000433 Ga0316585_100004336 499
247 3300032137 Ga0316585_10004497 Ga0316585_100044972 499
248 3300032137 Ga0316585_10006640 Ga0316585_100066402 499
249 3300032139 Ga0316580_10010643 Ga0316580_100106432 499
250 3300032168 Ga0316593_10017562 Ga0316593_100175622 499
251 3300033528 Ga0316588_1012157 Ga0316588_10121571 499
252 3300033541 Ga0316596_1001227 Ga0316596_10012273 499
253 3300033541 Ga0316596_1001412 Ga0316596_10014121 499
254 3300035398 Ga0316574_0016693 Ga0316574_0016693_1025_2611 499
255 3300035398 Ga0316574_0031300 Ga0316574_0031300_290_1909 499
256 3300035398 Ga0316574_0037785 Ga0316574_0037785_96_1667 499
257 3300035398 Ga0316574_0058235 Ga0316574_0058235_563_2191 499
258 3300035398 Ga0316574_0062661 Ga0316574_0062661_327_1958 499
259 3300036647 Ga0316582_0000721 Ga0316582_0000721_3532_5121 499
260 3300036647 Ga0316582_0024726 Ga0316582_0024726_1435_3054 499
261 3300036712 Ga0316584_0013749 Ga0316584_0013749_2918_4537 499
262 3300036712 Ga0316584_0017510 Ga0316584_0017510_2799_4409 499
263 3300036712 Ga0316584_0034962 Ga0316584_0034962_1633_3285 499
264 3300039447 Ga0436361_0853288 Ga0436361_0853288_13624_15177 499
265 3300002739 JGI25158J39367_1003658 JGI25158J39367_10036582 500
266 3300002987 JGI25159J45721_1000012 JGI25159J45721_100001212 500
267 3300003354 JGI25160J50197_1000042 JGI25160J50197_1000042140 500
268 3300003374 JGI25161J50226_1000305 JGI25161J50226_100030515 500
269 3300003771 Ga0055526_1006244 Ga0055526_10062445 500
270 3300003781 Ga0055536_1003542 Ga0055536_10035426 500
271 3300003791 Ga0055530_10011311 Ga0055530_100113112 500
272 3300003794 Ga0055531_10015903 Ga0055531_100159033 500
273 3300004625 Ga0055543_1000395 Ga0055543_10003956 500
274 3300005262 Ga0065165_1000174 Ga0065165_100017412 500
275 3300005295 Ga0065707_10089715 Ga0065707_100897154 500
276 3300005338 Ga0068868_100028039 Ga0068868_1000280392 500
277 3300005340 Ga0070689_100019676 Ga0070689_1000196762 500
278 3300005364 Ga0070673_100006294 Ga0070673_1000062943 500
279 3300005456 Ga0070678_100076054 Ga0070678_1000760542 500
280 3300005466 Ga0070685_10095147 Ga0070685_100951471 500
281 3300005530 Ga0070679_100094825 Ga0070679_1000948251 500
282 3300005983 Ga0081540_1002982 Ga0081540_100298210 500
283 3300006038 Ga0075365_10026268 Ga0075365_100262682 500
284 3300006178 Ga0075367_10002037 Ga0075367_100020372 500
285 3300006186 Ga0075369_10001195 Ga0075369_100011953 500
286 3300006844 Ga0075428_100035212 Ga0075428_1000352122 500
287 3300006847 Ga0075431_100046225 Ga0075431_1000462252 500
288 3300006847 Ga0075431_100164933 Ga0075431_1001649332 500
289 3300006852 Ga0075433_10022534 Ga0075433_100225343 500
290 3300006871 Ga0075434_100032510 Ga0075434_1000325102 500
291 3300007076 Ga0075435_100024285 Ga0075435_1000242852 500
292 3300007265 Ga0099794_10009713 Ga0099794_100097133 500
293 3300009094 Ga0111539_10126996 Ga0111539_101269963 500
294 3300009553 Ga0105249_10230118 Ga0105249_102301181 500
295 3300009766 Ga0123342_1024402 Ga0123342_10244021 500
296 3300025208 Ga0209436_100080 Ga0209436_10008012 500
297 3300025284 Ga0209130_1000075 Ga0209130_1000075141 500
298 3300025292 Ga0209676_1006011 Ga0209676_10060115 500
299 3300025294 Ga0209025_1010036 Ga0209025_10100365 500
300 3300025295 Ga0209564_1006120 Ga0209564_10061205 500
301 3300025298 Ga0209050_1008880 Ga0209050_10088802 500
302 3300025299 Ga0209256_1002274 Ga0209256_100227414 500
303 3300025302 Ga0207426_1000163 Ga0207426_1000163141 500
304 3300025303 Ga0209051_1017931 Ga0209051_10179313 500
305 3300025921 Ga0207652_10020941 Ga0207652_100209415 500
306 3300025936 Ga0207670_10082196 Ga0207670_100821961 500
307 3300025940 Ga0207691_10028500 Ga0207691_100285004 500
308 3300025960 Ga0207651_10008525 Ga0207651_100085251 500
309 3300027111 Ga0209281_1000869 Ga0209281_100086923 500
310 3300027395 Ga0209996_1000313 Ga0209996_10003136 500
311 3300027682 Ga0209971_1000009 Ga0209971_100000931 500
312 3300031665 Ga0316575_10000886 Ga0316575_100008863 500
313 3300031691 Ga0316579_10032925 Ga0316579_100329251 500
314 3300031727 Ga0316576_10028912 Ga0316576_100289124 500
315 3300031728 Ga0316578_10002173 Ga0316578_100021737 500
316 3300032137 Ga0316585_10001154 Ga0316585_100011542 500
317 3300032168 Ga0316593_10007466 Ga0316593_100074663 500
318 3300033524 Ga0316592_1003958 Ga0316592_10039582 500
319 3300033527 Ga0316586_1004278 Ga0316586_10042782 500
320 3300033541 Ga0316596_1008937 Ga0316596_10089372 500
321 3300034818 Ga0373950_0000035 Ga0373950_0000035_93885_95408 500
322 3300035398 Ga0316574_0001009 Ga0316574_0001009_8389_10005 500
323 3300035398 Ga0316574_0026664 Ga0316574_0026664_1842_3440 500
324 3300035398 Ga0316574_0073667 Ga0316574_0073667_528_2147 500
325 3300035692 Ga0373935_0128386 Ga0373935_0128386_32_1534 500
326 3300035695 Ga0373927_0006813 Ga0373927_0006813_799_2391 500
327 3300035724 Ga0373933_0001653 Ga0373933_0001653_1744_3267 500
328 3300036647 Ga0316582_0000583 Ga0316582_0000583_5622_7238 500
329 3300036647 Ga0316582_0035593 Ga0316582_0035593_591_2198 500
330 3300036712 Ga0316584_0010976 Ga0316584_0010976_369_1985 500
331 3300037418 Ga0395900_0167712 Ga0395900_0167712_620_2146 500
332 3300046452 Ga0495617_001182 Ga0495617_001182_3790_5418 500
333 3300046452 Ga0495617_010998 Ga0495617_010998_45_1547 500
334 3300046492 Ga0495585_0000003 Ga0495585_0000003_273218_274846 500
335 3300046513 Ga0495616_0003231 Ga0495616_0003231_2493_4121 500
336 3300046524 Ga0495648_0000011 Ga0495648_0000011_198309_199937 500
337 3300046536 Ga0495587_0025624 Ga0495587_0025624_2090_3592 500
338 3300046809 Ga0495600_0055557 Ga0495600_0055557_11_1513 500
339 3300047315 Ga0495581_0022666 Ga0495581_0022666_2111_3613 500
340 3300047319 Ga0495674_0101314 Ga0495674_0101314_547_2145 500
341 3300047323 Ga0495683_0001897 Ga0495683_0001897_10497_12137 500
342 3300048089 Ga0495614_0062861 Ga0495614_0062861_61_1563 500
343 3300048903 Ga0496100_0147386 Ga0496100_0147386_141_1643 500
344 3300048907 Ga0496104_0012840 Ga0496104_0012840_1202_2839 500
345 3300048907 Ga0496104_0054969 Ga0496104_0054969_2226_3749 500
346 3300049574 Ga0501038_0069826 Ga0501038_0069826_641_2161 500
347 3300049580 Ga0501046_0000002 Ga0501046_0000002_42041_43564 500
348 3300049581 Ga0501047_0097546 Ga0501047_0097546_1258_2778 500
349 3300049583 Ga0501067_0000107 Ga0501067_0000107_42652_44175 500
350 3300049583 Ga0501067_0015750 Ga0501067_0015750_1895_3415 500
351 3300049583 Ga0501067_0056030 Ga0501067_0056030_609_2132 500
352 3300049584 Ga0501068_0000021 Ga0501068_0000021_6800_8320 500
353 3300049585 Ga0501069_0008724 Ga0501069_0008724_1313_2833 500
354 3300049585 Ga0501069_0024293 Ga0501069_0024293_53_1576 500
355 3300049586 Ga0501070_0000023 Ga0501070_0000023_31369_32892 500
356 3300049586 Ga0501070_0073596 Ga0501070_0073596_48_1571 500
357 3300049588 Ga0501072_0000028 Ga0501072_0000028_58127_59647 500
358 3300049589 Ga0501073_0000095 Ga0501073_0000095_51230_52753 500
359 3300049589 Ga0501073_0006162 Ga0501073_0006162_4559_6082 500
360 3300049589 Ga0501073_0012122 Ga0501073_0012122_4469_5992 500
361 3300049589 Ga0501073_0017866 Ga0501073_0017866_1208_2731 500
362 3300049590 Ga0501074_0031168 Ga0501074_0031168_830_2350 500
363 3300049593 Ga0501077_0001503 Ga0501077_0001503_6104_7624 500
364 3300049742 Ga0501080_0057767 Ga0501080_0057767_2061_3584 500
365 3300049742 Ga0501080_0079477 Ga0501080_0079477_576_2099 500
366 3300049743 Ga0501081_0018342 Ga0501081_0018342_1512_3035 500
367 3300049744 Ga0501083_0010940 Ga0501083_0010940_3707_5230 500
368 3300049744 Ga0501083_0025795 Ga0501083_0025795_540_2060 500
369 3300050513 nmdc:mga0rr50_33241_c1 nmdc:mga0rr50_33241_c1_274_1797 500
370 3300050515 nmdc:mga0a205_46371_c1 nmdc:mga0a205_46371_c1_1928_3538 500
371 3300053077 Ga0495601_0018712 Ga0495601_0018712_2678_4201 500
372 3300054114 Ga0501084_0000056 Ga0501084_0000056_76668_78188 500
373 3300060353 Ga0501082_0001835 Ga0501082_0001835_7979_9499 500
374 3300060353 Ga0501082_0014422 Ga0501082_0014422_2982_4505 500
375 iso_pu_bacteria 2517093001 2517106651 500
376 3300005295 Ga0065707_10014590 Ga0065707_100145901 501
377 3300005330 Ga0070690_100027767 Ga0070690_1000277671 501
378 3300005335 Ga0070666_10006038 Ga0070666_100060384 501
379 3300005338 Ga0068868_100142672 Ga0068868_1001426721 501
380 3300005353 Ga0070669_100059586 Ga0070669_1000595862 501
381 3300005355 Ga0070671_100029154 Ga0070671_1000291543 501
382 3300005367 Ga0070667_100008416 Ga0070667_1000084165 501
383 3300005548 Ga0070665_100058904 Ga0070665_1000589042 501
384 3300005617 Ga0068859_100030137 Ga0068859_1000301375 501
385 3300005841 Ga0068863_100039872 Ga0068863_1000398721 501
386 3300005843 Ga0068860_100004444 Ga0068860_1000044447 501
387 3300006028 Ga0070717_10131315 Ga0070717_101313152 501
388 3300006178 Ga0075367_10023742 Ga0075367_100237422 501
389 3300006237 Ga0097621_100110778 Ga0097621_1001107782 501
390 3300006852 Ga0075433_10076404 Ga0075433_100764042 501
391 3300006931 Ga0097620_100030134 Ga0097620_1000301342 501
392 3300009098 Ga0105245_10003993 Ga0105245_1000399313 501
393 3300013296 Ga0157374_10015802 Ga0157374_100158026 501
394 3300013306 Ga0163162_10014080 Ga0163162_100140804 501
395 3300013308 Ga0157375_10025788 Ga0157375_100257881 501
396 3300014325 Ga0163163_10064190 Ga0163163_100641902 501
397 3300014968 Ga0157379_10005055 Ga0157379_100050555 501
398 3300014969 Ga0157376_10052219 Ga0157376_100522191 501
399 3300025939 Ga0207665_10050370 Ga0207665_100503702 501
400 3300025941 Ga0207711_10014649 Ga0207711_100146493 501
401 3300026035 Ga0207703_10010145 Ga0207703_100101454 501
402 3300028379 Ga0268266_10135932 Ga0268266_101359321 501
403 3300028381 Ga0268264_10010707 Ga0268264_100107073 501
404 3300028800 Ga0265338_10003401 Ga0265338_100034017 501
405 3300031239 Ga0265328_10002438 Ga0265328_100024382 501
406 3300031240 Ga0265320_10001053 Ga0265320_100010538 501
407 3300031240 Ga0265320_10045220 Ga0265320_100452201 501
408 3300031712 Ga0265342_10000289 Ga0265342_1000028940 501
409 3300031712 Ga0265342_10001993 Ga0265342_100019938 501
410 3300048907 Ga0496104_0016818 Ga0496104_0016818_160_1797 501
411 3300048909 Ga0496106_0119000 Ga0496106_0119000_37_1689 501
412 3300048911 Ga0496108_0022136 Ga0496108_0022136_189_1826 501
413 3300048912 Ga0496109_0001561 Ga0496109_0001561_7374_9011 501
414 3300048913 Ga0496110_0037305 Ga0496110_0037305_461_2098 501
415 3300050492 nmdc:mga0yw44_26570_c1 nmdc:mga0yw44_26570_c1_933_2639 501
416 3300050493 nmdc:mga0k408_33924_c1 nmdc:mga0k408_33924_c1_608_2314 501
417 3300050494 nmdc:mga06z11_26407_c1 nmdc:mga06z11_26407_c1_449_2155 501
418 3300005329 Ga0070683_100002396 Ga0070683_10000239611 502
419 3300005329 Ga0070683_100003410 Ga0070683_1000034103 502
420 3300005354 Ga0070675_100148689 Ga0070675_1001486892 502
421 3300005439 Ga0070711_100015901 Ga0070711_1000159014 502
422 3300005535 Ga0070684_100001303 Ga0070684_1000013033 502
423 3300005535 Ga0070684_100001930 Ga0070684_10000193012 502
424 3300005616 Ga0068852_100118306 Ga0068852_1001183062 502
425 3300005841 Ga0068863_100018695 Ga0068863_1000186952 502
426 3300005844 Ga0068862_100016711 Ga0068862_1000167114 502
427 3300005937 Ga0081455_10100287 Ga0081455_101002872 502
428 3300006871 Ga0075434_100062795 Ga0075434_1000627953 502
429 3300009094 Ga0111539_10063046 Ga0111539_100630462 502
430 3300013307 Ga0157372_10209520 Ga0157372_102095202 502
431 3300025911 Ga0207654_10007655 Ga0207654_100076553 502
432 3300025926 Ga0207659_10116317 Ga0207659_101163171 502
433 3300025944 Ga0207661_10000349 Ga0207661_1000034916 502
434 3300025944 Ga0207661_10000875 Ga0207661_100008756 502
435 3300026067 Ga0207678_10058717 Ga0207678_100587173 502
436 3300026078 Ga0207702_10003959 Ga0207702_1000395911 502
437 3300026088 Ga0207641_10014367 Ga0207641_100143672 502
438 3300027907 Ga0207428_10009544 Ga0207428_100095443 502
439 3300028380 Ga0268265_10015962 Ga0268265_100159624 502
440 3300031665 Ga0316575_10000520 Ga0316575_100005202 502
441 3300031727 Ga0316576_10000338 Ga0316576_100003388 502
442 3300031727 Ga0316576_10033033 Ga0316576_100330332 502
443 3300031727 Ga0316576_10064259 Ga0316576_100642591 502
444 3300031728 Ga0316578_10004402 Ga0316578_100044023 502
445 3300031728 Ga0316578_10028344 Ga0316578_100283442 502
446 3300031733 Ga0316577_10006285 Ga0316577_100062854 502
447 3300032139 Ga0316580_10012120 Ga0316580_100121202 502
448 3300035086 Ga0373934_0006196 Ga0373934_0006196_730_2364 502
449 3300035119 Ga0373956_0004360 Ga0373956_0004360_479_2113 502
450 3300035172 Ga0373955_0013751 Ga0373955_0013751_809_2443 502
451 3300035398 Ga0316574_0006476 Ga0316574_0006476_3763_5409 502
452 3300035398 Ga0316574_0035840 Ga0316574_0035840_889_2514 502
453 3300035410 Ga0373924_0025336 Ga0373924_0025336_95_1729 502
454 3300035724 Ga0373933_0003708 Ga0373933_0003708_6116_7750 502
455 3300036401 Ga0373937_0107675 Ga0373937_0107675_742_2430 502
456 3300036647 Ga0316582_0008819 Ga0316582_0008819_1783_3429 502
457 3300036712 Ga0316584_0002828 Ga0316584_0002828_8931_10577 502
458 3300036712 Ga0316584_0051408 Ga0316584_0051408_568_2193 502
459 3300037068 Ga0373925_0181582 Ga0373925_0181582_31_1569 502
460 3300038443 Ga0395901_0062723 Ga0395901_0062723_262_1869 502
461 3300046454 Ga0495592_0007242 Ga0495592_0007242_335_1969 502
462 3300046459 Ga0495629_0005519 Ga0495629_0005519_422_2056 502
463 3300046462 Ga0495651_0083152 Ga0495651_0083152_300_1934 502
464 3300046463 Ga0495653_0002132 Ga0495653_0002132_6723_8357 502
465 3300046511 Ga0495608_0007875 Ga0495608_0007875_682_2316 502
466 3300046529 Ga0495652_0001396 Ga0495652_0001396_1733_3367 502
467 3300046543 Ga0495645_0034571 Ga0495645_0034571_1782_3416 502
468 3300046559 Ga0495667_0000359 Ga0495667_0000359_26266_27900 502
469 3300046642 Ga0495634_0015780 Ga0495634_0015780_3731_5365 502
470 3300046663 Ga0495635_0003414 Ga0495635_0003414_6391_8025 502
471 3300046675 Ga0495657_0014963 Ga0495657_0014963_2959_4593 502
472 3300046678 Ga0495599_0000305 Ga0495599_0000305_815_2449 502
473 3300046689 Ga0495613_0019404 Ga0495613_0019404_271_1905 502
474 3300046809 Ga0495600_0006184 Ga0495600_0006184_373_2007 502
475 3300047317 Ga0495604_0005631 Ga0495604_0005631_2392_4026 502
476 3300047471 Ga0495684_0000297 Ga0495684_0000297_6509_8143 502
477 3300048912 Ga0496109_0000051 Ga0496109_0000051_43177_44736 502
478 3300048917 Ga0496114_0004829 Ga0496114_0004829_8786_10336 502
479 3300050511 nmdc:mga08y16_207829_c1 nmdc:mga08y16_207829_c1_395_1954 502
480 3300050515 nmdc:mga0a205_147153_c1 nmdc:mga0a205_147153_c1_459_2018 502
481 3300053085 Ga0495619_0000877 Ga0495619_0000877_2689_4323 502
482 iso_pu_bacteria 2883291878 2883294749 502
483 3300005329 Ga0070683_100063516 Ga0070683_1000635162 503
484 3300006844 Ga0075428_100054495 Ga0075428_1000544953 503
485 3300006846 Ga0075430_100031534 Ga0075430_1000315342 503
486 3300006852 Ga0075433_10031390 Ga0075433_100313903 503
487 3300006871 Ga0075434_100043275 Ga0075434_1000432752 503
488 3300006880 Ga0075429_100022193 Ga0075429_1000221936 503
489 3300013307 Ga0157372_10008562 Ga0157372_100085624 503
490 3300025944 Ga0207661_10051096 Ga0207661_100510963 503
491 3300026121 Ga0207683_10032518 Ga0207683_100325183 503
492 3300027907 Ga0207428_10011197 Ga0207428_100111977 503
493 3300046537 Ga0495598_0001479 Ga0495598_0001479_1199_2950 503
494 3300048915 Ga0496112_0052606 Ga0496112_0052606_1031_2653 503
495 3300050507 nmdc:mga05p37_77676_c1 nmdc:mga05p37_77676_c1_1333_2931 503
496 3300050508 nmdc:mga09592_54346_c1 nmdc:mga09592_54346_c1_1158_2756 503
497 3300050509 nmdc:mga0qj67_43766_c1 nmdc:mga0qj67_43766_c1_1301_2899 503
498 3300050510 nmdc:mga06r32_11345_c1 nmdc:mga06r32_11345_c1_5583_7181 503
499 3300050511 nmdc:mga08y16_19765_c1 nmdc:mga08y16_19765_c1_1347_2945 503
500 3300050512 nmdc:mga0n895_8609_c1 nmdc:mga0n895_8609_c1_6455_8053 503
501 3300050515 nmdc:mga0a205_6488_c1 nmdc:mga0a205_6488_c1_8141_9739 503
502 3300005436 Ga0070713_100021323 Ga0070713_1000213233 504
503 3300005437 Ga0070710_10003169 Ga0070710_100031696 504
504 3300006847 Ga0075431_100023751 Ga0075431_1000237513 504
505 3300006852 Ga0075433_10019011 Ga0075433_100190112 504
506 3300006871 Ga0075434_100026284 Ga0075434_1000262843 504
507 3300006880 Ga0075429_100022239 Ga0075429_1000222393 504
508 3300009094 Ga0111539_10033248 Ga0111539_100332486 504
509 3300014325 Ga0163163_10114177 Ga0163163_101141772 504
510 3300025898 Ga0207692_10003382 Ga0207692_100033827 504
511 3300025906 Ga0207699_10033010 Ga0207699_100330102 504
512 3300025928 Ga0207700_10071207 Ga0207700_100712071 504
513 3300031238 Ga0265332_10007913 Ga0265332_100079132 504
514 3300031247 Ga0265340_10001611 Ga0265340_100016119 504
515 3300031249 Ga0265339_10018185 Ga0265339_100181852 504
516 3300031250 Ga0265331_10055588 Ga0265331_100555881 504
517 3300031712 Ga0265342_10000031 Ga0265342_10000031125 504
518 3300039437 Ga0436365_0956053 Ga0436365_0956053_478_2049 504
519 3300046642 Ga0495634_0002863 Ga0495634_0002863_1941_3581 504
520 3300046679 Ga0495623_0001642 Ga0495623_0001642_10513_12153 504
521 3300046689 Ga0495613_0037230 Ga0495613_0037230_485_2125 504
522 3300047317 Ga0495604_0060496 Ga0495604_0060496_626_2266 504
523 3300047322 Ga0495680_0012449 Ga0495680_0012449_5257_6897 504
524 3300050512 nmdc:mga0n895_19623_c1 nmdc:mga0n895_19623_c1_1224_2822 504
525 3300050512 nmdc:mga0n895_63852_c1 nmdc:mga0n895_63852_c1_319_1905 504
526 3300050513 nmdc:mga0rr50_16500_c1 nmdc:mga0rr50_16500_c1_2014_3600 504
527 3300050515 nmdc:mga0a205_21834_c1 nmdc:mga0a205_21834_c1_3451_5049 504
528 iso_pu_bacteria 8005258706 8005262836 504
529 3300000545 CNXas_1000056 CNXas_10000565 505
530 3300005455 Ga0070663_100012170 Ga0070663_1000121703 505
531 3300005539 Ga0068853_100008160 Ga0068853_1000081604 505
532 3300005547 Ga0070693_100026718 Ga0070693_1000267183 505
533 3300005614 Ga0068856_100138031 Ga0068856_1001380312 505
534 3300005618 Ga0068864_100075872 Ga0068864_1000758722 505
535 3300005983 Ga0081540_1001568 Ga0081540_10015686 505
536 3300005983 Ga0081540_1047470 Ga0081540_10474702 505
537 3300006038 Ga0075365_10067034 Ga0075365_100670342 505
538 3300009174 Ga0105241_10014227 Ga0105241_100142272 505
539 3300009176 Ga0105242_10038780 Ga0105242_100387802 505
540 3300009177 Ga0105248_10058160 Ga0105248_100581606 505
541 3300010375 Ga0105239_10123882 Ga0105239_101238824 505
542 3300011119 Ga0105246_10028009 Ga0105246_100280092 505
543 3300013308 Ga0157375_10020553 Ga0157375_100205532 505
544 3300014325 Ga0163163_10005914 Ga0163163_100059143 505
545 3300014968 Ga0157379_10183694 Ga0157379_101836941 505
546 3300014969 Ga0157376_10136647 Ga0157376_101366472 505
547 3300025934 Ga0207686_10091385 Ga0207686_100913851 505
548 3300031241 Ga0265325_10000048 Ga0265325_1000004814 505
549 3300035086 Ga0373934_0024015 Ga0373934_0024015_672_2282 505
550 3300035119 Ga0373956_0007443 Ga0373956_0007443_1005_2615 505
551 3300035170 Ga0373943_0012367 Ga0373943_0012367_145_1770 505
552 3300035172 Ga0373955_0003880 Ga0373955_0003880_96_1712 505
553 3300036401 Ga0373937_0015738 Ga0373937_0015738_366_1982 505
554 3300046454 Ga0495592_0079377 Ga0495592_0079377_391_2007 505
555 3300046514 Ga0495618_0004415 Ga0495618_0004415_5164_6780 505
556 3300046516 Ga0495628_0032865 Ga0495628_0032865_2178_3794 505
557 3300046529 Ga0495652_0059529 Ga0495652_0059529_669_2285 505
558 3300046533 Ga0495640_0013870 Ga0495640_0013870_1508_3124 505
559 3300046536 Ga0495587_0002573 Ga0495587_0002573_10303_11919 505
560 3300046543 Ga0495645_0061732 Ga0495645_0061732_369_1985 505
561 3300046559 Ga0495667_0062609 Ga0495667_0062609_437_2053 505
562 3300046663 Ga0495635_0001753 Ga0495635_0001753_4717_6333 505
563 3300046678 Ga0495599_0060141 Ga0495599_0060141_369_1985 505
564 3300046679 Ga0495623_0003465 Ga0495623_0003465_8758_10374 505
565 3300047317 Ga0495604_0000613 Ga0495604_0000613_7571_9187 505
566 3300047319 Ga0495674_0012764 Ga0495674_0012764_6060_7676 505
567 3300047322 Ga0495680_0005491 Ga0495680_0005491_9229_10845 505
568 3300047444 Ga0495675_0006795 Ga0495675_0006795_5034_6650 505
569 3300047471 Ga0495684_0054901 Ga0495684_0054901_300_1916 505
570 3300048088 Ga0495602_0020196 Ga0495602_0020196_4754_6370 505
571 3300048903 Ga0496100_0048298 Ga0496100_0048298_944_2602 505
572 3300048904 Ga0496101_0019984 Ga0496101_0019984_973_2631 505
573 3300048906 Ga0496103_0025544 Ga0496103_0025544_1407_2951 505
574 3300048907 Ga0496104_0077301 Ga0496104_0077301_224_1882 505
575 3300048909 Ga0496106_0007481 Ga0496106_0007481_5754_7439 505
576 3300048912 Ga0496109_0054062 Ga0496109_0054062_1226_2770 505
577 3300048913 Ga0496110_0088709 Ga0496110_0088709_1130_2671 505
578 3300048917 Ga0496114_0006917 Ga0496114_0006917_6545_8089 505
579 3300048918 Ga0496115_0093994 Ga0496115_0093994_349_1965 505
580 3300048918 Ga0496115_0211317 Ga0496115_0211317_37_1581 505
581 3300050492 nmdc:mga0yw44_71755_c1 nmdc:mga0yw44_71755_c1_157_1803 505
582 3300053077 Ga0495601_0002130 Ga0495601_0002130_8660_10276 505
583 3300053078 Ga0495612_0002496 Ga0495612_0002496_3793_5409 505
584 3300053084 Ga0495595_0023060 Ga0495595_0023060_672_2288 505
585 3300053085 Ga0495619_0001591 Ga0495619_0001591_4964_6580 505
586 iso_pu_bacteria 2989771324 2989772514 505
587 3300005436 Ga0070713_100043189 Ga0070713_1000431891 506
588 3300005535 Ga0070684_100001996 Ga0070684_1000019962 506
589 3300005563 Ga0068855_100177802 Ga0068855_1001778022 506
590 3300006028 Ga0070717_10017148 Ga0070717_100171482 506
591 3300006195 Ga0075366_10007390 Ga0075366_100073902 506
592 3300009147 Ga0114129_10233336 Ga0114129_102333362 506
593 3300009545 Ga0105237_10017752 Ga0105237_100177521 506
594 3300010375 Ga0105239_10104102 Ga0105239_101041021 506
595 3300013296 Ga0157374_10144723 Ga0157374_101447231 506
596 3300013306 Ga0163162_10168074 Ga0163162_101680742 506
597 3300013308 Ga0157375_10124439 Ga0157375_101244392 506
598 3300025914 Ga0207671_10132401 Ga0207671_101324011 506
599 3300025915 Ga0207693_10051842 Ga0207693_100518422 506
600 3300025921 Ga0207652_10009388 Ga0207652_100093883 506
601 3300025921 Ga0207652_10041544 Ga0207652_100415442 506
602 3300025928 Ga0207700_10002139 Ga0207700_100021393 506
603 3300026067 Ga0207678_10027621 Ga0207678_100276211 506
604 3300026121 Ga0207683_10140419 Ga0207683_101404192 506
605 3300031240 Ga0265320_10030160 Ga0265320_100301602 506
606 3300031595 Ga0265313_10022719 Ga0265313_100227192 506
607 3300031711 Ga0265314_10025219 Ga0265314_100252192 506
608 3300031712 Ga0265342_10013038 Ga0265342_100130384 506
609 3300033180 Ga0307510_10022486 Ga0307510_100224863 506
610 3300033180 Ga0307510_10067066 Ga0307510_100670663 506
611 3300035172 Ga0373955_0050565 Ga0373955_0050565_158_1867 506
612 3300035695 Ga0373927_0028658 Ga0373927_0028658_830_2416 506
613 3300035695 Ga0373927_0034840 Ga0373927_0034840_1451_3037 506
614 3300035725 Ga0373947_0005272 Ga0373947_0005272_237_1946 506
615 3300035725 Ga0373947_0049733 Ga0373947_0049733_264_1850 506
616 3300037466 Ga0395898_0050256 Ga0395898_0050256_1650_3359 506
617 3300046455 Ga0495603_0000079 Ga0495603_0000079_21516_23225 506
618 3300046459 Ga0495629_0002647 Ga0495629_0002647_8709_10418 506
619 3300046472 Ga0495580_0000434 Ga0495580_0000434_5467_7176 506
620 3300046473 Ga0495582_0000429 Ga0495582_0000429_5722_7431 506
621 3300046475 Ga0495639_0003660 Ga0495639_0003660_736_2445 506
622 3300046499 Ga0495594_0000174 Ga0495594_0000174_19653_21362 506
623 3300046507 Ga0495606_0020300 Ga0495606_0020300_2434_4143 506
624 3300046524 Ga0495648_0035396 Ga0495648_0035396_658_2367 506
625 3300046531 Ga0495665_0012864 Ga0495665_0012864_1954_3663 506
626 3300046642 Ga0495634_0014854 Ga0495634_0014854_3842_5551 506
627 3300046663 Ga0495635_0006871 Ga0495635_0006871_1763_3478 506
628 3300046689 Ga0495613_0000495 Ga0495613_0000495_2006_3715 506
629 3300046690 Ga0495624_0041562 Ga0495624_0041562_487_2196 506
630 3300046694 Ga0495649_0028858 Ga0495649_0028858_554_2263 506
631 3300047315 Ga0495581_0003589 Ga0495581_0003589_7028_8737 506
632 3300048904 Ga0496101_0183744 Ga0496101_0183744_55_1599 506
633 3300048915 Ga0496112_0068136 Ga0496112_0068136_1664_3406 506
634 3300049575 Ga0501039_0017833 Ga0501039_0017833_1136_2770 506
635 3300049582 Ga0501048_0013445 Ga0501048_0013445_2362_3996 506
636 3300049741 Ga0501079_0011380 Ga0501079_0011380_4196_5830 506
637 3300049824 Ga0501045_0016545 Ga0501045_0016545_796_2448 506
638 3300050493 nmdc:mga0k408_7563_c1 nmdc:mga0k408_7563_c1_982_2631 506
639 3300050509 nmdc:mga0qj67_45785_c1 nmdc:mga0qj67_45785_c1_484_2130 506
640 3300053087 Ga0500643_000025 Ga0500643_000025_89531_91186 506
641 3300053103 Ga0500555_000954 Ga0500555_000954_395_2050 506
642 3300053730 Ga0500645_012150 Ga0500645_012150_394_2148 506
643 3300054114 Ga0501084_0035292 Ga0501084_0035292_2440_4074 506
644 3300060353 Ga0501082_0032090 Ga0501082_0032090_91_1725 506
645 3300005329 Ga0070683_100167707 Ga0070683_1001677072 507
646 3300005548 Ga0070665_100098056 Ga0070665_1000980561 507
647 3300009147 Ga0114129_10121462 Ga0114129_101214621 507
648 3300013306 Ga0163162_10205670 Ga0163162_102056702 507
649 3300025944 Ga0207661_10058345 Ga0207661_100583452 507
650 3300035691 Ga0373931_0023742 Ga0373931_0023742_588_2204 507
651 3300046463 Ga0495653_0000254 Ga0495653_0000254_35764_37374 507
652 3300046514 Ga0495618_0068314 Ga0495618_0068314_10_1614 507
653 3300046537 Ga0495598_0008146 Ga0495598_0008146_117_1826 507
654 3300049579 Ga0501043_0121916 Ga0501043_0121916_123_1799 507
655 3300049583 Ga0501067_0068618 Ga0501067_0068618_361_1944 507
656 3300049741 Ga0501079_0031604 Ga0501079_0031604_34_1671 507
657 3300050507 nmdc:mga05p37_21883_c1 nmdc:mga05p37_21883_c1_433_2049 507
658 3300053077 Ga0495601_0025317 Ga0495601_0025317_984_2588 507
659 3300053085 Ga0495619_0020350 Ga0495619_0020350_573_2177 507
660 iso_pu_bacteria 2842509118 2842509411 507
661 3300005439 Ga0070711_100087880 Ga0070711_1000878802 508
662 3300005530 Ga0070679_100221658 Ga0070679_1002216581 508
663 3300005535 Ga0070684_100004750 Ga0070684_1000047505 508
664 3300005539 Ga0068853_100071476 Ga0068853_1000714762 508
665 3300005546 Ga0070696_100001705 Ga0070696_10000170512 508
666 3300005547 Ga0070693_100038833 Ga0070693_1000388331 508
667 3300005563 Ga0068855_100117720 Ga0068855_1001177202 508
668 3300005564 Ga0070664_100063518 Ga0070664_1000635182 508
669 3300005616 Ga0068852_100007592 Ga0068852_1000075924 508
670 3300006237 Ga0097621_100039475 Ga0097621_1000394753 508
671 3300006237 Ga0097621_100061983 Ga0097621_1000619832 508
672 3300006844 Ga0075428_100154878 Ga0075428_1001548782 508
673 3300006871 Ga0075434_100006825 Ga0075434_1000068256 508
674 3300009098 Ga0105245_10034338 Ga0105245_100343382 508
675 3300009174 Ga0105241_10003528 Ga0105241_100035286 508
676 3300009177 Ga0105248_10244859 Ga0105248_102448592 508
677 3300013105 Ga0157369_10160927 Ga0157369_101609272 508
678 3300013297 Ga0157378_10117989 Ga0157378_101179892 508
679 3300013306 Ga0163162_10045638 Ga0163162_100456381 508
680 3300013307 Ga0157372_10044726 Ga0157372_100447262 508
681 3300013308 Ga0157375_10183349 Ga0157375_101833491 508
682 3300014969 Ga0157376_10009403 Ga0157376_100094033 508
683 3300014969 Ga0157376_10029854 Ga0157376_100298544 508
684 3300025911 Ga0207654_10006185 Ga0207654_100061853 508
685 3300025912 Ga0207707_10010395 Ga0207707_100103952 508
686 3300025916 Ga0207663_10034429 Ga0207663_100344291 508
687 3300025944 Ga0207661_10060493 Ga0207661_100604932 508
688 3300025945 Ga0207679_10050051 Ga0207679_100500512 508
689 3300025945 Ga0207679_10109155 Ga0207679_101091552 508
690 3300026035 Ga0207703_10158613 Ga0207703_101586131 508
691 3300026041 Ga0207639_10032829 Ga0207639_100328291 508
692 3300026067 Ga0207678_10066339 Ga0207678_100663392 508
693 3300026121 Ga0207683_10132118 Ga0207683_101321182 508
694 3300027907 Ga0207428_10061985 Ga0207428_100619851 508
695 3300036401 Ga0373937_0012255 Ga0373937_0012255_4310_5881 508
696 3300039438 Ga0436360_0947776 Ga0436360_0947776_454_2055 508
697 3300041491 Ga0451833_0683236 Ga0451833_0683236_2540_4081 508
698 3300041505 Ga0451849_1244665 Ga0451849_1244665_3450_4991 508
699 3300041509 Ga0451843_0309713 Ga0451843_0309713_237_1778 508
700 3300047319 Ga0495674_0010069 Ga0495674_0010069_1616_3241 508
701 3300047471 Ga0495684_0013638 Ga0495684_0013638_2938_4530 508
702 3300048904 Ga0496101_0099137 Ga0496101_0099137_120_1688 508
703 3300048908 Ga0496105_0026034 Ga0496105_0026034_1824_3437 508
704 3300048910 Ga0496107_0007929 Ga0496107_0007929_5678_7303 508
705 3300048911 Ga0496108_0111954 Ga0496108_0111954_652_2265 508
706 3300048912 Ga0496109_0067968 Ga0496109_0067968_1173_2786 508
707 3300048915 Ga0496112_0025853 Ga0496112_0025853_830_2443 508
708 3300048915 Ga0496112_0057895 Ga0496112_0057895_1608_3176 508
709 3300048918 Ga0496115_0019570 Ga0496115_0019570_986_2581 508
710 3300048918 Ga0496115_0025857 Ga0496115_0025857_447_2072 508
711 3300048918 Ga0496115_0078893 Ga0496115_0078893_869_2494 508
712 3300050511 nmdc:mga08y16_10345_c1 nmdc:mga08y16_10345_c1_2586_4268 508
713 3300050513 nmdc:mga0rr50_58264_c1 nmdc:mga0rr50_58264_c1_122_1804 508
714 3300050515 nmdc:mga0a205_21551_c1 nmdc:mga0a205_21551_c1_3300_4982 508
715 3300053153 Ga0500616_0022352 Ga0500616_0022352_551_2158 508
716 iso_pu_bacteria 2513237098 2513677994 508
717 iso_pu_bacteria 2513237141 2513894719 508
718 3300005445 Ga0070708_100000463 Ga0070708_10000046314 509
719 3300005458 Ga0070681_10072376 Ga0070681_100723763 509
720 3300005530 Ga0070679_100002450 Ga0070679_10000245015 509
721 3300025912 Ga0207707_10076561 Ga0207707_100765612 509
722 3300025921 Ga0207652_10165053 Ga0207652_101650532 509
723 3300035120 Ga0373957_0001576 Ga0373957_0001576_200_1759 509
724 3300035172 Ga0373955_0050616 Ga0373955_0050616_203_1762 509
725 3300036401 Ga0373937_0107775 Ga0373937_0107775_262_1821 509
726 3300046462 Ga0495651_0072934 Ga0495651_0072934_841_2406 509
727 3300047317 Ga0495604_0067631 Ga0495604_0067631_155_1750 509
728 3300053077 Ga0495601_0008374 Ga0495601_0008374_3691_5337 509
729 3300053084 Ga0495595_0010925 Ga0495595_0010925_66_1679 509
730 3300053085 Ga0495619_0099937 Ga0495619_0099937_42_1607 509
731 3300053136 Ga0500559_0008794 Ga0500559_0008794_2493_4163 509
732 3300005335 Ga0070666_10010253 Ga0070666_100102536 510
733 3300005364 Ga0070673_100057412 Ga0070673_1000574122 510
734 3300005367 Ga0070667_100010430 Ga0070667_1000104304 510
735 3300005456 Ga0070678_100043974 Ga0070678_1000439742 510
736 3300005530 Ga0070679_100054212 Ga0070679_1000542122 510
737 3300005543 Ga0070672_100098945 Ga0070672_1000989452 510
738 3300005548 Ga0070665_100051469 Ga0070665_1000514692 510
739 3300007076 Ga0075435_100064099 Ga0075435_1000640994 510
740 3300013296 Ga0157374_10060397 Ga0157374_100603972 510
741 3300013296 Ga0157374_10089473 Ga0157374_100894731 510
742 3300013308 Ga0157375_10002829 Ga0157375_100028296 510
743 3300014968 Ga0157379_10120395 Ga0157379_101203952 510
744 3300014969 Ga0157376_10041524 Ga0157376_100415241 510
745 3300025903 Ga0207680_10007938 Ga0207680_100079385 510
746 3300025924 Ga0207694_10009805 Ga0207694_100098054 510
747 3300025926 Ga0207659_10028351 Ga0207659_100283512 510
748 3300025940 Ga0207691_10002696 Ga0207691_100026969 510
749 3300025942 Ga0207689_10019759 Ga0207689_100197593 510
750 3300025960 Ga0207651_10009178 Ga0207651_100091782 510
751 3300025986 Ga0207658_10020305 Ga0207658_100203055 510
752 3300026121 Ga0207683_10044274 Ga0207683_100442743 510
753 3300028379 Ga0268266_10083895 Ga0268266_100838953 510
754 3300028379 Ga0268266_10109987 Ga0268266_101099871 510
755 3300035113 Ga0373936_0002689 Ga0373936_0002689_4187_5788 510
756 3300035118 Ga0373954_0003279 Ga0373954_0003279_131_1732 510
757 3300035171 Ga0373946_0001631 Ga0373946_0001631_2353_3954 510
758 3300035172 Ga0373955_0001143 Ga0373955_0001143_7025_8626 510
759 3300035410 Ga0373924_0002062 Ga0373924_0002062_1816_3417 510
760 3300035692 Ga0373935_0000556 Ga0373935_0000556_9212_10813 510
761 3300035695 Ga0373927_0001508 Ga0373927_0001508_10836_12437 510
762 3300035695 Ga0373927_0025713 Ga0373927_0025713_913_2643 510
763 3300035725 Ga0373947_0003947 Ga0373947_0003947_4230_5831 510
764 3300035725 Ga0373947_0059381 Ga0373947_0059381_346_1962 510
765 3300036401 Ga0373937_0004798 Ga0373937_0004798_4030_5631 510
766 3300037068 Ga0373925_0002823 Ga0373925_0002823_6739_8340 510
767 3300039447 Ga0436361_0999240 Ga0436361_0999240_8947_10554 510
768 3300045051 Ga0451576_0135724 Ga0451576_0135724_527_2149 510
769 3300046459 Ga0495629_0000315 Ga0495629_0000315_24988_26613 510
770 3300046462 Ga0495651_0023232 Ga0495651_0023232_2842_4572 510
771 3300046472 Ga0495580_0004809 Ga0495580_0004809_6613_8214 510
772 3300046472 Ga0495580_0102051 Ga0495580_0102051_122_1738 510
773 3300046475 Ga0495639_0011273 Ga0495639_0011273_1768_3393 510
774 3300046475 Ga0495639_0018800 Ga0495639_0018800_513_2114 510
775 3300046476 Ga0495662_0014663 Ga0495662_0014663_59_1660 510
776 3300046477 Ga0495664_0000425 Ga0495664_0000425_7505_9106 510
777 3300046516 Ga0495628_0023763 Ga0495628_0023763_883_2484 510
778 3300046517 Ga0495630_0002059 Ga0495630_0002059_6180_7781 510
779 3300046524 Ga0495648_0044069 Ga0495648_0044069_185_1792 510
780 3300046529 Ga0495652_0014422 Ga0495652_0014422_1487_3088 510
781 3300046531 Ga0495665_0053738 Ga0495665_0053738_246_1847 510
782 3300046533 Ga0495640_0005274 Ga0495640_0005274_7359_8960 510
783 3300046543 Ga0495645_0031814 Ga0495645_0031814_2124_3725 510
784 3300046559 Ga0495667_0086708 Ga0495667_0086708_151_1752 510
785 3300046642 Ga0495634_0002662 Ga0495634_0002662_7096_8697 510
786 3300046642 Ga0495634_0011929 Ga0495634_0011929_1966_3696 510
787 3300046663 Ga0495635_0017329 Ga0495635_0017329_1200_2825 510
788 3300046675 Ga0495657_0027029 Ga0495657_0027029_1263_2966 510
789 3300046680 Ga0495646_0074804 Ga0495646_0074804_265_1968 510
790 3300046683 Ga0495658_0005911 Ga0495658_0005911_1189_2814 510
791 3300046689 Ga0495613_0014036 Ga0495613_0014036_3249_4874 510
792 3300046690 Ga0495624_0015686 Ga0495624_0015686_2904_4505 510
793 3300047315 Ga0495581_0001735 Ga0495581_0001735_9354_10979 510
794 3300047319 Ga0495674_0002976 Ga0495674_0002976_11794_13395 510
795 3300047322 Ga0495680_0005251 Ga0495680_0005251_1268_2893 510
796 3300047322 Ga0495680_0027773 Ga0495680_0027773_1076_2779 510
797 3300048089 Ga0495614_0050202 Ga0495614_0050202_98_1723 510
798 3300050492 nmdc:mga0yw44_65657_c1 nmdc:mga0yw44_65657_c1_444_2060 510
799 3300050514 nmdc:mga08x19_78843_c1 nmdc:mga08x19_78843_c1_99_1715 510
800 3300053084 Ga0495595_0003437 Ga0495595_0003437_1688_3382 510
801 3300053085 Ga0495619_0002483 Ga0495619_0002483_7621_9246 510
802 iso_pu_bacteria 2513237144 2513913829 510
803 iso_pu_bacteria 2920760137 2920762074 510
804 iso_pu_bacteria 8024486573 8024489462 510
805 3300005436 Ga0070713_100066880 Ga0070713_1000668802 511
806 3300005439 Ga0070711_100026588 Ga0070711_1000265881 511
807 3300005455 Ga0070663_100073906 Ga0070663_1000739061 511
808 3300005518 Ga0070699_100000012 Ga0070699_10000001224 511
809 3300005548 Ga0070665_100049731 Ga0070665_1000497312 511
810 3300005983 Ga0081540_1002563 Ga0081540_100256312 511
811 3300006175 Ga0070712_100008029 Ga0070712_1000080299 511
812 3300006844 Ga0075428_100052603 Ga0075428_1000526033 511
813 3300006852 Ga0075433_10044318 Ga0075433_100443181 511
814 3300006871 Ga0075434_100088633 Ga0075434_1000886331 511
815 3300007076 Ga0075435_100057508 Ga0075435_1000575082 511
816 3300009098 Ga0105245_10011822 Ga0105245_100118223 511
817 3300009553 Ga0105249_10165678 Ga0105249_101656782 511
818 3300011119 Ga0105246_10107186 Ga0105246_101071861 511
819 3300025315 Ga0207697_10011880 Ga0207697_100118803 511
820 3300025906 Ga0207699_10007565 Ga0207699_100075651 511
821 3300025906 Ga0207699_10014082 Ga0207699_100140823 511
822 3300025911 Ga0207654_10005086 Ga0207654_100050864 511
823 3300025914 Ga0207671_10073262 Ga0207671_100732622 511
824 3300025915 Ga0207693_10003192 Ga0207693_100031927 511
825 3300025927 Ga0207687_10039689 Ga0207687_100396892 511
826 3300026023 Ga0207677_10007312 Ga0207677_100073122 511
827 3300026067 Ga0207678_10081380 Ga0207678_100813802 511
828 3300026118 Ga0207675_100121044 Ga0207675_1001210442 511
829 3300026121 Ga0207683_10022372 Ga0207683_100223722 511
830 3300028379 Ga0268266_10010853 Ga0268266_100108533 511
831 3300028800 Ga0265338_10083809 Ga0265338_100838092 511
832 3300046452 Ga0495617_016204 Ga0495617_016204_25_1734 511
833 3300046457 Ga0495590_0003258 Ga0495590_0003258_1770_3506 511
834 3300046460 Ga0495638_0016679 Ga0495638_0016679_2325_4034 511
835 3300046472 Ga0495580_0023479 Ga0495580_0023479_1948_3678 511
836 3300046474 Ga0495605_0024773 Ga0495605_0024773_161_1897 511
837 3300046477 Ga0495664_0025157 Ga0495664_0025157_1112_2842 511
838 3300046500 Ga0495596_0022274 Ga0495596_0022274_815_2551 511
839 3300046513 Ga0495616_0025088 Ga0495616_0025088_1303_3012 511
840 3300046514 Ga0495618_0025220 Ga0495618_0025220_1204_2934 511
841 3300046516 Ga0495628_0151943 Ga0495628_0151943_10_1656 511
842 3300046529 Ga0495652_0074915 Ga0495652_0074915_879_2609 511
843 3300046648 Ga0495611_0020307 Ga0495611_0020307_804_2540 511
844 3300046660 Ga0495625_0033583 Ga0495625_0033583_1168_2877 511
845 3300046680 Ga0495646_0050298 Ga0495646_0050298_109_1824 511
846 3300046684 Ga0495669_0033253 Ga0495669_0033253_50_1759 511
847 3300046694 Ga0495649_0013121 Ga0495649_0013121_1524_3260 511
848 3300047319 Ga0495674_0014927 Ga0495674_0014927_1726_3456 511
849 3300047445 Ga0495677_0021301 Ga0495677_0021301_223_1932 511
850 3300047471 Ga0495684_0081577 Ga0495684_0081577_106_1836 511
851 3300047673 Ga0495593_0014697 Ga0495593_0014697_1640_3370 511
852 3300048907 Ga0496104_0000997 Ga0496104_0000997_19151_20707 511
853 3300048907 Ga0496104_0107084 Ga0496104_0107084_143_1849 511
854 3300048908 Ga0496105_0039590 Ga0496105_0039590_1874_3478 511
855 3300048916 Ga0496113_0102419 Ga0496113_0102419_165_1769 511
856 3300048918 Ga0496115_0088121 Ga0496115_0088121_179_1885 511
857 3300048924 Ga0496121_0009187 Ga0496121_0009187_4822_6528 511
858 3300048929 Ga0496126_0027484 Ga0496126_0027484_2356_4074 511
859 3300048929 Ga0496126_0041487 Ga0496126_0041487_797_2503 511
860 3300050515 nmdc:mga0a205_16466_c1 nmdc:mga0a205_16466_c1_409_2031 511
861 3300053086 Ga0500578_0045402 Ga0500578_0045402_400_2109 511
862 3300053093 Ga0500651_0000454 Ga0500651_0000454_3608_5317 511
863 3300053108 Ga0500562_002689 Ga0500562_002689_2405_4114 511
864 3300053119 Ga0500595_002419 Ga0500595_002419_792_2501 511
865 3300053134 Ga0500658_0004485 Ga0500658_0004485_445_2154 511
866 3300053156 Ga0500622_0021626 Ga0500622_0021626_106_1842 511
867 iso_pu_bacteria 2513237104 2513715483 511
868 iso_pu_bacteria 2524023228 2524537462 511
869 iso_pu_bacteria 2816332527 2818240314 511
870 iso_pu_bacteria 2824600985 2824604994 511
871 iso_pu_bacteria 2824609381 2824613870 511
872 iso_pu_bacteria 2879099564 2879108143 511
873 iso_pu_bacteria 2922368715 2922373704 511
874 iso_pu_bacteria 2922368715 2922373705 511
875 iso_pu_bacteria 2929615660 2929617433 511
876 iso_pu_bacteria 2929624759 2929627138 511
877 iso_pu_bacteria 2932818245 2932820793 511
878 iso_pu_bacteria 2933577622 2933579389 511
879 iso_pu_bacteria 2935638405 2935642743 511
880 iso_pu_bacteria 2935665750 2935667845 511
881 iso_pu_bacteria 2935675223 2935682337 511
882 iso_pu_bacteria 2935684952 2935688596 511
883 iso_pu_bacteria 2935694250 2935695947 511
884 iso_pu_bacteria 2935703347 2935706686 511
885 iso_pu_bacteria 2935713505 2935715615 511
886 iso_pu_bacteria 2935722832 2935725821 511
887 iso_pu_bacteria 2935732158 2935734434 511
888 iso_pu_bacteria 2935741537 2935743813 511
889 iso_pu_bacteria 2935750917 2935754150 511
890 iso_pu_bacteria 2935760218 2935763189 511
891 iso_pu_bacteria 2935810662 2935812940 511
892 iso_pu_bacteria 2935827899 2935830592 511
893 iso_pu_bacteria 2936002035 2936006447 511
894 iso_pu_bacteria 2936037263 2936041528 511
895 iso_pu_bacteria 2940556831 2940560474 511
896 iso_pu_bacteria 8006933436 8006942476 511
897 iso_pu_bacteria 8006973647 8006982203 511
898 iso_pu_bacteria 8019586578 8019589569 511
899 iso_pu_bacteria 8019608314 8019616852 511
900 iso_pu_bacteria 8055742211 8055746952 511
901 3300005355 Ga0070671_100074369 Ga0070671_1000743692 512
902 3300005364 Ga0070673_100042106 Ga0070673_1000421062 512
903 3300005365 Ga0070688_100067500 Ga0070688_1000675001 512
904 3300005367 Ga0070667_100021384 Ga0070667_1000213843 512
905 3300005435 Ga0070714_100025184 Ga0070714_1000251844 512
906 3300005436 Ga0070713_100012156 Ga0070713_1000121563 512
907 3300005436 Ga0070713_100130357 Ga0070713_1001303571 512
908 3300005437 Ga0070710_10008566 Ga0070710_100085661 512
909 3300005439 Ga0070711_100027656 Ga0070711_1000276561 512
910 3300005439 Ga0070711_100032989 Ga0070711_1000329894 512
911 3300005455 Ga0070663_100032154 Ga0070663_1000321542 512
912 3300005466 Ga0070685_10009734 Ga0070685_100097341 512
913 3300005548 Ga0070665_100076065 Ga0070665_1000760652 512
914 3300005618 Ga0068864_100025157 Ga0068864_1000251573 512
915 3300005618 Ga0068864_100053406 Ga0068864_1000534062 512
916 3300005842 Ga0068858_100022309 Ga0068858_1000223093 512
917 3300005983 Ga0081540_1007236 Ga0081540_10072366 512
918 3300006028 Ga0070717_10001594 Ga0070717_100015949 512
919 3300006175 Ga0070712_100032593 Ga0070712_1000325932 512
920 3300006175 Ga0070712_100042570 Ga0070712_1000425701 512
921 3300006237 Ga0097621_100178949 Ga0097621_1001789491 512
922 3300006358 Ga0068871_100018242 Ga0068871_1000182422 512
923 3300006871 Ga0075434_100044796 Ga0075434_1000447965 512
924 3300009098 Ga0105245_10024971 Ga0105245_100249713 512
925 3300009147 Ga0114129_10092943 Ga0114129_100929433 512
926 3300009148 Ga0105243_10000121 Ga0105243_1000012168 512
927 3300009148 Ga0105243_10041421 Ga0105243_100414211 512
928 3300009174 Ga0105241_10015209 Ga0105241_100152091 512
929 3300009176 Ga0105242_10000338 Ga0105242_100003388 512
930 3300009177 Ga0105248_10002300 Ga0105248_100023009 512
931 3300009177 Ga0105248_10063106 Ga0105248_100631063 512
932 3300013296 Ga0157374_10055424 Ga0157374_100554242 512
933 3300013306 Ga0163162_10055952 Ga0163162_100559521 512
934 3300014325 Ga0163163_10074623 Ga0163163_100746232 512
935 3300014969 Ga0157376_10102112 Ga0157376_101021122 512
936 3300025900 Ga0207710_10022175 Ga0207710_100221751 512
937 3300025905 Ga0207685_10019543 Ga0207685_100195431 512
938 3300025906 Ga0207699_10080477 Ga0207699_100804771 512
939 3300025906 Ga0207699_10090846 Ga0207699_100908461 512
940 3300025911 Ga0207654_10017513 Ga0207654_100175132 512
941 3300025915 Ga0207693_10030417 Ga0207693_100304171 512
942 3300025915 Ga0207693_10044830 Ga0207693_100448303 512
943 3300025916 Ga0207663_10044694 Ga0207663_100446942 512
944 3300025916 Ga0207663_10079545 Ga0207663_100795451 512
945 3300025927 Ga0207687_10015839 Ga0207687_100158392 512
946 3300025928 Ga0207700_10107274 Ga0207700_101072741 512
947 3300025929 Ga0207664_10014223 Ga0207664_100142233 512
948 3300025931 Ga0207644_10057401 Ga0207644_100574011 512
949 3300025934 Ga0207686_10001043 Ga0207686_100010438 512
950 3300025935 Ga0207709_10000012 Ga0207709_10000012263 512
951 3300025941 Ga0207711_10010984 Ga0207711_100109843 512
952 3300025942 Ga0207689_10114769 Ga0207689_101147691 512
953 3300025945 Ga0207679_10058830 Ga0207679_100588301 512
954 3300026067 Ga0207678_10030173 Ga0207678_100301732 512
955 3300026067 Ga0207678_10042507 Ga0207678_100425072 512
956 3300027907 Ga0207428_10051038 Ga0207428_100510382 512
957 3300028379 Ga0268266_10037001 Ga0268266_100370011 512
958 3300033442 Ga0315911_1000022 Ga0315911_100002216 512
959 3300035170 Ga0373943_0014583 Ga0373943_0014583_227_1906 512
960 3300035725 Ga0373947_0008033 Ga0373947_0008033_2969_4579 512
961 3300044694 Ga0466963_0041175 Ga0466963_0041175_369_2063 512
962 3300046459 Ga0495629_0026813 Ga0495629_0026813_1859_3469 512
963 3300046475 Ga0495639_0018012 Ga0495639_0018012_1111_2790 512
964 3300046533 Ga0495640_0009393 Ga0495640_0009393_4074_5684 512
965 3300046642 Ga0495634_0017853 Ga0495634_0017853_2948_4558 512
966 3300046681 Ga0495647_0012317 Ga0495647_0012317_480_2090 512
967 3300047317 Ga0495604_0117196 Ga0495604_0117196_283_1893 512
968 3300047319 Ga0495674_0026422 Ga0495674_0026422_3601_5232 512
969 3300047319 Ga0495674_0056383 Ga0495674_0056383_506_2116 512
970 3300047321 Ga0495676_0011110 Ga0495676_0011110_4887_6497 512
971 3300047322 Ga0495680_0010331 Ga0495680_0010331_4888_6498 512
972 3300048905 Ga0496102_0113431 Ga0496102_0113431_582_2171 512
973 3300048908 Ga0496105_0002108 Ga0496105_0002108_2465_4054 512
974 3300048908 Ga0496105_0027471 Ga0496105_0027471_1329_2978 512
975 3300048909 Ga0496106_0007893 Ga0496106_0007893_5947_7536 512
976 3300048910 Ga0496107_0006684 Ga0496107_0006684_386_1975 512
977 3300048911 Ga0496108_0008576 Ga0496108_0008576_734_2323 512
978 3300048913 Ga0496110_0014134 Ga0496110_0014134_3255_4844 512
979 3300048914 Ga0496111_0021704 Ga0496111_0021704_2513_4102 512
980 3300048916 Ga0496113_0002444 Ga0496113_0002444_1209_2798 512
981 3300048917 Ga0496114_0055524 Ga0496114_0055524_697_2346 512
982 3300048919 Ga0496116_0010376 Ga0496116_0010376_6067_7716 512
983 3300048924 Ga0496121_0009187 Ga0496121_0009187_6753_8402 512
984 3300050507 nmdc:mga05p37_63535_c1 nmdc:mga05p37_63535_c1_539_2200 512
985 3300050511 nmdc:mga08y16_65751_c1 nmdc:mga08y16_65751_c1_1346_3007 512
986 3300050515 nmdc:mga0a205_33836_c1 nmdc:mga0a205_33836_c1_2157_3818 512
987 3300053077 Ga0495601_0021842 Ga0495601_0021842_464_2143 512
988 3300053085 Ga0495619_0000059 Ga0495619_0000059_54720_56330 512
989 3300053085 Ga0495619_0021335 Ga0495619_0021335_1844_3454 512
990 3300053137 Ga0500561_0001087 Ga0500561_0001087_475_2184 512
991 iso_pu_bacteria 2513237146 2513928203 512
992 iso_pu_bacteria 2599185170 2599416906 512
993 iso_pu_bacteria 2838035591 2838041766 512
994 iso_pu_bacteria 2936375103 2936377796 512
995 3300003911 JGI25405J52794_10001392 JGI25405J52794_100013924 513
996 3300005841 Ga0068863_100024543 Ga0068863_1000245432 513
997 3300005937 Ga0081455_10004202 Ga0081455_100042026 513
998 3300005937 Ga0081455_10095661 Ga0081455_100956612 513
999 3300006847 Ga0075431_100051949 Ga0075431_1000519492 513
1000 3300026088 Ga0207641_10029056 Ga0207641_100290562 513
1001 3300028379 Ga0268266_10000757 Ga0268266_1000075721 513
1002 3300031241 Ga0265325_10012064 Ga0265325_100120642 513
1003 3300031595 Ga0265313_10032697 Ga0265313_100326972 513
1004 3300036401 Ga0373937_0168867 Ga0373937_0168867_311_1897 513
1005 3300039438 Ga0436360_0045408 Ga0436360_0045408_155_2017 513
1006 3300039453 Ga0436362_1259766 Ga0436362_1259766_2601_4376 513
1007 3300046459 Ga0495629_0112601 Ga0495629_0112601_88_1701 513
1008 3300047471 Ga0495684_0073475 Ga0495684_0073475_69_1682 513
1009 3300048929 Ga0496126_0111880 Ga0496126_0111880_80_1741 513
1010 3300049589 Ga0501073_0063268 Ga0501073_0063268_684_2321 513
1011 3300049744 Ga0501083_0006706 Ga0501083_0006706_5526_7163 513
1012 3300050491 nmdc:mga00v17_4300_c1 nmdc:mga00v17_4300_c1_1508_3259 513
1013 3300050507 nmdc:mga05p37_20084_c1 nmdc:mga05p37_20084_c1_2478_4049 513
1014 3300050507 nmdc:mga05p37_70918_c1 nmdc:mga05p37_70918_c1_1628_3199 513
1015 3300053077 Ga0495601_0082186 Ga0495601_0082186_253_1866 513
1016 3300053085 Ga0495619_0019741 Ga0495619_0019741_1629_3242 513
1017 3300053104 Ga0500556_0000184 Ga0500556_0000184_24209_25837 513
1018 3300053108 Ga0500562_004887 Ga0500562_004887_446_2161 513
1019 3300053153 Ga0500616_0003045 Ga0500616_0003045_8572_10191 513
1020 3300053153 Ga0500616_0009246 Ga0500616_0009246_242_1930 513
1021 3300053156 Ga0500622_0015306 Ga0500622_0015306_1741_3483 513
1022 3300060353 Ga0501082_0023725 Ga0501082_0023725_2090_3727 513
1023 iso_pu_bacteria 2582581283 2585169204 513
1024 3300005439 Ga0070711_100095190 Ga0070711_1000951901 514
1025 3300005456 Ga0070678_100005132 Ga0070678_1000051322 514
1026 3300005543 Ga0070672_100053897 Ga0070672_1000538972 514
1027 3300006175 Ga0070712_100168320 Ga0070712_1001683201 514
1028 3300006914 Ga0075436_100010677 Ga0075436_1000106773 514
1029 3300009177 Ga0105248_10055273 Ga0105248_100552732 514
1030 3300025960 Ga0207651_10005907 Ga0207651_100059074 514
1031 3300035083 Ga0373926_0001282 Ga0373926_0001282_5239_6843 514
1032 3300035089 Ga0373944_0000567 Ga0373944_0000567_3751_5412 514
1033 3300035692 Ga0373935_0011416 Ga0373935_0011416_1488_3092 514
1034 3300035692 Ga0373935_0120237 Ga0373935_0120237_72_1676 514
1035 3300035695 Ga0373927_0012706 Ga0373927_0012706_724_2385 514
1036 3300037068 Ga0373925_0000137 Ga0373925_0000137_56608_58269 514
1037 3300046463 Ga0495653_0018885 Ga0495653_0018885_3267_4895 514
1038 3300046473 Ga0495582_0001132 Ga0495582_0001132_2444_4048 514
1039 3300046491 Ga0495584_0000286 Ga0495584_0000286_14048_15592 514
1040 3300046517 Ga0495630_0035039 Ga0495630_0035039_749_2389 514
1041 3300046526 Ga0495666_0005038 Ga0495666_0005038_3871_5511 514
1042 3300046531 Ga0495665_0001539 Ga0495665_0001539_10416_12020 514
1043 3300046531 Ga0495665_0025293 Ga0495665_0025293_465_2105 514
1044 3300046536 Ga0495587_0003831 Ga0495587_0003831_7072_8712 514
1045 3300047315 Ga0495581_0003813 Ga0495581_0003813_2490_4118 514
1046 3300047470 Ga0495681_0000218 Ga0495681_0000218_693_2240 514
1047 3300047470 Ga0495681_0002169 Ga0495681_0002169_7842_9386 514
1048 3300047673 Ga0495593_0031333 Ga0495593_0031333_694_2334 514
1049 3300050514 nmdc:mga08x19_3551_c1 nmdc:mga08x19_3551_c1_3598_5202 514
1050 iso_pu_bacteria 2582581299 2585228341 514
1051 iso_pu_bacteria 2838661181 2838666988 514
1052 iso_pu_bacteria 2977516862 2977522925 514
1053 3300002987 JGI25159J45721_1000051 JGI25159J45721_10000512 515
1054 3300003354 JGI25160J50197_1000040 JGI25160J50197_100004048 515
1055 3300003374 JGI25161J50226_1000023 JGI25161J50226_100002348 515
1056 3300004625 Ga0055543_1000044 Ga0055543_100004447 515
1057 3300005262 Ga0065165_1000249 Ga0065165_100024948 515
1058 3300005290 Ga0065712_10011481 Ga0065712_100114811 515
1059 3300005331 Ga0070670_100071864 Ga0070670_1000718642 515
1060 3300005331 Ga0070670_100095976 Ga0070670_1000959762 515
1061 3300005364 Ga0070673_100177643 Ga0070673_1001776431 515
1062 3300005543 Ga0070672_100169802 Ga0070672_1001698021 515
1063 3300005841 Ga0068863_100184827 Ga0068863_1001848272 515
1064 3300005842 Ga0068858_100102687 Ga0068858_1001026872 515
1065 3300005844 Ga0068862_100023340 Ga0068862_1000233406 515
1066 3300006028 Ga0070717_10008555 Ga0070717_100085556 515
1067 3300006914 Ga0075436_100051101 Ga0075436_1000511012 515
1068 3300006946 Ga0079104_1001893 Ga0079104_10018937 515
1069 3300009101 Ga0105247_10042510 Ga0105247_100425102 515
1070 3300009177 Ga0105248_10069841 Ga0105248_100698412 515
1071 3300009763 Ga0123340_1000192 Ga0123340_100019213 515
1072 3300009765 Ga0123341_1000928 Ga0123341_100092823 515
1073 3300014325 Ga0163163_10027042 Ga0163163_100270422 515
1074 3300015683 Ga0183362_10002 Ga0183362_100021334 515
1075 3300025284 Ga0209130_1000142 Ga0209130_100014213 515
1076 3300025302 Ga0207426_1000076 Ga0207426_1000076199 515
1077 3300025925 Ga0207650_10042632 Ga0207650_100426322 515
1078 3300025926 Ga0207659_10033545 Ga0207659_100335452 515
1079 3300025931 Ga0207644_10062466 Ga0207644_100624662 515
1080 3300025940 Ga0207691_10008451 Ga0207691_100084514 515
1081 3300025940 Ga0207691_10041491 Ga0207691_100414912 515
1082 3300026035 Ga0207703_10087028 Ga0207703_100870281 515
1083 3300027471 Ga0209995_1005989 Ga0209995_10059892 515
1084 3300028016 Ga0265354_1000120 Ga0265354_10001202 515
1085 3300028016 Ga0265354_1000712 Ga0265354_10007124 515
1086 3300028380 Ga0268265_10016959 Ga0268265_100169593 515
1087 3300030878 Ga0265770_1000422 Ga0265770_10004224 515
1088 3300031090 Ga0265760_10002951 Ga0265760_100029512 515
1089 3300031090 Ga0265760_10004126 Ga0265760_100041262 515
1090 3300031242 Ga0265329_10002251 Ga0265329_100022516 515
1091 3300031250 Ga0265331_10001354 Ga0265331_100013548 515
1092 3300033547 Ga0316212_1000415 Ga0316212_10004153 515
1093 3300035695 Ga0373927_0116005 Ga0373927_0116005_13_1710 515
1094 3300036401 Ga0373937_0004731 Ga0373937_0004731_2832_4415 515
1095 3300036401 Ga0373937_0025387 Ga0373937_0025387_1995_3593 515
1096 3300036401 Ga0373937_0038573 Ga0373937_0038573_353_1984 515
1097 3300036401 Ga0373937_0082503 Ga0373937_0082503_1109_2743 515
1098 3300037068 Ga0373925_0010908 Ga0373925_0010908_1090_2721 515
1099 3300039447 Ga0436361_0278774 Ga0436361_0278774_642_2306 515
1100 3300044712 Ga0453684_0035489 Ga0453684_0035489_5089_6780 515
1101 3300045051 Ga0451576_0124721 Ga0451576_0124721_140_1750 515
1102 3300046454 Ga0495592_0002061 Ga0495592_0002061_3831_5462 515
1103 3300046454 Ga0495592_0002690 Ga0495592_0002690_3289_4887 515
1104 3300046454 Ga0495592_0095729 Ga0495592_0095729_185_1804 515
1105 3300046476 Ga0495662_0061940 Ga0495662_0061940_48_1628 515
1106 3300046477 Ga0495664_0084340 Ga0495664_0084340_43_1674 515
1107 3300046491 Ga0495584_0011850 Ga0495584_0011850_515_2149 515
1108 3300046492 Ga0495585_0007600 Ga0495585_0007600_1092_2729 515
1109 3300046492 Ga0495585_0011017 Ga0495585_0011017_1768_3402 515
1110 3300046499 Ga0495594_0064692 Ga0495594_0064692_130_1767 515
1111 3300046500 Ga0495596_0009474 Ga0495596_0009474_517_2151 515
1112 3300046506 Ga0495583_0025710 Ga0495583_0025710_853_2490 515
1113 3300046507 Ga0495606_0019357 Ga0495606_0019357_2645_4309 515
1114 3300046516 Ga0495628_0007407 Ga0495628_0007407_5154_6752 515
1115 3300046516 Ga0495628_0020211 Ga0495628_0020211_3393_5024 515
1116 3300046516 Ga0495628_0058547 Ga0495628_0058547_258_1895 515
1117 3300046518 Ga0495631_0008779 Ga0495631_0008779_3201_4835 515
1118 3300046518 Ga0495631_0045908 Ga0495631_0045908_159_1796 515
1119 3300046528 Ga0495642_0015541 Ga0495642_0015541_385_2022 515
1120 3300046529 Ga0495652_0014052 Ga0495652_0014052_4165_5796 515
1121 3300046535 Ga0495586_0023236 Ga0495586_0023236_1241_2917 515
1122 3300046536 Ga0495587_0025604 Ga0495587_0025604_43_1623 515
1123 3300046538 Ga0495609_0002631 Ga0495609_0002631_3469_5103 515
1124 3300046538 Ga0495609_0007663 Ga0495609_0007663_1798_3435 515
1125 3300046543 Ga0495645_0003891 Ga0495645_0003891_1001_2632 515
1126 3300046543 Ga0495645_0004826 Ga0495645_0004826_6036_7673 515
1127 3300046543 Ga0495645_0005342 Ga0495645_0005342_3838_5436 515
1128 3300046558 Ga0495633_0003005 Ga0495633_0003005_4430_6067 515
1129 3300046616 Ga0495668_0036170 Ga0495668_0036170_823_2457 515
1130 3300046648 Ga0495611_0001643 Ga0495611_0001643_2804_4441 515
1131 3300046660 Ga0495625_0061503 Ga0495625_0061503_167_1804 515
1132 3300046678 Ga0495599_0000638 Ga0495599_0000638_3743_5362 515
1133 3300046678 Ga0495599_0001563 Ga0495599_0001563_5716_7314 515
1134 3300046678 Ga0495599_0014781 Ga0495599_0014781_274_1911 515
1135 3300046679 Ga0495623_0018109 Ga0495623_0018109_2723_4321 515
1136 3300046683 Ga0495658_0005325 Ga0495658_0005325_2327_3967 515
1137 3300046691 Ga0495670_0000914 Ga0495670_0000914_4843_6480 515
1138 3300047317 Ga0495604_0007389 Ga0495604_0007389_5699_7318 515
1139 3300047322 Ga0495680_0047851 Ga0495680_0047851_520_2097 515
1140 3300047322 Ga0495680_0121025 Ga0495680_0121025_75_1712 515
1141 3300047323 Ga0495683_0039208 Ga0495683_0039208_495_2132 515
1142 3300047444 Ga0495675_0026442 Ga0495675_0026442_1916_3514 515
1143 3300047444 Ga0495675_0059182 Ga0495675_0059182_526_2157 515
1144 3300047471 Ga0495684_0088842 Ga0495684_0088842_499_2139 515
1145 3300048088 Ga0495602_0032836 Ga0495602_0032836_1154_2752 515
1146 3300048912 Ga0496109_0116703 Ga0496109_0116703_31_1671 515
1147 3300048914 Ga0496111_0038694 Ga0496111_0038694_1067_2701 515
1148 3300048915 Ga0496112_0008017 Ga0496112_0008017_429_2063 515
1149 3300048916 Ga0496113_0012504 Ga0496113_0012504_3691_5325 515
1150 3300048918 Ga0496115_0063964 Ga0496115_0063964_323_1954 515
1151 3300050512 nmdc:mga0n895_78660_c1 nmdc:mga0n895_78660_c1_1416_3059 515
1152 3300050514 nmdc:mga08x19_68068_c1 nmdc:mga08x19_68068_c1_141_1766 515
1153 3300053077 Ga0495601_0000321 Ga0495601_0000321_372_2009 515
1154 3300053077 Ga0495601_0000568 Ga0495601_0000568_4459_6090 515
1155 3300053077 Ga0495601_0002320 Ga0495601_0002320_5393_6991 515
1156 3300053078 Ga0495612_0000342 Ga0495612_0000342_15804_17435 515
1157 3300053084 Ga0495595_0001001 Ga0495595_0001001_1708_3339 515
1158 3300053085 Ga0495619_0002133 Ga0495619_0002133_265_1896 515
1159 3300053148 Ga0500590_008632 Ga0500590_008632_158_1783 515
1160 3300060353 Ga0501082_0042038 Ga0501082_0042038_585_2192 515
1161 iso_pu_bacteria 2534681796 2535518107 515
1162 iso_pu_bacteria 2852387548 2852393518 515
1163 iso_pu_bacteria 2889306138 2889308899 515
1164 iso_pu_bacteria 2970156795 2970163399 515
1165 iso_pu_bacteria 2996887358 2996887584 515
1166 iso_pu_bacteria 8005321885 8005322111 515
1167 iso_pu_bacteria 8005542996 8005548991 515
1168 iso_pu_bacteria 8024486573 8024489154 515
1169 iso_pu_bacteria 8046767195 8046773600 515
1170 iso_pu_bacteria 8057575449 8057575628 515
1171 3300003790 Ga0055528_1016939 Ga0055528_10169392 516
1172 3300005290 Ga0065712_10002859 Ga0065712_100028596 516
1173 3300005293 Ga0065715_10001699 Ga0065715_100016997 516
1174 3300005339 Ga0070660_100004962 Ga0070660_1000049628 516
1175 3300005457 Ga0070662_100001886 Ga0070662_1000018865 516
1176 3300005457 Ga0070662_100073534 Ga0070662_1000735341 516
1177 3300005937 Ga0081455_10009119 Ga0081455_100091197 516
1178 3300006048 Ga0075363_100032767 Ga0075363_1000327672 516
1179 3300006844 Ga0075428_100004284 Ga0075428_1000042842 516
1180 3300006942 Ga0099824_1013845 Ga0099824_10138452 516
1181 3300025292 Ga0209676_1015160 Ga0209676_10151602 516
1182 3300025298 Ga0209050_1017332 Ga0209050_10173322 516
1183 3300025303 Ga0209051_1000288 Ga0209051_100028882 516
1184 3300025304 Ga0209257_1002287 Ga0209257_100228718 516
1185 3300025919 Ga0207657_10031994 Ga0207657_100319942 516
1186 3300025932 Ga0207690_10045274 Ga0207690_100452741 516
1187 3300025933 Ga0207706_10053990 Ga0207706_100539902 516
1188 3300025933 Ga0207706_10095544 Ga0207706_100955442 516
1189 3300026089 Ga0207648_10016679 Ga0207648_100166797 516
1190 3300027296 Ga0209389_1000035 Ga0209389_100003539 516
1191 3300027357 Ga0209589_1000039 Ga0209589_100003939 516
1192 3300027361 Ga0209489_100084 Ga0209489_10008439 516
1193 3300028653 Ga0265323_10000304 Ga0265323_100003049 516
1194 3300031240 Ga0265320_10003188 Ga0265320_100031884 516
1195 3300031240 Ga0265320_10035331 Ga0265320_100353311 516
1196 3300031241 Ga0265325_10000149 Ga0265325_1000014933 516
1197 3300031249 Ga0265339_10002783 Ga0265339_100027835 516
1198 3300031250 Ga0265331_10000101 Ga0265331_1000010149 516
1199 3300031595 Ga0265313_10000497 Ga0265313_1000049718 516
1200 3300031711 Ga0265314_10000308 Ga0265314_1000030815 516
1201 3300036401 Ga0373937_0067881 Ga0373937_0067881_1558_3192 516
1202 3300045976 Ga0466967_0090329 Ga0466967_0090329_514_2223 516
1203 3300046462 Ga0495651_0099666 Ga0495651_0099666_255_1991 516
1204 3300046463 Ga0495653_0010824 Ga0495653_0010824_3682_5235 516
1205 3300046473 Ga0495582_0002204 Ga0495582_0002204_8299_9852 516
1206 3300046475 Ga0495639_0012716 Ga0495639_0012716_1872_3425 516
1207 3300046499 Ga0495594_0011202 Ga0495594_0011202_1082_2635 516
1208 3300046507 Ga0495606_0099254 Ga0495606_0099254_34_1644 516
1209 3300046517 Ga0495630_0013985 Ga0495630_0013985_2142_3695 516
1210 3300046535 Ga0495586_0019777 Ga0495586_0019777_908_2461 516
1211 3300046680 Ga0495646_0000160 Ga0495646_0000160_4068_5621 516
1212 3300046692 Ga0495671_0020545 Ga0495671_0020545_672_2273 516
1213 3300046810 Ga0495660_0055469 Ga0495660_0055469_227_1837 516
1214 3300047317 Ga0495604_0007393 Ga0495604_0007393_1945_3591 516
1215 3300047322 Ga0495680_0000283 Ga0495680_0000283_30206_31759 516
1216 3300047322 Ga0495680_0039281 Ga0495680_0039281_253_1989 516
1217 3300047444 Ga0495675_0000863 Ga0495675_0000863_2015_3568 516
1218 3300048907 Ga0496104_0003939 Ga0496104_0003939_8064_9659 516
1219 3300048907 Ga0496104_0005155 Ga0496104_0005155_9026_10621 516
1220 3300048913 Ga0496110_0039685 Ga0496110_0039685_381_1976 516
1221 3300048915 Ga0496112_0001629 Ga0496112_0001629_15105_16700 516
1222 3300048922 Ga0496119_0002352 Ga0496119_0002352_17028_18668 516
1223 3300050511 nmdc:mga08y16_138038_c1 nmdc:mga08y16_138038_c1_195_1802 516
1224 3300053084 Ga0495595_0037726 Ga0495595_0037726_174_1910 516
1225 iso_pu_bacteria 2516653085 2517074996 516
1226 iso_pu_bacteria 2643221637 2644207782 516
1227 iso_pu_bacteria 2643221718 2644651871 516
1228 iso_pu_bacteria 2724679232 2725946532 516
1229 iso_pu_bacteria 2791355267 2793368091 516
1230 iso_pu_bacteria 2838686498 2838693937 516
1231 iso_pu_bacteria 2842156927 2842163678 516
1232 iso_pu_bacteria 2842180545 2842187279 516
1233 iso_pu_bacteria 2842271015 2842278461 516
1234 iso_pu_bacteria 2842304105 2842307252 516
1235 iso_pu_bacteria 2933570622 2933572635 516
1236 iso_pu_bacteria 8056375014 8056379213 516
1237 3300000549 LJQas_1003113 LJQas_10031131 517
1238 3300003659 JGI25404J52841_10006787 JGI25404J52841_100067872 517
1239 3300003775 Ga0055524_1024916 Ga0055524_10249161 517
1240 3300005334 Ga0068869_100110640 Ga0068869_1001106401 517
1241 3300005336 Ga0070680_100016668 Ga0070680_1000166683 517
1242 3300005458 Ga0070681_10073047 Ga0070681_100730472 517
1243 3300005530 Ga0070679_100070486 Ga0070679_1000704861 517
1244 3300005535 Ga0070684_100001996 Ga0070684_1000019963 517
1245 3300005548 Ga0070665_100007756 Ga0070665_1000077564 517
1246 3300005983 Ga0081540_1000423 Ga0081540_100042325 517
1247 3300009147 Ga0114129_10336702 Ga0114129_103367021 517
1248 3300013105 Ga0157369_10032242 Ga0157369_100322422 517
1249 3300013297 Ga0157378_10040057 Ga0157378_100400572 517
1250 3300013307 Ga0157372_10094176 Ga0157372_100941762 517
1251 3300025297 Ga0209758_1002240 Ga0209758_10022407 517
1252 3300025912 Ga0207707_10026782 Ga0207707_100267822 517
1253 3300025917 Ga0207660_10015781 Ga0207660_100157813 517
1254 3300025921 Ga0207652_10009388 Ga0207652_100093882 517
1255 3300025929 Ga0207664_10058867 Ga0207664_100588672 517
1256 3300025942 Ga0207689_10023561 Ga0207689_100235612 517
1257 3300025944 Ga0207661_10034071 Ga0207661_100340712 517
1258 3300026041 Ga0207639_10074047 Ga0207639_100740472 517
1259 3300026067 Ga0207678_10004849 Ga0207678_1000484911 517
1260 3300026118 Ga0207675_100102904 Ga0207675_1001029042 517
1261 3300028379 Ga0268266_10001600 Ga0268266_1000160010 517
1262 3300031507 Ga0307509_10076127 Ga0307509_100761273 517
1263 3300031730 Ga0307516_10007923 Ga0307516_100079232 517
1264 3300031730 Ga0307516_10095820 Ga0307516_100958202 517
1265 3300033180 Ga0307510_10048587 Ga0307510_100485872 517
1266 3300035113 Ga0373936_0005453 Ga0373936_0005453_2724_4370 517
1267 3300035113 Ga0373936_0011837 Ga0373936_0011837_607_2349 517
1268 3300035118 Ga0373954_0017774 Ga0373954_0017774_17_1759 517
1269 3300035170 Ga0373943_0001172 Ga0373943_0001172_6706_8448 517
1270 3300035171 Ga0373946_0001950 Ga0373946_0001950_4729_6471 517
1271 3300035172 Ga0373955_0000139 Ga0373955_0000139_15209_16951 517
1272 3300035172 Ga0373955_0026944 Ga0373955_0026944_1161_2864 517
1273 3300035410 Ga0373924_0001010 Ga0373924_0001010_2183_3925 517
1274 3300035692 Ga0373935_0000307 Ga0373935_0000307_1615_3357 517
1275 3300035692 Ga0373935_0001033 Ga0373935_0001033_9046_10692 517
1276 3300035695 Ga0373927_0002069 Ga0373927_0002069_3406_5052 517
1277 3300035695 Ga0373927_0014738 Ga0373927_0014738_2879_4582 517
1278 3300035724 Ga0373933_0058116 Ga0373933_0058116_292_2034 517
1279 3300035725 Ga0373947_0000940 Ga0373947_0000940_2280_3926 517
1280 3300035725 Ga0373947_0002780 Ga0373947_0002780_1622_3325 517
1281 3300035725 Ga0373947_0009220 Ga0373947_0009220_1159_2901 517
1282 3300036401 Ga0373937_0000224 Ga0373937_0000224_19325_21067 517
1283 3300037068 Ga0373925_0000025 Ga0373925_0000025_14165_15907 517
1284 3300037068 Ga0373925_0001317 Ga0373925_0001317_16320_17966 517
1285 3300037068 Ga0373925_0006618 Ga0373925_0006618_3612_5315 517
1286 3300041408 Ga0439453_0002170 Ga0439453_0002170_883_2571 517
1287 3300041496 Ga0451839_0679937 Ga0451839_0679937_1122_2711 517
1288 3300041503 Ga0451847_0845324 Ga0451847_0845324_862_2451 517
1289 3300041507 Ga0451851_0580182 Ga0451851_0580182_1408_2997 517
1290 3300045051 Ga0451576_0202829 Ga0451576_0202829_328_1923 517
1291 3300046454 Ga0495592_0000351 Ga0495592_0000351_763_2505 517
1292 3300046455 Ga0495603_0022044 Ga0495603_0022044_2180_3826 517
1293 3300046459 Ga0495629_0003668 Ga0495629_0003668_6278_7924 517
1294 3300046460 Ga0495638_0040174 Ga0495638_0040174_630_2339 517
1295 3300046461 Ga0495641_0003365 Ga0495641_0003365_6765_8411 517
1296 3300046462 Ga0495651_0005489 Ga0495651_0005489_1238_2980 517
1297 3300046463 Ga0495653_0006285 Ga0495653_0006285_6671_8413 517
1298 3300046471 Ga0495650_0004077 Ga0495650_0004077_8642_10195 517
1299 3300046472 Ga0495580_0004108 Ga0495580_0004108_5959_7605 517
1300 3300046473 Ga0495582_0000528 Ga0495582_0000528_3752_5398 517
1301 3300046474 Ga0495605_0025096 Ga0495605_0025096_799_2457 517
1302 3300046475 Ga0495639_0000044 Ga0495639_0000044_46763_48409 517
1303 3300046475 Ga0495639_0011804 Ga0495639_0011804_1468_3171 517
1304 3300046476 Ga0495662_0010688 Ga0495662_0010688_1312_2958 517
1305 3300046476 Ga0495662_0014407 Ga0495662_0014407_1150_2892 517
1306 3300046477 Ga0495664_0000005 Ga0495664_0000005_208773_210515 517
1307 3300046477 Ga0495664_0016524 Ga0495664_0016524_1691_3337 517
1308 3300046492 Ga0495585_0015211 Ga0495585_0015211_1024_2682 517
1309 3300046499 Ga0495594_0000351 Ga0495594_0000351_4623_6269 517
1310 3300046506 Ga0495583_0021417 Ga0495583_0021417_954_2612 517
1311 3300046511 Ga0495608_0000003 Ga0495608_0000003_229063_230805 517
1312 3300046514 Ga0495618_0000010 Ga0495618_0000010_7217_8959 517
1313 3300046514 Ga0495618_0017659 Ga0495618_0017659_1702_3405 517
1314 3300046516 Ga0495628_0000019 Ga0495628_0000019_139031_140773 517
1315 3300046517 Ga0495630_0000507 Ga0495630_0000507_19755_21497 517
1316 3300046517 Ga0495630_0015813 Ga0495630_0015813_502_2205 517
1317 3300046518 Ga0495631_0019585 Ga0495631_0019585_1393_3051 517
1318 3300046519 Ga0495632_0010913 Ga0495632_0010913_3019_4716 517
1319 3300046522 Ga0495643_0002128 Ga0495643_0002128_8050_9654 517
1320 3300046529 Ga0495652_0000028 Ga0495652_0000028_139031_140773 517
1321 3300046531 Ga0495665_0000397 Ga0495665_0000397_16713_18359 517
1322 3300046533 Ga0495640_0000014 Ga0495640_0000014_20969_22711 517
1323 3300046536 Ga0495587_0000026 Ga0495587_0000026_7047_8789 517
1324 3300046543 Ga0495645_0000005 Ga0495645_0000005_208744_210486 517
1325 3300046557 Ga0495622_0001316 Ga0495622_0001316_3365_5011 517
1326 3300046559 Ga0495667_0000003 Ga0495667_0000003_154147_155889 517
1327 3300046616 Ga0495668_0009665 Ga0495668_0009665_2600_4258 517
1328 3300046616 Ga0495668_0010271 Ga0495668_0010271_3016_4725 517
1329 3300046616 Ga0495668_0033893 Ga0495668_0033893_1103_2761 517
1330 3300046642 Ga0495634_0000252 Ga0495634_0000252_42318_43964 517
1331 3300046642 Ga0495634_0000563 Ga0495634_0000563_20100_21842 517
1332 3300046642 Ga0495634_0017164 Ga0495634_0017164_698_2401 517
1333 3300046660 Ga0495625_0001628 Ga0495625_0001628_9582_11135 517
1334 3300046660 Ga0495625_0011521 Ga0495625_0011521_2491_4143 517
1335 3300046660 Ga0495625_0028940 Ga0495625_0028940_2058_3755 517
1336 3300046660 Ga0495625_0046019 Ga0495625_0046019_326_1939 517
1337 3300046663 Ga0495635_0000024 Ga0495635_0000024_7441_9183 517
1338 3300046663 Ga0495635_0041766 Ga0495635_0041766_989_2692 517
1339 3300046674 Ga0495588_0018957 Ga0495588_0018957_308_1954 517
1340 3300046675 Ga0495657_0000034 Ga0495657_0000034_119785_121527 517
1341 3300046678 Ga0495599_0000017 Ga0495599_0000017_139350_141092 517
1342 3300046679 Ga0495623_0005243 Ga0495623_0005243_1627_3369 517
1343 3300046680 Ga0495646_0000015 Ga0495646_0000015_948_2690 517
1344 3300046680 Ga0495646_0014838 Ga0495646_0014838_17_1663 517
1345 3300046681 Ga0495647_0002303 Ga0495647_0002303_3375_5021 517
1346 3300046683 Ga0495658_0001461 Ga0495658_0001461_6397_8043 517
1347 3300046690 Ga0495624_0002092 Ga0495624_0002092_525_2171 517
1348 3300046690 Ga0495624_0033713 Ga0495624_0033713_948_2690 517
1349 3300046691 Ga0495670_0003857 Ga0495670_0003857_741_2399 517
1350 3300046809 Ga0495600_0000289 Ga0495600_0000289_913_2655 517
1351 3300046810 Ga0495660_0036217 Ga0495660_0036217_1025_2683 517
1352 3300047315 Ga0495581_0001351 Ga0495581_0001351_3731_5377 517
1353 3300047317 Ga0495604_0000021 Ga0495604_0000021_139028_140770 517
1354 3300047319 Ga0495674_0000005 Ga0495674_0000005_234357_236099 517
1355 3300047319 Ga0495674_0003317 Ga0495674_0003317_13790_15436 517
1356 3300047319 Ga0495674_0008248 Ga0495674_0008248_7214_8917 517
1357 3300047320 Ga0495672_0082975 Ga0495672_0082975_38_1696 517
1358 3300047322 Ga0495680_0037696 Ga0495680_0037696_1205_2947 517
1359 3300047323 Ga0495683_0000156 Ga0495683_0000156_39942_41495 517
1360 3300047444 Ga0495675_0001997 Ga0495675_0001997_3727_5469 517
1361 3300047471 Ga0495684_0000001 Ga0495684_0000001_139007_140749 517
1362 3300047471 Ga0495684_0023948 Ga0495684_0023948_2573_4276 517
1363 3300047471 Ga0495684_0061951 Ga0495684_0061951_1158_2804 517
1364 3300047472 Ga0495686_0044047 Ga0495686_0044047_890_2629 517
1365 3300047673 Ga0495593_0002490 Ga0495593_0002490_3629_5275 517
1366 3300047673 Ga0495593_0008735 Ga0495593_0008735_783_2486 517
1367 3300047673 Ga0495593_0009995 Ga0495593_0009995_907_2649 517
1368 3300048088 Ga0495602_0000003 Ga0495602_0000003_216468_218210 517
1369 3300048089 Ga0495614_0027542 Ga0495614_0027542_477_2123 517
1370 3300048907 Ga0496104_0003549 Ga0496104_0003549_6920_8668 517
1371 3300048908 Ga0496105_0000728 Ga0496105_0000728_18240_19988 517
1372 3300048916 Ga0496113_0041158 Ga0496113_0041158_349_2097 517
1373 3300048922 Ga0496119_0019802 Ga0496119_0019802_1134_2882 517
1374 3300048929 Ga0496126_0008379 Ga0496126_0008379_3956_5704 517
1375 3300049459 Ga0495678_023099 Ga0495678_023099_215_1873 517
1376 3300049459 Ga0495678_039689 Ga0495678_039689_58_1671 517
1377 3300049460 Ga0495682_0034197 Ga0495682_0034197_13_1722 517
1378 3300050494 nmdc:mga06z11_10278_c1 nmdc:mga06z11_10278_c1_1517_3166 517
1379 3300050496 nmdc:mga07m45_4799_c1 nmdc:mga07m45_4799_c1_4028_5770 517
1380 3300050507 nmdc:mga05p37_360698_c1 nmdc:mga05p37_360698_c1_19_1608 517
1381 3300050508 nmdc:mga09592_100936_c1 nmdc:mga09592_100936_c1_679_2289 517
1382 3300050510 nmdc:mga06r32_224563_c1 nmdc:mga06r32_224563_c1_176_1765 517
1383 3300053077 Ga0495601_0000005 Ga0495601_0000005_136911_138653 517
1384 3300053077 Ga0495601_0004438 Ga0495601_0004438_648_2351 517
1385 3300053078 Ga0495612_0000001 Ga0495612_0000001_277472_279214 517
1386 3300053084 Ga0495595_0000033 Ga0495595_0000033_14304_16046 517
1387 3300053085 Ga0495619_0000007 Ga0495619_0000007_139031_140773 517
1388 3300053086 Ga0500578_0092721 Ga0500578_0092721_71_1756 517
1389 3300053093 Ga0500651_0035428 Ga0500651_0035428_1445_3124 517
1390 3300053102 Ga0500554_000347 Ga0500554_000347_107_1837 517
1391 3300053109 Ga0500569_008797 Ga0500569_008797_675_2264 517
1392 3300053118 Ga0500594_0001600 Ga0500594_0001600_2504_4162 517
1393 3300053134 Ga0500658_0000064 Ga0500658_0000064_45678_47291 517
1394 3300053139 Ga0500568_0000738 Ga0500568_0000738_10877_12535 517
1395 3300053150 Ga0500603_000375 Ga0500603_000375_9372_11102 517
1396 3300053153 Ga0500616_0003400 Ga0500616_0003400_7078_8736 517
1397 3300053178 Ga0500637_0005499 Ga0500637_0005499_523_2253 517
1398 3300053737 Ga0500601_000244 Ga0500601_000244_137_1852 517
1399 iso_pu_bacteria 2508501042 2508698683 517
1400 iso_pu_bacteria 2510461076 2510899317 517
1401 iso_pu_bacteria 2513237085 2513581029 517
1402 iso_pu_bacteria 2513237095 2513646491 517
1403 iso_pu_bacteria 2513237096 2513659218 517
1404 iso_pu_bacteria 2513237103 2513710215 517
1405 iso_pu_bacteria 2513237137 2513859060 517
1406 iso_pu_bacteria 2513237145 2513921902 517
1407 iso_pu_bacteria 2513237162 2514019917 517
1408 iso_pu_bacteria 2515154113 2515633658 517
1409 iso_pu_bacteria 2515154114 2515642201 517
1410 iso_pu_bacteria 2515154116 2515656255 517
1411 iso_pu_bacteria 2515154134 2515743253 517
1412 iso_pu_bacteria 2516653077 2517035592 517
1413 iso_pu_bacteria 2517093001 2517106631 517
1414 iso_pu_bacteria 2517572143 2517895985 517
1415 iso_pu_bacteria 2585427526 2585525163 517
1416 iso_pu_bacteria 2767802442 2770200170 517
1417 iso_pu_bacteria 2824600985 2824605726 517
1418 iso_pu_bacteria 2824609381 2824611711 517
1419 iso_pu_bacteria 2824609381 2824617584 517
1420 iso_pu_bacteria 2824661429 2824665147 517
1421 iso_pu_bacteria 2824704595 2824705641 517
1422 iso_pu_bacteria 2824704595 2824705855 517
1423 iso_pu_bacteria 2824704595 2824706995 517
1424 iso_pu_bacteria 2824753945 2824755397 517
1425 iso_pu_bacteria 2824763712 2824767894 517
1426 iso_pu_bacteria 2824763712 2824770929 517
1427 iso_pu_bacteria 2841957949 2841962819 517
1428 iso_pu_bacteria 2842163707 2842169551 517
1429 iso_pu_bacteria 2842217011 2842220618 517
1430 iso_pu_bacteria 2888378607 2888383106 517
1431 iso_pu_bacteria 2904699407 2904700894 517
1432 iso_pu_bacteria 2904711408 2904718737 517
1433 iso_pu_bacteria 2906635258 2906639586 517
1434 iso_pu_bacteria 2906660503 2906661748 517
1435 iso_pu_bacteria 2932784394 2932787533 517
1436 iso_pu_bacteria 2932794094 2932798908 517
1437 iso_pu_bacteria 2932801729 2932805031 517
1438 iso_pu_bacteria 2932809354 2932813286 517
1439 iso_pu_bacteria 2932818245 2932820792 517
1440 iso_pu_bacteria 2932828146 2932834906 517
1441 iso_pu_bacteria 2935616580 2935621799 517
1442 iso_pu_bacteria 2935630451 2935634976 517
1443 iso_pu_bacteria 2935638405 2935642744 517
1444 iso_pu_bacteria 2935648319 2935651690 517
1445 iso_pu_bacteria 2935656913 2935660500 517
1446 iso_pu_bacteria 2935665750 2935667846 517
1447 iso_pu_bacteria 2935675223 2935682338 517
1448 iso_pu_bacteria 2935684952 2935688597 517
1449 iso_pu_bacteria 2935694250 2935695948 517
1450 iso_pu_bacteria 2935703347 2935706687 517
1451 iso_pu_bacteria 2935713505 2935715616 517
1452 iso_pu_bacteria 2935722832 2935725820 517
1453 iso_pu_bacteria 2935732158 2935734435 517
1454 iso_pu_bacteria 2935741537 2935743814 517
1455 iso_pu_bacteria 2935750917 2935754149 517
1456 iso_pu_bacteria 2935760218 2935763188 517
1457 iso_pu_bacteria 2935777560 2935781821 517
1458 iso_pu_bacteria 2935785616 2935789455 517
1459 iso_pu_bacteria 2935793552 2935797502 517
1460 iso_pu_bacteria 2935801545 2935806338 517
1461 iso_pu_bacteria 2935810662 2935812939 517
1462 iso_pu_bacteria 2935819856 2935820748 517
1463 iso_pu_bacteria 2935827899 2935830591 517
1464 iso_pu_bacteria 2935837841 2935840621 517
1465 iso_pu_bacteria 2935847175 2935849234 517
1466 iso_pu_bacteria 2935855204 2935860046 517
1467 iso_pu_bacteria 2935864058 2935869319 517
1468 iso_pu_bacteria 2935873716 2935880520 517
1469 iso_pu_bacteria 2935883170 2935889295 517
1470 iso_pu_bacteria 2935901341 2935908519 517
1471 iso_pu_bacteria 2935916978 2935920385 517
1472 iso_pu_bacteria 2935959822 2935966077 517
1473 iso_pu_bacteria 2935984226 2935990301 517
1474 iso_pu_bacteria 2935992306 2935999568 517
1475 iso_pu_bacteria 2936002035 2936006446 517
1476 iso_pu_bacteria 2936011229 2936014556 517
1477 iso_pu_bacteria 2936019824 2936023648 517
1478 iso_pu_bacteria 2936028420 2936032676 517
1479 iso_pu_bacteria 2936037263 2936041527 517
1480 iso_pu_bacteria 2936046547 2936050297 517
1481 iso_pu_bacteria 2936055302 2936059211 517
1482 iso_pu_bacteria 2940556831 2940560475 517
1483 iso_pu_bacteria 2941507105 2941511745 517
1484 iso_pu_bacteria 2941515067 2941519272 517
1485 iso_pu_bacteria 2941523033 2941527604 517
1486 iso_pu_bacteria 2941538514 2941541249 517
1487 iso_pu_bacteria 639633055 639648151 517
1488 iso_pu_bacteria 8005307578 8005312230 517
1489 iso_pu_bacteria 8016511872 8016513978 517
1490 iso_pu_bacteria 8016522445 8016524200 517
1491 iso_pu_bacteria 8016530956 8016537747 517
1492 iso_pu_bacteria 8016548790 8016551254 517
1493 iso_pu_bacteria 8016557553 8016559648 517
1494 iso_pu_bacteria 8016575299 8016580111 517
1495 iso_pu_bacteria 8016583857 8016593545 517
1496 iso_pu_bacteria 8016603502 8016604725 517
1497 iso_pu_bacteria 8016613128 8016620287 517
1498 iso_pu_bacteria 8016622563 8016629717 517
1499 iso_pu_bacteria 8017057580 8017062499 517
1500 iso_pu_bacteria 8019530166 8019537420 517
1501 iso_pu_bacteria 8019538911 8019539133 517
1502 iso_pu_bacteria 8019555841 8019562846 517
1503 iso_pu_bacteria 8019565922 8019572922 517
1504 iso_pu_bacteria 8019586578 8019589570 517
1505 iso_pu_bacteria 8019597564 8019601697 517
1506 iso_pu_bacteria 8023680758 8023683524 517
1507 iso_pu_bacteria 8057874678 8057875481 517
1508 3300005545 Ga0070695_100000884 Ga0070695_1000008843 518
1509 3300006051 Ga0075364_10016787 Ga0075364_100167872 518
1510 3300013307 Ga0157372_10055454 Ga0157372_100554544 518
1511 3300015265 Ga0182005_1002102 Ga0182005_10021023 518
1512 3300027378 Ga0209981_1000803 Ga0209981_10008033 518
1513 3300027543 Ga0209999_1000288 Ga0209999_10002885 518
1514 3300027614 Ga0209970_1000625 Ga0209970_10006254 518
1515 3300027695 Ga0209966_1000203 Ga0209966_10002039 518
1516 3300027876 Ga0209974_10002614 Ga0209974_100026143 518
1517 3300045051 Ga0451576_0012760 Ga0451576_0012760_3886_5502 518
1518 3300045051 Ga0451576_0137533 Ga0451576_0137533_624_2240 518
1519 3300046458 Ga0495591_006079 Ga0495591_006079_2114_3727 518
1520 3300046460 Ga0495638_0008654 Ga0495638_0008654_2889_4502 518
1521 3300046474 Ga0495605_0001455 Ga0495605_0001455_5817_7430 518
1522 3300046476 Ga0495662_0034554 Ga0495662_0034554_271_1881 518
1523 3300046491 Ga0495584_0006495 Ga0495584_0006495_3887_5500 518
1524 3300046507 Ga0495606_0011364 Ga0495606_0011364_2724_4337 518
1525 3300046511 Ga0495608_0043928 Ga0495608_0043928_663_2291 518
1526 3300046512 Ga0495610_0005508 Ga0495610_0005508_1014_2627 518
1527 3300046513 Ga0495616_0011335 Ga0495616_0011335_2734_4347 518
1528 3300046515 Ga0495620_0021197 Ga0495620_0021197_914_2527 518
1529 3300046517 Ga0495630_0054673 Ga0495630_0054673_1126_2736 518
1530 3300046518 Ga0495631_0018888 Ga0495631_0018888_582_2195 518
1531 3300046519 Ga0495632_0005428 Ga0495632_0005428_1986_3599 518
1532 3300046523 Ga0495644_0011044 Ga0495644_0011044_769_2382 518
1533 3300046529 Ga0495652_0089117 Ga0495652_0089117_882_2492 518
1534 3300046530 Ga0495654_0000843 Ga0495654_0000843_6891_8465 518
1535 3300046536 Ga0495587_0052094 Ga0495587_0052094_118_1728 518
1536 3300046537 Ga0495598_0006473 Ga0495598_0006473_759_2393 518
1537 3300046542 Ga0495597_0005069 Ga0495597_0005069_3342_4955 518
1538 3300046665 Ga0495661_0007276 Ga0495661_0007276_488_2101 518
1539 3300047322 Ga0495680_0008669 Ga0495680_0008669_2421_3980 518
1540 3300047444 Ga0495675_0032694 Ga0495675_0032694_855_2465 518
1541 3300047469 Ga0495673_0001383 Ga0495673_0001383_3171_4784 518
1542 3300047470 Ga0495681_0001470 Ga0495681_0001470_12247_13821 518
1543 3300047471 Ga0495684_0094726 Ga0495684_0094726_264_1874 518
1544 3300047472 Ga0495686_0066495 Ga0495686_0066495_551_2164 518
1545 3300047673 Ga0495593_0016357 Ga0495593_0016357_763_2322 518
1546 3300048088 Ga0495602_0065099 Ga0495602_0065099_42_1652 518
1547 3300048091 Ga0495626_0000070 Ga0495626_0000070_110290_111864 518
1548 3300049459 Ga0495678_008577 Ga0495678_008577_2780_4393 518
1549 3300050491 nmdc:mga00v17_15820_c1 nmdc:mga00v17_15820_c1_1531_3168 518
1550 3300050512 nmdc:mga0n895_259788_c1 nmdc:mga0n895_259788_c1_67_1650 518
1551 iso_pu_bacteria 2881665667 2881666007 518
1552 iso_pu_bacteria 2903748898 2903756588 518
1553 iso_pu_bacteria 2919119836 2919121178 518
1554 2124908027 MRS2a_Contig_163 MRS2a_00062970 519
1555 3300005288 Ga0065714_10002753 Ga0065714_1000275315 519
1556 3300005288 Ga0065714_10098399 Ga0065714_100983991 519
1557 3300006058 Ga0075432_10025935 Ga0075432_100259352 519
1558 3300009011 Ga0105251_10028943 Ga0105251_100289432 519
1559 3300009011 Ga0105251_10030386 Ga0105251_100303862 519
1560 3300011119 Ga0105246_10021563 Ga0105246_100215631 519
1561 3300013100 Ga0157373_10001946 Ga0157373_100019466 519
1562 3300013102 Ga0157371_10050902 Ga0157371_100509022 519
1563 3300013104 Ga0157370_10025583 Ga0157370_100255831 519
1564 3300013104 Ga0157370_10038345 Ga0157370_100383452 519
1565 3300013306 Ga0163162_10001487 Ga0163162_100014875 519
1566 3300014497 Ga0182008_10022400 Ga0182008_100224002 519
1567 3300015265 Ga0182005_1000773 Ga0182005_10007739 519
1568 3300015265 Ga0182005_1016194 Ga0182005_10161942 519
1569 3300025298 Ga0209050_1001809 Ga0209050_100180915 519
1570 3300025303 Ga0209051_1013677 Ga0209051_10136772 519
1571 3300025728 Ga0207655_1003046 Ga0207655_10030466 519
1572 3300025728 Ga0207655_1034990 Ga0207655_10349901 519
1573 3300025735 Ga0207713_1010124 Ga0207713_10101242 519
1574 3300025735 Ga0207713_1024090 Ga0207713_10240902 519
1575 3300026116 Ga0207674_10026659 Ga0207674_100266594 519
1576 3300026121 Ga0207683_10021272 Ga0207683_100212725 519
1577 3300027907 Ga0207428_10024091 Ga0207428_100240914 519
1578 3300028379 Ga0268266_10003215 Ga0268266_100032158 519
1579 3300028379 Ga0268266_10028853 Ga0268266_100288533 519
1580 3300028379 Ga0268266_10035975 Ga0268266_100359753 519
1581 3300028786 Ga0307517_10104731 Ga0307517_101047312 519
1582 3300031251 Ga0265327_10000463 Ga0265327_1000046336 519
1583 3300035118 Ga0373954_0011766 Ga0373954_0011766_1235_2932 519
1584 3300035119 Ga0373956_0009618 Ga0373956_0009618_2178_3875 519
1585 3300036401 Ga0373937_0037613 Ga0373937_0037613_1860_3557 519
1586 3300037312 Ga0395899_0003783 Ga0395899_0003783_7920_9551 519
1587 3300038443 Ga0395901_0005518 Ga0395901_0005518_2392_4023 519
1588 3300041491 Ga0451833_0239188 Ga0451833_0239188_765_2387 519
1589 3300041496 Ga0451839_0468455 Ga0451839_0468455_809_2431 519
1590 3300041505 Ga0451849_1483964 Ga0451849_1483964_580_2202 519
1591 3300041507 Ga0451851_0817964 Ga0451851_0817964_809_2431 519
1592 3300041512 Ga0451853_1703964 Ga0451853_1703964_604_2226 519
1593 3300042009 Ga0439451_001743 Ga0439451_001743_2567_4183 519
1594 3300042010 Ga0439452_002356 Ga0439452_002356_2580_4169 519
1595 3300042013 Ga0439456_001747 Ga0439456_001747_2120_3709 519
1596 3300042016 Ga0439463_007986 Ga0439463_007986_126_1742 519
1597 3300042137 Ga0450902_000279 Ga0450902_000279_2910_4472 519
1598 3300046452 Ga0495617_001540 Ga0495617_001540_6030_7598 519
1599 3300046452 Ga0495617_001721 Ga0495617_001721_6062_7675 519
1600 3300046452 Ga0495617_003547 Ga0495617_003547_2642_4201 519
1601 3300046455 Ga0495603_0000220 Ga0495603_0000220_3289_4905 519
1602 3300046455 Ga0495603_0016588 Ga0495603_0016588_1896_3512 519
1603 3300046457 Ga0495590_0000153 Ga0495590_0000153_19633_21249 519
1604 3300046457 Ga0495590_0000286 Ga0495590_0000286_22133_23722 519
1605 3300046457 Ga0495590_0003622 Ga0495590_0003622_3920_5488 519
1606 3300046457 Ga0495590_0021075 Ga0495590_0021075_146_1705 519
1607 3300046458 Ga0495591_000121 Ga0495591_000121_77123_78691 519
1608 3300046458 Ga0495591_000489 Ga0495591_000489_22295_23857 519
1609 3300046458 Ga0495591_003206 Ga0495591_003206_1339_2898 519
1610 3300046460 Ga0495638_0001881 Ga0495638_0001881_14773_16431 519
1611 3300046460 Ga0495638_0002792 Ga0495638_0002792_9711_11327 519
1612 3300046460 Ga0495638_0003494 Ga0495638_0003494_5640_7199 519
1613 3300046460 Ga0495638_0010941 Ga0495638_0010941_1720_3309 519
1614 3300046460 Ga0495638_0026955 Ga0495638_0026955_385_1998 519
1615 3300046460 Ga0495638_0055082 Ga0495638_0055082_98_1666 519
1616 3300046471 Ga0495650_0001142 Ga0495650_0001142_22679_24247 519
1617 3300046471 Ga0495650_0001374 Ga0495650_0001374_2759_4375 519
1618 3300046471 Ga0495650_0002584 Ga0495650_0002584_6098_7657 519
1619 3300046474 Ga0495605_0000976 Ga0495605_0000976_5599_7188 519
1620 3300046474 Ga0495605_0001174 Ga0495605_0001174_13765_15378 519
1621 3300046474 Ga0495605_0001731 Ga0495605_0001731_1861_3501 519
1622 3300046474 Ga0495605_0002999 Ga0495605_0002999_5569_7128 519
1623 3300046474 Ga0495605_0031215 Ga0495605_0031215_855_2423 519
1624 3300046475 Ga0495639_0003439 Ga0495639_0003439_958_2574 519
1625 3300046491 Ga0495584_0000353 Ga0495584_0000353_20921_22480 519
1626 3300046491 Ga0495584_0004818 Ga0495584_0004818_4583_6151 519
1627 3300046492 Ga0495585_0004037 Ga0495585_0004037_6624_8183 519
1628 3300046492 Ga0495585_0012939 Ga0495585_0012939_1880_3493 519
1629 3300046492 Ga0495585_0048753 Ga0495585_0048753_177_1736 519
1630 3300046499 Ga0495594_0007040 Ga0495594_0007040_3057_4673 519
1631 3300046499 Ga0495594_0010621 Ga0495594_0010621_2671_4230 519
1632 3300046500 Ga0495596_0000056 Ga0495596_0000056_5298_6866 519
1633 3300046501 Ga0495607_0000259 Ga0495607_0000259_35275_36891 519
1634 3300046501 Ga0495607_0000449 Ga0495607_0000449_37747_39360 519
1635 3300046501 Ga0495607_0022990 Ga0495607_0022990_984_2546 519
1636 3300046501 Ga0495607_0029407 Ga0495607_0029407_1059_2627 519
1637 3300046506 Ga0495583_0000518 Ga0495583_0000518_44852_46411 519
1638 3300046506 Ga0495583_0001807 Ga0495583_0001807_5780_7339 519
1639 3300046507 Ga0495606_0003180 Ga0495606_0003180_5409_7022 519
1640 3300046512 Ga0495610_0004057 Ga0495610_0004057_1190_2749 519
1641 3300046512 Ga0495610_0013115 Ga0495610_0013115_1127_2740 519
1642 3300046512 Ga0495610_0018364 Ga0495610_0018364_1878_3491 519
1643 3300046513 Ga0495616_0000203 Ga0495616_0000203_28090_29706 519
1644 3300046513 Ga0495616_0001046 Ga0495616_0001046_8463_10076 519
1645 3300046513 Ga0495616_0034697 Ga0495616_0034697_196_1764 519
1646 3300046514 Ga0495618_0008537 Ga0495618_0008537_1109_2806 519
1647 3300046515 Ga0495620_0003842 Ga0495620_0003842_1106_2719 519
1648 3300046515 Ga0495620_0004701 Ga0495620_0004701_1775_3343 519
1649 3300046517 Ga0495630_0107014 Ga0495630_0107014_194_1891 519
1650 3300046518 Ga0495631_0000457 Ga0495631_0000457_1974_3590 519
1651 3300046518 Ga0495631_0008670 Ga0495631_0008670_1333_2901 519
1652 3300046519 Ga0495632_0000487 Ga0495632_0000487_8260_9819 519
1653 3300046519 Ga0495632_0016732 Ga0495632_0016732_1639_3207 519
1654 3300046520 Ga0495637_0000619 Ga0495637_0000619_685_2244 519
1655 3300046520 Ga0495637_0006023 Ga0495637_0006023_2172_3740 519
1656 3300046520 Ga0495637_0008234 Ga0495637_0008234_2189_3802 519
1657 3300046522 Ga0495643_0020063 Ga0495643_0020063_2119_3678 519
1658 3300046523 Ga0495644_0015212 Ga0495644_0015212_712_2271 519
1659 3300046524 Ga0495648_0003029 Ga0495648_0003029_4300_5889 519
1660 3300046524 Ga0495648_0007019 Ga0495648_0007019_1707_3320 519
1661 3300046524 Ga0495648_0025277 Ga0495648_0025277_2260_3828 519
1662 3300046524 Ga0495648_0040031 Ga0495648_0040031_252_1865 519
1663 3300046526 Ga0495666_0028359 Ga0495666_0028359_360_2000 519
1664 3300046528 Ga0495642_0000030 Ga0495642_0000030_14015_15604 519
1665 3300046528 Ga0495642_0000346 Ga0495642_0000346_8512_10071 519
1666 3300046530 Ga0495654_0000270 Ga0495654_0000270_19998_21614 519
1667 3300046530 Ga0495654_0001431 Ga0495654_0001431_12150_13709 519
1668 3300046530 Ga0495654_0004211 Ga0495654_0004211_1324_2883 519
1669 3300046530 Ga0495654_0004237 Ga0495654_0004237_1677_3293 519
1670 3300046530 Ga0495654_0012283 Ga0495654_0012283_972_2588 519
1671 3300046530 Ga0495654_0015436 Ga0495654_0015436_1199_2815 519
1672 3300046530 Ga0495654_0016274 Ga0495654_0016274_196_1764 519
1673 3300046530 Ga0495654_0041521 Ga0495654_0041521_64_1677 519
1674 3300046533 Ga0495640_0043708 Ga0495640_0043708_1080_2729 519
1675 3300046533 Ga0495640_0047507 Ga0495640_0047507_981_2678 519
1676 3300046535 Ga0495586_0004881 Ga0495586_0004881_2352_4049 519
1677 3300046536 Ga0495587_0001942 Ga0495587_0001942_10448_12088 519
1678 3300046538 Ga0495609_0000211 Ga0495609_0000211_48174_49733 519
1679 3300046542 Ga0495597_0003836 Ga0495597_0003836_6330_7943 519
1680 3300046542 Ga0495597_0004597 Ga0495597_0004597_1438_3006 519
1681 3300046542 Ga0495597_0006900 Ga0495597_0006900_108_1667 519
1682 3300046542 Ga0495597_0013611 Ga0495597_0013611_324_1940 519
1683 3300046557 Ga0495622_0001127 Ga0495622_0001127_7607_9166 519
1684 3300046557 Ga0495622_0003112 Ga0495622_0003112_3661_5277 519
1685 3300046557 Ga0495622_0013860 Ga0495622_0013860_1769_3382 519
1686 3300046557 Ga0495622_0021882 Ga0495622_0021882_1103_2719 519
1687 3300046558 Ga0495633_0000784 Ga0495633_0000784_21759_23372 519
1688 3300046559 Ga0495667_0018690 Ga0495667_0018690_168_1865 519
1689 3300046616 Ga0495668_0000176 Ga0495668_0000176_23824_25392 519
1690 3300046616 Ga0495668_0015572 Ga0495668_0015572_2058_3617 519
1691 3300046642 Ga0495634_0003233 Ga0495634_0003233_11440_13137 519
1692 3300046660 Ga0495625_0017154 Ga0495625_0017154_3263_4831 519
1693 3300046663 Ga0495635_0002143 Ga0495635_0002143_1413_3053 519
1694 3300046665 Ga0495661_0005553 Ga0495661_0005553_5177_6736 519
1695 3300046665 Ga0495661_0009681 Ga0495661_0009681_2749_4317 519
1696 3300046674 Ga0495588_0002475 Ga0495588_0002475_3233_4792 519
1697 3300046674 Ga0495588_0004155 Ga0495588_0004155_4321_5880 519
1698 3300046674 Ga0495588_0012575 Ga0495588_0012575_886_2502 519
1699 3300046679 Ga0495623_0019295 Ga0495623_0019295_1283_2950 519
1700 3300046684 Ga0495669_0000415 Ga0495669_0000415_18242_19801 519
1701 3300046689 Ga0495613_0001312 Ga0495613_0001312_1297_2994 519
1702 3300046691 Ga0495670_0000564 Ga0495670_0000564_6641_8230 519
1703 3300046691 Ga0495670_0000871 Ga0495670_0000871_11144_12760 519
1704 3300046691 Ga0495670_0007190 Ga0495670_0007190_3292_4851 519
1705 3300046691 Ga0495670_0018283 Ga0495670_0018283_23_1591 519
1706 3300046692 Ga0495671_0000287 Ga0495671_0000287_9611_11227 519
1707 3300046692 Ga0495671_0008774 Ga0495671_0008774_2772_4388 519
1708 3300046692 Ga0495671_0010949 Ga0495671_0010949_849_2408 519
1709 3300046692 Ga0495671_0012748 Ga0495671_0012748_1754_3343 519
1710 3300046692 Ga0495671_0015459 Ga0495671_0015459_289_1848 519
1711 3300046692 Ga0495671_0036998 Ga0495671_0036998_805_2373 519
1712 3300046694 Ga0495649_0001392 Ga0495649_0001392_3261_4820 519
1713 3300046694 Ga0495649_0011583 Ga0495649_0011583_1674_3263 519
1714 3300046694 Ga0495649_0024381 Ga0495649_0024381_825_2393 519
1715 3300046794 Ga0495589_0003145 Ga0495589_0003145_2882_4450 519
1716 3300046794 Ga0495589_0032983 Ga0495589_0032983_585_2144 519
1717 3300046809 Ga0495600_0009800 Ga0495600_0009800_932_2494 519
1718 3300046810 Ga0495660_0002760 Ga0495660_0002760_6734_8350 519
1719 3300046810 Ga0495660_0010447 Ga0495660_0010447_2600_4159 519
1720 3300046810 Ga0495660_0022082 Ga0495660_0022082_308_1867 519
1721 3300047317 Ga0495604_0030854 Ga0495604_0030854_2022_3584 519
1722 3300047319 Ga0495674_0008920 Ga0495674_0008920_6044_7684 519
1723 3300047320 Ga0495672_0000841 Ga0495672_0000841_17164_18753 519
1724 3300047320 Ga0495672_0003472 Ga0495672_0003472_9587_11176 519
1725 3300047320 Ga0495672_0018041 Ga0495672_0018041_1980_3539 519
1726 3300047320 Ga0495672_0020479 Ga0495672_0020479_506_2065 519
1727 3300047323 Ga0495683_0000436 Ga0495683_0000436_5446_7005 519
1728 3300047323 Ga0495683_0005278 Ga0495683_0005278_215_1774 519
1729 3300047323 Ga0495683_0015750 Ga0495683_0015750_1685_3253 519
1730 3300047323 Ga0495683_0027592 Ga0495683_0027592_280_1839 519
1731 3300047323 Ga0495683_0054011 Ga0495683_0054011_317_1933 519
1732 3300047443 Ga0495687_001294 Ga0495687_001294_4204_5793 519
1733 3300047443 Ga0495687_004526 Ga0495687_004526_3499_5088 519
1734 3300047445 Ga0495677_0001361 Ga0495677_0001361_7508_9067 519
1735 3300047446 Ga0495679_000743 Ga0495679_000743_11695_13254 519
1736 3300047469 Ga0495673_0000169 Ga0495673_0000169_27582_29198 519
1737 3300047469 Ga0495673_0001149 Ga0495673_0001149_6229_7788 519
1738 3300047469 Ga0495673_0012995 Ga0495673_0012995_1504_3093 519
1739 3300047470 Ga0495681_0000109 Ga0495681_0000109_19614_21230 519
1740 3300047470 Ga0495681_0000652 Ga0495681_0000652_23978_25546 519
1741 3300047470 Ga0495681_0035286 Ga0495681_0035286_198_1826 519
1742 3300047471 Ga0495684_0005871 Ga0495684_0005871_3716_5278 519
1743 3300047472 Ga0495686_0008348 Ga0495686_0008348_3531_5099 519
1744 3300047673 Ga0495593_0000091 Ga0495593_0000091_6789_8351 519
1745 3300048091 Ga0495626_0000087 Ga0495626_0000087_20247_21836 519
1746 3300048091 Ga0495626_0000143 Ga0495626_0000143_77941_79509 519
1747 3300048091 Ga0495626_0000844 Ga0495626_0000844_20063_21622 519
1748 3300048091 Ga0495626_0004118 Ga0495626_0004118_6661_8220 519
1749 3300048905 Ga0496102_0000815 Ga0496102_0000815_13555_15195 519
1750 3300048906 Ga0496103_0000725 Ga0496103_0000725_11620_13260 519
1751 3300048921 Ga0496118_0005371 Ga0496118_0005371_11540_13180 519
1752 3300048921 Ga0496118_0016327 Ga0496118_0016327_3447_5036 519
1753 3300048924 Ga0496121_0025780 Ga0496121_0025780_3291_4931 519
1754 3300048927 Ga0496124_0020533 Ga0496124_0020533_1799_3388 519
1755 3300048928 Ga0496125_0006220 Ga0496125_0006220_9268_10881 519
1756 3300049459 Ga0495678_004735 Ga0495678_004735_4259_5818 519
1757 3300049459 Ga0495678_005555 Ga0495678_005555_4546_6114 519
1758 3300049459 Ga0495678_010335 Ga0495678_010335_953_2512 519
1759 3300049460 Ga0495682_0000629 Ga0495682_0000629_2733_4349 519
1760 3300049460 Ga0495682_0002252 Ga0495682_0002252_5978_7537 519
1761 3300049460 Ga0495682_0005547 Ga0495682_0005547_280_1839 519
1762 3300049823 Ga0501044_0068563 Ga0501044_0068563_87_1781 519
1763 3300050489 nmdc:mga03683_48778_c1 nmdc:mga03683_48778_c1_16_1575 519
1764 3300053139 Ga0500568_0000059 Ga0500568_0000059_32799_34409 519
1765 iso_pu_bacteria 2511231008 2511278306 519
1766 iso_pu_bacteria 2511231012 2511303634 519
1767 iso_pu_bacteria 2511231014 2511316482 519
1768 iso_pu_bacteria 2511231015 2511322421 519
1769 iso_pu_bacteria 2511231017 2511330290 519
1770 iso_pu_bacteria 2511231020 2511350738 519
1771 iso_pu_bacteria 2511231021 2511356812 519
1772 iso_pu_bacteria 2513237084 2513573503 519
1773 iso_pu_bacteria 2515075009 2515110794 519
1774 iso_pu_bacteria 2517287029 2517405417 519
1775 iso_pu_bacteria 2643221589 2643953470 519
1776 iso_pu_bacteria 2643221602 2644021212 519
1777 iso_pu_bacteria 2643221633 2644186865 519
1778 iso_pu_bacteria 2738543004 2739200127 519
1779 iso_pu_bacteria 2738543015 2739261834 519
1780 iso_pu_bacteria 2808606377 2808930144 519
1781 iso_pu_bacteria 2808606381 2808952291 519
1782 iso_pu_bacteria 2860339153 2860342138 519
1783 iso_pu_bacteria 2904550169 2904551923 519
1784 iso_pu_bacteria 2919456309 2919456412 519
1785 iso_pu_bacteria 2931396565 2931401054 519
1786 iso_pu_bacteria 2933016740 2933023179 519
1787 iso_pu_bacteria 8005460587 8005461437 519
1788 iso_pu_bacteria 8055617313 8055623157 519
1789 iso_pu_bacteria 8056125926 8056128209 519

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00884

Sulfatase

Sulfatase

115

459

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7aj0-assembly1.cif.gz_F crystal structure of psfucs1 sulfatase from pseudoalteromonas sp. 0.8267 13 498
6psm-assembly1.cif.gz_B crystal structure of pss1_19b c77s in complex with kappa-neocarrabiose 0.8259 13 451
6bia-assembly1.cif.gz_C crystal structure of ps i-cgsb 0.8174 14 512
1n2l-assembly1.cif.gz_A-2 crystal structure of a covalent intermediate of endogenous human arylsulfatase a 0.816 12 451
6psm-assembly3.cif.gz_F crystal structure of pss1_19b c77s in complex with kappa-neocarrabiose 0.8109 13 451
ID Description Score Start End Superfamily
af_P25549_453_517_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.8635 399 446 3.40.720.10
af_Q32KJ6_30_387_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.8333 12 403 3.40.720.10
af_Q32KJ6_30_387_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.8311 12 403 3.40.720.10
af_Q8SZ72_26_377_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.8151 14 397 3.40.720.10
af_A0A286Y802_23_363_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.8143 14 393 3.40.720.10
ID Description Score Start End GO Terms
AF-A0A2V6T911-F1-model_v4 Arylsulfatase 0.989 1 477
AF-A0A7Y2WCT7-F1-model_v4 deleted 0.9801 2 519
AF-A0A810BE42-F1-model_v4 Arylsulfatase 0.9797 20 519
AF-A0A810BE42-F1-model_v4 Arylsulfatase 0.9778 20 519
AF-A0A2V7APX5-F1-model_v4 Arylsulfatase 0.9771 76 519

Feature Viewer

pLDDT pTM Quality
91.19 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map