F495703

General Info

Members Datasets Scaffolds Average Seq Length
1787 493 1787 122

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10105819|Ga0157378_101058193
Length 134
Sequence LLGRIQQLSNQATQQPFQGATAMIQMGTVLQVADNTGAKKIACIKMLGGSTAGQYARLGDVITASVKEASPDGTVKKVKESRRRDGSYIKFDDNAAVLINDAREPVGTRVFGPVARELRERKFMKIISLAPEVI

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
7 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
8 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
9 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
12 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
44 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
47 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
48 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
49 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
50 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
51 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
52 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
59 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
60 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
61 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
62 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
69 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
70 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
71 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
72 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
73 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
74 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
75 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
84 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
85 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
86 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
87 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
88 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
89 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
90 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
91 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
92 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
93 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
94 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
95 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
96 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
97 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
98 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
99 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
102 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
103 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
104 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
105 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
106 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
107 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
108 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
109 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
111 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
112 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
113 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
114 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
119 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
121 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
122 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
123 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
124 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
125 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
126 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
127 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
128 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
129 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
130 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
131 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
132 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
133 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
134 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
135 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
136 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
139 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
140 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
141 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
142 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
143 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
144 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
145 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
146 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
148 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
149 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
150 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
230 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
234 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
235 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
236 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
237 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
238 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
241 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
242 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
243 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
244 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
245 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
246 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
247 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
248 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
249 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
250 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
251 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
252 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
253 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
254 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
255 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
256 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
257 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
258 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
259 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
260 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
261 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
262 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
263 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
264 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
265 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
266 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
267 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
268 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
269 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
270 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
271 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
272 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
273 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
278 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
279 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
280 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
281 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
282 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
283 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
284 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
285 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
286 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
287 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
288 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
289 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
290 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
291 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
292 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
293 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
294 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
295 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
296 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
297 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
298 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
299 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
300 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
301 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
302 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
303 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
304 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
305 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
306 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
307 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
308 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
309 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
310 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
311 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
312 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
313 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
314 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
315 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
316 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
317 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
318 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
319 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
320 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
321 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
322 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
323 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
324 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
325 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
326 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
327 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
328 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
329 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
330 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
331 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
332 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
333 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
334 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
335 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
336 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
337 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
338 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
339 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
340 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
341 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
342 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
343 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
344 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
345 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
346 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
347 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
348 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
349 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
350 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
351 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
352 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
353 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
354 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
355 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
356 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
357 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
358 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
359 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
360 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
361 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
362 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
363 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
364 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
365 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
366 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
367 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
368 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
369 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
370 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
371 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
372 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
373 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
374 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
375 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
376 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
377 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
378 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
379 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
380 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
381 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
382 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
383 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
384 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
385 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
386 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
387 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
388 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
389 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
390 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
391 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
392 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
393 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
394 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
395 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
396 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
397 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
398 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
399 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
400 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
401 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
402 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
403 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
404 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
405 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
406 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
407 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
408 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
409 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
410 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
411 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
412 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
413 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
414 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
415 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
416 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
417 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
418 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
419 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
420 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
421 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
422 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
423 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
424 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
425 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
427 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
428 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
430 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
431 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
432 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
433 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
434 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
435 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
436 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
437 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
438 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
439 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
440 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
441 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
442 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
443 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
444 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
445 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
446 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
447 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
448 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
449 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
450 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
451 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
452 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
453 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
454 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
455 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
456 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
457 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
458 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
459 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
460 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
461 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
462 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
463 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
464 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
465 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
466 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
467 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
468 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
469 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
470 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
471 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
472 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
473 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
474 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
475 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
476 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
477 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
478 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
479 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
480 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
481 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
482 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
483 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
484 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
485 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
486 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
487 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
488 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
489 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
490 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
491 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
492 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
493 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.48
Metatranscriptomes 2.52
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 4.59
Rhizosphere 93.12
Stem 0
Stem Tuber 0
Unclassified 2.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_291308 2162886007 Unclassified 1389
2 SwRhRL2b_contig_3903249 2162886007 Bacteria 1678
3 MBSR1b_contig_4233670 2162886012 Bacteria 831
4 JGI24746J21847_1016431 3300001977 Unclassified 1057
5 JGI24742J22300_10007131 3300002244 Bacteria 1843
6 rootL2_10282489 3300003322 Bacteria 1869
7 JGI26145J50221_1001211 3300003371 Bacteria 2045
8 JGI26141J51220_1003121 3300003503 Bacteria 1020
9 JGI25405J52794_10000604 3300003911 Bacteria 5327
10 Ga0058863_10059782 3300004799 Bacteria 2822
11 Ga0058863_11875765 3300004799 Bacteria 505
12 Ga0058861_12030344 3300004800 Bacteria 2573
13 Ga0058860_12230108 3300004801 Bacteria 926
14 Ga0058862_10154497 3300004803 Bacteria 1389
15 Ga0065704_10005699 3300005289 Bacteria 4814
16 Ga0065704_10085970 3300005289 Bacteria 3168
17 Ga0065704_10190762 3300005289 Unclassified 1191
18 Ga0065704_10394263 3300005289 Bacteria 759
19 Ga0065712_10374598 3300005290 Bacteria 751
20 Ga0065715_10121974 3300005293 Bacteria 2216
21 Ga0065715_10445920 3300005293 Bacteria 831
22 Ga0065715_11162660 3300005293 Bacteria 506
23 Ga0065707_10025635 3300005295 Bacteria 1864
24 Ga0070658_10039091 3300005327 Bacteria 3827
25 Ga0070658_11318469 3300005327 Bacteria 627
26 Ga0070676_10018293 3300005328 Bacteria 3881
27 Ga0070676_10026300 3300005328 Bacteria 3294
28 Ga0070676_10541632 3300005328 Bacteria 832
29 Ga0070676_11479038 3300005328 Bacteria 523
30 Ga0070683_100000033 3300005329 Bacteria 135305
31 Ga0070683_100004175 3300005329 Bacteria 11835
32 Ga0070690_100005750 3300005330 Bacteria 6987
33 Ga0070690_100030946 3300005330 Bacteria 3331
34 Ga0070690_100065969 3300005330 Bacteria 2342
35 Ga0070690_100256616 3300005330 Bacteria 1239
36 Ga0070690_100776228 3300005330 Bacteria 741
37 Ga0070670_100006072 3300005331 Bacteria 10217
38 Ga0070670_100029495 3300005331 Bacteria 4723
39 Ga0070670_100218024 3300005331 Bacteria 1660
40 Ga0070670_100303900 3300005331 Bacteria 1396
41 Ga0070670_100324478 3300005331 Bacteria 1349
42 Ga0070670_100546168 3300005331 Bacteria 1033
43 Ga0070670_100676845 3300005331 Bacteria 927
44 Ga0070670_102113790 3300005331 Bacteria 519
45 Ga0070677_10005399 3300005333 Bacteria 4210
46 Ga0068869_100009311 3300005334 Bacteria 6370
47 Ga0068869_100015378 3300005334 Bacteria 5132
48 Ga0068869_100041040 3300005334 Bacteria 3312
49 Ga0068869_100167792 3300005334 Bacteria 1713
50 Ga0068869_100200424 3300005334 Bacteria 1574
51 Ga0068869_100268990 3300005334 Bacteria 1367
52 Ga0068869_100646961 3300005334 Bacteria 897
53 Ga0070666_10001387 3300005335 Bacteria 14671
54 Ga0070666_10001507 3300005335 Bacteria 14139
55 Ga0070666_10011673 3300005335 Bacteria 5522
56 Ga0070666_10040333 3300005335 Bacteria 3116
57 Ga0070666_10162092 3300005335 Bacteria 1563
58 Ga0070666_10521737 3300005335 Bacteria 862
59 Ga0070666_10958131 3300005335 Bacteria 634
60 Ga0070680_100707670 3300005336 Bacteria 867
61 Ga0070682_100256877 3300005337 Bacteria 1263
62 Ga0068868_100000632 3300005338 Bacteria 23664
63 Ga0068868_100906099 3300005338 Bacteria 802
64 Ga0070660_100100051 3300005339 Bacteria 2296
65 Ga0070660_100406772 3300005339 Bacteria 1126
66 Ga0070689_100068193 3300005340 Bacteria 2774
67 Ga0070689_100101559 3300005340 Bacteria 2276
68 Ga0070689_100103520 3300005340 Bacteria 2256
69 Ga0070689_100204302 3300005340 Bacteria 1614
70 Ga0070689_100259633 3300005340 Bacteria 1435
71 Ga0070689_100412269 3300005340 Bacteria 1144
72 Ga0070689_100427886 3300005340 Bacteria 1123
73 Ga0070689_100507022 3300005340 Bacteria 1034
74 Ga0070689_100688822 3300005340 Bacteria 892
75 Ga0070689_100796799 3300005340 Bacteria 831
76 Ga0070689_101067422 3300005340 Bacteria 721
77 Ga0070689_101578820 3300005340 Bacteria 595
78 Ga0070691_10060647 3300005341 Bacteria 1819
79 Ga0070691_10309448 3300005341 Bacteria 865
80 Ga0070691_10961339 3300005341 Bacteria 531
81 Ga0070687_100051489 3300005343 Bacteria 2132
82 Ga0070687_100114596 3300005343 Bacteria 1531
83 Ga0070687_100136833 3300005343 Bacteria 1421
84 Ga0070687_100427962 3300005343 Bacteria 875
85 Ga0070687_100465332 3300005343 Bacteria 844
86 Ga0070687_100515402 3300005343 Bacteria 808
87 Ga0070661_100010686 3300005344 Bacteria 6387
88 Ga0070692_10001104 3300005345 Bacteria 9415
89 Ga0070692_10004482 3300005345 Bacteria 5844
90 Ga0070692_10102494 3300005345 Bacteria 1571
91 Ga0070692_11082159 3300005345 Bacteria 565
92 Ga0070692_11154071 3300005345 Bacteria 549
93 Ga0070668_100028739 3300005347 Bacteria 4219
94 Ga0070668_100117946 3300005347 Bacteria 2118
95 Ga0070669_100025363 3300005353 Bacteria 4257
96 Ga0070669_100097584 3300005353 Bacteria 2212
97 Ga0070669_100278937 3300005353 Bacteria 1338
98 Ga0070669_101569360 3300005353 Bacteria 573
99 Ga0070669_101635007 3300005353 Bacteria 561
100 Ga0070675_100000007 3300005354 Bacteria 263394
101 Ga0070675_100032515 3300005354 Bacteria 4223
102 Ga0070675_100092402 3300005354 Bacteria 2536
103 Ga0070675_100105703 3300005354 Bacteria 2375
104 Ga0070675_100123749 3300005354 Bacteria 2199
105 Ga0070675_100183980 3300005354 Bacteria 1808
106 Ga0070675_100185688 3300005354 Bacteria 1799
107 Ga0070675_100318549 3300005354 Bacteria 1373
108 Ga0070675_100342603 3300005354 Bacteria 1324
109 Ga0070675_101193667 3300005354 Bacteria 700
110 Ga0070675_101372066 3300005354 Bacteria 652
111 Ga0070671_100190181 3300005355 Bacteria 1739
112 Ga0070671_100191826 3300005355 Bacteria 1732
113 Ga0070674_100007457 3300005356 Bacteria 6453
114 Ga0070674_100007905 3300005356 Bacteria 6293
115 Ga0070674_100343338 3300005356 Bacteria 1203
116 Ga0070674_100367453 3300005356 Bacteria 1167
117 Ga0070674_100587817 3300005356 Bacteria 939
118 Ga0070674_101389008 3300005356 Bacteria 628
119 Ga0070674_101735933 3300005356 Bacteria 565
120 Ga0070673_100051191 3300005364 Bacteria 3232
121 Ga0070673_100071173 3300005364 Bacteria 2793
122 Ga0070673_100099405 3300005364 Bacteria 2393
123 Ga0070673_100226177 3300005364 Bacteria 1621
124 Ga0070673_100677707 3300005364 Bacteria 945
125 Ga0070673_101809998 3300005364 Bacteria 578
126 Ga0070688_100175984 3300005365 Bacteria 1481
127 Ga0070688_100426728 3300005365 Bacteria 986
128 Ga0070688_100533180 3300005365 Bacteria 890
129 Ga0070688_100874058 3300005365 Bacteria 707
130 Ga0070659_100169875 3300005366 Bacteria 1786
131 Ga0070667_100002921 3300005367 Bacteria 14677
132 Ga0070667_100091951 3300005367 Bacteria 2609
133 Ga0070667_100234407 3300005367 Bacteria 1637
134 Ga0070667_100604574 3300005367 Bacteria 1010
135 Ga0070667_100977738 3300005367 Unclassified 789
136 Ga0070667_101203917 3300005367 Bacteria 709
137 Ga0070703_10097871 3300005406 Bacteria 1029
138 Ga0070709_10019666 3300005434 Bacteria 3908
139 Ga0070709_10075841 3300005434 Bacteria 2182
140 Ga0070709_10133261 3300005434 Bacteria 1699
141 Ga0070709_10444071 3300005434 Bacteria 976
142 Ga0070709_10899752 3300005434 Bacteria 700
143 Ga0070713_100115557 3300005436 Bacteria 2345
144 Ga0070710_10298597 3300005437 Bacteria 1051
145 Ga0070710_10482662 3300005437 Bacteria 845
146 Ga0070701_10014144 3300005438 Bacteria 3651
147 Ga0070701_10085332 3300005438 Bacteria 1719
148 Ga0070701_10562179 3300005438 Bacteria 750
149 Ga0070711_100350307 3300005439 Bacteria 1187
150 Ga0070711_100355922 3300005439 Bacteria 1178
151 Ga0070711_100364914 3300005439 Bacteria 1164
152 Ga0070711_101924400 3300005439 Bacteria 520
153 Ga0070705_100021563 3300005440 Bacteria 3429
154 Ga0070705_100481005 3300005440 Bacteria 938
155 Ga0070700_100000050 3300005441 Bacteria 88421
156 Ga0070700_100105528 3300005441 Bacteria 1863
157 Ga0070700_100699064 3300005441 Bacteria 806
158 Ga0070700_101465297 3300005441 Bacteria 579
159 Ga0070694_100004904 3300005444 Bacteria 8062
160 Ga0070694_100018421 3300005444 Bacteria 4431
161 Ga0070694_100026241 3300005444 Bacteria 3775
162 Ga0070694_100923232 3300005444 Bacteria 722
163 Ga0070694_101063760 3300005444 Bacteria 674
164 Ga0070694_101212678 3300005444 Bacteria 633
165 Ga0070708_100157158 3300005445 Bacteria 2117
166 Ga0070708_100172273 3300005445 Bacteria 2021
167 Ga0070708_100263368 3300005445 Bacteria 1621
168 Ga0070708_100263468 3300005445 Bacteria 1620
169 Ga0070708_101206272 3300005445 Bacteria 708
170 Ga0070708_101221233 3300005445 Bacteria 703
171 Ga0070708_101357583 3300005445 Bacteria 663
172 Ga0070708_101527797 3300005445 Unclassified 622
173 Ga0070708_101802727 3300005445 Bacteria 568
174 Ga0070663_100046825 3300005455 Bacteria 3062
175 Ga0070663_100507789 3300005455 Bacteria 1002
176 Ga0070678_100006394 3300005456 Bacteria 6913
177 Ga0070678_100277422 3300005456 Bacteria 1416
178 Ga0070678_100505663 3300005456 Bacteria 1067
179 Ga0070662_100093375 3300005457 Bacteria 2263
180 Ga0070662_100124500 3300005457 Bacteria 1979
181 Ga0070662_100146168 3300005457 Bacteria 1837
182 Ga0070662_100201195 3300005457 Bacteria 1581
183 Ga0070662_101086956 3300005457 Bacteria 686
184 Ga0070662_101352454 3300005457 Bacteria 613
185 Ga0070681_10212292 3300005458 Bacteria 1851
186 Ga0070681_10388776 3300005458 Bacteria 1306
187 Ga0070681_11357294 3300005458 Bacteria 634
188 Ga0068867_100016292 3300005459 Bacteria 5278
189 Ga0068867_100023693 3300005459 Bacteria 4395
190 Ga0068867_100025055 3300005459 Bacteria 4279
191 Ga0068867_100261944 3300005459 Bacteria 1410
192 Ga0068867_101344521 3300005459 Bacteria 661
193 Ga0070685_10112403 3300005466 Bacteria 1680
194 Ga0070685_10811138 3300005466 Bacteria 690
195 Ga0070706_100005176 3300005467 Bacteria 12446
196 Ga0070706_100021749 3300005467 Bacteria 5905
197 Ga0070706_100060377 3300005467 Bacteria 3500
198 Ga0070706_100084802 3300005467 Unclassified 2935
199 Ga0070706_100143886 3300005467 Bacteria 2226
200 Ga0070706_100152709 3300005467 Bacteria 2156
201 Ga0070706_100160143 3300005467 Bacteria 2101
202 Ga0070706_100185121 3300005467 Bacteria 1946
203 Ga0070706_100253498 3300005467 Bacteria 1643
204 Ga0070706_100290414 3300005467 Bacteria 1526
205 Ga0070707_100006596 3300005468 Bacteria 10769
206 Ga0070707_100084042 3300005468 Bacteria 3076
207 Ga0070707_100222760 3300005468 Bacteria 1837
208 Ga0070707_100271464 3300005468 Bacteria 1649
209 Ga0070707_100459544 3300005468 Bacteria 1234
210 Ga0070707_100574266 3300005468 Bacteria 1090
211 Ga0070707_100613758 3300005468 Bacteria 1050
212 Ga0070707_101381124 3300005468 Bacteria 671
213 Ga0070698_100004976 3300005471 Bacteria 14561
214 Ga0070698_100022395 3300005471 Bacteria 6610
215 Ga0070698_100039505 3300005471 Bacteria 4857
216 Ga0070698_100150648 3300005471 Bacteria 2274
217 Ga0070698_100337116 3300005471 Bacteria 1439
218 Ga0070698_100358829 3300005471 Bacteria 1389
219 Ga0070698_100771513 3300005471 Bacteria 905
220 Ga0070698_101613421 3300005471 Bacteria 601
221 Ga0070699_100242768 3300005518 Bacteria 1608
222 Ga0070699_100270563 3300005518 Bacteria 1520
223 Ga0070699_100331429 3300005518 Bacteria 1369
224 Ga0070699_100372948 3300005518 Bacteria 1288
225 Ga0070699_100894802 3300005518 Bacteria 813
226 Ga0070699_100980595 3300005518 Bacteria 775
227 Ga0070699_100988430 3300005518 Bacteria 771
228 Ga0070699_101044073 3300005518 Bacteria 749
229 Ga0070699_101840844 3300005518 Bacteria 554
230 Ga0070679_100029036 3300005530 Bacteria 5455
231 Ga0070679_101054963 3300005530 Bacteria 757
232 Ga0070679_101391791 3300005530 Bacteria 648
233 Ga0070684_100006540 3300005535 Bacteria 9022
234 Ga0070684_100034321 3300005535 Bacteria 4337
235 Ga0070684_100315549 3300005535 Bacteria 1435
236 Ga0070684_100501115 3300005535 Bacteria 1125
237 Ga0070684_101450530 3300005535 Bacteria 646
238 Ga0070697_100002003 3300005536 Bacteria 15614
239 Ga0070697_100006235 3300005536 Bacteria 9233
240 Ga0070697_100016639 3300005536 Bacteria 5784
241 Ga0070697_100050503 3300005536 Bacteria 3376
242 Ga0070697_100057785 3300005536 Bacteria 3156
243 Ga0070697_100073385 3300005536 Bacteria 2809
244 Ga0070697_100131871 3300005536 Bacteria 2096
245 Ga0070697_100173619 3300005536 Bacteria 1825
246 Ga0070697_100292248 3300005536 Bacteria 1400
247 Ga0070697_100788006 3300005536 Bacteria 841
248 Ga0070697_100935321 3300005536 Bacteria 770
249 Ga0070697_101020950 3300005536 Bacteria 735
250 Ga0070697_101092673 3300005536 Bacteria 710
251 Ga0068853_100010446 3300005539 Bacteria 7515
252 Ga0068853_100558747 3300005539 Bacteria 1085
253 Ga0070672_100005180 3300005543 Bacteria 8619
254 Ga0070672_100057049 3300005543 Bacteria 3065
255 Ga0070672_100074196 3300005543 Bacteria 2713
256 Ga0070672_100078636 3300005543 Bacteria 2639
257 Ga0070672_100083257 3300005543 Bacteria 2567
258 Ga0070672_100189079 3300005543 Bacteria 1718
259 Ga0070672_100222200 3300005543 Bacteria 1584
260 Ga0070672_101545981 3300005543 Bacteria 595
261 Ga0070686_100022242 3300005544 Bacteria 3774
262 Ga0070686_100065761 3300005544 Bacteria 2356
263 Ga0070686_101648143 3300005544 Bacteria 543
264 Ga0070695_100043544 3300005545 Bacteria 2854
265 Ga0070695_100121956 3300005545 Bacteria 1784
266 Ga0070695_100123311 3300005545 Bacteria 1776
267 Ga0070695_100147012 3300005545 Bacteria 1641
268 Ga0070695_100332431 3300005545 Bacteria 1133
269 Ga0070696_100012751 3300005546 Bacteria 5644
270 Ga0070696_100015270 3300005546 Bacteria 5155
271 Ga0070696_100023806 3300005546 Bacteria 4163
272 Ga0070696_100068104 3300005546 Bacteria 2498
273 Ga0070696_100143548 3300005546 Bacteria 1747
274 Ga0070696_100290648 3300005546 Bacteria 1249
275 Ga0070696_101204782 3300005546 Bacteria 640
276 Ga0070693_100037146 3300005547 Bacteria 2714
277 Ga0070693_100063520 3300005547 Bacteria 2152
278 Ga0070665_100022280 3300005548 Bacteria 6375
279 Ga0070665_100027592 3300005548 Bacteria 5718
280 Ga0070665_100425601 3300005548 Bacteria 1336
281 Ga0070665_101177422 3300005548 Bacteria 777
282 Ga0070665_101605544 3300005548 Bacteria 658
283 Ga0070704_100044966 3300005549 Bacteria 3071
284 Ga0070704_100199616 3300005549 Bacteria 1614
285 Ga0070704_100228149 3300005549 Bacteria 1518
286 Ga0070704_100346746 3300005549 Bacteria 1252
287 Ga0070704_100408103 3300005549 Bacteria 1161
288 Ga0068855_100000266 3300005563 Bacteria 65127
289 Ga0068855_100946306 3300005563 Bacteria 908
290 Ga0070664_100005841 3300005564 Bacteria 9927
291 Ga0070664_100436529 3300005564 Bacteria 1201
292 Ga0070664_100688159 3300005564 Bacteria 952
293 Ga0070664_100756549 3300005564 Bacteria 907
294 Ga0068857_100333822 3300005577 Bacteria 1402
295 Ga0068854_100126246 3300005578 Bacteria 1949
296 Ga0068854_100248683 3300005578 Bacteria 1419
297 Ga0068854_100287407 3300005578 Bacteria 1326
298 Ga0068854_100331794 3300005578 Bacteria 1239
299 Ga0068854_100978744 3300005578 Bacteria 748
300 Ga0068856_100007761 3300005614 Bacteria 10480
301 Ga0068856_100009234 3300005614 Bacteria 9591
302 Ga0068856_100859975 3300005614 Bacteria 926
303 Ga0068856_100867057 3300005614 Unclassified 922
304 Ga0068856_102227847 3300005614 Bacteria 557
305 Ga0070702_100039824 3300005615 Bacteria 2625
306 Ga0070702_100067864 3300005615 Bacteria 2097
307 Ga0070702_100187967 3300005615 Bacteria 1357
308 Ga0070702_100299624 3300005615 Bacteria 1112
309 Ga0070702_100550133 3300005615 Bacteria 857
310 Ga0070702_100565046 3300005615 Bacteria 847
311 Ga0068852_100160088 3300005616 Bacteria 2101
312 Ga0068852_100419281 3300005616 Bacteria 1320
313 Ga0068852_101268419 3300005616 Unclassified 758
314 Ga0068859_100000677 3300005617 Bacteria 34196
315 Ga0068859_100163938 3300005617 Bacteria 2302
316 Ga0068859_100284313 3300005617 Bacteria 1747
317 Ga0068859_100310919 3300005617 Bacteria 1669
318 Ga0068859_100425056 3300005617 Bacteria 1425
319 Ga0068859_100971326 3300005617 Bacteria 932
320 Ga0068859_100995658 3300005617 Bacteria 920
321 Ga0068859_101953714 3300005617 Bacteria 648
322 Ga0068864_100031613 3300005618 Bacteria 4493
323 Ga0068864_100094210 3300005618 Bacteria 2646
324 Ga0068864_100108236 3300005618 Bacteria 2474
325 Ga0068864_100197897 3300005618 Bacteria 1845
326 Ga0068864_100669070 3300005618 Bacteria 1012
327 Ga0068866_10270079 3300005718 Bacteria 1049
328 Ga0068866_10396743 3300005718 Bacteria 889
329 Ga0068866_10972721 3300005718 Unclassified 601
330 Ga0068861_100020829 3300005719 Bacteria 4703
331 Ga0068861_100084086 3300005719 Bacteria 2498
332 Ga0068861_100182569 3300005719 Bacteria 1748
333 Ga0068861_100283062 3300005719 Bacteria 1429
334 Ga0068861_100400314 3300005719 Bacteria 1218
335 Ga0068861_100663397 3300005719 Bacteria 965
336 Ga0068870_10075673 3300005840 Bacteria 1847
337 Ga0068870_10389803 3300005840 Bacteria 904
338 Ga0068870_10612235 3300005840 Bacteria 741
339 Ga0068863_100061234 3300005841 Bacteria 3558
340 Ga0068863_100135598 3300005841 Bacteria 2352
341 Ga0068863_100614434 3300005841 Bacteria 1077
342 Ga0068863_101247584 3300005841 Bacteria 750
343 Ga0068858_100004672 3300005842 Bacteria 13423
344 Ga0068858_100183416 3300005842 Bacteria 1976
345 Ga0068858_100479193 3300005842 Bacteria 1201
346 Ga0068858_100940654 3300005842 Bacteria 846
347 Ga0068858_101981642 3300005842 Bacteria 576
348 Ga0068860_100005124 3300005843 Bacteria 13325
349 Ga0068860_100042506 3300005843 Bacteria 4339
350 Ga0068860_100110903 3300005843 Bacteria 2623
351 Ga0068860_100407065 3300005843 Bacteria 1347
352 Ga0068860_100625000 3300005843 Bacteria 1084
353 Ga0068860_100709199 3300005843 Bacteria 1016
354 Ga0068860_100937514 3300005843 Bacteria 883
355 Ga0068860_101594488 3300005843 Bacteria 675
356 Ga0068860_101787277 3300005843 Bacteria 636
357 Ga0068862_100003143 3300005844 Bacteria 14358
358 Ga0068862_100040470 3300005844 Bacteria 3961
359 Ga0068862_100091874 3300005844 Bacteria 2644
360 Ga0068862_100103172 3300005844 Bacteria 2497
361 Ga0068862_100115629 3300005844 Bacteria 2359
362 Ga0068862_100446059 3300005844 Bacteria 1219
363 Ga0068862_100483215 3300005844 Bacteria 1173
364 Ga0081455_10000422 3300005937 Bacteria 55396
365 Ga0081455_10010015 3300005937 Bacteria 9686
366 Ga0081455_10028987 3300005937 Bacteria 5051
367 Ga0081455_10079207 3300005937 Bacteria 2698
368 Ga0081455_10448240 3300005937 Bacteria 882
369 Ga0081455_10548763 3300005937 Bacteria 765
370 Ga0081540_1027578 3300005983 Bacteria 3213
371 Ga0070717_10000064 3300006028 Bacteria 89273
372 Ga0070717_10417247 3300006028 Bacteria 1207
373 Ga0070717_10756042 3300006028 Bacteria 884
374 Ga0075363_100924436 3300006048 Bacteria 535
375 Ga0075364_11251736 3300006051 Bacteria 503
376 Ga0075432_10006617 3300006058 Bacteria 3943
377 Ga0075432_10058477 3300006058 Bacteria 1369
378 Ga0075432_10395084 3300006058 Bacteria 596
379 Ga0070715_10683641 3300006163 Bacteria 611
380 Ga0070716_100026284 3300006173 Bacteria 3116
381 Ga0070716_100270517 3300006173 Bacteria 1167
382 Ga0070716_100442032 3300006173 Bacteria 946
383 Ga0070716_100815246 3300006173 Bacteria 724
384 Ga0070712_101881419 3300006175 Bacteria 524
385 Ga0097621_100030376 3300006237 Bacteria 4276
386 Ga0097621_100492357 3300006237 Bacteria 1109
387 Ga0097621_101324039 3300006237 Bacteria 681
388 Ga0097621_101458930 3300006237 Bacteria 649
389 Ga0097621_101491088 3300006237 Bacteria 642
390 Ga0068871_100129959 3300006358 Bacteria 2135
391 Ga0068871_100377689 3300006358 Bacteria 1258
392 Ga0068871_100454439 3300006358 Bacteria 1149
393 Ga0068871_100711669 3300006358 Bacteria 921
394 Ga0068871_101018833 3300006358 Bacteria 772
395 Ga0068871_101193520 3300006358 Bacteria 714
396 Ga0068871_101282765 3300006358 Bacteria 688
397 Ga0075428_100002976 3300006844 Bacteria 18459
398 Ga0075428_100003062 3300006844 Bacteria 18244
399 Ga0075428_100032404 3300006844 Bacteria 5773
400 Ga0075428_100069486 3300006844 Bacteria 3850
401 Ga0075428_100209761 3300006844 Bacteria 2105
402 Ga0075428_100307525 3300006844 Bacteria 1704
403 Ga0075428_100371042 3300006844 Bacteria 1534
404 Ga0075430_100002410 3300006846 Bacteria 15562
405 Ga0075430_100006690 3300006846 Bacteria 9725
406 Ga0075430_100040471 3300006846 Bacteria 3945
407 Ga0075430_100299056 3300006846 Bacteria 1331
408 Ga0075430_100517172 3300006846 Unclassified 985
409 Ga0075431_100003027 3300006847 Bacteria 16266
410 Ga0075431_100179475 3300006847 Bacteria 2173
411 Ga0075431_100350728 3300006847 Bacteria 1484
412 Ga0075431_100638920 3300006847 Bacteria 1046
413 Ga0075431_100703020 3300006847 Bacteria 988
414 Ga0075431_100806056 3300006847 Bacteria 912
415 Ga0075431_100841912 3300006847 Bacteria 889
416 Ga0075431_101001326 3300006847 Bacteria 803
417 Ga0075431_101649011 3300006847 Bacteria 599
418 Ga0075433_10002443 3300006852 Bacteria 14147
419 Ga0075433_10005052 3300006852 Bacteria 10341
420 Ga0075433_10065602 3300006852 Bacteria 3184
421 Ga0075433_10084417 3300006852 Bacteria 2803
422 Ga0075433_10088307 3300006852 Bacteria 2739
423 Ga0075433_10111840 3300006852 Bacteria 2423
424 Ga0075433_10163788 3300006852 Bacteria 1979
425 Ga0075433_10187982 3300006852 Bacteria 1837
426 Ga0075433_10447346 3300006852 Bacteria 1139
427 Ga0075433_10773066 3300006852 Bacteria 840
428 Ga0075433_10830830 3300006852 Bacteria 807
429 Ga0075434_100000038 3300006871 Bacteria 59843
430 Ga0075434_100002471 3300006871 Bacteria 16270
431 Ga0075434_100014841 3300006871 Bacteria 7452
432 Ga0075434_100110302 3300006871 Bacteria 2762
433 Ga0075434_100135458 3300006871 Bacteria 2482
434 Ga0075434_100135556 3300006871 Bacteria 2481
435 Ga0075434_100246019 3300006871 Bacteria 1808
436 Ga0075429_100008584 3300006880 Bacteria 8889
437 Ga0075429_100099339 3300006880 Bacteria 2539
438 Ga0075429_100292591 3300006880 Bacteria 1426
439 Ga0075429_100305175 3300006880 Bacteria 1394
440 Ga0075429_100550555 3300006880 Bacteria 1011
441 Ga0068865_100005424 3300006881 Bacteria 7732
442 Ga0068865_100016601 3300006881 Bacteria 4716
443 Ga0075436_100002590 3300006914 Bacteria 12435
444 Ga0075436_100002790 3300006914 Bacteria 11964
445 Ga0075436_100004621 3300006914 Bacteria 9434
446 Ga0075436_100027386 3300006914 Bacteria 3923
447 Ga0075436_100076615 3300006914 Bacteria 2316
448 Ga0075436_100098077 3300006914 Bacteria 2039
449 Ga0075436_100176487 3300006914 Bacteria 1509
450 Ga0075436_100248625 3300006914 Bacteria 1266
451 Ga0075436_100915907 3300006914 Bacteria 656
452 Ga0097620_100000677 3300006931 Bacteria 34196
453 Ga0097620_100163956 3300006931 Bacteria 2302
454 Ga0097620_100284333 3300006931 Bacteria 1747
455 Ga0097620_100310923 3300006931 Bacteria 1669
456 Ga0097620_100425040 3300006931 Bacteria 1425
457 Ga0097620_100971311 3300006931 Bacteria 932
458 Ga0097620_100995693 3300006931 Bacteria 920
459 Ga0097620_101953811 3300006931 Bacteria 648
460 Ga0075435_100002461 3300007076 Bacteria 12304
461 Ga0075435_100027645 3300007076 Bacteria 4440
462 Ga0075435_100088348 3300007076 Bacteria 2554
463 Ga0075435_100236973 3300007076 Bacteria 1551
464 Ga0075435_100242611 3300007076 Bacteria 1533
465 Ga0075435_100300747 3300007076 Bacteria 1372
466 Ga0075435_100488791 3300007076 Bacteria 1064
467 Ga0075435_100747103 3300007076 Bacteria 851
468 Ga0075435_101963034 3300007076 Bacteria 514
469 Ga0099794_10049726 3300007265 Bacteria 2016
470 Ga0099794_10197181 3300007265 Bacteria 1031
471 Ga0099794_10297416 3300007265 Unclassified 836
472 Ga0099795_10020338 3300007788 Bacteria 2160
473 Ga0099795_10424156 3300007788 Bacteria 608
474 Ga0105251_10107526 3300009011 Bacteria 1272
475 Ga0105251_10293874 3300009011 Bacteria 736
476 Ga0105244_10011650 3300009036 Bacteria 5253
477 Ga0105240_10127569 3300009093 Bacteria 3055
478 Ga0105240_10732476 3300009093 Bacteria 1076
479 Ga0111539_10000022 3300009094 Bacteria 240838
480 Ga0111539_10058961 3300009094 Bacteria 4554
481 Ga0111539_10199861 3300009094 Bacteria 2331
482 Ga0111539_10349380 3300009094 Bacteria 1721
483 Ga0111539_10923746 3300009094 Bacteria 1015
484 Ga0111539_10934786 3300009094 Bacteria 1008
485 Ga0111539_11120732 3300009094 Bacteria 914
486 Ga0111539_12242981 3300009094 Bacteria 633
487 Ga0111539_12975874 3300009094 Bacteria 548
488 Ga0105245_10001507 3300009098 Bacteria 21079
489 Ga0105245_10368411 3300009098 Bacteria 1428
490 Ga0105245_11361665 3300009098 Bacteria 759
491 Ga0105245_11449824 3300009098 Bacteria 737
492 Ga0105247_10151259 3300009101 Bacteria 1529
493 Ga0105247_10271221 3300009101 Bacteria 1167
494 Ga0114129_10000247 3300009147 Bacteria 60820
495 Ga0114129_10001417 3300009147 Bacteria 32326
496 Ga0114129_10002852 3300009147 Bacteria 24170
497 Ga0114129_10046019 3300009147 Bacteria 6133
498 Ga0114129_10063914 3300009147 Bacteria 5136
499 Ga0114129_10177970 3300009147 Bacteria 2896
500 Ga0114129_10439907 3300009147 Bacteria 1712
501 Ga0114129_10521343 3300009147 Bacteria 1549
502 Ga0114129_10525620 3300009147 Bacteria 1542
503 Ga0114129_10715113 3300009147 Bacteria 1286
504 Ga0114129_11090486 3300009147 Bacteria 1000
505 Ga0114129_11460040 3300009147 Bacteria 842
506 Ga0114129_11718743 3300009147 Bacteria 765
507 Ga0105243_10000009 3300009148 Bacteria 354419
508 Ga0105243_11007106 3300009148 Bacteria 836
509 Ga0105241_10080778 3300009174 Bacteria 2545
510 Ga0105241_11962224 3300009174 Bacteria 575
511 Ga0105242_10012536 3300009176 Bacteria 6525
512 Ga0105242_10080321 3300009176 Bacteria 2725
513 Ga0105242_10713146 3300009176 Bacteria 983
514 Ga0105242_10748162 3300009176 Bacteria 962
515 Ga0105242_12012325 3300009176 Bacteria 620
516 Ga0105248_10008944 3300009177 Bacteria 11015
517 Ga0105248_10223859 3300009177 Bacteria 2118
518 Ga0105248_10574996 3300009177 Bacteria 1271
519 Ga0105248_10689478 3300009177 Bacteria 1152
520 Ga0105248_10960038 3300009177 Bacteria 965
521 Ga0105248_11517177 3300009177 Bacteria 759
522 Ga0105248_12580991 3300009177 Bacteria 579
523 Ga0105248_12890409 3300009177 Bacteria 548
524 Ga0105248_13041606 3300009177 Bacteria 534
525 Ga0105237_10066336 3300009545 Bacteria 3604
526 Ga0105237_11477833 3300009545 Bacteria 686
527 Ga0105238_10000002 3300009551 Bacteria 772711
528 Ga0105238_10145814 3300009551 Bacteria 2344
529 Ga0105238_10456576 3300009551 Bacteria 1275
530 Ga0105238_11023362 3300009551 Bacteria 847
531 Ga0105249_10026603 3300009553 Bacteria 5216
532 Ga0105249_10725262 3300009553 Bacteria 1055
533 Ga0105249_11281389 3300009553 Unclassified 804
534 Ga0105249_11793297 3300009553 Bacteria 686
535 Ga0105249_12996498 3300009553 Bacteria 542
536 Ga0099796_10090524 3300010159 Bacteria 1137
537 Ga0099796_10554021 3300010159 Bacteria 517
538 Ga0105239_11699799 3300010375 Bacteria 730
539 Ga0105239_12145162 3300010375 Bacteria 649
540 Ga0105239_12558569 3300010375 Bacteria 595
541 Ga0105239_13315569 3300010375 Bacteria 524
542 Ga0105246_10235421 3300011119 Bacteria 1444
543 Ga0157347_1066412 3300012502 Bacteria 525
544 Ga0157373_10325377 3300013100 Bacteria 1094
545 Ga0157373_10638818 3300013100 Bacteria 777
546 Ga0157369_10001943 3300013105 Bacteria 24887
547 Ga0157369_10100872 3300013105 Bacteria 3077
548 Ga0157369_11203607 3300013105 Bacteria 773
549 Ga0157374_10000005 3300013296 Bacteria 646767
550 Ga0157374_10002664 3300013296 Bacteria 15039
551 Ga0157374_10039567 3300013296 Bacteria 4339
552 Ga0157374_10508101 3300013296 Bacteria 1210
553 Ga0157378_10012246 3300013297 Bacteria 7510
554 Ga0157378_10096295 3300013297 Bacteria 2697
555 Ga0157378_10105819 3300013297 Bacteria 2573
556 Ga0157378_10108940 3300013297 Bacteria 2537
557 Ga0157378_10227763 3300013297 Bacteria 1774
558 Ga0157378_10300065 3300013297 Bacteria 1555
559 Ga0157378_10325710 3300013297 Bacteria 1494
560 Ga0157378_11002773 3300013297 Bacteria 869
561 Ga0157378_12184179 3300013297 Bacteria 605
562 Ga0163162_10093242 3300013306 Bacteria 3096
563 Ga0163162_10212271 3300013306 Bacteria 2066
564 Ga0163162_10429766 3300013306 Bacteria 1453
565 Ga0157372_11136133 3300013307 Bacteria 903
566 Ga0157375_10012356 3300013308 Bacteria 7571
567 Ga0157375_10021527 3300013308 Bacteria 5914
568 Ga0157375_10064497 3300013308 Bacteria 3647
569 Ga0157375_10071083 3300013308 Bacteria 3492
570 Ga0157375_10237799 3300013308 Bacteria 1981
571 Ga0157375_10379526 3300013308 Bacteria 1580
572 Ga0157375_10536984 3300013308 Bacteria 1332
573 Ga0157375_10749389 3300013308 Bacteria 1128
574 Ga0157375_10928052 3300013308 Bacteria 1013
575 Ga0157375_11218204 3300013308 Bacteria 883
576 Ga0157375_12260814 3300013308 Bacteria 648
577 Ga0163163_10036365 3300014325 Bacteria 4782
578 Ga0163163_10053167 3300014325 Bacteria 3997
579 Ga0163163_10054913 3300014325 Bacteria 3936
580 Ga0163163_10139935 3300014325 Bacteria 2462
581 Ga0163163_10271121 3300014325 Bacteria 1748
582 Ga0163163_10313241 3300014325 Bacteria 1623
583 Ga0163163_10365909 3300014325 Bacteria 1499
584 Ga0163163_10723073 3300014325 Bacteria 1059
585 Ga0163163_10728194 3300014325 Bacteria 1055
586 Ga0163163_10844320 3300014325 Bacteria 979
587 Ga0163163_10928670 3300014325 Bacteria 933
588 Ga0163163_11145053 3300014325 Bacteria 841
589 Ga0157380_10001355 3300014326 Bacteria 15948
590 Ga0157380_10205467 3300014326 Bacteria 1751
591 Ga0157380_10688406 3300014326 Bacteria 1025
592 Ga0157380_12863327 3300014326 Bacteria 549
593 Ga0157380_13133087 3300014326 Bacteria 528
594 Ga0182008_10834581 3300014497 Bacteria 537
595 Ga0157377_10000001 3300014745 Bacteria 623098
596 Ga0157377_10000414 3300014745 Bacteria 18520
597 Ga0157377_10046193 3300014745 Bacteria 2434
598 Ga0157377_10191602 3300014745 Bacteria 1292
599 Ga0157377_10565156 3300014745 Bacteria 806
600 Ga0157379_10000714 3300014968 Bacteria 26943
601 Ga0157379_10138032 3300014968 Bacteria 2197
602 Ga0157379_10307620 3300014968 Bacteria 1445
603 Ga0157379_10533826 3300014968 Bacteria 1090
604 Ga0157379_10549618 3300014968 Bacteria 1074
605 Ga0157379_11303935 3300014968 Bacteria 701
606 Ga0157379_11498675 3300014968 Bacteria 656
607 Ga0157376_10000003 3300014969 Bacteria 568634
608 Ga0157376_10046438 3300014969 Bacteria 3581
609 Ga0157376_10654389 3300014969 Bacteria 1051
610 Ga0157376_10676509 3300014969 Bacteria 1035
611 Ga0157376_11115777 3300014969 Bacteria 815
612 Ga0157376_11341442 3300014969 Bacteria 746
613 Ga0157376_11493894 3300014969 Bacteria 708
614 Ga0157376_11763036 3300014969 Bacteria 655
615 Ga0182007_10306095 3300015262 Bacteria 585
616 Ga0163161_10063568 3300017792 Bacteria 2691
617 Ga0206356_11765259 3300020070 Bacteria 1730
618 Ga0206352_10878108 3300020078 Bacteria 2719
619 Ga0213873_10000018 3300021358 Bacteria 123140
620 Ga0213873_10000553 3300021358 Bacteria 6058
621 Ga0213876_10000009 3300021384 Bacteria 496136
622 Ga0213876_10000058 3300021384 Bacteria 134080
623 Ga0207666_1001625 3300025271 Bacteria 2664
624 Ga0207697_10009073 3300025315 Bacteria 4310
625 Ga0207697_10068448 3300025315 Bacteria 1485
626 Ga0207655_1019809 3300025728 Bacteria 3494
627 Ga0207653_10128253 3300025885 Unclassified 919
628 Ga0207682_10001734 3300025893 Bacteria 10002
629 Ga0207682_10143047 3300025893 Bacteria 1074
630 Ga0207692_10077477 3300025898 Bacteria 1769
631 Ga0207692_10915755 3300025898 Bacteria 577
632 Ga0207642_10101044 3300025899 Bacteria 1448
633 Ga0207710_10203240 3300025900 Bacteria 979
634 Ga0207710_10504380 3300025900 Bacteria 628
635 Ga0207688_10006667 3300025901 Bacteria 6282
636 Ga0207680_10003484 3300025903 Bacteria 7410
637 Ga0207680_10007364 3300025903 Bacteria 5358
638 Ga0207680_10033943 3300025903 Bacteria 2915
639 Ga0207680_10152895 3300025903 Bacteria 1540
640 Ga0207680_10374993 3300025903 Bacteria 1002
641 Ga0207680_10472711 3300025903 Bacteria 891
642 Ga0207680_10571957 3300025903 Bacteria 807
643 Ga0207680_10793122 3300025903 Bacteria 679
644 Ga0207647_10068009 3300025904 Bacteria 2157
645 Ga0207647_10118635 3300025904 Bacteria 1561
646 Ga0207647_10422104 3300025904 Bacteria 750
647 Ga0207685_10194185 3300025905 Bacteria 949
648 Ga0207685_10353728 3300025905 Unclassified 741
649 Ga0207685_10353837 3300025905 Bacteria 741
650 Ga0207685_10811008 3300025905 Bacteria 516
651 Ga0207699_10068910 3300025906 Bacteria 2155
652 Ga0207699_10096815 3300025906 Bacteria 1864
653 Ga0207699_10205798 3300025906 Bacteria 1336
654 Ga0207699_10276684 3300025906 Bacteria 1165
655 Ga0207699_10423402 3300025906 Bacteria 951
656 Ga0207645_10006128 3300025907 Bacteria 8639
657 Ga0207645_10021058 3300025907 Bacteria 4257
658 Ga0207645_10123441 3300025907 Bacteria 1682
659 Ga0207643_10001235 3300025908 Bacteria 15094
660 Ga0207643_10017199 3300025908 Bacteria 3950
661 Ga0207643_10081943 3300025908 Bacteria 1870
662 Ga0207643_10206890 3300025908 Bacteria 1197
663 Ga0207684_10011604 3300025910 Bacteria 7699
664 Ga0207684_10035936 3300025910 Unclassified 4205
665 Ga0207684_10043926 3300025910 Bacteria 3789
666 Ga0207684_10072862 3300025910 Bacteria 2917
667 Ga0207684_10134177 3300025910 Bacteria 2125
668 Ga0207684_10141204 3300025910 Bacteria 2070
669 Ga0207684_10190569 3300025910 Bacteria 1769
670 Ga0207684_10238580 3300025910 Bacteria 1568
671 Ga0207684_10544790 3300025910 Unclassified 993
672 Ga0207684_11008326 3300025910 Bacteria 696
673 Ga0207654_10623314 3300025911 Bacteria 771
674 Ga0207707_10070280 3300025912 Bacteria 3051
675 Ga0207707_10317843 3300025912 Bacteria 1345
676 Ga0207707_10899627 3300025912 Unclassified 732
677 Ga0207695_10091115 3300025913 Bacteria 3063
678 Ga0207695_10433346 3300025913 Bacteria 1198
679 Ga0207693_10090246 3300025915 Bacteria 2402
680 Ga0207693_10218115 3300025915 Bacteria 1499
681 Ga0207693_10299968 3300025915 Bacteria 1259
682 Ga0207693_10378669 3300025915 Bacteria 1107
683 Ga0207693_11170599 3300025915 Bacteria 581
684 Ga0207663_10052095 3300025916 Bacteria 2552
685 Ga0207663_10173978 3300025916 Bacteria 1532
686 Ga0207663_10383107 3300025916 Bacteria 1072
687 Ga0207660_10774686 3300025917 Bacteria 783
688 Ga0207660_11262676 3300025917 Bacteria 600
689 Ga0207662_10059669 3300025918 Bacteria 2287
690 Ga0207662_10068221 3300025918 Bacteria 2147
691 Ga0207662_10086791 3300025918 Bacteria 1918
692 Ga0207662_10136184 3300025918 Bacteria 1552
693 Ga0207662_10153364 3300025918 Bacteria 1467
694 Ga0207662_11017249 3300025918 Bacteria 589
695 Ga0207657_10064105 3300025919 Bacteria 3138
696 Ga0207657_10489885 3300025919 Bacteria 963
697 Ga0207657_10604040 3300025919 Bacteria 856
698 Ga0207657_10653070 3300025919 Bacteria 819
699 Ga0207649_10268711 3300025920 Bacteria 1235
700 Ga0207649_10724585 3300025920 Bacteria 772
701 Ga0207652_10293903 3300025921 Bacteria 1466
702 Ga0207646_10000343 3300025922 Bacteria 62896
703 Ga0207646_10080346 3300025922 Bacteria 2915
704 Ga0207646_10140516 3300025922 Bacteria 2175
705 Ga0207646_10147358 3300025922 Bacteria 2121
706 Ga0207646_10207606 3300025922 Bacteria 1769
707 Ga0207646_10215582 3300025922 Bacteria 1734
708 Ga0207646_10333027 3300025922 Bacteria 1371
709 Ga0207646_10581853 3300025922 Bacteria 1005
710 Ga0207646_10586794 3300025922 Bacteria 1001
711 Ga0207646_10821657 3300025922 Bacteria 827
712 Ga0207646_11430375 3300025922 Bacteria 601
713 Ga0207681_10002742 3300025923 Bacteria 11146
714 Ga0207681_10152701 3300025923 Bacteria 1732
715 Ga0207681_10287031 3300025923 Bacteria 1297
716 Ga0207681_10767289 3300025923 Bacteria 804
717 Ga0207681_11437631 3300025923 Bacteria 579
718 Ga0207694_10000001 3300025924 Bacteria 4078485
719 Ga0207694_10176365 3300025924 Bacteria 1732
720 Ga0207650_10000082 3300025925 Bacteria 128722
721 Ga0207650_10011593 3300025925 Bacteria 6071
722 Ga0207650_10048909 3300025925 Bacteria 3120
723 Ga0207650_10116501 3300025925 Bacteria 2075
724 Ga0207650_10302623 3300025925 Bacteria 1306
725 Ga0207650_10768909 3300025925 Bacteria 815
726 Ga0207659_10000036 3300025926 Bacteria 103327
727 Ga0207659_10115953 3300025926 Bacteria 2044
728 Ga0207659_10120504 3300025926 Bacteria 2010
729 Ga0207659_10287415 3300025926 Bacteria 1346
730 Ga0207659_10329048 3300025926 Bacteria 1263
731 Ga0207659_10403812 3300025926 Bacteria 1143
732 Ga0207659_10669329 3300025926 Bacteria 888
733 Ga0207659_10779324 3300025926 Bacteria 821
734 Ga0207687_10000005 3300025927 Bacteria 770649
735 Ga0207687_10607398 3300025927 Bacteria 922
736 Ga0207687_11309652 3300025927 Bacteria 623
737 Ga0207687_11549680 3300025927 Bacteria 569
738 Ga0207700_10051399 3300025928 Bacteria 3076
739 Ga0207700_10089784 3300025928 Bacteria 2423
740 Ga0207700_10098343 3300025928 Bacteria 2328
741 Ga0207700_10801507 3300025928 Bacteria 842
742 Ga0207700_10945405 3300025928 Bacteria 771
743 Ga0207644_10055836 3300025931 Bacteria 2848
744 Ga0207644_10259586 3300025931 Bacteria 1389
745 Ga0207644_11465725 3300025931 Bacteria 573
746 Ga0207690_10025055 3300025932 Bacteria 3742
747 Ga0207690_10136438 3300025932 Bacteria 1802
748 Ga0207706_10013582 3300025933 Bacteria 7398
749 Ga0207706_10073033 3300025933 Bacteria 3016
750 Ga0207706_10091565 3300025933 Bacteria 2673
751 Ga0207706_10105904 3300025933 Bacteria 2474
752 Ga0207706_10433223 3300025933 Bacteria 1139
753 Ga0207706_10588375 3300025933 Bacteria 957
754 Ga0207706_10954501 3300025933 Bacteria 722
755 Ga0207686_10001508 3300025934 Bacteria 13115
756 Ga0207686_10217571 3300025934 Bacteria 1377
757 Ga0207709_10000026 3300025935 Bacteria 354467
758 Ga0207709_10210974 3300025935 Bacteria 1394
759 Ga0207709_11215995 3300025935 Bacteria 621
760 Ga0207670_10070690 3300025936 Bacteria 2412
761 Ga0207670_10136374 3300025936 Bacteria 1804
762 Ga0207670_10148699 3300025936 Bacteria 1735
763 Ga0207670_10150696 3300025936 Bacteria 1725
764 Ga0207670_10309877 3300025936 Bacteria 1239
765 Ga0207670_10474085 3300025936 Bacteria 1013
766 Ga0207670_10531204 3300025936 Bacteria 959
767 Ga0207670_10555149 3300025936 Bacteria 939
768 Ga0207670_10850257 3300025936 Bacteria 762
769 Ga0207670_11671863 3300025936 Bacteria 541
770 Ga0207669_10100540 3300025937 Bacteria 1910
771 Ga0207669_10323551 3300025937 Bacteria 1181
772 Ga0207669_10468953 3300025937 Bacteria 1001
773 Ga0207669_10705697 3300025937 Bacteria 829
774 Ga0207669_11881879 3300025937 Bacteria 511
775 Ga0207704_10003857 3300025938 Bacteria 6810
776 Ga0207704_10029913 3300025938 Bacteria 3046
777 Ga0207704_10765814 3300025938 Bacteria 804
778 Ga0207704_11810931 3300025938 Bacteria 525
779 Ga0207665_10006268 3300025939 Bacteria 7894
780 Ga0207665_10009968 3300025939 Bacteria 6235
781 Ga0207665_10018501 3300025939 Bacteria 4577
782 Ga0207665_10026836 3300025939 Bacteria 3803
783 Ga0207665_10251041 3300025939 Bacteria 1307
784 Ga0207665_10305436 3300025939 Bacteria 1190
785 Ga0207665_10457139 3300025939 Bacteria 981
786 Ga0207665_10496467 3300025939 Bacteria 942
787 Ga0207665_10548002 3300025939 Bacteria 898
788 Ga0207665_10864190 3300025939 Unclassified 716
789 Ga0207691_10000326 3300025940 Bacteria 47354
790 Ga0207691_10002644 3300025940 Bacteria 17504
791 Ga0207691_10006947 3300025940 Bacteria 10917
792 Ga0207691_10133717 3300025940 Bacteria 2189
793 Ga0207691_10204635 3300025940 Bacteria 1717
794 Ga0207691_10289454 3300025940 Bacteria 1409
795 Ga0207691_10727844 3300025940 Bacteria 836
796 Ga0207691_11018557 3300025940 Bacteria 691
797 Ga0207711_10007454 3300025941 Bacteria 9155
798 Ga0207711_10197035 3300025941 Bacteria 1837
799 Ga0207711_10389374 3300025941 Bacteria 1294
800 Ga0207711_11458974 3300025941 Bacteria 627
801 Ga0207711_11985335 3300025941 Bacteria 525
802 Ga0207689_10009254 3300025942 Bacteria 8519
803 Ga0207689_10009503 3300025942 Bacteria 8397
804 Ga0207689_10020085 3300025942 Bacteria 5624
805 Ga0207689_10065221 3300025942 Bacteria 2996
806 Ga0207689_10140200 3300025942 Bacteria 1992
807 Ga0207689_10340280 3300025942 Bacteria 1246
808 Ga0207689_10446792 3300025942 Bacteria 1080
809 Ga0207689_11199927 3300025942 Bacteria 639
810 Ga0207689_11416054 3300025942 Bacteria 582
811 Ga0207661_10000006 3300025944 Bacteria 537727
812 Ga0207661_10007008 3300025944 Bacteria 7997
813 Ga0207661_10082186 3300025944 Bacteria 2663
814 Ga0207679_10071083 3300025945 Bacteria 2624
815 Ga0207679_10482510 3300025945 Bacteria 1104
816 Ga0207679_10566129 3300025945 Bacteria 1021
817 Ga0207679_10716020 3300025945 Bacteria 909
818 Ga0207679_11403420 3300025945 Bacteria 641
819 Ga0207679_11573638 3300025945 Bacteria 602
820 Ga0207667_10003431 3300025949 Bacteria 19566
821 Ga0207667_10023566 3300025949 Bacteria 6777
822 Ga0207651_10006583 3300025960 Bacteria 6102
823 Ga0207651_10007125 3300025960 Bacteria 5937
824 Ga0207651_10064605 3300025960 Bacteria 2562
825 Ga0207651_10099429 3300025960 Bacteria 2154
826 Ga0207651_10742043 3300025960 Bacteria 867
827 Ga0207651_10855995 3300025960 Bacteria 808
828 Ga0207651_11107468 3300025960 Bacteria 710
829 Ga0207712_10290886 3300025961 Bacteria 1337
830 Ga0207712_10624678 3300025961 Unclassified 934
831 Ga0207712_10782455 3300025961 Bacteria 838
832 Ga0207712_10943791 3300025961 Bacteria 764
833 Ga0207668_10018999 3300025972 Bacteria 4334
834 Ga0207668_10554333 3300025972 Bacteria 996
835 Ga0207640_10107477 3300025981 Bacteria 1970
836 Ga0207640_10305543 3300025981 Bacteria 1260
837 Ga0207640_10989329 3300025981 Bacteria 739
838 Ga0207658_10001637 3300025986 Bacteria 17158
839 Ga0207658_10055938 3300025986 Bacteria 2926
840 Ga0207658_10351037 3300025986 Bacteria 1284
841 Ga0207677_10000101 3300026023 Bacteria 70739
842 Ga0207677_10218669 3300026023 Bacteria 1526
843 Ga0207677_10291313 3300026023 Bacteria 1345
844 Ga0207677_11090546 3300026023 Bacteria 727
845 Ga0207677_11423989 3300026023 Unclassified 639
846 Ga0207677_11805638 3300026023 Bacteria 568
847 Ga0207703_10007604 3300026035 Bacteria 8591
848 Ga0207703_10316451 3300026035 Bacteria 1428
849 Ga0207703_10392236 3300026035 Bacteria 1286
850 Ga0207703_10410089 3300026035 Bacteria 1259
851 Ga0207703_11039613 3300026035 Bacteria 786
852 Ga0207703_11467887 3300026035 Bacteria 656
853 Ga0207703_11536237 3300026035 Bacteria 641
854 Ga0207639_10000013 3300026041 Bacteria 293084
855 Ga0207639_10189920 3300026041 Bacteria 1754
856 Ga0207639_10492689 3300026041 Bacteria 1118
857 Ga0207678_10049059 3300026067 Bacteria 3648
858 Ga0207678_10190888 3300026067 Bacteria 1751
859 Ga0207678_10222677 3300026067 Bacteria 1615
860 Ga0207678_10759286 3300026067 Bacteria 855
861 Ga0207678_11932014 3300026067 Bacteria 514
862 Ga0207708_10000041 3300026075 Bacteria 126142
863 Ga0207708_10011108 3300026075 Bacteria 6697
864 Ga0207708_10012451 3300026075 Bacteria 6340
865 Ga0207708_10906223 3300026075 Bacteria 763
866 Ga0207702_10001471 3300026078 Bacteria 23360
867 Ga0207702_10011175 3300026078 Bacteria 7488
868 Ga0207702_10182964 3300026078 Bacteria 1931
869 Ga0207702_10332278 3300026078 Bacteria 1450
870 Ga0207702_10808274 3300026078 Bacteria 927
871 Ga0207702_10819429 3300026078 Bacteria 920
872 Ga0207702_11743255 3300026078 Bacteria 615
873 Ga0207641_10037244 3300026088 Bacteria 4061
874 Ga0207641_10048111 3300026088 Bacteria 3598
875 Ga0207641_10137639 3300026088 Bacteria 2199
876 Ga0207641_10147519 3300026088 Bacteria 2128
877 Ga0207641_10465979 3300026088 Bacteria 1223
878 Ga0207641_10611981 3300026088 Bacteria 1067
879 Ga0207641_10648581 3300026088 Bacteria 1037
880 Ga0207641_10688216 3300026088 Bacteria 1006
881 Ga0207648_10011154 3300026089 Bacteria 8479
882 Ga0207648_10024555 3300026089 Bacteria 5379
883 Ga0207648_10035580 3300026089 Bacteria 4388
884 Ga0207648_10043194 3300026089 Bacteria 3957
885 Ga0207648_10307115 3300026089 Bacteria 1423
886 Ga0207648_10359341 3300026089 Bacteria 1314
887 Ga0207676_10098517 3300026095 Bacteria 2417
888 Ga0207676_10177426 3300026095 Bacteria 1862
889 Ga0207676_10214264 3300026095 Bacteria 1711
890 Ga0207676_10500738 3300026095 Bacteria 1153
891 Ga0207676_10736336 3300026095 Bacteria 958
892 Ga0207674_11570213 3300026116 Bacteria 627
893 Ga0207674_11773476 3300026116 Bacteria 585
894 Ga0207675_100002645 3300026118 Bacteria 17685
895 Ga0207675_100002673 3300026118 Bacteria 17594
896 Ga0207675_100013850 3300026118 Bacteria 7520
897 Ga0207675_100060186 3300026118 Bacteria 3545
898 Ga0207675_100109886 3300026118 Bacteria 2602
899 Ga0207675_100361315 3300026118 Bacteria 1424
900 Ga0207675_101074241 3300026118 Bacteria 824
901 Ga0207683_10005107 3300026121 Bacteria 11263
902 Ga0207683_10317284 3300026121 Bacteria 1427
903 Ga0207683_10512688 3300026121 Bacteria 1108
904 Ga0207698_10043801 3300026142 Bacteria 3356
905 Ga0207698_10208854 3300026142 Bacteria 1755
906 Ga0207698_10703309 3300026142 Bacteria 1006
907 Ga0207698_12121934 3300026142 Bacteria 575
908 Ga0209969_1040868 3300027360 Bacteria 720
909 Ga0209981_1011093 3300027378 Bacteria 1241
910 Ga0209996_1014048 3300027395 Bacteria 1087
911 Ga0209179_1027708 3300027512 Bacteria 1144
912 Ga0209968_1002058 3300027526 Bacteria 3059
913 Ga0209982_1007080 3300027552 Bacteria 1638
914 Ga0210002_1020599 3300027617 Bacteria 1062
915 Ga0209983_1000280 3300027665 Bacteria 10618
916 Ga0209588_1025351 3300027671 Bacteria 1876
917 Ga0209588_1032623 3300027671 Bacteria 1669
918 Ga0209588_1218255 3300027671 Bacteria 590
919 Ga0209971_1000384 3300027682 Bacteria 12081
920 Ga0209966_1133005 3300027695 Bacteria 575
921 Ga0209998_10002827 3300027717 Bacteria 3904
922 Ga0209974_10004420 3300027876 Bacteria 5002
923 Ga0209974_10128164 3300027876 Bacteria 903
924 Ga0209974_10197531 3300027876 Bacteria 742
925 Ga0207428_10000030 3300027907 Bacteria 240846
926 Ga0207428_10017611 3300027907 Bacteria 6126
927 Ga0207428_10042290 3300027907 Bacteria 3684
928 Ga0207428_10380583 3300027907 Bacteria 1035
929 Ga0207428_11037160 3300027907 Bacteria 575
930 Ga0207428_11047024 3300027907 Bacteria 572
931 Ga0268266_10000259 3300028379 Bacteria 88660
932 Ga0268266_10015961 3300028379 Bacteria 6425
933 Ga0268266_10047157 3300028379 Bacteria 3690
934 Ga0268266_10309020 3300028379 Bacteria 1477
935 Ga0268265_10009861 3300028380 Bacteria 6450
936 Ga0268265_10034866 3300028380 Bacteria 3671
937 Ga0268265_10037170 3300028380 Bacteria 3572
938 Ga0268265_10045924 3300028380 Bacteria 3262
939 Ga0268265_10220454 3300028380 Bacteria 1659
940 Ga0268265_10485770 3300028380 Bacteria 1161
941 Ga0268265_10490222 3300028380 Bacteria 1156
942 Ga0268265_10490646 3300028380 Bacteria 1156
943 Ga0268265_11237145 3300028380 Bacteria 745
944 Ga0268265_11331701 3300028380 Bacteria 719
945 Ga0268264_10005977 3300028381 Bacteria 10304
946 Ga0268264_10044863 3300028381 Bacteria 3669
947 Ga0268264_10049767 3300028381 Bacteria 3488
948 Ga0268264_10136493 3300028381 Bacteria 2181
949 Ga0268264_10144015 3300028381 Bacteria 2128
950 Ga0268264_10197367 3300028381 Bacteria 1838
951 Ga0268264_10209665 3300028381 Bacteria 1788
952 Ga0268264_10259334 3300028381 Bacteria 1618
953 Ga0268264_10362378 3300028381 Bacteria 1383
954 Ga0268264_10497856 3300028381 Bacteria 1188
955 Ga0268264_11076106 3300028381 Bacteria 812
956 Ga0268264_11085509 3300028381 Bacteria 809
957 Ga0265319_1044281 3300028563 Bacteria 1492
958 Ga0265319_1060122 3300028563 Bacteria 1234
959 Ga0265334_10078109 3300028573 Bacteria 1223
960 Ga0265323_10004178 3300028653 Bacteria 6252
961 Ga0265323_10067614 3300028653 Bacteria 1228
962 Ga0265338_10016967 3300028800 Bacteria 7878
963 Ga0265338_10128873 3300028800 Bacteria 2002
964 Ga0265338_10345344 3300028800 Bacteria 1071
965 Ga0265338_10642953 3300028800 Bacteria 736
966 Ga0265338_11184375 3300028800 Unclassified 513
967 Ga0307511_10002513 3300030521 Bacteria 19146
968 Ga0307511_10231185 3300030521 Unclassified 915
969 Ga0265767_110710 3300030836 Bacteria 616
970 Ga0265767_112437 3300030836 Bacteria 588
971 Ga0265764_113392 3300030882 Bacteria 547
972 Ga0265330_10000541 3300031235 Bacteria 24732
973 Ga0265330_10001334 3300031235 Bacteria 14415
974 Ga0265330_10003060 3300031235 Bacteria 8862
975 Ga0265330_10375265 3300031235 Bacteria 601
976 Ga0265332_10064443 3300031238 Bacteria 1565
977 Ga0265332_10155677 3300031238 Bacteria 955
978 Ga0265328_10051354 3300031239 Bacteria 1514
979 Ga0265320_10307898 3300031240 Bacteria 700
980 Ga0265329_10003473 3300031242 Bacteria 6856
981 Ga0265329_10015790 3300031242 Bacteria 2630
982 Ga0265329_10034598 3300031242 Bacteria 1632
983 Ga0265340_10015118 3300031247 Bacteria 4016
984 Ga0265339_10055328 3300031249 Bacteria 2153
985 Ga0265339_10075819 3300031249 Bacteria 1785
986 Ga0265339_10240841 3300031249 Bacteria 878
987 Ga0265331_10073224 3300031250 Bacteria 1600
988 Ga0265331_10233136 3300031250 Bacteria 827
989 Ga0265316_10000251 3300031344 Bacteria 61672
990 Ga0265316_10000984 3300031344 Bacteria 30933
991 Ga0265316_10014237 3300031344 Bacteria 7014
992 Ga0265316_10018769 3300031344 Bacteria 5936
993 Ga0265316_10028493 3300031344 Bacteria 4607
994 Ga0265316_10048657 3300031344 Unclassified 3345
995 Ga0265316_10169982 3300031344 Bacteria 1626
996 Ga0265316_10388436 3300031344 Bacteria 1006
997 Ga0307408_100164966 3300031548 Bacteria 1763
998 Ga0307408_100236106 3300031548 Unclassified 1500
999 Ga0307408_102138195 3300031548 Bacteria 540
1000 Ga0265313_10122813 3300031595 Bacteria 1131
1001 Ga0307508_10050191 3300031616 Bacteria 3713
1002 Ga0316575_10002995 3300031665 Bacteria 5756
1003 Ga0316575_10014672 3300031665 Bacteria 2945
1004 Ga0316575_10021116 3300031665 Bacteria 2503
1005 Ga0316579_10070932 3300031691 Bacteria 1651
1006 Ga0316579_10157791 3300031691 Bacteria 1096
1007 Ga0265314_10023438 3300031711 Bacteria 4706
1008 Ga0265314_10114121 3300031711 Bacteria 1712
1009 Ga0265342_10008085 3300031712 Bacteria 7603
1010 Ga0265342_10036131 3300031712 Bacteria 3019
1011 Ga0265342_10039697 3300031712 Bacteria 2858
1012 Ga0265342_10085382 3300031712 Bacteria 1817
1013 Ga0265342_10176966 3300031712 Bacteria 1170
1014 Ga0316576_10012802 3300031727 Bacteria 5552
1015 Ga0316576_10031380 3300031727 Bacteria 3770
1016 Ga0316576_10072783 3300031727 Bacteria 2538
1017 Ga0316576_10254444 3300031727 Bacteria 1318
1018 Ga0316576_10343935 3300031727 Bacteria 1110
1019 Ga0316576_10358298 3300031727 Bacteria 1085
1020 Ga0316578_10148460 3300031728 Bacteria 1412
1021 Ga0307516_10003404 3300031730 Bacteria 20479
1022 Ga0307405_10139666 3300031731 Bacteria 1687
1023 Ga0307405_10724904 3300031731 Bacteria 826
1024 Ga0316577_10006446 3300031733 Bacteria 6198
1025 Ga0316577_10035166 3300031733 Bacteria 2800
1026 Ga0316577_10160530 3300031733 Bacteria 1268
1027 Ga0316577_10429752 3300031733 Bacteria 750
1028 Ga0307413_10005834 3300031824 Bacteria 5550
1029 Ga0307413_10371109 3300031824 Bacteria 1111
1030 Ga0307410_10001864 3300031852 Bacteria 9833
1031 Ga0307410_10034138 3300031852 Bacteria 3291
1032 Ga0307410_10371816 3300031852 Bacteria 1148
1033 Ga0326468_10043698 3300031889 Bacteria 651
1034 Ga0307406_10235992 3300031901 Bacteria 1369
1035 Ga0307406_10787551 3300031901 Bacteria 801
1036 Ga0307406_12037644 3300031901 Bacteria 513
1037 Ga0307407_10033183 3300031903 Bacteria 2814
1038 Ga0307407_11490439 3300031903 Bacteria 535
1039 Ga0307412_10233228 3300031911 Bacteria 1419
1040 Ga0307412_10394963 3300031911 Bacteria 1124
1041 Ga0307412_11035527 3300031911 Bacteria 727
1042 Ga0307412_11463688 3300031911 Bacteria 620
1043 Ga0307409_100002915 3300031995 Bacteria 9086
1044 Ga0307409_100048335 3300031995 Bacteria 3236
1045 Ga0307409_100109897 3300031995 Bacteria 2309
1046 Ga0307409_100625568 3300031995 Bacteria 1067
1047 Ga0307409_101589606 3300031995 Bacteria 682
1048 Ga0307409_102225915 3300031995 Bacteria 578
1049 Ga0307416_100018585 3300032002 Bacteria 4902
1050 Ga0307416_100039410 3300032002 Bacteria 3658
1051 Ga0307416_100496117 3300032002 Bacteria 1284
1052 Ga0307416_100807659 3300032002 Bacteria 1034
1053 Ga0307416_101190947 3300032002 Bacteria 867
1054 Ga0307416_101215820 3300032002 Bacteria 859
1055 Ga0307416_101970819 3300032002 Bacteria 687
1056 Ga0307414_10005193 3300032004 Bacteria 7147
1057 Ga0307414_10007281 3300032004 Bacteria 6215
1058 Ga0307414_10028964 3300032004 Bacteria 3599
1059 Ga0307414_10042491 3300032004 Bacteria 3089
1060 Ga0307411_10003742 3300032005 Bacteria 7136
1061 Ga0307411_10008827 3300032005 Bacteria 5250
1062 Ga0307411_11011757 3300032005 Bacteria 745
1063 Ga0307411_11232053 3300032005 Bacteria 679
1064 Ga0316053_117483 3300032120 Unclassified 545
1065 Ga0307415_100056689 3300032126 Bacteria 2688
1066 Ga0307415_100268612 3300032126 Bacteria 1396
1067 Ga0307415_101068181 3300032126 Bacteria 754
1068 Ga0307415_101167579 3300032126 Bacteria 724
1069 Ga0316593_10001783 3300032168 Bacteria 4897
1070 Ga0316593_10002618 3300032168 Bacteria 4311
1071 Ga0316593_10014252 3300032168 Bacteria 2367
1072 Ga0316593_10019333 3300032168 Bacteria 2104
1073 Ga0316593_10019508 3300032168 Bacteria 2096
1074 Ga0316593_10028372 3300032168 Bacteria 1804
1075 Ga0316593_10158812 3300032168 Bacteria 825
1076 Ga0316593_10316334 3300032168 Bacteria 593
1077 Ga0316593_10329705 3300032168 Unclassified 581
1078 Ga0316592_1024201 3300033524 Bacteria 1306
1079 Ga0316588_1007611 3300033528 Bacteria 2203
1080 Ga0316588_1018568 3300033528 Bacteria 1559
1081 Ga0316588_1040523 3300033528 Bacteria 1113
1082 Ga0316588_1051023 3300033528 Bacteria 1003
1083 Ga0316588_1067069 3300033528 Bacteria 879
1084 Ga0316588_1067880 3300033528 Bacteria 874
1085 Ga0316588_1088459 3300033528 Bacteria 771
1086 Ga0316588_1105398 3300033528 Bacteria 707
1087 Ga0316596_1000493 3300033541 Bacteria 6704
1088 Ga0316596_1070869 3300033541 Bacteria 933
1089 Ga0316596_1169994 3300033541 Bacteria 602
1090 Ga0373930_0030179 3300034816 Bacteria 1112
1091 Ga0373948_0130321 3300034817 Bacteria 615
1092 Ga0373948_0132447 3300034817 Bacteria 611
1093 Ga0373958_0009873 3300034819 Bacteria 1581
1094 Ga0373959_0134078 3300034820 Bacteria 615
1095 Ga0373938_0175085 3300034957 Bacteria 583
1096 Ga0373926_0001122 3300035083 Bacteria 7940
1097 Ga0373926_0009400 3300035083 Bacteria 3269
1098 Ga0373926_0258941 3300035083 Bacteria 675
1099 Ga0373929_0094499 3300035085 Bacteria 746
1100 Ga0373934_0104707 3300035086 Bacteria 1145
1101 Ga0373940_0187565 3300035088 Bacteria 675
1102 Ga0373944_0057907 3300035089 Bacteria 1236
1103 Ga0373944_0244742 3300035089 Bacteria 660
1104 Ga0373951_0113679 3300035091 Bacteria 731
1105 Ga0373952_0180221 3300035092 Bacteria 609
1106 Ga0373923_0053759 3300035111 Bacteria 1694
1107 Ga0373923_0090832 3300035111 Bacteria 1336
1108 Ga0373923_0385065 3300035111 Bacteria 673
1109 Ga0373923_0433015 3300035111 Bacteria 636
1110 Ga0373932_0274730 3300035112 Bacteria 622
1111 Ga0373936_0037210 3300035113 Bacteria 1943
1112 Ga0373936_0205470 3300035113 Bacteria 870
1113 Ga0373936_0418617 3300035113 Bacteria 617
1114 Ga0373939_0122999 3300035114 Bacteria 918
1115 Ga0373941_0115498 3300035115 Bacteria 951
1116 Ga0373941_0205636 3300035115 Bacteria 750
1117 Ga0373945_0018377 3300035116 Bacteria 2378
1118 Ga0373945_0062158 3300035116 Bacteria 1396
1119 Ga0373953_0002723 3300035117 Bacteria 5364
1120 Ga0373953_0086762 3300035117 Bacteria 1306
1121 Ga0373953_0118381 3300035117 Bacteria 1124
1122 Ga0373954_0014604 3300035118 Bacteria 3502
1123 Ga0373954_0156125 3300035118 Bacteria 1116
1124 Ga0373954_0163207 3300035118 Bacteria 1090
1125 Ga0373954_0522548 3300035118 Bacteria 588
1126 Ga0373956_0009506 3300035119 Bacteria 3958
1127 Ga0373956_0010739 3300035119 Bacteria 3760
1128 Ga0373956_0108665 3300035119 Bacteria 1290
1129 Ga0373957_0057958 3300035120 Bacteria 1495
1130 Ga0373957_0117503 3300035120 Bacteria 1075
1131 Ga0373957_0154822 3300035120 Bacteria 942
1132 Ga0373960_0231198 3300035121 Bacteria 665
1133 Ga0373943_0011073 3300035170 Bacteria 4051
1134 Ga0373943_0367741 3300035170 Bacteria 826
1135 Ga0373955_0013590 3300035172 Bacteria 3940
1136 Ga0373955_0037811 3300035172 Bacteria 2568
1137 Ga0373955_0058171 3300035172 Bacteria 2126
1138 Ga0373955_0109033 3300035172 Bacteria 1599
1139 Ga0373955_0327525 3300035172 Bacteria 926
1140 Ga0373955_0345873 3300035172 Bacteria 900
1141 Ga0373942_0347133 3300035207 Bacteria 524
1142 Ga0373961_0135251 3300035241 Bacteria 829
1143 Ga0373961_0146509 3300035241 Bacteria 801
1144 Ga0373961_0257992 3300035241 Bacteria 633
1145 Ga0316574_0001004 3300035398 Bacteria 12720
1146 Ga0316574_0022880 3300035398 Bacteria 3726
1147 Ga0316574_0047770 3300035398 Bacteria 2658
1148 Ga0316574_0109331 3300035398 Bacteria 1772
1149 Ga0316574_0140482 3300035398 Bacteria 1556
1150 Ga0316574_0143803 3300035398 Bacteria 1537
1151 Ga0316574_0161536 3300035398 Bacteria 1443
1152 Ga0316574_0833998 3300035398 Bacteria 560
1153 Ga0373924_0126646 3300035410 Bacteria 1110
1154 Ga0373931_0136727 3300035691 Bacteria 1415
1155 Ga0373931_0260324 3300035691 Unclassified 1058
1156 Ga0373931_0303750 3300035691 Bacteria 986
1157 Ga0373931_1274424 3300035691 Bacteria 505
1158 Ga0373935_0051065 3300035692 Bacteria 2625
1159 Ga0373935_0075929 3300035692 Bacteria 2175
1160 Ga0373927_0004438 3300035695 Bacteria 9831
1161 Ga0373927_0005589 3300035695 Bacteria 8642
1162 Ga0373927_0161417 3300035695 Bacteria 1468
1163 Ga0373927_0625416 3300035695 Bacteria 712
1164 Ga0373927_1096771 3300035695 Bacteria 525
1165 Ga0373933_0294661 3300035724 Bacteria 1050
1166 Ga0373933_0373450 3300035724 Bacteria 928
1167 Ga0373947_0007919 3300035725 Bacteria 6127
1168 Ga0373947_0013676 3300035725 Bacteria 4650
1169 Ga0373947_0114040 3300035725 Bacteria 1711
1170 Ga0373947_0223935 3300035725 Bacteria 1237
1171 Ga0373947_0256443 3300035725 Bacteria 1158
1172 Ga0373947_0783854 3300035725 Bacteria 651
1173 Ga0373947_0992452 3300035725 Unclassified 573
1174 Ga0373937_0007252 3300036401 Bacteria 9594
1175 Ga0373937_0025601 3300036401 Bacteria 5328
1176 Ga0373937_0030240 3300036401 Bacteria 4905
1177 Ga0373937_0056404 3300036401 Bacteria 3608
1178 Ga0373937_0076114 3300036401 Bacteria 3099
1179 Ga0373937_0113979 3300036401 Bacteria 2516
1180 Ga0373937_0171110 3300036401 Bacteria 2038
1181 Ga0373937_0431917 3300036401 Bacteria 1250
1182 Ga0373937_0866335 3300036401 Unclassified 852
1183 Ga0373937_1848163 3300036401 Bacteria 550
1184 Ga0373937_2066069 3300036401 Bacteria 516
1185 Ga0316582_0200485 3300036647 Bacteria 1361
1186 Ga0316582_0287953 3300036647 Bacteria 1128
1187 Ga0316582_0643517 3300036647 Bacteria 729
1188 Ga0316582_0705715 3300036647 Unclassified 693
1189 Ga0316584_0351874 3300036712 Bacteria 1058
1190 Ga0316584_0358687 3300036712 Unclassified 1045
1191 Ga0316584_0408499 3300036712 Bacteria 966
1192 Ga0316584_0518106 3300036712 Bacteria 836
1193 Ga0316584_0577819 3300036712 Bacteria 782
1194 Ga0316584_0622151 3300036712 Bacteria 747
1195 Ga0316584_0726414 3300036712 Unclassified 679
1196 Ga0316584_0729147 3300036712 Bacteria 678
1197 Ga0316584_0734471 3300036712 Bacteria 674
1198 Ga0373925_0001662 3300037068 Bacteria 18731
1199 Ga0373925_0001788 3300037068 Bacteria 17923
1200 Ga0373925_0094451 3300037068 Bacteria 2290
1201 Ga0373925_0262346 3300037068 Bacteria 1388
1202 Ga0373925_0263319 3300037068 Bacteria 1385
1203 Ga0373925_0554776 3300037068 Unclassified 945
1204 Ga0373925_0872321 3300037068 Bacteria 742
1205 Ga0395899_0173762 3300037312 Bacteria 1516
1206 Ga0395900_0018609 3300037418 Bacteria 7084
1207 Ga0395900_0954656 3300037418 Bacteria 779
1208 Ga0395900_1480901 3300037418 Unclassified 591
1209 Ga0395900_1668877 3300037418 Bacteria 548
1210 Ga0395898_0564374 3300037466 Bacteria 1081
1211 Ga0395905_0000275 3300037471 Bacteria 76114
1212 Ga0395905_0001744 3300037471 Bacteria 25404
1213 Ga0395905_0082831 3300037471 Bacteria 3006
1214 Ga0395905_0369455 3300037471 Bacteria 1328
1215 Ga0395905_0877384 3300037471 Unclassified 800
1216 Ga0316581_0013010 3300037588 Bacteria 2354
1217 Ga0395901_0113158 3300038443 Bacteria 2850
1218 Ga0400490_17491 3300038726 Bacteria 28094
1219 Ga0400491_12215 3300038727 Bacteria 7556
1220 Ga0400483_126972 3300039062 Bacteria 3049
1221 Ga0400483_247471 3300039062 Bacteria 2928
1222 Ga0400489_10986 3300039093 Bacteria 1435
1223 Ga0400489_86969 3300039093 Bacteria 10581
1224 Ga0436365_0154164 3300039437 Bacteria 11061
1225 Ga0436365_1563210 3300039437 Bacteria 4201
1226 Ga0436365_1839659 3300039437 Bacteria 4011
1227 Ga0436365_1927449 3300039437 Bacteria 710
1228 Ga0436360_0080201 3300039438 Bacteria 942
1229 Ga0436360_0406311 3300039438 Bacteria 1003
1230 Ga0436363_0576030 3300039450 Bacteria 1107
1231 Ga0436363_1475130 3300039450 Bacteria 615
1232 Ga0436362_0225975 3300039453 Bacteria 2143
1233 Ga0436362_1063276 3300039453 Bacteria 20265
1234 Ga0436362_1069013 3300039453 Bacteria 90804
1235 Ga0439461_0064471 3300041410 Bacteria 838
1236 Ga0451793_0687095 3300041452 Unclassified 1134
1237 Ga0451795_0060284 3300041456 Bacteria 1073
1238 Ga0451839_0487727 3300041496 Bacteria 1989
1239 Ga0451851_0850392 3300041507 Bacteria 930
1240 Ga0439433_0112274 3300041999 Bacteria 683
1241 Ga0439451_125562 3300042009 Bacteria 523
1242 Ga0439444_0094397 3300042437 Bacteria 671
1243 Ga0451577_0008700 3300042876 Bacteria 9846
1244 Ga0451577_0012592 3300042876 Bacteria 7940
1245 Ga0451577_0016347 3300042876 Bacteria 6875
1246 Ga0451577_0033756 3300042876 Bacteria 4614
1247 Ga0451577_0134048 3300042876 Bacteria 2223
1248 Ga0451577_0161269 3300042876 Bacteria 2019
1249 Ga0451577_0317597 3300042876 Bacteria 1412
1250 Ga0451577_1403892 3300042876 Bacteria 619
1251 Ga0439440_0013796 3300042993 Bacteria 1738
1252 Ga0453683_0000086 3300044673 Bacteria 139689
1253 Ga0453683_0008784 3300044673 Bacteria 6768
1254 Ga0453683_0054837 3300044673 Bacteria 2495
1255 Ga0453683_0055812 3300044673 Bacteria 2472
1256 Ga0453683_0122574 3300044673 Bacteria 1637
1257 Ga0453683_0216829 3300044673 Bacteria 1216
1258 Ga0466965_0436268 3300044683 Bacteria 728
1259 Ga0453684_0001061 3300044712 Bacteria 87486
1260 Ga0453684_0001518 3300044712 Bacteria 65070
1261 Ga0453684_0006427 3300044712 Bacteria 22339
1262 Ga0453684_0008349 3300044712 Bacteria 18610
1263 Ga0453684_0011806 3300044712 Bacteria 14554
1264 Ga0453684_0019106 3300044712 Bacteria 10459
1265 Ga0453684_0019836 3300044712 Bacteria 10199
1266 Ga0453684_0020573 3300044712 Bacteria 9941
1267 Ga0453684_0033355 3300044712 Bacteria 7181
1268 Ga0453684_0037288 3300044712 Bacteria 6674
1269 Ga0453684_0042819 3300044712 Bacteria 6096
1270 Ga0453684_0044000 3300044712 Bacteria 5986
1271 Ga0453684_0048627 3300044712 Bacteria 5603
1272 Ga0453684_0060385 3300044712 Bacteria 4877
1273 Ga0453684_0062580 3300044712 Bacteria 4765
1274 Ga0453684_0075363 3300044712 Bacteria 4241
1275 Ga0453684_0090894 3300044712 Bacteria 3771
1276 Ga0453684_0111000 3300044712 Bacteria 3332
1277 Ga0453684_0240329 3300044712 Bacteria 2085
1278 Ga0453684_0373414 3300044712 Bacteria 1603
1279 Ga0453684_0646837 3300044712 Bacteria 1154
1280 Ga0453684_1257000 3300044712 Bacteria 774
1281 Ga0453684_1813505 3300044712 Bacteria 620
1282 Ga0451576_0004083 3300045051 Bacteria 19291
1283 Ga0451576_0005300 3300045051 Bacteria 16207
1284 Ga0451576_0019582 3300045051 Bacteria 7386
1285 Ga0451576_0093519 3300045051 Bacteria 3126
1286 Ga0451576_0129629 3300045051 Bacteria 2629
1287 Ga0451576_0137895 3300045051 Bacteria 2544
1288 Ga0451576_0196516 3300045051 Bacteria 2107
1289 Ga0451576_0213585 3300045051 Bacteria 2015
1290 Ga0451576_0215670 3300045051 Bacteria 2004
1291 Ga0451576_0312134 3300045051 Bacteria 1645
1292 Ga0451576_0499547 3300045051 Bacteria 1278
1293 Ga0451576_0648915 3300045051 Bacteria 1109
1294 Ga0451576_0682098 3300045051 Bacteria 1079
1295 Ga0451576_1292499 3300045051 Bacteria 761
1296 Ga0451576_2130053 3300045051 Bacteria 576
1297 Ga0466967_0445372 3300045976 Bacteria 1265
1298 Ga0466967_0955867 3300045976 Bacteria 853
1299 Ga0495617_143473 3300046452 Bacteria 762
1300 Ga0495592_0161903 3300046454 Bacteria 1539
1301 Ga0495603_0016598 3300046455 Bacteria 4455
1302 Ga0495603_0334793 3300046455 Bacteria 869
1303 Ga0495629_0007707 3300046459 Bacteria 7921
1304 Ga0495629_0016479 3300046459 Bacteria 5304
1305 Ga0495629_0184529 3300046459 Bacteria 1445
1306 Ga0495629_0419104 3300046459 Bacteria 909
1307 Ga0495641_0041758 3300046461 Bacteria 2129
1308 Ga0495641_0047852 3300046461 Bacteria 1962
1309 Ga0495641_0125788 3300046461 Bacteria 1144
1310 Ga0495641_0141431 3300046461 Bacteria 1075
1311 Ga0495651_0042906 3300046462 Bacteria 3510
1312 Ga0495651_0481615 3300046462 Bacteria 797
1313 Ga0495651_0597215 3300046462 Bacteria 697
1314 Ga0495580_0001448 3300046472 Bacteria 20804
1315 Ga0495580_0002827 3300046472 Bacteria 14922
1316 Ga0495580_0005582 3300046472 Bacteria 10367
1317 Ga0495580_0012791 3300046472 Bacteria 6432
1318 Ga0495580_0050436 3300046472 Bacteria 2943
1319 Ga0495580_0057891 3300046472 Bacteria 2727
1320 Ga0495580_0080283 3300046472 Bacteria 2274
1321 Ga0495580_0121196 3300046472 Bacteria 1816
1322 Ga0495580_0125962 3300046472 Bacteria 1778
1323 Ga0495580_0261064 3300046472 Bacteria 1185
1324 Ga0495580_0411869 3300046472 Bacteria 910
1325 Ga0495580_0584354 3300046472 Unclassified 739
1326 Ga0495580_0654197 3300046472 Bacteria 691
1327 Ga0495580_0921904 3300046472 Unclassified 560
1328 Ga0495582_0000113 3300046473 Bacteria 42436
1329 Ga0495582_0026338 3300046473 Bacteria 3187
1330 Ga0495582_0079298 3300046473 Bacteria 1822
1331 Ga0495582_0295889 3300046473 Bacteria 930
1332 Ga0495582_0417230 3300046473 Bacteria 774
1333 Ga0495639_0020227 3300046475 Bacteria 2908
1334 Ga0495639_0122966 3300046475 Bacteria 1239
1335 Ga0495662_0522177 3300046476 Bacteria 582
1336 Ga0495664_0005945 3300046477 Bacteria 6720
1337 Ga0495584_0399912 3300046491 Bacteria 698
1338 Ga0495585_0380470 3300046492 Bacteria 682
1339 Ga0495585_0494208 3300046492 Bacteria 582
1340 Ga0495594_0021611 3300046499 Bacteria 3435
1341 Ga0495594_0076463 3300046499 Bacteria 1867
1342 Ga0495594_0452844 3300046499 Bacteria 730
1343 Ga0495616_0235832 3300046513 Bacteria 791
1344 Ga0495618_0033948 3300046514 Bacteria 3199
1345 Ga0495618_0047295 3300046514 Bacteria 2716
1346 Ga0495618_0179620 3300046514 Bacteria 1345
1347 Ga0495618_0346716 3300046514 Bacteria 916
1348 Ga0495628_0268257 3300046516 Bacteria 1270
1349 Ga0495628_0573546 3300046516 Bacteria 808
1350 Ga0495630_0003551 3300046517 Bacteria 10859
1351 Ga0495630_0016248 3300046517 Bacteria 5437
1352 Ga0495630_0019992 3300046517 Bacteria 4930
1353 Ga0495630_0776267 3300046517 Bacteria 732
1354 Ga0495630_0982529 3300046517 Unclassified 642
1355 Ga0495666_0137734 3300046526 Bacteria 1139
1356 Ga0495666_0195179 3300046526 Bacteria 932
1357 Ga0495666_0326231 3300046526 Bacteria 693
1358 Ga0495666_0333159 3300046526 Bacteria 684
1359 Ga0495642_0362330 3300046528 Bacteria 638
1360 Ga0495652_0354639 3300046529 Bacteria 1050
1361 Ga0495652_0384663 3300046529 Bacteria 997
1362 Ga0495665_0017070 3300046531 Bacteria 3905
1363 Ga0495665_0038759 3300046531 Bacteria 2540
1364 Ga0495665_0105049 3300046531 Bacteria 1482
1365 Ga0495665_0695753 3300046531 Bacteria 504
1366 Ga0495640_0084228 3300046533 Bacteria 2109
1367 Ga0495640_0194210 3300046533 Bacteria 1289
1368 Ga0495640_0739393 3300046533 Bacteria 589
1369 Ga0495586_0003305 3300046535 Bacteria 8648
1370 Ga0495586_0031142 3300046535 Bacteria 2856
1371 Ga0495586_0031189 3300046535 Bacteria 2853
1372 Ga0495586_0047729 3300046535 Bacteria 2312
1373 Ga0495587_0002355 3300046536 Bacteria 12626
1374 Ga0495587_0019640 3300046536 Bacteria 4180
1375 Ga0495587_0213134 3300046536 Bacteria 1090
1376 Ga0495598_0017282 3300046537 Bacteria 1857
1377 Ga0495645_0630048 3300046543 Bacteria 657
1378 Ga0495645_0654462 3300046543 Bacteria 641
1379 Ga0495622_0267752 3300046557 Bacteria 749
1380 Ga0495633_0069411 3300046558 Bacteria 1645
1381 Ga0495656_0000397 3300046615 Bacteria 14422
1382 Ga0495656_0517719 3300046615 Bacteria 634
1383 Ga0495656_0726992 3300046615 Unclassified 535
1384 Ga0495668_0770055 3300046616 Bacteria 533
1385 Ga0495634_0000649 3300046642 Bacteria 33746
1386 Ga0495634_0165167 3300046642 Bacteria 1394
1387 Ga0495635_0069638 3300046663 Bacteria 2412
1388 Ga0495588_0457836 3300046674 Bacteria 669
1389 Ga0495657_0158952 3300046675 Bacteria 1399
1390 Ga0495657_0273279 3300046675 Unclassified 1013
1391 Ga0495657_0274523 3300046675 Bacteria 1010
1392 Ga0495657_0444406 3300046675 Bacteria 760
1393 Ga0495623_0095320 3300046679 Bacteria 1819
1394 Ga0495647_0004304 3300046681 Bacteria 4612
1395 Ga0495647_0006082 3300046681 Bacteria 3979
1396 Ga0495647_0007570 3300046681 Bacteria 3644
1397 Ga0495647_0040084 3300046681 Bacteria 1778
1398 Ga0495647_0249323 3300046681 Bacteria 790
1399 Ga0495647_0452968 3300046681 Bacteria 594
1400 Ga0495658_0017882 3300046683 Bacteria 3674
1401 Ga0495658_0028263 3300046683 Bacteria 3025
1402 Ga0495658_0056441 3300046683 Bacteria 2240
1403 Ga0495658_0189652 3300046683 Bacteria 1277
1404 Ga0495669_0106398 3300046684 Bacteria 1307
1405 Ga0495669_0505155 3300046684 Bacteria 588
1406 Ga0495613_0042407 3300046689 Bacteria 3367
1407 Ga0495613_0095480 3300046689 Bacteria 2150
1408 Ga0495613_0642490 3300046689 Bacteria 703
1409 Ga0495624_0023361 3300046690 Bacteria 4078
1410 Ga0495670_0019811 3300046691 Bacteria 3315
1411 Ga0495670_0731190 3300046691 Unclassified 540
1412 Ga0495589_0432283 3300046794 Bacteria 603
1413 Ga0495600_0047423 3300046809 Bacteria 2802
1414 Ga0495600_0361141 3300046809 Bacteria 908
1415 Ga0495581_0208241 3300047315 Bacteria 1144
1416 Ga0495581_0262135 3300047315 Bacteria 1010
1417 Ga0495604_0039896 3300047317 Bacteria 3689
1418 Ga0495604_0368503 3300047317 Bacteria 951
1419 Ga0495604_0595068 3300047317 Bacteria 710
1420 Ga0495604_0776194 3300047317 Bacteria 605
1421 Ga0495636_0000893 3300047318 Bacteria 11074
1422 Ga0495636_0044847 3300047318 Bacteria 1842
1423 Ga0495636_0175385 3300047318 Bacteria 971
1424 Ga0495636_0273477 3300047318 Bacteria 785
1425 Ga0495674_0001336 3300047319 Bacteria 24042
1426 Ga0495674_0036483 3300047319 Bacteria 4424
1427 Ga0495674_0094633 3300047319 Bacteria 2548
1428 Ga0495674_0202418 3300047319 Bacteria 1646
1429 Ga0495674_0835104 3300047319 Bacteria 715
1430 Ga0495676_0030282 3300047321 Bacteria 4597
1431 Ga0495676_0588623 3300047321 Bacteria 725
1432 Ga0495680_0202098 3300047322 Bacteria 1425
1433 Ga0495680_0378620 3300047322 Bacteria 981
1434 Ga0495680_1005008 3300047322 Bacteria 533
1435 Ga0495675_0068217 3300047444 Bacteria 2247
1436 Ga0495679_007316 3300047446 Bacteria 4617
1437 Ga0495684_0026659 3300047471 Bacteria 4441
1438 Ga0495684_0054352 3300047471 Bacteria 3054
1439 Ga0495684_0078814 3300047471 Bacteria 2500
1440 Ga0495684_0231057 3300047471 Bacteria 1353
1441 Ga0495684_0260054 3300047471 Bacteria 1259
1442 Ga0495593_0078777 3300047673 Bacteria 1706
1443 Ga0495593_0252399 3300047673 Bacteria 883
1444 Ga0495602_0017278 3300048088 Bacteria 7234
1445 Ga0495602_0227086 3300048088 Bacteria 1405
1446 Ga0495614_0010953 3300048089 Bacteria 3991
1447 Ga0495614_0069510 3300048089 Bacteria 1517
1448 Ga0495615_0003089 3300048090 Bacteria 2754
1449 Ga0496100_0003660 3300048903 Bacteria 8042
1450 Ga0496100_0017930 3300048903 Bacteria 4189
1451 Ga0496100_0998411 3300048903 Bacteria 659
1452 Ga0496101_0025125 3300048904 Bacteria 4129
1453 Ga0496101_0179518 3300048904 Bacteria 1630
1454 Ga0496101_0523564 3300048904 Bacteria 937
1455 Ga0496101_0666373 3300048904 Bacteria 822
1456 Ga0496101_0925184 3300048904 Bacteria 686
1457 Ga0496102_0000916 3300048905 Bacteria 27806
1458 Ga0496102_0003028 3300048905 Bacteria 14227
1459 Ga0496102_0018905 3300048905 Bacteria 6062
1460 Ga0496102_0035581 3300048905 Bacteria 4483
1461 Ga0496102_0146115 3300048905 Bacteria 2219
1462 Ga0496102_0766183 3300048905 Bacteria 888
1463 Ga0496103_0030082 3300048906 Bacteria 3303
1464 Ga0496104_0028984 3300048907 Bacteria 5133
1465 Ga0496104_0036226 3300048907 Bacteria 4612
1466 Ga0496104_0103951 3300048907 Bacteria 2721
1467 Ga0496104_0107857 3300048907 Bacteria 2668
1468 Ga0496104_0322079 3300048907 Bacteria 1459
1469 Ga0496104_0351967 3300048907 Bacteria 1386
1470 Ga0496104_0370528 3300048907 Bacteria 1345
1471 Ga0496105_0078298 3300048908 Bacteria 2730
1472 Ga0496105_0139233 3300048908 Bacteria 1998
1473 Ga0496105_0166096 3300048908 Bacteria 1811
1474 Ga0496105_0213217 3300048908 Bacteria 1573
1475 Ga0496105_0524359 3300048908 Bacteria 927
1476 Ga0496105_0684031 3300048908 Bacteria 789
1477 Ga0496106_0003518 3300048909 Bacteria 11675
1478 Ga0496106_0030306 3300048909 Bacteria 4035
1479 Ga0496106_0087377 3300048909 Bacteria 2402
1480 Ga0496106_0283939 3300048909 Bacteria 1326
1481 Ga0496106_0970159 3300048909 Bacteria 669
1482 Ga0496106_1362863 3300048909 Bacteria 549
1483 Ga0496107_0000796 3300048910 Bacteria 18296
1484 Ga0496107_0067376 3300048910 Bacteria 2597
1485 Ga0496107_0933349 3300048910 Bacteria 632
1486 Ga0496108_0032489 3300048911 Bacteria 4335
1487 Ga0496108_0124186 3300048911 Bacteria 2215
1488 Ga0496108_0286001 3300048911 Bacteria 1435
1489 Ga0496108_0482416 3300048911 Bacteria 1083
1490 Ga0496108_0767720 3300048911 Bacteria 833
1491 Ga0496108_1634796 3300048911 Bacteria 532
1492 Ga0496109_0060025 3300048912 Bacteria 3475
1493 Ga0496109_0087350 3300048912 Bacteria 2880
1494 Ga0496109_0404303 3300048912 Bacteria 1290
1495 Ga0496109_1425728 3300048912 Bacteria 628
1496 Ga0496110_0000091 3300048913 Bacteria 48115
1497 Ga0496110_0004643 3300048913 Bacteria 10677
1498 Ga0496110_0023793 3300048913 Bacteria 5213
1499 Ga0496110_0286750 3300048913 Bacteria 1499
1500 Ga0496110_0587594 3300048913 Bacteria 1011
1501 Ga0496111_0016892 3300048914 Bacteria 5037
1502 Ga0496111_0048928 3300048914 Bacteria 3048
1503 Ga0496111_0225915 3300048914 Bacteria 1391
1504 Ga0496111_0375322 3300048914 Bacteria 1052
1505 Ga0496111_1316029 3300048914 Bacteria 509
1506 Ga0496112_0030222 3300048915 Bacteria 5242
1507 Ga0496112_0356812 3300048915 Bacteria 1404
1508 Ga0496112_0663177 3300048915 Bacteria 972
1509 Ga0496112_0773487 3300048915 Bacteria 886
1510 Ga0496112_1465119 3300048915 Bacteria 597
1511 Ga0496113_0021257 3300048916 Bacteria 4575
1512 Ga0496113_0648146 3300048916 Bacteria 845
1513 Ga0496113_0732631 3300048916 Bacteria 788
1514 Ga0496113_0902278 3300048916 Bacteria 699
1515 Ga0496114_0000386 3300048917 Bacteria 32590
1516 Ga0496114_0001141 3300048917 Bacteria 20073
1517 Ga0496114_0004194 3300048917 Bacteria 11164
1518 Ga0496114_0006073 3300048917 Bacteria 9506
1519 Ga0496114_0230229 3300048917 Bacteria 1628
1520 Ga0496114_0320615 3300048917 Bacteria 1369
1521 Ga0496114_0353784 3300048917 Bacteria 1299
1522 Ga0496114_0778035 3300048917 Bacteria 835
1523 Ga0496115_0006616 3300048918 Bacteria 8497
1524 Ga0496115_0047334 3300048918 Bacteria 3439
1525 Ga0496115_0059367 3300048918 Bacteria 3080
1526 Ga0496115_0389278 3300048918 Bacteria 1132
1527 Ga0496115_0443708 3300048918 Bacteria 1049
1528 Ga0496115_0561298 3300048918 Bacteria 911
1529 Ga0496116_0025193 3300048919 Bacteria 4378
1530 Ga0496116_0030225 3300048919 Bacteria 3895
1531 Ga0496117_0001863 3300048920 Bacteria 28457
1532 Ga0496117_0059650 3300048920 Bacteria 2634
1533 Ga0496117_0204017 3300048920 Bacteria 1115
1534 Ga0496122_0008592 3300048925 Bacteria 10970
1535 Ga0496123_0029360 3300048926 Bacteria 4049
1536 Ga0496124_0000001 3300048927 Bacteria 1747840
1537 Ga0496124_0075016 3300048927 Bacteria 2795
1538 Ga0496125_0056825 3300048928 Bacteria 3174
1539 Ga0496125_0384470 3300048928 Bacteria 826
1540 Ga0496126_0096151 3300048929 Bacteria 2597
1541 Ga0496126_0097584 3300048929 Bacteria 2575
1542 Ga0496126_0626774 3300048929 Bacteria 844
1543 Ga0501305_018599 3300049161 Bacteria 1007
1544 Ga0501307_006084 3300049162 Bacteria 1292
1545 Ga0501307_091116 3300049162 Bacteria 509
1546 Ga0501290_028794 3300049513 Bacteria 788
1547 Ga0501298_057336 3300049521 Unclassified 819
1548 Ga0501317_062977 3300049533 Bacteria 612
1549 Ga0501031_0100714 3300049568 Bacteria 1885
1550 Ga0501031_0118379 3300049568 Bacteria 1731
1551 Ga0501032_0175090 3300049569 Bacteria 1406
1552 Ga0501033_0071425 3300049570 Bacteria 2550
1553 Ga0501034_0079903 3300049571 Bacteria 3274
1554 Ga0501034_1384106 3300049571 Bacteria 579
1555 Ga0501036_0014973 3300049572 Bacteria 6470
1556 Ga0501036_0034010 3300049572 Bacteria 4311
1557 Ga0501036_1550544 3300049572 Bacteria 535
1558 Ga0501037_0011186 3300049573 Bacteria 6604
1559 Ga0501037_0700449 3300049573 Bacteria 674
1560 Ga0501038_0000271 3300049574 Bacteria 43706
1561 Ga0501038_0583992 3300049574 Bacteria 847
1562 Ga0501038_0997715 3300049574 Bacteria 615
1563 Ga0501039_0108043 3300049575 Bacteria 2174
1564 Ga0501039_0153331 3300049575 Bacteria 1810
1565 Ga0501039_0306749 3300049575 Bacteria 1248
1566 Ga0501039_0806175 3300049575 Bacteria 732
1567 Ga0501039_0960743 3300049575 Unclassified 664
1568 Ga0501039_1022063 3300049575 Bacteria 642
1569 Ga0501040_0001044 3300049576 Bacteria 17516
1570 Ga0501040_0062391 3300049576 Bacteria 2564
1571 Ga0501040_0088966 3300049576 Bacteria 2145
1572 Ga0501040_0160571 3300049576 Bacteria 1589
1573 Ga0501040_0211230 3300049576 Bacteria 1380
1574 Ga0501040_0230286 3300049576 Bacteria 1319
1575 Ga0501041_0000002 3300049577 Bacteria 84985
1576 Ga0501041_0163295 3300049577 Bacteria 1393
1577 Ga0501042_0000645 3300049578 Bacteria 18688
1578 Ga0501042_0048885 3300049578 Bacteria 3016
1579 Ga0501042_0134671 3300049578 Bacteria 1781
1580 Ga0501043_0085474 3300049579 Bacteria 2479
1581 Ga0501043_0121334 3300049579 Bacteria 2050
1582 Ga0501043_0185513 3300049579 Bacteria 1620
1583 Ga0501046_0051614 3300049580 Bacteria 3245
1584 Ga0501046_0119838 3300049580 Bacteria 2003
1585 Ga0501046_0295744 3300049580 Bacteria 1183
1586 Ga0501046_1237436 3300049580 Bacteria 512
1587 Ga0501047_0468086 3300049581 Bacteria 1089
1588 Ga0501048_0002109 3300049582 Bacteria 15162
1589 Ga0501048_0234505 3300049582 Bacteria 1302
1590 Ga0501048_0241932 3300049582 Bacteria 1281
1591 Ga0501048_0902011 3300049582 Bacteria 636
1592 Ga0501067_0003773 3300049583 Bacteria 8357
1593 Ga0501068_0117831 3300049584 Bacteria 1654
1594 Ga0501068_0225851 3300049584 Bacteria 1190
1595 Ga0501068_0262995 3300049584 Bacteria 1101
1596 Ga0501069_0748886 3300049585 Bacteria 591
1597 Ga0501070_0607196 3300049586 Bacteria 872
1598 Ga0501070_1410966 3300049586 Bacteria 529
1599 Ga0501071_0001937 3300049587 Bacteria 12334
1600 Ga0501071_0145214 3300049587 Bacteria 1768
1601 Ga0501071_0172545 3300049587 Bacteria 1619
1602 Ga0501071_0231051 3300049587 Bacteria 1393
1603 Ga0501072_0000128 3300049588 Bacteria 56185
1604 Ga0501072_0032391 3300049588 Bacteria 4094
1605 Ga0501072_0215997 3300049588 Bacteria 1528
1606 Ga0501073_0003382 3300049589 Bacteria 11991
1607 Ga0501073_0009833 3300049589 Bacteria 7039
1608 Ga0501073_0038469 3300049589 Bacteria 3393
1609 Ga0501073_0207608 3300049589 Bacteria 1354
1610 Ga0501074_0003300 3300049590 Bacteria 11409
1611 Ga0501074_0110042 3300049590 Bacteria 1971
1612 Ga0501074_0281025 3300049590 Bacteria 1183
1613 Ga0501074_0387843 3300049590 Bacteria 991
1614 Ga0501075_0015531 3300049591 Bacteria 5464
1615 Ga0501075_0038544 3300049591 Bacteria 3573
1616 Ga0501075_0090751 3300049591 Bacteria 2318
1617 Ga0501075_0103332 3300049591 Bacteria 2165
1618 Ga0501075_0149057 3300049591 Bacteria 1783
1619 Ga0501075_0536782 3300049591 Bacteria 893
1620 Ga0501076_0000022 3300049592 Bacteria 83199
1621 Ga0501076_0012924 3300049592 Bacteria 6250
1622 Ga0501076_0015095 3300049592 Bacteria 5833
1623 Ga0501076_0019380 3300049592 Bacteria 5201
1624 Ga0501076_0165212 3300049592 Bacteria 1804
1625 Ga0501076_0198838 3300049592 Bacteria 1636
1626 Ga0501076_1433015 3300049592 Bacteria 567
1627 Ga0501076_1586770 3300049592 Bacteria 537
1628 Ga0501077_0000017 3300049593 Bacteria 86892
1629 Ga0501077_0005748 3300049593 Bacteria 7555
1630 Ga0501077_0013601 3300049593 Bacteria 5102
1631 Ga0501077_0138932 3300049593 Bacteria 1541
1632 Ga0501077_0182664 3300049593 Bacteria 1333
1633 Ga0501077_0477644 3300049593 Bacteria 799
1634 Ga0501198_019554 3300049649 Bacteria 1068
1635 Ga0501217_156633 3300049661 Bacteria 684
1636 Ga0501249_047500 3300049679 Bacteria 982
1637 Ga0501252_029041 3300049682 Bacteria 759
1638 Ga0501258_020947 3300049687 Bacteria 769
1639 Ga0501079_0000549 3300049741 Bacteria 24511
1640 Ga0501079_0039652 3300049741 Bacteria 3632
1641 Ga0501079_0219200 3300049741 Bacteria 1486
1642 Ga0501079_0338296 3300049741 Bacteria 1179
1643 Ga0501079_0785145 3300049741 Bacteria 750
1644 Ga0501080_0004016 3300049742 Bacteria 13028
1645 Ga0501080_0054009 3300049742 Bacteria 3741
1646 Ga0501080_0058519 3300049742 Bacteria 3587
1647 Ga0501080_0169697 3300049742 Bacteria 2013
1648 Ga0501080_0430265 3300049742 Bacteria 1185
1649 Ga0501080_1110040 3300049742 Bacteria 682
1650 Ga0501081_0000105 3300049743 Bacteria 35434
1651 Ga0501081_0212764 3300049743 Bacteria 1404
1652 Ga0501081_0438763 3300049743 Bacteria 969
1653 Ga0501081_0921357 3300049743 Bacteria 659
1654 Ga0501083_0098494 3300049744 Bacteria 1929
1655 Ga0501083_0416796 3300049744 Bacteria 874
1656 Ga0501083_0832287 3300049744 Bacteria 601
1657 Ga0501083_0890704 3300049744 Bacteria 579
1658 Ga0501270_003093 3300049767 Unclassified 1769
1659 Ga0501035_0002385 3300049822 Bacteria 18452
1660 Ga0501035_0346800 3300049822 Bacteria 1243
1661 Ga0501035_0386792 3300049822 Bacteria 1166
1662 Ga0501035_0900218 3300049822 Bacteria 701
1663 Ga0501035_1074586 3300049822 Bacteria 630
1664 Ga0501045_0000113 3300049824 Bacteria 40870
1665 Ga0501045_0005535 3300049824 Bacteria 8737
1666 Ga0501045_0093809 3300049824 Bacteria 2220
1667 Ga0501045_0193347 3300049824 Bacteria 1516
1668 Ga0501212_038484 3300049851 Bacteria 786
1669 nmdc:mga00v17_852269_c1 3300050491 Bacteria 579
1670 nmdc:mga05p37_1252235_c1 3300050507 Bacteria 761
1671 nmdc:mga05p37_1701_c1 3300050507 Bacteria 25630
1672 nmdc:mga05p37_1842889_c1 3300050507 Bacteria 581
1673 nmdc:mga05p37_1993750_c1 3300050507 Bacteria 549
1674 nmdc:mga05p37_217608_c1 3300050507 Bacteria 2306
1675 nmdc:mga05p37_2357_c1 3300050507 Bacteria 21983
1676 nmdc:mga05p37_2405_c1 3300050507 Bacteria 21778
1677 nmdc:mga05p37_244065_c1 3300050507 Bacteria 2157
1678 nmdc:mga05p37_28557_c1 3300050507 Bacteria 6803
1679 nmdc:mga05p37_43119_c2 3300050507 Bacteria 3382
1680 nmdc:mga05p37_53231_c1 3300050507 Bacteria 4977
1681 nmdc:mga05p37_5571_c1 3300050507 Bacteria 14805
1682 nmdc:mga09592_1578074_c1 3300050508 Bacteria 532
1683 nmdc:mga09592_194091_c1 3300050508 Bacteria 1758
1684 nmdc:mga09592_47614_c1 3300050508 Bacteria 3613
1685 nmdc:mga09592_7449_c1 3300050508 Bacteria 8894
1686 nmdc:mga09592_845691_c1 3300050508 Bacteria 772
1687 nmdc:mga09592_88599_c1 3300050508 Bacteria 2643
1688 nmdc:mga0qj67_222840_c1 3300050509 Bacteria 1531
1689 nmdc:mga0qj67_263938_c1 3300050509 Bacteria 1397
1690 nmdc:mga0qj67_287621_c1 3300050509 Bacteria 1332
1691 nmdc:mga0qj67_36968_c1 3300050509 Bacteria 3823
1692 nmdc:mga0qj67_610306_c1 3300050509 Bacteria 872
1693 nmdc:mga06r32_1302523_c1 3300050510 Bacteria 670
1694 nmdc:mga06r32_299928_c1 3300050510 Bacteria 1593
1695 nmdc:mga06r32_600_c2 3300050510 Bacteria 13291
1696 nmdc:mga06r32_721966_c1 3300050510 Bacteria 961
1697 nmdc:mga08y16_1403866_c1 3300050511 Bacteria 661
1698 nmdc:mga08y16_158966_c1 3300050511 Bacteria 2348
1699 nmdc:mga08y16_1650152_c1 3300050511 Bacteria 598
1700 nmdc:mga08y16_20950_c1 3300050511 Bacteria 6902
1701 nmdc:mga08y16_24_c1 3300050511 Bacteria 240846
1702 nmdc:mga08y16_421972_c1 3300050511 Bacteria 1363
1703 nmdc:mga08y16_692563_c1 3300050511 Bacteria 1020
1704 nmdc:mga08y16_903961_c1 3300050511 Bacteria 869
1705 nmdc:mga0n895_112230_c1 3300050512 Bacteria 2743
1706 nmdc:mga0n895_116858_c1 3300050512 Bacteria 2686
1707 nmdc:mga0n895_124772_c1 3300050512 Bacteria 2598
1708 nmdc:mga0n895_15345_c1 3300050512 Bacteria 6981
1709 nmdc:mga0n895_157994_c1 3300050512 Bacteria 2298
1710 nmdc:mga0n895_16211_c1 3300050512 Bacteria 6831
1711 nmdc:mga0n895_165230_c1 3300050512 Bacteria 2245
1712 nmdc:mga0n895_248534_c1 3300050512 Bacteria 1805
1713 nmdc:mga0n895_32532_c1 3300050512 Bacteria 5007
1714 nmdc:mga0n895_4227_c1 3300050512 Bacteria 11739
1715 nmdc:mga0rr50_15066_c1 3300050513 Bacteria 5094
1716 nmdc:mga0rr50_1883_c1 3300050513 Bacteria 11637
1717 nmdc:mga0rr50_309450_c1 3300050513 Bacteria 1323
1718 nmdc:mga0rr50_436178_c1 3300050513 Bacteria 1109
1719 nmdc:mga0rr50_451926_c1 3300050513 Bacteria 1089
1720 nmdc:mga0rr50_4708_c1 3300050513 Bacteria 8045
1721 nmdc:mga0rr50_496957_c1 3300050513 Bacteria 1037
1722 nmdc:mga0rr50_603694_c1 3300050513 Unclassified 936
1723 nmdc:mga0rr50_70361_c1 3300050513 Bacteria 2666
1724 nmdc:mga0rr50_98517_c1 3300050513 Bacteria 2292
1725 nmdc:mga08x19_12242_c1 3300050514 Bacteria 5164
1726 nmdc:mga08x19_14593_c1 3300050514 Bacteria 4766
1727 nmdc:mga08x19_20353_c1 3300050514 Bacteria 4085
1728 nmdc:mga08x19_365_c1 3300050514 Bacteria 32003
1729 nmdc:mga08x19_39582_c1 3300050514 Bacteria 2997
1730 nmdc:mga08x19_53364_c1 3300050514 Bacteria 2601
1731 nmdc:mga08x19_59650_c1 3300050514 Bacteria 2470
1732 nmdc:mga08x19_87268_c1 3300050514 Bacteria 2055
1733 nmdc:mga08x19_95363_c1 3300050514 Bacteria 1968
1734 nmdc:mga0a205_10723_c1 3300050515 Bacteria 8426
1735 nmdc:mga0a205_137179_c1 3300050515 Bacteria 2347
1736 nmdc:mga0a205_16417_c1 3300050515 Bacteria 3641
1737 nmdc:mga0a205_245638_c1 3300050515 Bacteria 1670
1738 nmdc:mga0a205_256160_c1 3300050515 Bacteria 1628
1739 nmdc:mga0a205_260474_c1 3300050515 Bacteria 1612
1740 nmdc:mga0a205_263572_c1 3300050515 Bacteria 1601
1741 nmdc:mga0a205_287318_c1 3300050515 Bacteria 1519
1742 nmdc:mga0a205_34611_c1 3300050515 Bacteria 4846
1743 nmdc:mga0a205_357051_c1 3300050515 Bacteria 1328
1744 nmdc:mga0a205_390_c1 3300050515 Bacteria 33406
1745 nmdc:mga0a205_429315_c1 3300050515 Unclassified 1183
1746 nmdc:mga0a205_488289_c1 3300050515 Bacteria 1089
1747 nmdc:mga0a205_63533_c1 3300050515 Bacteria 3567
1748 nmdc:mga0a205_8807_c1 3300050515 Bacteria 9192
1749 Ga0495601_0016503 3300053077 Bacteria 4476
1750 Ga0495601_0460347 3300053077 Bacteria 822
1751 Ga0495601_0493210 3300053077 Bacteria 791
1752 Ga0495601_0562803 3300053077 Bacteria 733
1753 Ga0495612_0246593 3300053078 Bacteria 794
1754 Ga0495595_0015164 3300053084 Bacteria 3283
1755 Ga0495595_0466989 3300053084 Bacteria 642
1756 Ga0495619_0027932 3300053085 Bacteria 3639
1757 Ga0495619_0032380 3300053085 Bacteria 3392
1758 Ga0495619_0100730 3300053085 Bacteria 1966
1759 Ga0495619_0495056 3300053085 Bacteria 841
1760 Ga0495619_0518105 3300053085 Bacteria 819
1761 Ga0500643_000257 3300053087 Bacteria 48350
1762 Ga0500568_0035391 3300053139 Bacteria 2038
1763 Ga0501084_0000159 3300054114 Bacteria 52081
1764 Ga0501084_0071866 3300054114 Bacteria 2898
1765 Ga0501084_0287098 3300054114 Bacteria 1389
1766 Ga0501084_0503695 3300054114 Bacteria 1023
1767 Ga0501084_0505832 3300054114 Bacteria 1021
1768 Ga0501084_1633105 3300054114 Bacteria 539
1769 Ga0587084_041383 3300059477 Bacteria 784
1770 Ga0587066_018738 3300059490 Bacteria 1118
1771 Ga0587073_0040134 3300059492 Bacteria 1015
1772 Ga0587080_092063 3300059503 Bacteria 637
1773 Ga0587091_047439 3300059511 Bacteria 870
1774 Ga0587072_062076 3300059643 Bacteria 772
1775 Ga0587111_0035651 3300060346 Unclassified 1038
1776 Ga0587111_0078441 3300060346 Bacteria 785
1777 Ga0587111_0283623 3300060346 Bacteria 501
1778 Ga0501082_0002410 3300060353 Bacteria 16410
1779 Ga0501082_0485350 3300060353 Bacteria 1080
1780 Ga0501082_0650476 3300060353 Bacteria 922
1781 Ga0530510_0002449 3300061734 Bacteria 12792
1782 Ga0530510_0125550 3300061734 Bacteria 1886
1783 Ga0530510_0194648 3300061734 Bacteria 1505
1784 Ga0530510_0298278 3300061734 Bacteria 1206
1785 Ga0530510_0357705 3300061734 Bacteria 1097
1786 Ga0530510_0392298 3300061734 Bacteria 1045
1787 Ga0530510_0860580 3300061734 Bacteria 692

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025923 Ga0207681_11437631 Ga0207681_114376311 92
2 3300004799 Ga0058863_11875765 Ga0058863_118757651 99
3 3300026118 Ga0207675_100361315 Ga0207675_1003613153 99
4 3300046455 Ga0495603_0334793 Ga0495603_0334793_548_856 99
5 3300009176 Ga0105242_10713146 Ga0105242_107131462 103
6 3300034817 Ga0373948_0132447 Ga0373948_0132447_275_586 103
7 3300046543 Ga0495645_0654462 Ga0495645_0654462_294_605 103
8 3300046615 Ga0495656_0726992 Ga0495656_0726992_27_338 103
9 3300046616 Ga0495668_0770055 Ga0495668_0770055_199_510 103
10 3300048904 Ga0496101_0523564 Ga0496101_0523564_601_912 103
11 3300053087 Ga0500643_000257 Ga0500643_000257_35468_35779 103
12 3300039438 Ga0436360_0080201 Ga0436360_0080201_524_838 104
13 3300006914 Ga0075436_100002590 Ga0075436_10000259018 107
14 3300006914 Ga0075436_100248625 Ga0075436_1002486252 107
15 3300007788 Ga0099795_10424156 Ga0099795_104241562 107
16 3300026118 Ga0207675_101074241 Ga0207675_1010742411 107
17 3300035083 Ga0373926_0009400 Ga0373926_0009400_129_497 107
18 3300035089 Ga0373944_0244742 Ga0373944_0244742_108_476 107
19 3300035111 Ga0373923_0090832 Ga0373923_0090832_471_839 107
20 3300035695 Ga0373927_0004438 Ga0373927_0004438_3270_3638 107
21 3300035725 Ga0373947_0013676 Ga0373947_0013676_631_999 107
22 3300037068 Ga0373925_0001788 Ga0373925_0001788_11355_11723 107
23 3300046472 Ga0495580_0654197 Ga0495580_0654197_44_412 107
24 3300046517 Ga0495630_0019992 Ga0495630_0019992_196_564 107
25 3300046526 Ga0495666_0333159 Ga0495666_0333159_179_547 107
26 3300046690 Ga0495624_0023361 Ga0495624_0023361_2109_2477 107
27 3300049574 Ga0501038_0997715 Ga0501038_0997715_225_596 107
28 3300050514 nmdc:mga08x19_20353_c1 nmdc:mga08x19_20353_c1_169_537 107
29 3300050514 nmdc:mga08x19_365_c1 nmdc:mga08x19_365_c1_25498_25866 107
30 3300005334 Ga0068869_100646961 Ga0068869_1006469612 108
31 3300005356 Ga0070674_101735933 Ga0070674_1017359331 108
32 3300013297 Ga0157378_10325710 Ga0157378_103257103 108
33 3300025918 Ga0207662_10059669 Ga0207662_100596693 108
34 3300025937 Ga0207669_10468953 Ga0207669_104689531 108
35 3300025942 Ga0207689_10446792 Ga0207689_104467922 108
36 3300014745 Ga0157377_10565156 Ga0157377_105651562 109
37 3300059643 Ga0587072_062076 Ga0587072_062076_180_548 109
38 3300028800 Ga0265338_11184375 Ga0265338_111843752 110
39 3300032120 Ga0316053_117483 Ga0316053_1174832 110
40 3300035725 Ga0373947_0992452 Ga0373947_0992452_94_462 110
41 3300036647 Ga0316582_0287953 Ga0316582_0287953_701_1069 110
42 3300037068 Ga0373925_0554776 Ga0373925_0554776_509_877 110
43 3300046472 Ga0495580_0050436 Ga0495580_0050436_1286_1654 110
44 3300047319 Ga0495674_0202418 Ga0495674_0202418_372_740 110
45 3300047673 Ga0495593_0252399 Ga0495593_0252399_214_582 110
46 3300005327 Ga0070658_10039091 Ga0070658_100390913 111
47 3300005334 Ga0068869_100009311 Ga0068869_1000093113 111
48 3300005530 Ga0070679_101054963 Ga0070679_1010549631 111
49 3300006173 Ga0070716_100815246 Ga0070716_1008152461 111
50 3300006358 Ga0068871_101193520 Ga0068871_1011935202 111
51 3300009147 Ga0114129_10439907 Ga0114129_104399074 111
52 3300009551 Ga0105238_10000002 Ga0105238_10000002512 111
53 3300013296 Ga0157374_10000005 Ga0157374_10000005558 111
54 3300013297 Ga0157378_10105819 Ga0157378_101058193 111
55 3300013297 Ga0157378_10108940 Ga0157378_101089403 111
56 3300013308 Ga0157375_10071083 Ga0157375_100710835 111
57 3300014745 Ga0157377_10000001 Ga0157377_1000000114 111
58 3300021358 Ga0213873_10000553 Ga0213873_1000055310 111
59 3300021384 Ga0213876_10000009 Ga0213876_10000009226 111
60 3300025912 Ga0207707_10317843 Ga0207707_103178434 111
61 3300025924 Ga0207694_10000001 Ga0207694_10000001511 111
62 3300025942 Ga0207689_10009254 Ga0207689_1000925416 111
63 3300025981 Ga0207640_10989329 Ga0207640_109893292 111
64 3300030521 Ga0307511_10002513 Ga0307511_1000251330 111
65 3300039437 Ga0436365_0154164 Ga0436365_0154164_1824_2195 111
66 3300039453 Ga0436362_1063276 Ga0436362_1063276_11663_12034 111
67 3300041496 Ga0451839_0487727 Ga0451839_0487727_342_713 111
68 3300046528 Ga0495642_0362330 Ga0495642_0362330_172_543 111
69 3300047446 Ga0495679_007316 Ga0495679_007316_2903_3274 111
70 3300048909 Ga0496106_0283939 Ga0496106_0283939_816_1187 111
71 3300009094 Ga0111539_11120732 Ga0111539_111207322 112
72 3300026088 Ga0207641_10648581 Ga0207641_106485812 112
73 3300030836 Ga0265767_110710 Ga0265767_1107102 112
74 3300030882 Ga0265764_113392 Ga0265764_1133922 112
75 3300032002 Ga0307416_100807659 Ga0307416_1008076593 112
76 3300035115 Ga0373941_0115498 Ga0373941_0115498_556_927 112
77 3300050511 nmdc:mga08y16_903961_c1 nmdc:mga08y16_903961_c1_189_557 112
78 3300005436 Ga0070713_100115557 Ga0070713_1001155575 113
79 3300005471 Ga0070698_100771513 Ga0070698_1007715132 113
80 3300005546 Ga0070696_100023806 Ga0070696_1000238066 113
81 3300005547 Ga0070693_100063520 Ga0070693_1000635202 113
82 3300006028 Ga0070717_10000064 Ga0070717_1000006462 113
83 3300006173 Ga0070716_100026284 Ga0070716_1000262848 113
84 3300009177 Ga0105248_10574996 Ga0105248_105749964 113
85 3300025918 Ga0207662_10153364 Ga0207662_101533642 113
86 3300025928 Ga0207700_10098343 Ga0207700_100983433 113
87 3300025939 Ga0207665_10018501 Ga0207665_100185015 113
88 3300025941 Ga0207711_11458974 Ga0207711_114589742 113
89 3300054114 Ga0501084_1633105 Ga0501084_1633105_15_356 113
90 3300030521 Ga0307511_10231185 Ga0307511_102311852 116
91 3300031733 Ga0316577_10006446 Ga0316577_1000644611 116
92 3300036712 Ga0316584_0408499 Ga0316584_0408499_98_466 116
93 3300049741 Ga0501079_0785145 Ga0501079_0785145_316_666 116
94 3300005406 Ga0070703_10097871 Ga0070703_100978712 119
95 3300005471 Ga0070698_101613421 Ga0070698_1016134211 119
96 3300009545 Ga0105237_11477833 Ga0105237_114778332 119
97 3300035118 Ga0373954_0522548 Ga0373954_0522548_135_494 119
98 3300037418 Ga0395900_1668877 Ga0395900_1668877_87_446 119
99 3300038726 Ga0400490_17491 Ga0400490_17491_4582_4941 119
100 3300038727 Ga0400491_12215 Ga0400491_12215_4621_4980 119
101 3300046492 Ga0495585_0380470 Ga0495585_0380470_304_663 119
102 3300049513 Ga0501290_028794 Ga0501290_028794_278_637 119
103 3300050512 nmdc:mga0n895_112230_c1 nmdc:mga0n895_112230_c1_632_991 119
104 3300050513 nmdc:mga0rr50_4708_c1 nmdc:mga0rr50_4708_c1_6930_7289 119
105 3300050514 nmdc:mga08x19_14593_c1 nmdc:mga08x19_14593_c1_4313_4672 119
106 3300050515 nmdc:mga0a205_263572_c1 nmdc:mga0a205_263572_c1_1071_1430 119
107 3300005468 Ga0070707_101381124 Ga0070707_1013811242 121
108 3300025922 Ga0207646_11430375 Ga0207646_114303752 121
109 3300037471 Ga0395905_0369455 Ga0395905_0369455_576_941 121
110 3300044712 Ga0453684_0006427 Ga0453684_0006427_20960_21325 121
111 3300044712 Ga0453684_0020573 Ga0453684_0020573_7457_7822 121
112 3300050515 nmdc:mga0a205_488289_c1 nmdc:mga0a205_488289_c1_132_497 121
113 3300059490 Ga0587066_018738 Ga0587066_018738_132_497 121
114 3300059492 Ga0587073_0040134 Ga0587073_0040134_492_857 121
115 3300059503 Ga0587080_092063 Ga0587080_092063_181_546 121
116 3300059511 Ga0587091_047439 Ga0587091_047439_374_739 121
117 2162886007 SwRhRL2b_contig_291308 SwRhRL2b_0973.00005000 122
118 2162886007 SwRhRL2b_contig_3903249 SwRhRL2b_0411.00006200 122
119 2162886012 MBSR1b_contig_4233670 MBSR1b_0233.00004920 122
120 3300001977 JGI24746J21847_1016431 JGI24746J21847_10164311 122
121 3300002244 JGI24742J22300_10007131 JGI24742J22300_100071315 122
122 3300003322 rootL2_10282489 rootL2_102824894 122
123 3300003371 JGI26145J50221_1001211 JGI26145J50221_10012112 122
124 3300003503 JGI26141J51220_1003121 JGI26141J51220_10031213 122
125 3300003911 JGI25405J52794_10000604 JGI25405J52794_100006048 122
126 3300004799 Ga0058863_10059782 Ga0058863_100597824 122
127 3300004800 Ga0058861_12030344 Ga0058861_120303444 122
128 3300004801 Ga0058860_12230108 Ga0058860_122301082 122
129 3300004803 Ga0058862_10154497 Ga0058862_101544972 122
130 3300005289 Ga0065704_10005699 Ga0065704_100056998 122
131 3300005289 Ga0065704_10085970 Ga0065704_100859703 122
132 3300005289 Ga0065704_10190762 Ga0065704_101907622 122
133 3300005289 Ga0065704_10394263 Ga0065704_103942632 122
134 3300005290 Ga0065712_10374598 Ga0065712_103745981 122
135 3300005293 Ga0065715_10121974 Ga0065715_101219742 122
136 3300005293 Ga0065715_10445920 Ga0065715_104459201 122
137 3300005293 Ga0065715_11162660 Ga0065715_111626601 122
138 3300005295 Ga0065707_10025635 Ga0065707_100256353 122
139 3300005327 Ga0070658_11318469 Ga0070658_113184691 122
140 3300005328 Ga0070676_10018293 Ga0070676_100182934 122
141 3300005328 Ga0070676_10026300 Ga0070676_100263006 122
142 3300005328 Ga0070676_10541632 Ga0070676_105416322 122
143 3300005328 Ga0070676_11479038 Ga0070676_114790381 122
144 3300005329 Ga0070683_100000033 Ga0070683_10000003389 122
145 3300005329 Ga0070683_100004175 Ga0070683_1000041755 122
146 3300005330 Ga0070690_100005750 Ga0070690_10000575012 122
147 3300005330 Ga0070690_100030946 Ga0070690_1000309462 122
148 3300005330 Ga0070690_100065969 Ga0070690_1000659695 122
149 3300005330 Ga0070690_100256616 Ga0070690_1002566161 122
150 3300005330 Ga0070690_100776228 Ga0070690_1007762282 122
151 3300005331 Ga0070670_100006072 Ga0070670_10000607211 122
152 3300005331 Ga0070670_100029495 Ga0070670_10002949510 122
153 3300005331 Ga0070670_100218024 Ga0070670_1002180244 122
154 3300005331 Ga0070670_100303900 Ga0070670_1003039002 122
155 3300005331 Ga0070670_100324478 Ga0070670_1003244782 122
156 3300005331 Ga0070670_100546168 Ga0070670_1005461682 122
157 3300005331 Ga0070670_100676845 Ga0070670_1006768451 122
158 3300005331 Ga0070670_102113790 Ga0070670_1021137901 122
159 3300005333 Ga0070677_10005399 Ga0070677_100053998 122
160 3300005334 Ga0068869_100015378 Ga0068869_1000153783 122
161 3300005334 Ga0068869_100041040 Ga0068869_1000410405 122
162 3300005334 Ga0068869_100167792 Ga0068869_1001677924 122
163 3300005334 Ga0068869_100200424 Ga0068869_1002004243 122
164 3300005334 Ga0068869_100268990 Ga0068869_1002689903 122
165 3300005335 Ga0070666_10001387 Ga0070666_1000138713 122
166 3300005335 Ga0070666_10001507 Ga0070666_1000150713 122
167 3300005335 Ga0070666_10011673 Ga0070666_1001167311 122
168 3300005335 Ga0070666_10040333 Ga0070666_100403337 122
169 3300005335 Ga0070666_10162092 Ga0070666_101620923 122
170 3300005335 Ga0070666_10521737 Ga0070666_105217372 122
171 3300005335 Ga0070666_10958131 Ga0070666_109581312 122
172 3300005336 Ga0070680_100707670 Ga0070680_1007076702 122
173 3300005337 Ga0070682_100256877 Ga0070682_1002568772 122
174 3300005338 Ga0068868_100000632 Ga0068868_10000063213 122
175 3300005338 Ga0068868_100906099 Ga0068868_1009060992 122
176 3300005339 Ga0070660_100100051 Ga0070660_1001000513 122
177 3300005339 Ga0070660_100406772 Ga0070660_1004067722 122
178 3300005340 Ga0070689_100068193 Ga0070689_1000681935 122
179 3300005340 Ga0070689_100101559 Ga0070689_1001015595 122
180 3300005340 Ga0070689_100103520 Ga0070689_1001035201 122
181 3300005340 Ga0070689_100204302 Ga0070689_1002043022 122
182 3300005340 Ga0070689_100259633 Ga0070689_1002596333 122
183 3300005340 Ga0070689_100412269 Ga0070689_1004122692 122
184 3300005340 Ga0070689_100427886 Ga0070689_1004278862 122
185 3300005340 Ga0070689_100507022 Ga0070689_1005070222 122
186 3300005340 Ga0070689_100688822 Ga0070689_1006888222 122
187 3300005340 Ga0070689_100796799 Ga0070689_1007967992 122
188 3300005340 Ga0070689_101067422 Ga0070689_1010674222 122
189 3300005340 Ga0070689_101578820 Ga0070689_1015788202 122
190 3300005341 Ga0070691_10060647 Ga0070691_100606472 122
191 3300005341 Ga0070691_10309448 Ga0070691_103094481 122
192 3300005341 Ga0070691_10961339 Ga0070691_109613391 122
193 3300005343 Ga0070687_100051489 Ga0070687_1000514892 122
194 3300005343 Ga0070687_100114596 Ga0070687_1001145963 122
195 3300005343 Ga0070687_100136833 Ga0070687_1001368333 122
196 3300005343 Ga0070687_100427962 Ga0070687_1004279622 122
197 3300005343 Ga0070687_100465332 Ga0070687_1004653321 122
198 3300005343 Ga0070687_100515402 Ga0070687_1005154022 122
199 3300005344 Ga0070661_100010686 Ga0070661_10001068610 122
200 3300005345 Ga0070692_10001104 Ga0070692_1000110412 122
201 3300005345 Ga0070692_10004482 Ga0070692_1000448210 122
202 3300005345 Ga0070692_10102494 Ga0070692_101024942 122
203 3300005345 Ga0070692_11082159 Ga0070692_110821591 122
204 3300005345 Ga0070692_11154071 Ga0070692_111540711 122
205 3300005347 Ga0070668_100028739 Ga0070668_1000287398 122
206 3300005347 Ga0070668_100117946 Ga0070668_1001179463 122
207 3300005353 Ga0070669_100025363 Ga0070669_1000253635 122
208 3300005353 Ga0070669_100097584 Ga0070669_1000975843 122
209 3300005353 Ga0070669_100278937 Ga0070669_1002789372 122
210 3300005353 Ga0070669_101569360 Ga0070669_1015693601 122
211 3300005353 Ga0070669_101635007 Ga0070669_1016350071 122
212 3300005354 Ga0070675_100000007 Ga0070675_100000007258 122
213 3300005354 Ga0070675_100032515 Ga0070675_1000325156 122
214 3300005354 Ga0070675_100092402 Ga0070675_1000924021 122
215 3300005354 Ga0070675_100105703 Ga0070675_1001057034 122
216 3300005354 Ga0070675_100123749 Ga0070675_1001237494 122
217 3300005354 Ga0070675_100183980 Ga0070675_1001839802 122
218 3300005354 Ga0070675_100185688 Ga0070675_1001856883 122
219 3300005354 Ga0070675_100318549 Ga0070675_1003185494 122
220 3300005354 Ga0070675_100342603 Ga0070675_1003426034 122
221 3300005354 Ga0070675_101193667 Ga0070675_1011936672 122
222 3300005354 Ga0070675_101372066 Ga0070675_1013720662 122
223 3300005355 Ga0070671_100190181 Ga0070671_1001901811 122
224 3300005355 Ga0070671_100191826 Ga0070671_1001918263 122
225 3300005356 Ga0070674_100007457 Ga0070674_1000074578 122
226 3300005356 Ga0070674_100007905 Ga0070674_1000079059 122
227 3300005356 Ga0070674_100343338 Ga0070674_1003433384 122
228 3300005356 Ga0070674_100367453 Ga0070674_1003674533 122
229 3300005356 Ga0070674_100587817 Ga0070674_1005878172 122
230 3300005356 Ga0070674_101389008 Ga0070674_1013890082 122
231 3300005364 Ga0070673_100051191 Ga0070673_1000511913 122
232 3300005364 Ga0070673_100071173 Ga0070673_1000711733 122
233 3300005364 Ga0070673_100099405 Ga0070673_1000994053 122
234 3300005364 Ga0070673_100226177 Ga0070673_1002261772 122
235 3300005364 Ga0070673_100677707 Ga0070673_1006777071 122
236 3300005364 Ga0070673_101809998 Ga0070673_1018099982 122
237 3300005365 Ga0070688_100175984 Ga0070688_1001759844 122
238 3300005365 Ga0070688_100426728 Ga0070688_1004267283 122
239 3300005365 Ga0070688_100533180 Ga0070688_1005331802 122
240 3300005365 Ga0070688_100874058 Ga0070688_1008740582 122
241 3300005366 Ga0070659_100169875 Ga0070659_1001698754 122
242 3300005367 Ga0070667_100002921 Ga0070667_10000292113 122
243 3300005367 Ga0070667_100091951 Ga0070667_1000919516 122
244 3300005367 Ga0070667_100234407 Ga0070667_1002344072 122
245 3300005367 Ga0070667_100604574 Ga0070667_1006045742 122
246 3300005367 Ga0070667_100977738 Ga0070667_1009777382 122
247 3300005367 Ga0070667_101203917 Ga0070667_1012039171 122
248 3300005434 Ga0070709_10019666 Ga0070709_100196666 122
249 3300005434 Ga0070709_10075841 Ga0070709_100758414 122
250 3300005434 Ga0070709_10133261 Ga0070709_101332613 122
251 3300005434 Ga0070709_10444071 Ga0070709_104440713 122
252 3300005434 Ga0070709_10899752 Ga0070709_108997521 122
253 3300005437 Ga0070710_10298597 Ga0070710_102985973 122
254 3300005437 Ga0070710_10482662 Ga0070710_104826622 122
255 3300005438 Ga0070701_10014144 Ga0070701_100141444 122
256 3300005438 Ga0070701_10085332 Ga0070701_100853324 122
257 3300005438 Ga0070701_10562179 Ga0070701_105621792 122
258 3300005439 Ga0070711_100350307 Ga0070711_1003503072 122
259 3300005439 Ga0070711_100355922 Ga0070711_1003559222 122
260 3300005439 Ga0070711_100364914 Ga0070711_1003649143 122
261 3300005439 Ga0070711_101924400 Ga0070711_1019244001 122
262 3300005440 Ga0070705_100021563 Ga0070705_1000215636 122
263 3300005440 Ga0070705_100481005 Ga0070705_1004810052 122
264 3300005441 Ga0070700_100000050 Ga0070700_10000005091 122
265 3300005441 Ga0070700_100105528 Ga0070700_1001055282 122
266 3300005441 Ga0070700_100699064 Ga0070700_1006990642 122
267 3300005441 Ga0070700_101465297 Ga0070700_1014652971 122
268 3300005444 Ga0070694_100004904 Ga0070694_10000490413 122
269 3300005444 Ga0070694_100018421 Ga0070694_1000184215 122
270 3300005444 Ga0070694_100026241 Ga0070694_1000262418 122
271 3300005444 Ga0070694_100923232 Ga0070694_1009232321 122
272 3300005444 Ga0070694_101063760 Ga0070694_1010637602 122
273 3300005444 Ga0070694_101212678 Ga0070694_1012126781 122
274 3300005445 Ga0070708_100157158 Ga0070708_1001571583 122
275 3300005445 Ga0070708_100172273 Ga0070708_1001722732 122
276 3300005445 Ga0070708_100263368 Ga0070708_1002633683 122
277 3300005445 Ga0070708_100263468 Ga0070708_1002634682 122
278 3300005445 Ga0070708_101206272 Ga0070708_1012062722 122
279 3300005445 Ga0070708_101221233 Ga0070708_1012212332 122
280 3300005445 Ga0070708_101357583 Ga0070708_1013575832 122
281 3300005445 Ga0070708_101527797 Ga0070708_1015277971 122
282 3300005445 Ga0070708_101802727 Ga0070708_1018027271 122
283 3300005455 Ga0070663_100046825 Ga0070663_1000468252 122
284 3300005455 Ga0070663_100507789 Ga0070663_1005077893 122
285 3300005456 Ga0070678_100006394 Ga0070678_10000639411 122
286 3300005456 Ga0070678_100277422 Ga0070678_1002774224 122
287 3300005456 Ga0070678_100505663 Ga0070678_1005056632 122
288 3300005457 Ga0070662_100093375 Ga0070662_1000933753 122
289 3300005457 Ga0070662_100124500 Ga0070662_1001245004 122
290 3300005457 Ga0070662_100146168 Ga0070662_1001461681 122
291 3300005457 Ga0070662_100201195 Ga0070662_1002011952 122
292 3300005457 Ga0070662_101086956 Ga0070662_1010869562 122
293 3300005457 Ga0070662_101352454 Ga0070662_1013524541 122
294 3300005458 Ga0070681_10212292 Ga0070681_102122923 122
295 3300005458 Ga0070681_10388776 Ga0070681_103887761 122
296 3300005458 Ga0070681_11357294 Ga0070681_113572941 122
297 3300005459 Ga0068867_100016292 Ga0068867_1000162925 122
298 3300005459 Ga0068867_100023693 Ga0068867_1000236936 122
299 3300005459 Ga0068867_100025055 Ga0068867_1000250558 122
300 3300005459 Ga0068867_100261944 Ga0068867_1002619441 122
301 3300005459 Ga0068867_101344521 Ga0068867_1013445211 122
302 3300005466 Ga0070685_10112403 Ga0070685_101124032 122
303 3300005466 Ga0070685_10811138 Ga0070685_108111381 122
304 3300005467 Ga0070706_100005176 Ga0070706_10000517614 122
305 3300005467 Ga0070706_100021749 Ga0070706_10002174910 122
306 3300005467 Ga0070706_100060377 Ga0070706_1000603775 122
307 3300005467 Ga0070706_100084802 Ga0070706_1000848024 122
308 3300005467 Ga0070706_100143886 Ga0070706_1001438861 122
309 3300005467 Ga0070706_100152709 Ga0070706_1001527094 122
310 3300005467 Ga0070706_100160143 Ga0070706_1001601433 122
311 3300005467 Ga0070706_100185121 Ga0070706_1001851214 122
312 3300005467 Ga0070706_100253498 Ga0070706_1002534982 122
313 3300005467 Ga0070706_100290414 Ga0070706_1002904143 122
314 3300005468 Ga0070707_100006596 Ga0070707_1000065967 122
315 3300005468 Ga0070707_100084042 Ga0070707_1000840424 122
316 3300005468 Ga0070707_100222760 Ga0070707_1002227604 122
317 3300005468 Ga0070707_100271464 Ga0070707_1002714644 122
318 3300005468 Ga0070707_100459544 Ga0070707_1004595443 122
319 3300005468 Ga0070707_100574266 Ga0070707_1005742663 122
320 3300005468 Ga0070707_100613758 Ga0070707_1006137582 122
321 3300005471 Ga0070698_100004976 Ga0070698_10000497610 122
322 3300005471 Ga0070698_100022395 Ga0070698_1000223957 122
323 3300005471 Ga0070698_100039505 Ga0070698_10003950510 122
324 3300005471 Ga0070698_100150648 Ga0070698_1001506485 122
325 3300005471 Ga0070698_100337116 Ga0070698_1003371161 122
326 3300005471 Ga0070698_100358829 Ga0070698_1003588293 122
327 3300005518 Ga0070699_100242768 Ga0070699_1002427684 122
328 3300005518 Ga0070699_100270563 Ga0070699_1002705633 122
329 3300005518 Ga0070699_100331429 Ga0070699_1003314292 122
330 3300005518 Ga0070699_100372948 Ga0070699_1003729483 122
331 3300005518 Ga0070699_100894802 Ga0070699_1008948022 122
332 3300005518 Ga0070699_100980595 Ga0070699_1009805951 122
333 3300005518 Ga0070699_100988430 Ga0070699_1009884302 122
334 3300005518 Ga0070699_101044073 Ga0070699_1010440731 122
335 3300005518 Ga0070699_101840844 Ga0070699_1018408442 122
336 3300005530 Ga0070679_100029036 Ga0070679_10002903612 122
337 3300005530 Ga0070679_101391791 Ga0070679_1013917911 122
338 3300005535 Ga0070684_100006540 Ga0070684_10000654012 122
339 3300005535 Ga0070684_100034321 Ga0070684_1000343216 122
340 3300005535 Ga0070684_100315549 Ga0070684_1003155492 122
341 3300005535 Ga0070684_100501115 Ga0070684_1005011152 122
342 3300005535 Ga0070684_101450530 Ga0070684_1014505302 122
343 3300005536 Ga0070697_100002003 Ga0070697_10000200322 122
344 3300005536 Ga0070697_100006235 Ga0070697_10000623512 122
345 3300005536 Ga0070697_100016639 Ga0070697_1000166396 122
346 3300005536 Ga0070697_100050503 Ga0070697_1000505037 122
347 3300005536 Ga0070697_100057785 Ga0070697_1000577857 122
348 3300005536 Ga0070697_100073385 Ga0070697_1000733852 122
349 3300005536 Ga0070697_100131871 Ga0070697_1001318715 122
350 3300005536 Ga0070697_100173619 Ga0070697_1001736192 122
351 3300005536 Ga0070697_100292248 Ga0070697_1002922482 122
352 3300005536 Ga0070697_100788006 Ga0070697_1007880062 122
353 3300005536 Ga0070697_100935321 Ga0070697_1009353212 122
354 3300005536 Ga0070697_101020950 Ga0070697_1010209502 122
355 3300005536 Ga0070697_101092673 Ga0070697_1010926732 122
356 3300005539 Ga0068853_100010446 Ga0068853_1000104465 122
357 3300005539 Ga0068853_100558747 Ga0068853_1005587471 122
358 3300005543 Ga0070672_100005180 Ga0070672_1000051804 122
359 3300005543 Ga0070672_100057049 Ga0070672_1000570495 122
360 3300005543 Ga0070672_100074196 Ga0070672_1000741963 122
361 3300005543 Ga0070672_100078636 Ga0070672_1000786363 122
362 3300005543 Ga0070672_100083257 Ga0070672_1000832573 122
363 3300005543 Ga0070672_100189079 Ga0070672_1001890791 122
364 3300005543 Ga0070672_100222200 Ga0070672_1002222002 122
365 3300005543 Ga0070672_101545981 Ga0070672_1015459812 122
366 3300005544 Ga0070686_100022242 Ga0070686_1000222425 122
367 3300005544 Ga0070686_100065761 Ga0070686_1000657612 122
368 3300005544 Ga0070686_101648143 Ga0070686_1016481431 122
369 3300005545 Ga0070695_100043544 Ga0070695_1000435441 122
370 3300005545 Ga0070695_100121956 Ga0070695_1001219564 122
371 3300005545 Ga0070695_100123311 Ga0070695_1001233113 122
372 3300005545 Ga0070695_100147012 Ga0070695_1001470122 122
373 3300005545 Ga0070695_100332431 Ga0070695_1003324312 122
374 3300005546 Ga0070696_100012751 Ga0070696_1000127516 122
375 3300005546 Ga0070696_100015270 Ga0070696_1000152709 122
376 3300005546 Ga0070696_100068104 Ga0070696_1000681045 122
377 3300005546 Ga0070696_100143548 Ga0070696_1001435482 122
378 3300005546 Ga0070696_100290648 Ga0070696_1002906484 122
379 3300005546 Ga0070696_101204782 Ga0070696_1012047822 122
380 3300005547 Ga0070693_100037146 Ga0070693_1000371465 122
381 3300005548 Ga0070665_100022280 Ga0070665_1000222808 122
382 3300005548 Ga0070665_100027592 Ga0070665_1000275925 122
383 3300005548 Ga0070665_100425601 Ga0070665_1004256011 122
384 3300005548 Ga0070665_101177422 Ga0070665_1011774222 122
385 3300005548 Ga0070665_101605544 Ga0070665_1016055441 122
386 3300005549 Ga0070704_100044966 Ga0070704_1000449666 122
387 3300005549 Ga0070704_100199616 Ga0070704_1001996162 122
388 3300005549 Ga0070704_100228149 Ga0070704_1002281492 122
389 3300005549 Ga0070704_100346746 Ga0070704_1003467462 122
390 3300005549 Ga0070704_100408103 Ga0070704_1004081032 122
391 3300005563 Ga0068855_100000266 Ga0068855_10000026638 122
392 3300005563 Ga0068855_100946306 Ga0068855_1009463061 122
393 3300005564 Ga0070664_100005841 Ga0070664_10000584114 122
394 3300005564 Ga0070664_100436529 Ga0070664_1004365292 122
395 3300005564 Ga0070664_100688159 Ga0070664_1006881593 122
396 3300005564 Ga0070664_100756549 Ga0070664_1007565491 122
397 3300005577 Ga0068857_100333822 Ga0068857_1003338222 122
398 3300005578 Ga0068854_100126246 Ga0068854_1001262463 122
399 3300005578 Ga0068854_100248683 Ga0068854_1002486833 122
400 3300005578 Ga0068854_100287407 Ga0068854_1002874072 122
401 3300005578 Ga0068854_100331794 Ga0068854_1003317942 122
402 3300005578 Ga0068854_100978744 Ga0068854_1009787441 122
403 3300005614 Ga0068856_100007761 Ga0068856_10000776116 122
404 3300005614 Ga0068856_100009234 Ga0068856_1000092349 122
405 3300005614 Ga0068856_100859975 Ga0068856_1008599752 122
406 3300005614 Ga0068856_100867057 Ga0068856_1008670571 122
407 3300005614 Ga0068856_102227847 Ga0068856_1022278472 122
408 3300005615 Ga0070702_100039824 Ga0070702_1000398244 122
409 3300005615 Ga0070702_100067864 Ga0070702_1000678643 122
410 3300005615 Ga0070702_100187967 Ga0070702_1001879672 122
411 3300005615 Ga0070702_100299624 Ga0070702_1002996242 122
412 3300005615 Ga0070702_100550133 Ga0070702_1005501332 122
413 3300005615 Ga0070702_100565046 Ga0070702_1005650461 122
414 3300005616 Ga0068852_100160088 Ga0068852_1001600883 122
415 3300005616 Ga0068852_100419281 Ga0068852_1004192813 122
416 3300005616 Ga0068852_101268419 Ga0068852_1012684192 122
417 3300005617 Ga0068859_100000677 Ga0068859_10000067735 122
418 3300005617 Ga0068859_100163938 Ga0068859_1001639382 122
419 3300005617 Ga0068859_100284313 Ga0068859_1002843134 122
420 3300005617 Ga0068859_100310919 Ga0068859_1003109193 122
421 3300005617 Ga0068859_100425056 Ga0068859_1004250564 122
422 3300005617 Ga0068859_100971326 Ga0068859_1009713263 122
423 3300005617 Ga0068859_100995658 Ga0068859_1009956581 122
424 3300005617 Ga0068859_101953714 Ga0068859_1019537142 122
425 3300005618 Ga0068864_100031613 Ga0068864_1000316133 122
426 3300005618 Ga0068864_100094210 Ga0068864_1000942104 122
427 3300005618 Ga0068864_100108236 Ga0068864_1001082363 122
428 3300005618 Ga0068864_100197897 Ga0068864_1001978974 122
429 3300005618 Ga0068864_100669070 Ga0068864_1006690702 122
430 3300005718 Ga0068866_10270079 Ga0068866_102700792 122
431 3300005718 Ga0068866_10396743 Ga0068866_103967432 122
432 3300005718 Ga0068866_10972721 Ga0068866_109727211 122
433 3300005719 Ga0068861_100020829 Ga0068861_1000208292 122
434 3300005719 Ga0068861_100084086 Ga0068861_1000840861 122
435 3300005719 Ga0068861_100182569 Ga0068861_1001825692 122
436 3300005719 Ga0068861_100283062 Ga0068861_1002830622 122
437 3300005719 Ga0068861_100400314 Ga0068861_1004003142 122
438 3300005719 Ga0068861_100663397 Ga0068861_1006633972 122
439 3300005840 Ga0068870_10075673 Ga0068870_100756735 122
440 3300005840 Ga0068870_10389803 Ga0068870_103898033 122
441 3300005840 Ga0068870_10612235 Ga0068870_106122352 122
442 3300005841 Ga0068863_100061234 Ga0068863_1000612347 122
443 3300005841 Ga0068863_100135598 Ga0068863_1001355983 122
444 3300005841 Ga0068863_100614434 Ga0068863_1006144342 122
445 3300005841 Ga0068863_101247584 Ga0068863_1012475842 122
446 3300005842 Ga0068858_100004672 Ga0068858_10000467216 122
447 3300005842 Ga0068858_100183416 Ga0068858_1001834164 122
448 3300005842 Ga0068858_100479193 Ga0068858_1004791933 122
449 3300005842 Ga0068858_100940654 Ga0068858_1009406542 122
450 3300005842 Ga0068858_101981642 Ga0068858_1019816422 122
451 3300005843 Ga0068860_100005124 Ga0068860_10000512417 122
452 3300005843 Ga0068860_100042506 Ga0068860_1000425062 122
453 3300005843 Ga0068860_100110903 Ga0068860_1001109036 122
454 3300005843 Ga0068860_100407065 Ga0068860_1004070654 122
455 3300005843 Ga0068860_100625000 Ga0068860_1006250002 122
456 3300005843 Ga0068860_100709199 Ga0068860_1007091992 122
457 3300005843 Ga0068860_100937514 Ga0068860_1009375141 122
458 3300005843 Ga0068860_101594488 Ga0068860_1015944882 122
459 3300005843 Ga0068860_101787277 Ga0068860_1017872771 122
460 3300005844 Ga0068862_100003143 Ga0068862_10000314312 122
461 3300005844 Ga0068862_100040470 Ga0068862_1000404708 122
462 3300005844 Ga0068862_100091874 Ga0068862_1000918746 122
463 3300005844 Ga0068862_100103172 Ga0068862_1001031725 122
464 3300005844 Ga0068862_100115629 Ga0068862_1001156294 122
465 3300005844 Ga0068862_100446059 Ga0068862_1004460592 122
466 3300005844 Ga0068862_100483215 Ga0068862_1004832152 122
467 3300005937 Ga0081455_10000422 Ga0081455_1000042239 122
468 3300005937 Ga0081455_10010015 Ga0081455_1001001512 122
469 3300005937 Ga0081455_10028987 Ga0081455_100289873 122
470 3300005937 Ga0081455_10079207 Ga0081455_100792074 122
471 3300005937 Ga0081455_10448240 Ga0081455_104482402 122
472 3300005937 Ga0081455_10548763 Ga0081455_105487632 122
473 3300005983 Ga0081540_1027578 Ga0081540_10275785 122
474 3300006028 Ga0070717_10417247 Ga0070717_104172474 122
475 3300006028 Ga0070717_10756042 Ga0070717_107560423 122
476 3300006048 Ga0075363_100924436 Ga0075363_1009244361 122
477 3300006051 Ga0075364_11251736 Ga0075364_112517362 122
478 3300006058 Ga0075432_10006617 Ga0075432_100066178 122
479 3300006058 Ga0075432_10058477 Ga0075432_100584773 122
480 3300006058 Ga0075432_10395084 Ga0075432_103950842 122
481 3300006163 Ga0070715_10683641 Ga0070715_106836412 122
482 3300006173 Ga0070716_100270517 Ga0070716_1002705173 122
483 3300006173 Ga0070716_100442032 Ga0070716_1004420323 122
484 3300006175 Ga0070712_101881419 Ga0070712_1018814191 122
485 3300006237 Ga0097621_100030376 Ga0097621_1000303765 122
486 3300006237 Ga0097621_100492357 Ga0097621_1004923571 122
487 3300006237 Ga0097621_101324039 Ga0097621_1013240392 122
488 3300006237 Ga0097621_101458930 Ga0097621_1014589302 122
489 3300006237 Ga0097621_101491088 Ga0097621_1014910881 122
490 3300006358 Ga0068871_100129959 Ga0068871_1001299594 122
491 3300006358 Ga0068871_100377689 Ga0068871_1003776892 122
492 3300006358 Ga0068871_100454439 Ga0068871_1004544392 122
493 3300006358 Ga0068871_100711669 Ga0068871_1007116693 122
494 3300006358 Ga0068871_101018833 Ga0068871_1010188332 122
495 3300006358 Ga0068871_101282765 Ga0068871_1012827652 122
496 3300006844 Ga0075428_100002976 Ga0075428_10000297622 122
497 3300006844 Ga0075428_100003062 Ga0075428_10000306218 122
498 3300006844 Ga0075428_100032404 Ga0075428_1000324045 122
499 3300006844 Ga0075428_100069486 Ga0075428_1000694863 122
500 3300006844 Ga0075428_100209761 Ga0075428_1002097613 122
501 3300006844 Ga0075428_100307525 Ga0075428_1003075252 122
502 3300006844 Ga0075428_100371042 Ga0075428_1003710422 122
503 3300006846 Ga0075430_100002410 Ga0075430_10000241011 122
504 3300006846 Ga0075430_100006690 Ga0075430_10000669013 122
505 3300006846 Ga0075430_100040471 Ga0075430_1000404718 122
506 3300006846 Ga0075430_100299056 Ga0075430_1002990563 122
507 3300006846 Ga0075430_100517172 Ga0075430_1005171722 122
508 3300006847 Ga0075431_100003027 Ga0075431_10000302722 122
509 3300006847 Ga0075431_100179475 Ga0075431_1001794752 122
510 3300006847 Ga0075431_100350728 Ga0075431_1003507282 122
511 3300006847 Ga0075431_100638920 Ga0075431_1006389202 122
512 3300006847 Ga0075431_100703020 Ga0075431_1007030203 122
513 3300006847 Ga0075431_100806056 Ga0075431_1008060562 122
514 3300006847 Ga0075431_100841912 Ga0075431_1008419121 122
515 3300006847 Ga0075431_101001326 Ga0075431_1010013262 122
516 3300006847 Ga0075431_101649011 Ga0075431_1016490111 122
517 3300006852 Ga0075433_10002443 Ga0075433_1000244317 122
518 3300006852 Ga0075433_10005052 Ga0075433_1000505211 122
519 3300006852 Ga0075433_10065602 Ga0075433_100656023 122
520 3300006852 Ga0075433_10084417 Ga0075433_100844173 122
521 3300006852 Ga0075433_10088307 Ga0075433_100883075 122
522 3300006852 Ga0075433_10111840 Ga0075433_101118405 122
523 3300006852 Ga0075433_10163788 Ga0075433_101637884 122
524 3300006852 Ga0075433_10187982 Ga0075433_101879824 122
525 3300006852 Ga0075433_10447346 Ga0075433_104473464 122
526 3300006852 Ga0075433_10773066 Ga0075433_107730662 122
527 3300006852 Ga0075433_10830830 Ga0075433_108308303 122
528 3300006871 Ga0075434_100000038 Ga0075434_10000003830 122
529 3300006871 Ga0075434_100002471 Ga0075434_10000247113 122
530 3300006871 Ga0075434_100014841 Ga0075434_1000148416 122
531 3300006871 Ga0075434_100110302 Ga0075434_1001103026 122
532 3300006871 Ga0075434_100135458 Ga0075434_1001354582 122
533 3300006871 Ga0075434_100135556 Ga0075434_1001355562 122
534 3300006871 Ga0075434_100246019 Ga0075434_1002460191 122
535 3300006880 Ga0075429_100008584 Ga0075429_1000085848 122
536 3300006880 Ga0075429_100099339 Ga0075429_1000993393 122
537 3300006880 Ga0075429_100292591 Ga0075429_1002925912 122
538 3300006880 Ga0075429_100305175 Ga0075429_1003051754 122
539 3300006880 Ga0075429_100550555 Ga0075429_1005505553 122
540 3300006881 Ga0068865_100005424 Ga0068865_10000542419 122
541 3300006881 Ga0068865_100016601 Ga0068865_1000166017 122
542 3300006914 Ga0075436_100002790 Ga0075436_10000279015 122
543 3300006914 Ga0075436_100004621 Ga0075436_10000462116 122
544 3300006914 Ga0075436_100027386 Ga0075436_1000273865 122
545 3300006914 Ga0075436_100076615 Ga0075436_1000766155 122
546 3300006914 Ga0075436_100098077 Ga0075436_1000980775 122
547 3300006914 Ga0075436_100176487 Ga0075436_1001764871 122
548 3300006914 Ga0075436_100915907 Ga0075436_1009159072 122
549 3300006931 Ga0097620_100000677 Ga0097620_10000067735 122
550 3300006931 Ga0097620_100163956 Ga0097620_1001639562 122
551 3300006931 Ga0097620_100284333 Ga0097620_1002843333 122
552 3300006931 Ga0097620_100310923 Ga0097620_1003109233 122
553 3300006931 Ga0097620_100425040 Ga0097620_1004250402 122
554 3300006931 Ga0097620_100971311 Ga0097620_1009713113 122
555 3300006931 Ga0097620_100995693 Ga0097620_1009956931 122
556 3300006931 Ga0097620_101953811 Ga0097620_1019538112 122
557 3300007076 Ga0075435_100002461 Ga0075435_10000246114 122
558 3300007076 Ga0075435_100027645 Ga0075435_1000276453 122
559 3300007076 Ga0075435_100088348 Ga0075435_1000883485 122
560 3300007076 Ga0075435_100236973 Ga0075435_1002369735 122
561 3300007076 Ga0075435_100242611 Ga0075435_1002426113 122
562 3300007076 Ga0075435_100300747 Ga0075435_1003007472 122
563 3300007076 Ga0075435_100488791 Ga0075435_1004887911 122
564 3300007076 Ga0075435_100747103 Ga0075435_1007471032 122
565 3300007076 Ga0075435_101963034 Ga0075435_1019630341 122
566 3300007265 Ga0099794_10049726 Ga0099794_100497263 122
567 3300007265 Ga0099794_10197181 Ga0099794_101971813 122
568 3300007265 Ga0099794_10297416 Ga0099794_102974161 122
569 3300007788 Ga0099795_10020338 Ga0099795_100203384 122
570 3300009011 Ga0105251_10107526 Ga0105251_101075262 122
571 3300009011 Ga0105251_10293874 Ga0105251_102938742 122
572 3300009036 Ga0105244_10011650 Ga0105244_100116505 122
573 3300009093 Ga0105240_10127569 Ga0105240_101275696 122
574 3300009093 Ga0105240_10732476 Ga0105240_107324762 122
575 3300009094 Ga0111539_10000022 Ga0111539_1000002260 122
576 3300009094 Ga0111539_10058961 Ga0111539_1005896111 122
577 3300009094 Ga0111539_10199861 Ga0111539_101998615 122
578 3300009094 Ga0111539_10349380 Ga0111539_103493803 122
579 3300009094 Ga0111539_10923746 Ga0111539_109237462 122
580 3300009094 Ga0111539_10934786 Ga0111539_109347862 122
581 3300009094 Ga0111539_12242981 Ga0111539_122429812 122
582 3300009094 Ga0111539_12975874 Ga0111539_129758742 122
583 3300009098 Ga0105245_10001507 Ga0105245_1000150726 122
584 3300009098 Ga0105245_10368411 Ga0105245_103684114 122
585 3300009098 Ga0105245_11361665 Ga0105245_113616651 122
586 3300009098 Ga0105245_11449824 Ga0105245_114498242 122
587 3300009101 Ga0105247_10151259 Ga0105247_101512593 122
588 3300009101 Ga0105247_10271221 Ga0105247_102712213 122
589 3300009147 Ga0114129_10000247 Ga0114129_1000024720 122
590 3300009147 Ga0114129_10001417 Ga0114129_1000141732 122
591 3300009147 Ga0114129_10002852 Ga0114129_1000285213 122
592 3300009147 Ga0114129_10046019 Ga0114129_100460193 122
593 3300009147 Ga0114129_10063914 Ga0114129_100639147 122
594 3300009147 Ga0114129_10177970 Ga0114129_101779704 122
595 3300009147 Ga0114129_10521343 Ga0114129_105213432 122
596 3300009147 Ga0114129_10525620 Ga0114129_105256202 122
597 3300009147 Ga0114129_10715113 Ga0114129_107151132 122
598 3300009147 Ga0114129_11090486 Ga0114129_110904862 122
599 3300009147 Ga0114129_11460040 Ga0114129_114600402 122
600 3300009147 Ga0114129_11718743 Ga0114129_117187432 122
601 3300009148 Ga0105243_10000009 Ga0105243_10000009209 122
602 3300009148 Ga0105243_11007106 Ga0105243_110071062 122
603 3300009174 Ga0105241_10080778 Ga0105241_100807785 122
604 3300009174 Ga0105241_11962224 Ga0105241_119622241 122
605 3300009176 Ga0105242_10012536 Ga0105242_100125364 122
606 3300009176 Ga0105242_10080321 Ga0105242_100803215 122
607 3300009176 Ga0105242_10748162 Ga0105242_107481622 122
608 3300009176 Ga0105242_12012325 Ga0105242_120123251 122
609 3300009177 Ga0105248_10008944 Ga0105248_1000894411 122
610 3300009177 Ga0105248_10223859 Ga0105248_102238592 122
611 3300009177 Ga0105248_10689478 Ga0105248_106894782 122
612 3300009177 Ga0105248_10960038 Ga0105248_109600382 122
613 3300009177 Ga0105248_11517177 Ga0105248_115171772 122
614 3300009177 Ga0105248_12580991 Ga0105248_125809911 122
615 3300009177 Ga0105248_12890409 Ga0105248_128904091 122
616 3300009177 Ga0105248_13041606 Ga0105248_130416061 122
617 3300009545 Ga0105237_10066336 Ga0105237_100663367 122
618 3300009551 Ga0105238_10145814 Ga0105238_101458144 122
619 3300009551 Ga0105238_10456576 Ga0105238_104565763 122
620 3300009551 Ga0105238_11023362 Ga0105238_110233622 122
621 3300009553 Ga0105249_10026603 Ga0105249_1002660311 122
622 3300009553 Ga0105249_10725262 Ga0105249_107252623 122
623 3300009553 Ga0105249_11281389 Ga0105249_112813891 122
624 3300009553 Ga0105249_11793297 Ga0105249_117932972 122
625 3300009553 Ga0105249_12996498 Ga0105249_129964982 122
626 3300010159 Ga0099796_10090524 Ga0099796_100905242 122
627 3300010159 Ga0099796_10554021 Ga0099796_105540211 122
628 3300010375 Ga0105239_11699799 Ga0105239_116997992 122
629 3300010375 Ga0105239_12145162 Ga0105239_121451622 122
630 3300010375 Ga0105239_12558569 Ga0105239_125585692 122
631 3300010375 Ga0105239_13315569 Ga0105239_133155691 122
632 3300011119 Ga0105246_10235421 Ga0105246_102354212 122
633 3300012502 Ga0157347_1066412 Ga0157347_10664121 122
634 3300013100 Ga0157373_10325377 Ga0157373_103253771 122
635 3300013100 Ga0157373_10638818 Ga0157373_106388181 122
636 3300013105 Ga0157369_10001943 Ga0157369_1000194321 122
637 3300013105 Ga0157369_10100872 Ga0157369_101008726 122
638 3300013105 Ga0157369_11203607 Ga0157369_112036072 122
639 3300013296 Ga0157374_10002664 Ga0157374_1000266417 122
640 3300013296 Ga0157374_10039567 Ga0157374_100395675 122
641 3300013296 Ga0157374_10508101 Ga0157374_105081013 122
642 3300013297 Ga0157378_10012246 Ga0157378_1001224613 122
643 3300013297 Ga0157378_10096295 Ga0157378_100962954 122
644 3300013297 Ga0157378_10227763 Ga0157378_102277635 122
645 3300013297 Ga0157378_10300065 Ga0157378_103000652 122
646 3300013297 Ga0157378_11002773 Ga0157378_110027732 122
647 3300013297 Ga0157378_12184179 Ga0157378_121841791 122
648 3300013306 Ga0163162_10093242 Ga0163162_100932424 122
649 3300013306 Ga0163162_10212271 Ga0163162_102122715 122
650 3300013306 Ga0163162_10429766 Ga0163162_104297663 122
651 3300013307 Ga0157372_11136133 Ga0157372_111361332 122
652 3300013308 Ga0157375_10012356 Ga0157375_1001235610 122
653 3300013308 Ga0157375_10021527 Ga0157375_1002152713 122
654 3300013308 Ga0157375_10064497 Ga0157375_100644975 122
655 3300013308 Ga0157375_10237799 Ga0157375_102377993 122
656 3300013308 Ga0157375_10379526 Ga0157375_103795261 122
657 3300013308 Ga0157375_10536984 Ga0157375_105369843 122
658 3300013308 Ga0157375_10749389 Ga0157375_107493892 122
659 3300013308 Ga0157375_10928052 Ga0157375_109280521 122
660 3300013308 Ga0157375_11218204 Ga0157375_112182042 122
661 3300013308 Ga0157375_12260814 Ga0157375_122608142 122
662 3300014325 Ga0163163_10036365 Ga0163163_100363658 122
663 3300014325 Ga0163163_10053167 Ga0163163_100531672 122
664 3300014325 Ga0163163_10054913 Ga0163163_100549137 122
665 3300014325 Ga0163163_10139935 Ga0163163_101399354 122
666 3300014325 Ga0163163_10271121 Ga0163163_102711215 122
667 3300014325 Ga0163163_10313241 Ga0163163_103132413 122
668 3300014325 Ga0163163_10365909 Ga0163163_103659094 122
669 3300014325 Ga0163163_10723073 Ga0163163_107230731 122
670 3300014325 Ga0163163_10728194 Ga0163163_107281943 122
671 3300014325 Ga0163163_10844320 Ga0163163_108443202 122
672 3300014325 Ga0163163_10928670 Ga0163163_109286702 122
673 3300014325 Ga0163163_11145053 Ga0163163_111450532 122
674 3300014326 Ga0157380_10001355 Ga0157380_1000135513 122
675 3300014326 Ga0157380_10205467 Ga0157380_102054673 122
676 3300014326 Ga0157380_10688406 Ga0157380_106884063 122
677 3300014326 Ga0157380_12863327 Ga0157380_128633271 122
678 3300014326 Ga0157380_13133087 Ga0157380_131330872 122
679 3300014497 Ga0182008_10834581 Ga0182008_108345812 122
680 3300014745 Ga0157377_10000414 Ga0157377_100004145 122
681 3300014745 Ga0157377_10046193 Ga0157377_100461933 122
682 3300014745 Ga0157377_10191602 Ga0157377_101916023 122
683 3300014968 Ga0157379_10000714 Ga0157379_100007145 122
684 3300014968 Ga0157379_10138032 Ga0157379_101380325 122
685 3300014968 Ga0157379_10307620 Ga0157379_103076202 122
686 3300014968 Ga0157379_10533826 Ga0157379_105338263 122
687 3300014968 Ga0157379_10549618 Ga0157379_105496182 122
688 3300014968 Ga0157379_11303935 Ga0157379_113039352 122
689 3300014968 Ga0157379_11498675 Ga0157379_114986752 122
690 3300014969 Ga0157376_10000003 Ga0157376_10000003246 122
691 3300014969 Ga0157376_10046438 Ga0157376_100464388 122
692 3300014969 Ga0157376_10654389 Ga0157376_106543892 122
693 3300014969 Ga0157376_10676509 Ga0157376_106765093 122
694 3300014969 Ga0157376_11115777 Ga0157376_111157773 122
695 3300014969 Ga0157376_11341442 Ga0157376_113414422 122
696 3300014969 Ga0157376_11493894 Ga0157376_114938942 122
697 3300014969 Ga0157376_11763036 Ga0157376_117630362 122
698 3300015262 Ga0182007_10306095 Ga0182007_103060951 122
699 3300017792 Ga0163161_10063568 Ga0163161_100635686 122
700 3300020070 Ga0206356_11765259 Ga0206356_117652595 122
701 3300020078 Ga0206352_10878108 Ga0206352_108781085 122
702 3300021358 Ga0213873_10000018 Ga0213873_1000001888 122
703 3300021384 Ga0213876_10000058 Ga0213876_1000005893 122
704 3300025271 Ga0207666_1001625 Ga0207666_10016256 122
705 3300025315 Ga0207697_10009073 Ga0207697_1000907311 122
706 3300025315 Ga0207697_10068448 Ga0207697_100684482 122
707 3300025728 Ga0207655_1019809 Ga0207655_10198092 122
708 3300025885 Ga0207653_10128253 Ga0207653_101282533 122
709 3300025893 Ga0207682_10001734 Ga0207682_1000173410 122
710 3300025893 Ga0207682_10143047 Ga0207682_101430472 122
711 3300025898 Ga0207692_10077477 Ga0207692_100774774 122
712 3300025898 Ga0207692_10915755 Ga0207692_109157552 122
713 3300025899 Ga0207642_10101044 Ga0207642_101010442 122
714 3300025900 Ga0207710_10203240 Ga0207710_102032403 122
715 3300025900 Ga0207710_10504380 Ga0207710_105043801 122
716 3300025901 Ga0207688_10006667 Ga0207688_100066678 122
717 3300025903 Ga0207680_10003484 Ga0207680_100034845 122
718 3300025903 Ga0207680_10007364 Ga0207680_100073647 122
719 3300025903 Ga0207680_10033943 Ga0207680_100339434 122
720 3300025903 Ga0207680_10152895 Ga0207680_101528952 122
721 3300025903 Ga0207680_10374993 Ga0207680_103749932 122
722 3300025903 Ga0207680_10472711 Ga0207680_104727112 122
723 3300025903 Ga0207680_10571957 Ga0207680_105719572 122
724 3300025903 Ga0207680_10793122 Ga0207680_107931222 122
725 3300025904 Ga0207647_10068009 Ga0207647_100680093 122
726 3300025904 Ga0207647_10118635 Ga0207647_101186352 122
727 3300025904 Ga0207647_10422104 Ga0207647_104221041 122
728 3300025905 Ga0207685_10194185 Ga0207685_101941852 122
729 3300025905 Ga0207685_10353728 Ga0207685_103537282 122
730 3300025905 Ga0207685_10353837 Ga0207685_103538372 122
731 3300025905 Ga0207685_10811008 Ga0207685_108110081 122
732 3300025906 Ga0207699_10068910 Ga0207699_100689102 122
733 3300025906 Ga0207699_10096815 Ga0207699_100968152 122
734 3300025906 Ga0207699_10205798 Ga0207699_102057982 122
735 3300025906 Ga0207699_10276684 Ga0207699_102766842 122
736 3300025906 Ga0207699_10423402 Ga0207699_104234023 122
737 3300025907 Ga0207645_10006128 Ga0207645_1000612811 122
738 3300025907 Ga0207645_10021058 Ga0207645_100210587 122
739 3300025907 Ga0207645_10123441 Ga0207645_101234415 122
740 3300025908 Ga0207643_10001235 Ga0207643_100012358 122
741 3300025908 Ga0207643_10017199 Ga0207643_100171997 122
742 3300025908 Ga0207643_10081943 Ga0207643_100819432 122
743 3300025908 Ga0207643_10206890 Ga0207643_102068902 122
744 3300025910 Ga0207684_10011604 Ga0207684_100116047 122
745 3300025910 Ga0207684_10035936 Ga0207684_100359367 122
746 3300025910 Ga0207684_10043926 Ga0207684_100439268 122
747 3300025910 Ga0207684_10072862 Ga0207684_100728621 122
748 3300025910 Ga0207684_10134177 Ga0207684_101341772 122
749 3300025910 Ga0207684_10141204 Ga0207684_101412044 122
750 3300025910 Ga0207684_10190569 Ga0207684_101905692 122
751 3300025910 Ga0207684_10238580 Ga0207684_102385803 122
752 3300025910 Ga0207684_10544790 Ga0207684_105447902 122
753 3300025910 Ga0207684_11008326 Ga0207684_110083261 122
754 3300025911 Ga0207654_10623314 Ga0207654_106233142 122
755 3300025912 Ga0207707_10070280 Ga0207707_100702803 122
756 3300025912 Ga0207707_10899627 Ga0207707_108996272 122
757 3300025913 Ga0207695_10091115 Ga0207695_100911156 122
758 3300025913 Ga0207695_10433346 Ga0207695_104333463 122
759 3300025915 Ga0207693_10090246 Ga0207693_100902463 122
760 3300025915 Ga0207693_10218115 Ga0207693_102181151 122
761 3300025915 Ga0207693_10299968 Ga0207693_102999682 122
762 3300025915 Ga0207693_10378669 Ga0207693_103786692 122
763 3300025915 Ga0207693_11170599 Ga0207693_111705991 122
764 3300025916 Ga0207663_10052095 Ga0207663_100520953 122
765 3300025916 Ga0207663_10173978 Ga0207663_101739782 122
766 3300025916 Ga0207663_10383107 Ga0207663_103831072 122
767 3300025917 Ga0207660_10774686 Ga0207660_107746862 122
768 3300025917 Ga0207660_11262676 Ga0207660_112626761 122
769 3300025918 Ga0207662_10068221 Ga0207662_100682215 122
770 3300025918 Ga0207662_10086791 Ga0207662_100867913 122
771 3300025918 Ga0207662_10136184 Ga0207662_101361843 122
772 3300025918 Ga0207662_11017249 Ga0207662_110172491 122
773 3300025919 Ga0207657_10064105 Ga0207657_100641053 122
774 3300025919 Ga0207657_10489885 Ga0207657_104898852 122
775 3300025919 Ga0207657_10604040 Ga0207657_106040401 122
776 3300025919 Ga0207657_10653070 Ga0207657_106530701 122
777 3300025920 Ga0207649_10268711 Ga0207649_102687113 122
778 3300025920 Ga0207649_10724585 Ga0207649_107245852 122
779 3300025921 Ga0207652_10293903 Ga0207652_102939032 122
780 3300025922 Ga0207646_10000343 Ga0207646_1000034314 122
781 3300025922 Ga0207646_10080346 Ga0207646_100803465 122
782 3300025922 Ga0207646_10140516 Ga0207646_101405165 122
783 3300025922 Ga0207646_10147358 Ga0207646_101473584 122
784 3300025922 Ga0207646_10207606 Ga0207646_102076062 122
785 3300025922 Ga0207646_10215582 Ga0207646_102155823 122
786 3300025922 Ga0207646_10333027 Ga0207646_103330273 122
787 3300025922 Ga0207646_10581853 Ga0207646_105818533 122
788 3300025922 Ga0207646_10586794 Ga0207646_105867941 122
789 3300025922 Ga0207646_10821657 Ga0207646_108216571 122
790 3300025923 Ga0207681_10002742 Ga0207681_1000274212 122
791 3300025923 Ga0207681_10152701 Ga0207681_101527013 122
792 3300025923 Ga0207681_10287031 Ga0207681_102870313 122
793 3300025923 Ga0207681_10767289 Ga0207681_107672891 122
794 3300025924 Ga0207694_10176365 Ga0207694_101763653 122
795 3300025925 Ga0207650_10000082 Ga0207650_100000823 122
796 3300025925 Ga0207650_10011593 Ga0207650_1001159311 122
797 3300025925 Ga0207650_10048909 Ga0207650_100489092 122
798 3300025925 Ga0207650_10116501 Ga0207650_101165012 122
799 3300025925 Ga0207650_10302623 Ga0207650_103026233 122
800 3300025925 Ga0207650_10768909 Ga0207650_107689092 122
801 3300025926 Ga0207659_10000036 Ga0207659_1000003647 122
802 3300025926 Ga0207659_10115953 Ga0207659_101159533 122
803 3300025926 Ga0207659_10120504 Ga0207659_101205043 122
804 3300025926 Ga0207659_10287415 Ga0207659_102874152 122
805 3300025926 Ga0207659_10329048 Ga0207659_103290482 122
806 3300025926 Ga0207659_10403812 Ga0207659_104038122 122
807 3300025926 Ga0207659_10669329 Ga0207659_106693292 122
808 3300025926 Ga0207659_10779324 Ga0207659_107793243 122
809 3300025927 Ga0207687_10000005 Ga0207687_10000005424 122
810 3300025927 Ga0207687_10607398 Ga0207687_106073983 122
811 3300025927 Ga0207687_11309652 Ga0207687_113096522 122
812 3300025927 Ga0207687_11549680 Ga0207687_115496801 122
813 3300025928 Ga0207700_10051399 Ga0207700_100513995 122
814 3300025928 Ga0207700_10089784 Ga0207700_100897846 122
815 3300025928 Ga0207700_10801507 Ga0207700_108015071 122
816 3300025928 Ga0207700_10945405 Ga0207700_109454051 122
817 3300025931 Ga0207644_10055836 Ga0207644_100558365 122
818 3300025931 Ga0207644_10259586 Ga0207644_102595863 122
819 3300025931 Ga0207644_11465725 Ga0207644_114657251 122
820 3300025932 Ga0207690_10025055 Ga0207690_100250555 122
821 3300025932 Ga0207690_10136438 Ga0207690_101364384 122
822 3300025933 Ga0207706_10013582 Ga0207706_100135826 122
823 3300025933 Ga0207706_10073033 Ga0207706_100730336 122
824 3300025933 Ga0207706_10091565 Ga0207706_100915655 122
825 3300025933 Ga0207706_10105904 Ga0207706_101059044 122
826 3300025933 Ga0207706_10433223 Ga0207706_104332233 122
827 3300025933 Ga0207706_10588375 Ga0207706_105883752 122
828 3300025933 Ga0207706_10954501 Ga0207706_109545012 122
829 3300025934 Ga0207686_10001508 Ga0207686_100015086 122
830 3300025934 Ga0207686_10217571 Ga0207686_102175714 122
831 3300025935 Ga0207709_10000026 Ga0207709_10000026210 122
832 3300025935 Ga0207709_10210974 Ga0207709_102109743 122
833 3300025935 Ga0207709_11215995 Ga0207709_112159951 122
834 3300025936 Ga0207670_10070690 Ga0207670_100706905 122
835 3300025936 Ga0207670_10136374 Ga0207670_101363742 122
836 3300025936 Ga0207670_10148699 Ga0207670_101486993 122
837 3300025936 Ga0207670_10150696 Ga0207670_101506962 122
838 3300025936 Ga0207670_10309877 Ga0207670_103098773 122
839 3300025936 Ga0207670_10474085 Ga0207670_104740853 122
840 3300025936 Ga0207670_10531204 Ga0207670_105312043 122
841 3300025936 Ga0207670_10555149 Ga0207670_105551492 122
842 3300025936 Ga0207670_10850257 Ga0207670_108502572 122
843 3300025936 Ga0207670_11671863 Ga0207670_116718632 122
844 3300025937 Ga0207669_10100540 Ga0207669_101005404 122
845 3300025937 Ga0207669_10323551 Ga0207669_103235514 122
846 3300025937 Ga0207669_10705697 Ga0207669_107056972 122
847 3300025937 Ga0207669_11881879 Ga0207669_118818791 122
848 3300025938 Ga0207704_10003857 Ga0207704_1000385711 122
849 3300025938 Ga0207704_10029913 Ga0207704_100299133 122
850 3300025938 Ga0207704_10765814 Ga0207704_107658142 122
851 3300025938 Ga0207704_11810931 Ga0207704_118109311 122
852 3300025939 Ga0207665_10006268 Ga0207665_1000626814 122
853 3300025939 Ga0207665_10009968 Ga0207665_1000996810 122
854 3300025939 Ga0207665_10026836 Ga0207665_100268366 122
855 3300025939 Ga0207665_10251041 Ga0207665_102510412 122
856 3300025939 Ga0207665_10305436 Ga0207665_103054362 122
857 3300025939 Ga0207665_10457139 Ga0207665_104571392 122
858 3300025939 Ga0207665_10496467 Ga0207665_104964672 122
859 3300025939 Ga0207665_10548002 Ga0207665_105480021 122
860 3300025939 Ga0207665_10864190 Ga0207665_108641902 122
861 3300025940 Ga0207691_10000326 Ga0207691_1000032643 122
862 3300025940 Ga0207691_10002644 Ga0207691_1000264422 122
863 3300025940 Ga0207691_10006947 Ga0207691_1000694716 122
864 3300025940 Ga0207691_10133717 Ga0207691_101337175 122
865 3300025940 Ga0207691_10204635 Ga0207691_102046355 122
866 3300025940 Ga0207691_10289454 Ga0207691_102894541 122
867 3300025940 Ga0207691_10727844 Ga0207691_107278441 122
868 3300025940 Ga0207691_11018557 Ga0207691_110185571 122
869 3300025941 Ga0207711_10007454 Ga0207711_100074549 122
870 3300025941 Ga0207711_10197035 Ga0207711_101970355 122
871 3300025941 Ga0207711_10389374 Ga0207711_103893741 122
872 3300025941 Ga0207711_11985335 Ga0207711_119853351 122
873 3300025942 Ga0207689_10009503 Ga0207689_100095038 122
874 3300025942 Ga0207689_10020085 Ga0207689_1002008510 122
875 3300025942 Ga0207689_10065221 Ga0207689_100652214 122
876 3300025942 Ga0207689_10140200 Ga0207689_101402002 122
877 3300025942 Ga0207689_10340280 Ga0207689_103402802 122
878 3300025942 Ga0207689_11199927 Ga0207689_111999271 122
879 3300025942 Ga0207689_11416054 Ga0207689_114160541 122
880 3300025944 Ga0207661_10000006 Ga0207661_10000006456 122
881 3300025944 Ga0207661_10007008 Ga0207661_100070085 122
882 3300025944 Ga0207661_10082186 Ga0207661_100821862 122
883 3300025945 Ga0207679_10071083 Ga0207679_100710837 122
884 3300025945 Ga0207679_10482510 Ga0207679_104825103 122
885 3300025945 Ga0207679_10566129 Ga0207679_105661293 122
886 3300025945 Ga0207679_10716020 Ga0207679_107160202 122
887 3300025945 Ga0207679_11403420 Ga0207679_114034202 122
888 3300025945 Ga0207679_11573638 Ga0207679_115736382 122
889 3300025949 Ga0207667_10003431 Ga0207667_1000343114 122
890 3300025949 Ga0207667_10023566 Ga0207667_100235663 122
891 3300025960 Ga0207651_10006583 Ga0207651_100065838 122
892 3300025960 Ga0207651_10007125 Ga0207651_1000712512 122
893 3300025960 Ga0207651_10064605 Ga0207651_100646055 122
894 3300025960 Ga0207651_10099429 Ga0207651_100994293 122
895 3300025960 Ga0207651_10742043 Ga0207651_107420431 122
896 3300025960 Ga0207651_10855995 Ga0207651_108559952 122
897 3300025960 Ga0207651_11107468 Ga0207651_111074681 122
898 3300025961 Ga0207712_10290886 Ga0207712_102908863 122
899 3300025961 Ga0207712_10624678 Ga0207712_106246781 122
900 3300025961 Ga0207712_10782455 Ga0207712_107824552 122
901 3300025961 Ga0207712_10943791 Ga0207712_109437912 122
902 3300025972 Ga0207668_10018999 Ga0207668_100189993 122
903 3300025972 Ga0207668_10554333 Ga0207668_105543331 122
904 3300025981 Ga0207640_10107477 Ga0207640_101074772 122
905 3300025981 Ga0207640_10305543 Ga0207640_103055434 122
906 3300025986 Ga0207658_10001637 Ga0207658_1000163722 122
907 3300025986 Ga0207658_10055938 Ga0207658_100559386 122
908 3300025986 Ga0207658_10351037 Ga0207658_103510371 122
909 3300026023 Ga0207677_10000101 Ga0207677_1000010164 122
910 3300026023 Ga0207677_10218669 Ga0207677_102186693 122
911 3300026023 Ga0207677_10291313 Ga0207677_102913132 122
912 3300026023 Ga0207677_11090546 Ga0207677_110905462 122
913 3300026023 Ga0207677_11423989 Ga0207677_114239892 122
914 3300026023 Ga0207677_11805638 Ga0207677_118056382 122
915 3300026035 Ga0207703_10007604 Ga0207703_1000760413 122
916 3300026035 Ga0207703_10316451 Ga0207703_103164513 122
917 3300026035 Ga0207703_10392236 Ga0207703_103922363 122
918 3300026035 Ga0207703_10410089 Ga0207703_104100892 122
919 3300026035 Ga0207703_11039613 Ga0207703_110396132 122
920 3300026035 Ga0207703_11467887 Ga0207703_114678872 122
921 3300026035 Ga0207703_11536237 Ga0207703_115362372 122
922 3300026041 Ga0207639_10000013 Ga0207639_1000001335 122
923 3300026041 Ga0207639_10189920 Ga0207639_101899205 122
924 3300026041 Ga0207639_10492689 Ga0207639_104926892 122
925 3300026067 Ga0207678_10049059 Ga0207678_100490597 122
926 3300026067 Ga0207678_10190888 Ga0207678_101908883 122
927 3300026067 Ga0207678_10222677 Ga0207678_102226774 122
928 3300026067 Ga0207678_10759286 Ga0207678_107592862 122
929 3300026067 Ga0207678_11932014 Ga0207678_119320141 122
930 3300026075 Ga0207708_10000041 Ga0207708_1000004148 122
931 3300026075 Ga0207708_10011108 Ga0207708_100111082 122
932 3300026075 Ga0207708_10012451 Ga0207708_1001245112 122
933 3300026075 Ga0207708_10906223 Ga0207708_109062231 122
934 3300026078 Ga0207702_10001471 Ga0207702_1000147118 122
935 3300026078 Ga0207702_10011175 Ga0207702_1001117511 122
936 3300026078 Ga0207702_10182964 Ga0207702_101829642 122
937 3300026078 Ga0207702_10332278 Ga0207702_103322784 122
938 3300026078 Ga0207702_10808274 Ga0207702_108082742 122
939 3300026078 Ga0207702_10819429 Ga0207702_108194293 122
940 3300026078 Ga0207702_11743255 Ga0207702_117432552 122
941 3300026088 Ga0207641_10037244 Ga0207641_100372449 122
942 3300026088 Ga0207641_10048111 Ga0207641_100481115 122
943 3300026088 Ga0207641_10137639 Ga0207641_101376395 122
944 3300026088 Ga0207641_10147519 Ga0207641_101475195 122
945 3300026088 Ga0207641_10465979 Ga0207641_104659792 122
946 3300026088 Ga0207641_10611981 Ga0207641_106119812 122
947 3300026088 Ga0207641_10688216 Ga0207641_106882162 122
948 3300026089 Ga0207648_10011154 Ga0207648_1001115410 122
949 3300026089 Ga0207648_10024555 Ga0207648_100245554 122
950 3300026089 Ga0207648_10035580 Ga0207648_100355804 122
951 3300026089 Ga0207648_10043194 Ga0207648_100431949 122
952 3300026089 Ga0207648_10307115 Ga0207648_103071152 122
953 3300026089 Ga0207648_10359341 Ga0207648_103593412 122
954 3300026095 Ga0207676_10098517 Ga0207676_100985173 122
955 3300026095 Ga0207676_10177426 Ga0207676_101774262 122
956 3300026095 Ga0207676_10214264 Ga0207676_102142644 122
957 3300026095 Ga0207676_10500738 Ga0207676_105007383 122
958 3300026095 Ga0207676_10736336 Ga0207676_107363362 122
959 3300026116 Ga0207674_11570213 Ga0207674_115702131 122
960 3300026116 Ga0207674_11773476 Ga0207674_117734762 122
961 3300026118 Ga0207675_100002645 Ga0207675_10000264520 122
962 3300026118 Ga0207675_100002673 Ga0207675_10000267321 122
963 3300026118 Ga0207675_100013850 Ga0207675_1000138507 122
964 3300026118 Ga0207675_100060186 Ga0207675_1000601867 122
965 3300026118 Ga0207675_100109886 Ga0207675_1001098866 122
966 3300026121 Ga0207683_10005107 Ga0207683_1000510713 122
967 3300026121 Ga0207683_10317284 Ga0207683_103172844 122
968 3300026121 Ga0207683_10512688 Ga0207683_105126882 122
969 3300026142 Ga0207698_10043801 Ga0207698_100438018 122
970 3300026142 Ga0207698_10208854 Ga0207698_102088544 122
971 3300026142 Ga0207698_10703309 Ga0207698_107033093 122
972 3300026142 Ga0207698_12121934 Ga0207698_121219341 122
973 3300027360 Ga0209969_1040868 Ga0209969_10408682 122
974 3300027378 Ga0209981_1011093 Ga0209981_10110933 122
975 3300027395 Ga0209996_1014048 Ga0209996_10140481 122
976 3300027512 Ga0209179_1027708 Ga0209179_10277083 122
977 3300027526 Ga0209968_1002058 Ga0209968_10020586 122
978 3300027552 Ga0209982_1007080 Ga0209982_10070803 122
979 3300027617 Ga0210002_1020599 Ga0210002_10205993 122
980 3300027665 Ga0209983_1000280 Ga0209983_100028013 122
981 3300027671 Ga0209588_1025351 Ga0209588_10253514 122
982 3300027671 Ga0209588_1032623 Ga0209588_10326233 122
983 3300027671 Ga0209588_1218255 Ga0209588_12182552 122
984 3300027682 Ga0209971_1000384 Ga0209971_10003842 122
985 3300027695 Ga0209966_1133005 Ga0209966_11330051 122
986 3300027717 Ga0209998_10002827 Ga0209998_100028273 122
987 3300027876 Ga0209974_10004420 Ga0209974_100044204 122
988 3300027876 Ga0209974_10128164 Ga0209974_101281643 122
989 3300027876 Ga0209974_10197531 Ga0209974_101975312 122
990 3300027907 Ga0207428_10000030 Ga0207428_1000003060 122
991 3300027907 Ga0207428_10017611 Ga0207428_1001761111 122
992 3300027907 Ga0207428_10042290 Ga0207428_100422901 122
993 3300027907 Ga0207428_10380583 Ga0207428_103805832 122
994 3300027907 Ga0207428_11037160 Ga0207428_110371602 122
995 3300027907 Ga0207428_11047024 Ga0207428_110470242 122
996 3300028379 Ga0268266_10000259 Ga0268266_1000025967 122
997 3300028379 Ga0268266_10015961 Ga0268266_100159618 122
998 3300028379 Ga0268266_10047157 Ga0268266_100471575 122
999 3300028379 Ga0268266_10309020 Ga0268266_103090204 122
1000 3300028380 Ga0268265_10009861 Ga0268265_100098615 122
1001 3300028380 Ga0268265_10034866 Ga0268265_100348667 122
1002 3300028380 Ga0268265_10037170 Ga0268265_100371703 122
1003 3300028380 Ga0268265_10045924 Ga0268265_100459245 122
1004 3300028380 Ga0268265_10220454 Ga0268265_102204544 122
1005 3300028380 Ga0268265_10485770 Ga0268265_104857701 122
1006 3300028380 Ga0268265_10490222 Ga0268265_104902222 122
1007 3300028380 Ga0268265_10490646 Ga0268265_104906462 122
1008 3300028380 Ga0268265_11237145 Ga0268265_112371452 122
1009 3300028380 Ga0268265_11331701 Ga0268265_113317011 122
1010 3300028381 Ga0268264_10005977 Ga0268264_1000597713 122
1011 3300028381 Ga0268264_10044863 Ga0268264_100448639 122
1012 3300028381 Ga0268264_10049767 Ga0268264_100497675 122
1013 3300028381 Ga0268264_10136493 Ga0268264_101364935 122
1014 3300028381 Ga0268264_10144015 Ga0268264_101440155 122
1015 3300028381 Ga0268264_10197367 Ga0268264_101973673 122
1016 3300028381 Ga0268264_10209665 Ga0268264_102096653 122
1017 3300028381 Ga0268264_10259334 Ga0268264_102593343 122
1018 3300028381 Ga0268264_10362378 Ga0268264_103623782 122
1019 3300028381 Ga0268264_10497856 Ga0268264_104978562 122
1020 3300028381 Ga0268264_11076106 Ga0268264_110761062 122
1021 3300028381 Ga0268264_11085509 Ga0268264_110855092 122
1022 3300028563 Ga0265319_1044281 Ga0265319_10442814 122
1023 3300028563 Ga0265319_1060122 Ga0265319_10601223 122
1024 3300028573 Ga0265334_10078109 Ga0265334_100781092 122
1025 3300028653 Ga0265323_10004178 Ga0265323_100041786 122
1026 3300028653 Ga0265323_10067614 Ga0265323_100676143 122
1027 3300028800 Ga0265338_10016967 Ga0265338_1001696712 122
1028 3300028800 Ga0265338_10128873 Ga0265338_101288732 122
1029 3300028800 Ga0265338_10345344 Ga0265338_103453443 122
1030 3300028800 Ga0265338_10642953 Ga0265338_106429531 122
1031 3300030836 Ga0265767_112437 Ga0265767_1124371 122
1032 3300031235 Ga0265330_10000541 Ga0265330_1000054123 122
1033 3300031235 Ga0265330_10001334 Ga0265330_1000133411 122
1034 3300031235 Ga0265330_10003060 Ga0265330_1000306014 122
1035 3300031235 Ga0265330_10375265 Ga0265330_103752652 122
1036 3300031238 Ga0265332_10064443 Ga0265332_100644432 122
1037 3300031238 Ga0265332_10155677 Ga0265332_101556773 122
1038 3300031239 Ga0265328_10051354 Ga0265328_100513543 122
1039 3300031240 Ga0265320_10307898 Ga0265320_103078982 122
1040 3300031242 Ga0265329_10003473 Ga0265329_100034736 122
1041 3300031242 Ga0265329_10015790 Ga0265329_100157902 122
1042 3300031242 Ga0265329_10034598 Ga0265329_100345984 122
1043 3300031247 Ga0265340_10015118 Ga0265340_100151182 122
1044 3300031249 Ga0265339_10055328 Ga0265339_100553285 122
1045 3300031249 Ga0265339_10075819 Ga0265339_100758192 122
1046 3300031249 Ga0265339_10240841 Ga0265339_102408412 122
1047 3300031250 Ga0265331_10073224 Ga0265331_100732243 122
1048 3300031250 Ga0265331_10233136 Ga0265331_102331362 122
1049 3300031344 Ga0265316_10000251 Ga0265316_1000025112 122
1050 3300031344 Ga0265316_10000984 Ga0265316_1000098430 122
1051 3300031344 Ga0265316_10014237 Ga0265316_1001423712 122
1052 3300031344 Ga0265316_10018769 Ga0265316_1001876911 122
1053 3300031344 Ga0265316_10028493 Ga0265316_100284935 122
1054 3300031344 Ga0265316_10048657 Ga0265316_100486572 122
1055 3300031344 Ga0265316_10169982 Ga0265316_101699824 122
1056 3300031344 Ga0265316_10388436 Ga0265316_103884362 122
1057 3300031548 Ga0307408_100164966 Ga0307408_1001649662 122
1058 3300031548 Ga0307408_100236106 Ga0307408_1002361062 122
1059 3300031548 Ga0307408_102138195 Ga0307408_1021381952 122
1060 3300031595 Ga0265313_10122813 Ga0265313_101228133 122
1061 3300031616 Ga0307508_10050191 Ga0307508_100501914 122
1062 3300031665 Ga0316575_10002995 Ga0316575_100029952 122
1063 3300031665 Ga0316575_10014672 Ga0316575_100146727 122
1064 3300031665 Ga0316575_10021116 Ga0316575_100211166 122
1065 3300031691 Ga0316579_10070932 Ga0316579_100709323 122
1066 3300031691 Ga0316579_10157791 Ga0316579_101577912 122
1067 3300031711 Ga0265314_10023438 Ga0265314_100234387 122
1068 3300031711 Ga0265314_10114121 Ga0265314_101141214 122
1069 3300031712 Ga0265342_10008085 Ga0265342_1000808511 122
1070 3300031712 Ga0265342_10036131 Ga0265342_100361313 122
1071 3300031712 Ga0265342_10039697 Ga0265342_100396976 122
1072 3300031712 Ga0265342_10085382 Ga0265342_100853823 122
1073 3300031712 Ga0265342_10176966 Ga0265342_101769663 122
1074 3300031727 Ga0316576_10012802 Ga0316576_1001280211 122
1075 3300031727 Ga0316576_10031380 Ga0316576_100313806 122
1076 3300031727 Ga0316576_10072783 Ga0316576_100727832 122
1077 3300031727 Ga0316576_10254444 Ga0316576_102544442 122
1078 3300031727 Ga0316576_10343935 Ga0316576_103439351 122
1079 3300031727 Ga0316576_10358298 Ga0316576_103582983 122
1080 3300031728 Ga0316578_10148460 Ga0316578_101484603 122
1081 3300031730 Ga0307516_10003404 Ga0307516_1000340419 122
1082 3300031731 Ga0307405_10139666 Ga0307405_101396662 122
1083 3300031731 Ga0307405_10724904 Ga0307405_107249042 122
1084 3300031733 Ga0316577_10035166 Ga0316577_100351664 122
1085 3300031733 Ga0316577_10160530 Ga0316577_101605303 122
1086 3300031733 Ga0316577_10429752 Ga0316577_104297522 122
1087 3300031824 Ga0307413_10005834 Ga0307413_1000583411 122
1088 3300031824 Ga0307413_10371109 Ga0307413_103711092 122
1089 3300031852 Ga0307410_10001864 Ga0307410_1000186412 122
1090 3300031852 Ga0307410_10034138 Ga0307410_100341385 122
1091 3300031852 Ga0307410_10371816 Ga0307410_103718162 122
1092 3300031889 Ga0326468_10043698 Ga0326468_100436982 122
1093 3300031901 Ga0307406_10235992 Ga0307406_102359923 122
1094 3300031901 Ga0307406_10787551 Ga0307406_107875512 122
1095 3300031901 Ga0307406_12037644 Ga0307406_120376441 122
1096 3300031903 Ga0307407_10033183 Ga0307407_100331832 122
1097 3300031903 Ga0307407_11490439 Ga0307407_114904391 122
1098 3300031911 Ga0307412_10233228 Ga0307412_102332283 122
1099 3300031911 Ga0307412_10394963 Ga0307412_103949633 122
1100 3300031911 Ga0307412_11035527 Ga0307412_110355272 122
1101 3300031911 Ga0307412_11463688 Ga0307412_114636882 122
1102 3300031995 Ga0307409_100002915 Ga0307409_10000291515 122
1103 3300031995 Ga0307409_100048335 Ga0307409_1000483351 122
1104 3300031995 Ga0307409_100109897 Ga0307409_1001098971 122
1105 3300031995 Ga0307409_100625568 Ga0307409_1006255681 122
1106 3300031995 Ga0307409_101589606 Ga0307409_1015896062 122
1107 3300031995 Ga0307409_102225915 Ga0307409_1022259151 122
1108 3300032002 Ga0307416_100018585 Ga0307416_1000185854 122
1109 3300032002 Ga0307416_100039410 Ga0307416_1000394102 122
1110 3300032002 Ga0307416_100496117 Ga0307416_1004961174 122
1111 3300032002 Ga0307416_101190947 Ga0307416_1011909472 122
1112 3300032002 Ga0307416_101215820 Ga0307416_1012158202 122
1113 3300032002 Ga0307416_101970819 Ga0307416_1019708192 122
1114 3300032004 Ga0307414_10005193 Ga0307414_1000519310 122
1115 3300032004 Ga0307414_10007281 Ga0307414_1000728110 122
1116 3300032004 Ga0307414_10028964 Ga0307414_100289643 122
1117 3300032004 Ga0307414_10042491 Ga0307414_100424914 122
1118 3300032005 Ga0307411_10003742 Ga0307411_1000374213 122
1119 3300032005 Ga0307411_10008827 Ga0307411_100088275 122
1120 3300032005 Ga0307411_11011757 Ga0307411_110117572 122
1121 3300032005 Ga0307411_11232053 Ga0307411_112320531 122
1122 3300032126 Ga0307415_100056689 Ga0307415_1000566892 122
1123 3300032126 Ga0307415_100268612 Ga0307415_1002686123 122
1124 3300032126 Ga0307415_101068181 Ga0307415_1010681811 122
1125 3300032126 Ga0307415_101167579 Ga0307415_1011675792 122
1126 3300032168 Ga0316593_10001783 Ga0316593_1000178310 122
1127 3300032168 Ga0316593_10002618 Ga0316593_100026188 122
1128 3300032168 Ga0316593_10014252 Ga0316593_100142525 122
1129 3300032168 Ga0316593_10019333 Ga0316593_100193334 122
1130 3300032168 Ga0316593_10019508 Ga0316593_100195085 122
1131 3300032168 Ga0316593_10028372 Ga0316593_100283724 122
1132 3300032168 Ga0316593_10158812 Ga0316593_101588122 122
1133 3300032168 Ga0316593_10316334 Ga0316593_103163342 122
1134 3300032168 Ga0316593_10329705 Ga0316593_103297052 122
1135 3300033524 Ga0316592_1024201 Ga0316592_10242013 122
1136 3300033528 Ga0316588_1007611 Ga0316588_10076114 122
1137 3300033528 Ga0316588_1018568 Ga0316588_10185683 122
1138 3300033528 Ga0316588_1040523 Ga0316588_10405233 122
1139 3300033528 Ga0316588_1051023 Ga0316588_10510232 122
1140 3300033528 Ga0316588_1067069 Ga0316588_10670692 122
1141 3300033528 Ga0316588_1067880 Ga0316588_10678802 122
1142 3300033528 Ga0316588_1088459 Ga0316588_10884591 122
1143 3300033528 Ga0316588_1105398 Ga0316588_11053981 122
1144 3300033541 Ga0316596_1000493 Ga0316596_100049310 122
1145 3300033541 Ga0316596_1070869 Ga0316596_10708691 122
1146 3300033541 Ga0316596_1169994 Ga0316596_11699942 122
1147 3300034816 Ga0373930_0030179 Ga0373930_0030179_551_919 122
1148 3300034817 Ga0373948_0130321 Ga0373948_0130321_58_426 122
1149 3300034819 Ga0373958_0009873 Ga0373958_0009873_673_1041 122
1150 3300034820 Ga0373959_0134078 Ga0373959_0134078_26_394 122
1151 3300034957 Ga0373938_0175085 Ga0373938_0175085_105_473 122
1152 3300035083 Ga0373926_0001122 Ga0373926_0001122_5638_6006 122
1153 3300035083 Ga0373926_0258941 Ga0373926_0258941_117_485 122
1154 3300035085 Ga0373929_0094499 Ga0373929_0094499_50_427 122
1155 3300035086 Ga0373934_0104707 Ga0373934_0104707_480_848 122
1156 3300035088 Ga0373940_0187565 Ga0373940_0187565_198_575 122
1157 3300035089 Ga0373944_0057907 Ga0373944_0057907_822_1190 122
1158 3300035091 Ga0373951_0113679 Ga0373951_0113679_249_626 122
1159 3300035092 Ga0373952_0180221 Ga0373952_0180221_82_450 122
1160 3300035111 Ga0373923_0053759 Ga0373923_0053759_497_865 122
1161 3300035111 Ga0373923_0385065 Ga0373923_0385065_144_512 122
1162 3300035111 Ga0373923_0433015 Ga0373923_0433015_147_515 122
1163 3300035112 Ga0373932_0274730 Ga0373932_0274730_39_407 122
1164 3300035113 Ga0373936_0037210 Ga0373936_0037210_1425_1793 122
1165 3300035113 Ga0373936_0205470 Ga0373936_0205470_56_433 122
1166 3300035113 Ga0373936_0418617 Ga0373936_0418617_204_572 122
1167 3300035114 Ga0373939_0122999 Ga0373939_0122999_358_726 122
1168 3300035115 Ga0373941_0205636 Ga0373941_0205636_326_697 122
1169 3300035116 Ga0373945_0018377 Ga0373945_0018377_1285_1653 122
1170 3300035116 Ga0373945_0062158 Ga0373945_0062158_973_1350 122
1171 3300035117 Ga0373953_0002723 Ga0373953_0002723_3083_3451 122
1172 3300035117 Ga0373953_0086762 Ga0373953_0086762_737_1114 122
1173 3300035117 Ga0373953_0118381 Ga0373953_0118381_208_585 122
1174 3300035118 Ga0373954_0014604 Ga0373954_0014604_301_669 122
1175 3300035118 Ga0373954_0156125 Ga0373954_0156125_372_740 122
1176 3300035118 Ga0373954_0163207 Ga0373954_0163207_362_730 122
1177 3300035119 Ga0373956_0009506 Ga0373956_0009506_363_731 122
1178 3300035119 Ga0373956_0010739 Ga0373956_0010739_1611_1979 122
1179 3300035119 Ga0373956_0108665 Ga0373956_0108665_625_1002 122
1180 3300035120 Ga0373957_0057958 Ga0373957_0057958_891_1259 122
1181 3300035120 Ga0373957_0117503 Ga0373957_0117503_245_613 122
1182 3300035120 Ga0373957_0154822 Ga0373957_0154822_100_468 122
1183 3300035121 Ga0373960_0231198 Ga0373960_0231198_112_480 122
1184 3300035170 Ga0373943_0011073 Ga0373943_0011073_1454_1822 122
1185 3300035170 Ga0373943_0367741 Ga0373943_0367741_258_635 122
1186 3300035172 Ga0373955_0013590 Ga0373955_0013590_250_627 122
1187 3300035172 Ga0373955_0037811 Ga0373955_0037811_210_578 122
1188 3300035172 Ga0373955_0058171 Ga0373955_0058171_253_621 122
1189 3300035172 Ga0373955_0109033 Ga0373955_0109033_949_1326 122
1190 3300035172 Ga0373955_0327525 Ga0373955_0327525_84_452 122
1191 3300035172 Ga0373955_0345873 Ga0373955_0345873_444_812 122
1192 3300035207 Ga0373942_0347133 Ga0373942_0347133_99_476 122
1193 3300035241 Ga0373961_0135251 Ga0373961_0135251_346_714 122
1194 3300035241 Ga0373961_0146509 Ga0373961_0146509_66_434 122
1195 3300035241 Ga0373961_0257992 Ga0373961_0257992_93_461 122
1196 3300035398 Ga0316574_0001004 Ga0316574_0001004_3203_3571 122
1197 3300035398 Ga0316574_0022880 Ga0316574_0022880_779_1147 122
1198 3300035398 Ga0316574_0047770 Ga0316574_0047770_1442_1810 122
1199 3300035398 Ga0316574_0109331 Ga0316574_0109331_1384_1752 122
1200 3300035398 Ga0316574_0140482 Ga0316574_0140482_872_1240 122
1201 3300035398 Ga0316574_0143803 Ga0316574_0143803_1153_1521 122
1202 3300035398 Ga0316574_0161536 Ga0316574_0161536_578_949 122
1203 3300035398 Ga0316574_0833998 Ga0316574_0833998_61_432 122
1204 3300035410 Ga0373924_0126646 Ga0373924_0126646_31_399 122
1205 3300035691 Ga0373931_0136727 Ga0373931_0136727_912_1280 122
1206 3300035691 Ga0373931_0260324 Ga0373931_0260324_89_457 122
1207 3300035691 Ga0373931_0303750 Ga0373931_0303750_89_457 122
1208 3300035691 Ga0373931_1274424 Ga0373931_1274424_32_409 122
1209 3300035692 Ga0373935_0051065 Ga0373935_0051065_1735_2103 122
1210 3300035692 Ga0373935_0075929 Ga0373935_0075929_335_712 122
1211 3300035695 Ga0373927_0005589 Ga0373927_0005589_364_732 122
1212 3300035695 Ga0373927_0161417 Ga0373927_0161417_30_398 122
1213 3300035695 Ga0373927_0625416 Ga0373927_0625416_53_430 122
1214 3300035695 Ga0373927_1096771 Ga0373927_1096771_122_490 122
1215 3300035724 Ga0373933_0294661 Ga0373933_0294661_311_688 122
1216 3300035724 Ga0373933_0373450 Ga0373933_0373450_98_466 122
1217 3300035725 Ga0373947_0007919 Ga0373947_0007919_688_1065 122
1218 3300035725 Ga0373947_0114040 Ga0373947_0114040_580_957 122
1219 3300035725 Ga0373947_0223935 Ga0373947_0223935_579_947 122
1220 3300035725 Ga0373947_0256443 Ga0373947_0256443_349_726 122
1221 3300035725 Ga0373947_0783854 Ga0373947_0783854_17_385 122
1222 3300036401 Ga0373937_0007252 Ga0373937_0007252_4044_4421 122
1223 3300036401 Ga0373937_0025601 Ga0373937_0025601_1619_1987 122
1224 3300036401 Ga0373937_0030240 Ga0373937_0030240_1433_1810 122
1225 3300036401 Ga0373937_0056404 Ga0373937_0056404_1020_1388 122
1226 3300036401 Ga0373937_0076114 Ga0373937_0076114_1020_1388 122
1227 3300036401 Ga0373937_0113979 Ga0373937_0113979_934_1302 122
1228 3300036401 Ga0373937_0171110 Ga0373937_0171110_1236_1604 122
1229 3300036401 Ga0373937_0431917 Ga0373937_0431917_639_1007 122
1230 3300036401 Ga0373937_0866335 Ga0373937_0866335_464_832 122
1231 3300036401 Ga0373937_1848163 Ga0373937_1848163_36_413 122
1232 3300036401 Ga0373937_2066069 Ga0373937_2066069_10_378 122
1233 3300036647 Ga0316582_0200485 Ga0316582_0200485_896_1264 122
1234 3300036647 Ga0316582_0643517 Ga0316582_0643517_39_410 122
1235 3300036647 Ga0316582_0705715 Ga0316582_0705715_241_609 122
1236 3300036712 Ga0316584_0351874 Ga0316584_0351874_155_523 122
1237 3300036712 Ga0316584_0358687 Ga0316584_0358687_434_802 122
1238 3300036712 Ga0316584_0518106 Ga0316584_0518106_399_767 122
1239 3300036712 Ga0316584_0577819 Ga0316584_0577819_198_566 122
1240 3300036712 Ga0316584_0622151 Ga0316584_0622151_141_515 122
1241 3300036712 Ga0316584_0726414 Ga0316584_0726414_115_483 122
1242 3300036712 Ga0316584_0729147 Ga0316584_0729147_151_519 122
1243 3300036712 Ga0316584_0734471 Ga0316584_0734471_250_618 122
1244 3300037068 Ga0373925_0001662 Ga0373925_0001662_8908_9276 122
1245 3300037068 Ga0373925_0094451 Ga0373925_0094451_136_513 122
1246 3300037068 Ga0373925_0262346 Ga0373925_0262346_824_1192 122
1247 3300037068 Ga0373925_0263319 Ga0373925_0263319_978_1346 122
1248 3300037068 Ga0373925_0872321 Ga0373925_0872321_34_402 122
1249 3300037312 Ga0395899_0173762 Ga0395899_0173762_923_1291 122
1250 3300037418 Ga0395900_0018609 Ga0395900_0018609_4162_4530 122
1251 3300037418 Ga0395900_0954656 Ga0395900_0954656_270_647 122
1252 3300037418 Ga0395900_1480901 Ga0395900_1480901_116_484 122
1253 3300037466 Ga0395898_0564374 Ga0395898_0564374_562_930 122
1254 3300037471 Ga0395905_0000275 Ga0395905_0000275_34523_34891 122
1255 3300037471 Ga0395905_0001744 Ga0395905_0001744_14555_14923 122
1256 3300037471 Ga0395905_0082831 Ga0395905_0082831_1306_1674 122
1257 3300037471 Ga0395905_0877384 Ga0395905_0877384_163_531 122
1258 3300037588 Ga0316581_0013010 Ga0316581_0013010_389_757 122
1259 3300038443 Ga0395901_0113158 Ga0395901_0113158_135_503 122
1260 3300039062 Ga0400483_126972 Ga0400483_126972_948_1319 122
1261 3300039062 Ga0400483_247471 Ga0400483_247471_546_917 122
1262 3300039093 Ga0400489_10986 Ga0400489_10986_321_695 122
1263 3300039093 Ga0400489_86969 Ga0400489_86969_5483_5854 122
1264 3300039437 Ga0436365_1563210 Ga0436365_1563210_286_657 122
1265 3300039437 Ga0436365_1839659 Ga0436365_1839659_543_911 122
1266 3300039437 Ga0436365_1927449 Ga0436365_1927449_26_397 122
1267 3300039438 Ga0436360_0406311 Ga0436360_0406311_511_879 122
1268 3300039450 Ga0436363_0576030 Ga0436363_0576030_87_455 122
1269 3300039450 Ga0436363_1475130 Ga0436363_1475130_96_464 122
1270 3300039453 Ga0436362_0225975 Ga0436362_0225975_1118_1486 122
1271 3300039453 Ga0436362_1069013 Ga0436362_1069013_87248_87619 122
1272 3300041410 Ga0439461_0064471 Ga0439461_0064471_436_804 122
1273 3300041452 Ga0451793_0687095 Ga0451793_0687095_398_769 122
1274 3300041456 Ga0451795_0060284 Ga0451795_0060284_292_660 122
1275 3300041507 Ga0451851_0850392 Ga0451851_0850392_417_785 122
1276 3300041999 Ga0439433_0112274 Ga0439433_0112274_14_382 122
1277 3300042009 Ga0439451_125562 Ga0439451_125562_139_507 122
1278 3300042437 Ga0439444_0094397 Ga0439444_0094397_46_414 122
1279 3300042876 Ga0451577_0008700 Ga0451577_0008700_6723_7094 122
1280 3300042876 Ga0451577_0012592 Ga0451577_0012592_1409_1777 122
1281 3300042876 Ga0451577_0016347 Ga0451577_0016347_6206_6574 122
1282 3300042876 Ga0451577_0033756 Ga0451577_0033756_153_530 122
1283 3300042876 Ga0451577_0134048 Ga0451577_0134048_1841_2209 122
1284 3300042876 Ga0451577_0161269 Ga0451577_0161269_1357_1725 122
1285 3300042876 Ga0451577_0317597 Ga0451577_0317597_337_705 122
1286 3300042876 Ga0451577_1403892 Ga0451577_1403892_102_470 122
1287 3300042993 Ga0439440_0013796 Ga0439440_0013796_744_1112 122
1288 3300044673 Ga0453683_0000086 Ga0453683_0000086_71572_71940 122
1289 3300044673 Ga0453683_0008784 Ga0453683_0008784_5658_6026 122
1290 3300044673 Ga0453683_0054837 Ga0453683_0054837_2015_2383 122
1291 3300044673 Ga0453683_0055812 Ga0453683_0055812_530_901 122
1292 3300044673 Ga0453683_0122574 Ga0453683_0122574_371_739 122
1293 3300044673 Ga0453683_0216829 Ga0453683_0216829_756_1130 122
1294 3300044683 Ga0466965_0436268 Ga0466965_0436268_74_442 122
1295 3300044712 Ga0453684_0001061 Ga0453684_0001061_77303_77674 122
1296 3300044712 Ga0453684_0001518 Ga0453684_0001518_6984_7352 122
1297 3300044712 Ga0453684_0008349 Ga0453684_0008349_12202_12570 122
1298 3300044712 Ga0453684_0011806 Ga0453684_0011806_11778_12149 122
1299 3300044712 Ga0453684_0019106 Ga0453684_0019106_251_625 122
1300 3300044712 Ga0453684_0019836 Ga0453684_0019836_316_684 122
1301 3300044712 Ga0453684_0033355 Ga0453684_0033355_2995_3366 122
1302 3300044712 Ga0453684_0037288 Ga0453684_0037288_5692_6060 122
1303 3300044712 Ga0453684_0042819 Ga0453684_0042819_5043_5411 122
1304 3300044712 Ga0453684_0044000 Ga0453684_0044000_1402_1770 122
1305 3300044712 Ga0453684_0048627 Ga0453684_0048627_3709_4077 122
1306 3300044712 Ga0453684_0060385 Ga0453684_0060385_372_740 122
1307 3300044712 Ga0453684_0062580 Ga0453684_0062580_478_846 122
1308 3300044712 Ga0453684_0075363 Ga0453684_0075363_1293_1661 122
1309 3300044712 Ga0453684_0090894 Ga0453684_0090894_3382_3756 122
1310 3300044712 Ga0453684_0111000 Ga0453684_0111000_2350_2718 122
1311 3300044712 Ga0453684_0240329 Ga0453684_0240329_15_383 122
1312 3300044712 Ga0453684_0373414 Ga0453684_0373414_357_725 122
1313 3300044712 Ga0453684_0646837 Ga0453684_0646837_442_810 122
1314 3300044712 Ga0453684_1257000 Ga0453684_1257000_74_442 122
1315 3300044712 Ga0453684_1813505 Ga0453684_1813505_206_574 122
1316 3300045051 Ga0451576_0004083 Ga0451576_0004083_16829_17197 122
1317 3300045051 Ga0451576_0005300 Ga0451576_0005300_15745_16113 122
1318 3300045051 Ga0451576_0019582 Ga0451576_0019582_4581_4949 122
1319 3300045051 Ga0451576_0093519 Ga0451576_0093519_385_753 122
1320 3300045051 Ga0451576_0129629 Ga0451576_0129629_120_488 122
1321 3300045051 Ga0451576_0137895 Ga0451576_0137895_152_529 122
1322 3300045051 Ga0451576_0196516 Ga0451576_0196516_724_1092 122
1323 3300045051 Ga0451576_0213585 Ga0451576_0213585_100_468 122
1324 3300045051 Ga0451576_0215670 Ga0451576_0215670_1542_1913 122
1325 3300045051 Ga0451576_0312134 Ga0451576_0312134_777_1145 122
1326 3300045051 Ga0451576_0499547 Ga0451576_0499547_405_782 122
1327 3300045051 Ga0451576_0648915 Ga0451576_0648915_463_831 122
1328 3300045051 Ga0451576_0682098 Ga0451576_0682098_13_387 122
1329 3300045051 Ga0451576_1292499 Ga0451576_1292499_185_553 122
1330 3300045051 Ga0451576_2130053 Ga0451576_2130053_22_390 122
1331 3300045976 Ga0466967_0445372 Ga0466967_0445372_343_711 122
1332 3300045976 Ga0466967_0955867 Ga0466967_0955867_256_624 122
1333 3300046452 Ga0495617_143473 Ga0495617_143473_267_635 122
1334 3300046454 Ga0495592_0161903 Ga0495592_0161903_652_1020 122
1335 3300046455 Ga0495603_0016598 Ga0495603_0016598_1067_1435 122
1336 3300046459 Ga0495629_0007707 Ga0495629_0007707_3269_3637 122
1337 3300046459 Ga0495629_0016479 Ga0495629_0016479_2207_2584 122
1338 3300046459 Ga0495629_0184529 Ga0495629_0184529_365_742 122
1339 3300046459 Ga0495629_0419104 Ga0495629_0419104_168_536 122
1340 3300046461 Ga0495641_0041758 Ga0495641_0041758_81_449 122
1341 3300046461 Ga0495641_0047852 Ga0495641_0047852_289_657 122
1342 3300046461 Ga0495641_0125788 Ga0495641_0125788_660_1037 122
1343 3300046461 Ga0495641_0141431 Ga0495641_0141431_541_909 122
1344 3300046462 Ga0495651_0042906 Ga0495651_0042906_2380_2748 122
1345 3300046462 Ga0495651_0481615 Ga0495651_0481615_381_758 122
1346 3300046462 Ga0495651_0597215 Ga0495651_0597215_249_617 122
1347 3300046472 Ga0495580_0001448 Ga0495580_0001448_16292_16660 122
1348 3300046472 Ga0495580_0002827 Ga0495580_0002827_6233_6601 122
1349 3300046472 Ga0495580_0005582 Ga0495580_0005582_1896_2273 122
1350 3300046472 Ga0495580_0012791 Ga0495580_0012791_2356_2724 122
1351 3300046472 Ga0495580_0057891 Ga0495580_0057891_1039_1416 122
1352 3300046472 Ga0495580_0080283 Ga0495580_0080283_756_1133 122
1353 3300046472 Ga0495580_0121196 Ga0495580_0121196_221_598 122
1354 3300046472 Ga0495580_0125962 Ga0495580_0125962_1320_1697 122
1355 3300046472 Ga0495580_0261064 Ga0495580_0261064_198_575 122
1356 3300046472 Ga0495580_0411869 Ga0495580_0411869_171_548 122
1357 3300046472 Ga0495580_0584354 Ga0495580_0584354_298_666 122
1358 3300046472 Ga0495580_0921904 Ga0495580_0921904_91_459 122
1359 3300046473 Ga0495582_0000113 Ga0495582_0000113_4154_4522 122
1360 3300046473 Ga0495582_0026338 Ga0495582_0026338_832_1209 122
1361 3300046473 Ga0495582_0079298 Ga0495582_0079298_1092_1460 122
1362 3300046473 Ga0495582_0295889 Ga0495582_0295889_341_718 122
1363 3300046473 Ga0495582_0417230 Ga0495582_0417230_209_577 122
1364 3300046475 Ga0495639_0020227 Ga0495639_0020227_797_1165 122
1365 3300046475 Ga0495639_0122966 Ga0495639_0122966_453_830 122
1366 3300046476 Ga0495662_0522177 Ga0495662_0522177_184_561 122
1367 3300046477 Ga0495664_0005945 Ga0495664_0005945_4314_4682 122
1368 3300046491 Ga0495584_0399912 Ga0495584_0399912_13_390 122
1369 3300046492 Ga0495585_0494208 Ga0495585_0494208_159_536 122
1370 3300046499 Ga0495594_0021611 Ga0495594_0021611_683_1051 122
1371 3300046499 Ga0495594_0076463 Ga0495594_0076463_456_833 122
1372 3300046499 Ga0495594_0452844 Ga0495594_0452844_25_402 122
1373 3300046513 Ga0495616_0235832 Ga0495616_0235832_216_584 122
1374 3300046514 Ga0495618_0033948 Ga0495618_0033948_1040_1408 122
1375 3300046514 Ga0495618_0047295 Ga0495618_0047295_2271_2639 122
1376 3300046514 Ga0495618_0179620 Ga0495618_0179620_48_416 122
1377 3300046514 Ga0495618_0346716 Ga0495618_0346716_193_570 122
1378 3300046516 Ga0495628_0268257 Ga0495628_0268257_526_894 122
1379 3300046516 Ga0495628_0573546 Ga0495628_0573546_283_660 122
1380 3300046517 Ga0495630_0003551 Ga0495630_0003551_9535_9903 122
1381 3300046517 Ga0495630_0016248 Ga0495630_0016248_188_556 122
1382 3300046517 Ga0495630_0776267 Ga0495630_0776267_13_390 122
1383 3300046517 Ga0495630_0982529 Ga0495630_0982529_171_539 122
1384 3300046526 Ga0495666_0137734 Ga0495666_0137734_332_700 122
1385 3300046526 Ga0495666_0195179 Ga0495666_0195179_521_889 122
1386 3300046526 Ga0495666_0326231 Ga0495666_0326231_179_547 122
1387 3300046529 Ga0495652_0354639 Ga0495652_0354639_265_642 122
1388 3300046529 Ga0495652_0384663 Ga0495652_0384663_116_484 122
1389 3300046531 Ga0495665_0017070 Ga0495665_0017070_2008_2385 122
1390 3300046531 Ga0495665_0038759 Ga0495665_0038759_2063_2431 122
1391 3300046531 Ga0495665_0105049 Ga0495665_0105049_1073_1450 122
1392 3300046531 Ga0495665_0695753 Ga0495665_0695753_92_469 122
1393 3300046533 Ga0495640_0084228 Ga0495640_0084228_1557_1925 122
1394 3300046533 Ga0495640_0194210 Ga0495640_0194210_650_1027 122
1395 3300046533 Ga0495640_0739393 Ga0495640_0739393_172_540 122
1396 3300046535 Ga0495586_0003305 Ga0495586_0003305_8097_8474 122
1397 3300046535 Ga0495586_0031142 Ga0495586_0031142_893_1261 122
1398 3300046535 Ga0495586_0031189 Ga0495586_0031189_690_1058 122
1399 3300046535 Ga0495586_0047729 Ga0495586_0047729_202_570 122
1400 3300046536 Ga0495587_0002355 Ga0495587_0002355_8611_8979 122
1401 3300046536 Ga0495587_0019640 Ga0495587_0019640_64_441 122
1402 3300046536 Ga0495587_0213134 Ga0495587_0213134_172_540 122
1403 3300046537 Ga0495598_0017282 Ga0495598_0017282_157_528 122
1404 3300046543 Ga0495645_0630048 Ga0495645_0630048_105_473 122
1405 3300046557 Ga0495622_0267752 Ga0495622_0267752_42_410 122
1406 3300046558 Ga0495633_0069411 Ga0495633_0069411_708_1085 122
1407 3300046615 Ga0495656_0000397 Ga0495656_0000397_6000_6368 122
1408 3300046615 Ga0495656_0517719 Ga0495656_0517719_239_607 122
1409 3300046642 Ga0495634_0000649 Ga0495634_0000649_4703_5071 122
1410 3300046642 Ga0495634_0165167 Ga0495634_0165167_381_758 122
1411 3300046663 Ga0495635_0069638 Ga0495635_0069638_1869_2246 122
1412 3300046674 Ga0495588_0457836 Ga0495588_0457836_173_541 122
1413 3300046675 Ga0495657_0158952 Ga0495657_0158952_815_1192 122
1414 3300046675 Ga0495657_0273279 Ga0495657_0273279_46_414 122
1415 3300046675 Ga0495657_0274523 Ga0495657_0274523_205_573 122
1416 3300046675 Ga0495657_0444406 Ga0495657_0444406_248_625 122
1417 3300046679 Ga0495623_0095320 Ga0495623_0095320_572_949 122
1418 3300046681 Ga0495647_0004304 Ga0495647_0004304_2668_3036 122
1419 3300046681 Ga0495647_0006082 Ga0495647_0006082_2809_3186 122
1420 3300046681 Ga0495647_0007570 Ga0495647_0007570_1166_1543 122
1421 3300046681 Ga0495647_0040084 Ga0495647_0040084_952_1329 122
1422 3300046681 Ga0495647_0249323 Ga0495647_0249323_364_732 122
1423 3300046681 Ga0495647_0452968 Ga0495647_0452968_22_399 122
1424 3300046683 Ga0495658_0017882 Ga0495658_0017882_756_1133 122
1425 3300046683 Ga0495658_0028263 Ga0495658_0028263_534_911 122
1426 3300046683 Ga0495658_0056441 Ga0495658_0056441_959_1327 122
1427 3300046683 Ga0495658_0189652 Ga0495658_0189652_885_1253 122
1428 3300046684 Ga0495669_0106398 Ga0495669_0106398_657_1028 122
1429 3300046684 Ga0495669_0505155 Ga0495669_0505155_124_501 122
1430 3300046689 Ga0495613_0042407 Ga0495613_0042407_2350_2718 122
1431 3300046689 Ga0495613_0095480 Ga0495613_0095480_1088_1465 122
1432 3300046689 Ga0495613_0642490 Ga0495613_0642490_23_391 122
1433 3300046691 Ga0495670_0019811 Ga0495670_0019811_159_536 122
1434 3300046691 Ga0495670_0731190 Ga0495670_0731190_100_468 122
1435 3300046794 Ga0495589_0432283 Ga0495589_0432283_140_508 122
1436 3300046809 Ga0495600_0047423 Ga0495600_0047423_1734_2111 122
1437 3300046809 Ga0495600_0361141 Ga0495600_0361141_432_800 122
1438 3300047315 Ga0495581_0208241 Ga0495581_0208241_450_827 122
1439 3300047315 Ga0495581_0262135 Ga0495581_0262135_498_866 122
1440 3300047317 Ga0495604_0039896 Ga0495604_0039896_3093_3461 122
1441 3300047317 Ga0495604_0368503 Ga0495604_0368503_24_392 122
1442 3300047317 Ga0495604_0595068 Ga0495604_0595068_50_427 122
1443 3300047317 Ga0495604_0776194 Ga0495604_0776194_169_546 122
1444 3300047318 Ga0495636_0000893 Ga0495636_0000893_2723_3091 122
1445 3300047318 Ga0495636_0044847 Ga0495636_0044847_744_1112 122
1446 3300047318 Ga0495636_0175385 Ga0495636_0175385_539_907 122
1447 3300047318 Ga0495636_0273477 Ga0495636_0273477_351_719 122
1448 3300047319 Ga0495674_0001336 Ga0495674_0001336_19000_19368 122
1449 3300047319 Ga0495674_0036483 Ga0495674_0036483_3809_4177 122
1450 3300047319 Ga0495674_0094633 Ga0495674_0094633_452_829 122
1451 3300047319 Ga0495674_0835104 Ga0495674_0835104_86_463 122
1452 3300047321 Ga0495676_0030282 Ga0495676_0030282_3935_4303 122
1453 3300047321 Ga0495676_0588623 Ga0495676_0588623_322_690 122
1454 3300047322 Ga0495680_0202098 Ga0495680_0202098_318_686 122
1455 3300047322 Ga0495680_0378620 Ga0495680_0378620_483_851 122
1456 3300047322 Ga0495680_1005008 Ga0495680_1005008_16_393 122
1457 3300047444 Ga0495675_0068217 Ga0495675_0068217_1554_1922 122
1458 3300047471 Ga0495684_0026659 Ga0495684_0026659_3094_3462 122
1459 3300047471 Ga0495684_0054352 Ga0495684_0054352_617_985 122
1460 3300047471 Ga0495684_0078814 Ga0495684_0078814_373_750 122
1461 3300047471 Ga0495684_0231057 Ga0495684_0231057_133_510 122
1462 3300047471 Ga0495684_0260054 Ga0495684_0260054_405_782 122
1463 3300047673 Ga0495593_0078777 Ga0495593_0078777_595_963 122
1464 3300048088 Ga0495602_0017278 Ga0495602_0017278_4696_5073 122
1465 3300048088 Ga0495602_0227086 Ga0495602_0227086_209_577 122
1466 3300048089 Ga0495614_0010953 Ga0495614_0010953_1504_1872 122
1467 3300048089 Ga0495614_0069510 Ga0495614_0069510_397_774 122
1468 3300048090 Ga0495615_0003089 Ga0495615_0003089_1546_1914 122
1469 3300048903 Ga0496100_0003660 Ga0496100_0003660_4060_4428 122
1470 3300048903 Ga0496100_0017930 Ga0496100_0017930_453_830 122
1471 3300048903 Ga0496100_0998411 Ga0496100_0998411_34_402 122
1472 3300048904 Ga0496101_0025125 Ga0496101_0025125_1601_1978 122
1473 3300048904 Ga0496101_0179518 Ga0496101_0179518_1158_1526 122
1474 3300048904 Ga0496101_0666373 Ga0496101_0666373_231_599 122
1475 3300048904 Ga0496101_0925184 Ga0496101_0925184_207_575 122
1476 3300048905 Ga0496102_0000916 Ga0496102_0000916_22637_23005 122
1477 3300048905 Ga0496102_0003028 Ga0496102_0003028_5216_5593 122
1478 3300048905 Ga0496102_0018905 Ga0496102_0018905_342_719 122
1479 3300048905 Ga0496102_0035581 Ga0496102_0035581_3096_3464 122
1480 3300048905 Ga0496102_0146115 Ga0496102_0146115_1018_1395 122
1481 3300048905 Ga0496102_0766183 Ga0496102_0766183_216_584 122
1482 3300048906 Ga0496103_0030082 Ga0496103_0030082_1334_1711 122
1483 3300048907 Ga0496104_0028984 Ga0496104_0028984_3369_3746 122
1484 3300048907 Ga0496104_0036226 Ga0496104_0036226_2538_2906 122
1485 3300048907 Ga0496104_0103951 Ga0496104_0103951_1078_1446 122
1486 3300048907 Ga0496104_0107857 Ga0496104_0107857_827_1195 122
1487 3300048907 Ga0496104_0322079 Ga0496104_0322079_917_1285 122
1488 3300048907 Ga0496104_0351967 Ga0496104_0351967_686_1054 122
1489 3300048907 Ga0496104_0370528 Ga0496104_0370528_51_419 122
1490 3300048908 Ga0496105_0078298 Ga0496105_0078298_1109_1477 122
1491 3300048908 Ga0496105_0139233 Ga0496105_0139233_1505_1873 122
1492 3300048908 Ga0496105_0166096 Ga0496105_0166096_1266_1634 122
1493 3300048908 Ga0496105_0213217 Ga0496105_0213217_1175_1543 122
1494 3300048908 Ga0496105_0524359 Ga0496105_0524359_488_856 122
1495 3300048908 Ga0496105_0684031 Ga0496105_0684031_379_747 122
1496 3300048909 Ga0496106_0003518 Ga0496106_0003518_10388_10765 122
1497 3300048909 Ga0496106_0030306 Ga0496106_0030306_328_696 122
1498 3300048909 Ga0496106_0087377 Ga0496106_0087377_342_719 122
1499 3300048909 Ga0496106_0970159 Ga0496106_0970159_281_649 122
1500 3300048909 Ga0496106_1362863 Ga0496106_1362863_163_531 122
1501 3300048910 Ga0496107_0000796 Ga0496107_0000796_15809_16186 122
1502 3300048910 Ga0496107_0067376 Ga0496107_0067376_2078_2455 122
1503 3300048910 Ga0496107_0933349 Ga0496107_0933349_200_568 122
1504 3300048911 Ga0496108_0032489 Ga0496108_0032489_3402_3770 122
1505 3300048911 Ga0496108_0124186 Ga0496108_0124186_1660_2028 122
1506 3300048911 Ga0496108_0286001 Ga0496108_0286001_1032_1400 122
1507 3300048911 Ga0496108_0482416 Ga0496108_0482416_417_794 122
1508 3300048911 Ga0496108_0767720 Ga0496108_0767720_324_692 122
1509 3300048911 Ga0496108_1634796 Ga0496108_1634796_96_473 122
1510 3300048912 Ga0496109_0060025 Ga0496109_0060025_1420_1788 122
1511 3300048912 Ga0496109_0087350 Ga0496109_0087350_321_698 122
1512 3300048912 Ga0496109_0404303 Ga0496109_0404303_255_623 122
1513 3300048912 Ga0496109_1425728 Ga0496109_1425728_126_494 122
1514 3300048913 Ga0496110_0000091 Ga0496110_0000091_16195_16563 122
1515 3300048913 Ga0496110_0004643 Ga0496110_0004643_10021_10389 122
1516 3300048913 Ga0496110_0023793 Ga0496110_0023793_1471_1848 122
1517 3300048913 Ga0496110_0286750 Ga0496110_0286750_869_1237 122
1518 3300048913 Ga0496110_0587594 Ga0496110_0587594_214_582 122
1519 3300048914 Ga0496111_0016892 Ga0496111_0016892_3065_3442 122
1520 3300048914 Ga0496111_0048928 Ga0496111_0048928_2278_2646 122
1521 3300048914 Ga0496111_0225915 Ga0496111_0225915_782_1150 122
1522 3300048914 Ga0496111_0375322 Ga0496111_0375322_28_396 122
1523 3300048914 Ga0496111_1316029 Ga0496111_1316029_19_387 122
1524 3300048915 Ga0496112_0030222 Ga0496112_0030222_4230_4598 122
1525 3300048915 Ga0496112_0356812 Ga0496112_0356812_909_1277 122
1526 3300048915 Ga0496112_0663177 Ga0496112_0663177_414_785 122
1527 3300048915 Ga0496112_0773487 Ga0496112_0773487_185_553 122
1528 3300048915 Ga0496112_1465119 Ga0496112_1465119_189_566 122
1529 3300048916 Ga0496113_0021257 Ga0496113_0021257_2060_2437 122
1530 3300048916 Ga0496113_0648146 Ga0496113_0648146_418_786 122
1531 3300048916 Ga0496113_0732631 Ga0496113_0732631_374_742 122
1532 3300048916 Ga0496113_0902278 Ga0496113_0902278_306_674 122
1533 3300048917 Ga0496114_0000386 Ga0496114_0000386_21871_22239 122
1534 3300048917 Ga0496114_0001141 Ga0496114_0001141_13548_13916 122
1535 3300048917 Ga0496114_0004194 Ga0496114_0004194_2540_2908 122
1536 3300048917 Ga0496114_0006073 Ga0496114_0006073_4705_5073 122
1537 3300048917 Ga0496114_0230229 Ga0496114_0230229_974_1342 122
1538 3300048917 Ga0496114_0320615 Ga0496114_0320615_223_591 122
1539 3300048917 Ga0496114_0353784 Ga0496114_0353784_193_570 122
1540 3300048917 Ga0496114_0778035 Ga0496114_0778035_174_542 122
1541 3300048918 Ga0496115_0006616 Ga0496115_0006616_5151_5519 122
1542 3300048918 Ga0496115_0047334 Ga0496115_0047334_629_997 122
1543 3300048918 Ga0496115_0059367 Ga0496115_0059367_320_688 122
1544 3300048918 Ga0496115_0389278 Ga0496115_0389278_714_1091 122
1545 3300048918 Ga0496115_0443708 Ga0496115_0443708_473_841 122
1546 3300048918 Ga0496115_0561298 Ga0496115_0561298_302_670 122
1547 3300048919 Ga0496116_0025193 Ga0496116_0025193_98_466 122
1548 3300048919 Ga0496116_0030225 Ga0496116_0030225_1440_1808 122
1549 3300048920 Ga0496117_0001863 Ga0496117_0001863_20978_21346 122
1550 3300048920 Ga0496117_0059650 Ga0496117_0059650_1151_1519 122
1551 3300048920 Ga0496117_0204017 Ga0496117_0204017_391_759 122
1552 3300048925 Ga0496122_0008592 Ga0496122_0008592_6296_6664 122
1553 3300048926 Ga0496123_0029360 Ga0496123_0029360_376_744 122
1554 3300048927 Ga0496124_0000001 Ga0496124_0000001_98354_98722 122
1555 3300048927 Ga0496124_0075016 Ga0496124_0075016_1364_1732 122
1556 3300048928 Ga0496125_0056825 Ga0496125_0056825_421_789 122
1557 3300048928 Ga0496125_0384470 Ga0496125_0384470_229_597 122
1558 3300048929 Ga0496126_0096151 Ga0496126_0096151_1390_1758 122
1559 3300048929 Ga0496126_0097584 Ga0496126_0097584_372_740 122
1560 3300048929 Ga0496126_0626774 Ga0496126_0626774_284_652 122
1561 3300049161 Ga0501305_018599 Ga0501305_018599_201_569 122
1562 3300049162 Ga0501307_006084 Ga0501307_006084_544_912 122
1563 3300049162 Ga0501307_091116 Ga0501307_091116_98_466 122
1564 3300049521 Ga0501298_057336 Ga0501298_057336_66_434 122
1565 3300049533 Ga0501317_062977 Ga0501317_062977_30_401 122
1566 3300049568 Ga0501031_0100714 Ga0501031_0100714_605_973 122
1567 3300049568 Ga0501031_0118379 Ga0501031_0118379_467_835 122
1568 3300049569 Ga0501032_0175090 Ga0501032_0175090_443_811 122
1569 3300049570 Ga0501033_0071425 Ga0501033_0071425_790_1158 122
1570 3300049571 Ga0501034_0079903 Ga0501034_0079903_1441_1809 122
1571 3300049571 Ga0501034_1384106 Ga0501034_1384106_131_499 122
1572 3300049572 Ga0501036_0014973 Ga0501036_0014973_2093_2461 122
1573 3300049572 Ga0501036_0034010 Ga0501036_0034010_235_603 122
1574 3300049572 Ga0501036_1550544 Ga0501036_1550544_137_505 122
1575 3300049573 Ga0501037_0011186 Ga0501037_0011186_1695_2063 122
1576 3300049573 Ga0501037_0700449 Ga0501037_0700449_199_567 122
1577 3300049574 Ga0501038_0000271 Ga0501038_0000271_22632_23000 122
1578 3300049574 Ga0501038_0583992 Ga0501038_0583992_441_809 122
1579 3300049575 Ga0501039_0108043 Ga0501039_0108043_1344_1712 122
1580 3300049575 Ga0501039_0153331 Ga0501039_0153331_207_575 122
1581 3300049575 Ga0501039_0306749 Ga0501039_0306749_518_895 122
1582 3300049575 Ga0501039_0806175 Ga0501039_0806175_80_448 122
1583 3300049575 Ga0501039_0960743 Ga0501039_0960743_20_388 122
1584 3300049575 Ga0501039_1022063 Ga0501039_1022063_23_403 122
1585 3300049576 Ga0501040_0001044 Ga0501040_0001044_4872_5240 122
1586 3300049576 Ga0501040_0062391 Ga0501040_0062391_876_1244 122
1587 3300049576 Ga0501040_0088966 Ga0501040_0088966_549_926 122
1588 3300049576 Ga0501040_0160571 Ga0501040_0160571_124_492 122
1589 3300049576 Ga0501040_0211230 Ga0501040_0211230_758_1126 122
1590 3300049576 Ga0501040_0230286 Ga0501040_0230286_868_1248 122
1591 3300049577 Ga0501041_0000002 Ga0501041_0000002_71462_71830 122
1592 3300049577 Ga0501041_0163295 Ga0501041_0163295_94_474 122
1593 3300049578 Ga0501042_0000645 Ga0501042_0000645_13252_13620 122
1594 3300049578 Ga0501042_0048885 Ga0501042_0048885_462_830 122
1595 3300049578 Ga0501042_0134671 Ga0501042_0134671_385_753 122
1596 3300049579 Ga0501043_0085474 Ga0501043_0085474_1326_1694 122
1597 3300049579 Ga0501043_0121334 Ga0501043_0121334_1614_1982 122
1598 3300049579 Ga0501043_0185513 Ga0501043_0185513_1237_1605 122
1599 3300049580 Ga0501046_0051614 Ga0501046_0051614_442_810 122
1600 3300049580 Ga0501046_0119838 Ga0501046_0119838_959_1327 122
1601 3300049580 Ga0501046_0295744 Ga0501046_0295744_579_947 122
1602 3300049580 Ga0501046_1237436 Ga0501046_1237436_132_500 122
1603 3300049581 Ga0501047_0468086 Ga0501047_0468086_613_981 122
1604 3300049582 Ga0501048_0002109 Ga0501048_0002109_415_783 122
1605 3300049582 Ga0501048_0234505 Ga0501048_0234505_183_551 122
1606 3300049582 Ga0501048_0241932 Ga0501048_0241932_548_925 122
1607 3300049582 Ga0501048_0902011 Ga0501048_0902011_218_598 122
1608 3300049583 Ga0501067_0003773 Ga0501067_0003773_5354_5722 122
1609 3300049584 Ga0501068_0117831 Ga0501068_0117831_1114_1482 122
1610 3300049584 Ga0501068_0225851 Ga0501068_0225851_748_1116 122
1611 3300049584 Ga0501068_0262995 Ga0501068_0262995_60_428 122
1612 3300049585 Ga0501069_0748886 Ga0501069_0748886_106_474 122
1613 3300049586 Ga0501070_0607196 Ga0501070_0607196_475_843 122
1614 3300049586 Ga0501070_1410966 Ga0501070_1410966_140_508 122
1615 3300049587 Ga0501071_0001937 Ga0501071_0001937_5483_5851 122
1616 3300049587 Ga0501071_0145214 Ga0501071_0145214_547_927 122
1617 3300049587 Ga0501071_0172545 Ga0501071_0172545_1193_1561 122
1618 3300049587 Ga0501071_0231051 Ga0501071_0231051_159_527 122
1619 3300049588 Ga0501072_0000128 Ga0501072_0000128_48525_48893 122
1620 3300049588 Ga0501072_0032391 Ga0501072_0032391_995_1363 122
1621 3300049588 Ga0501072_0215997 Ga0501072_0215997_632_1000 122
1622 3300049589 Ga0501073_0003382 Ga0501073_0003382_4141_4509 122
1623 3300049589 Ga0501073_0009833 Ga0501073_0009833_1623_1994 122
1624 3300049589 Ga0501073_0038469 Ga0501073_0038469_2869_3237 122
1625 3300049589 Ga0501073_0207608 Ga0501073_0207608_699_1067 122
1626 3300049590 Ga0501074_0003300 Ga0501074_0003300_11005_11373 122
1627 3300049590 Ga0501074_0110042 Ga0501074_0110042_783_1160 122
1628 3300049590 Ga0501074_0281025 Ga0501074_0281025_23_391 122
1629 3300049590 Ga0501074_0387843 Ga0501074_0387843_439_807 122
1630 3300049591 Ga0501075_0015531 Ga0501075_0015531_1283_1651 122
1631 3300049591 Ga0501075_0038544 Ga0501075_0038544_2551_2919 122
1632 3300049591 Ga0501075_0090751 Ga0501075_0090751_1814_2182 122
1633 3300049591 Ga0501075_0103332 Ga0501075_0103332_830_1198 122
1634 3300049591 Ga0501075_0149057 Ga0501075_0149057_842_1219 122
1635 3300049591 Ga0501075_0536782 Ga0501075_0536782_417_785 122
1636 3300049592 Ga0501076_0000022 Ga0501076_0000022_71336_71704 122
1637 3300049592 Ga0501076_0012924 Ga0501076_0012924_3500_3868 122
1638 3300049592 Ga0501076_0015095 Ga0501076_0015095_3837_4217 122
1639 3300049592 Ga0501076_0019380 Ga0501076_0019380_3439_3816 122
1640 3300049592 Ga0501076_0165212 Ga0501076_0165212_1409_1786 122
1641 3300049592 Ga0501076_0198838 Ga0501076_0198838_322_690 122
1642 3300049592 Ga0501076_1433015 Ga0501076_1433015_172_552 122
1643 3300049592 Ga0501076_1586770 Ga0501076_1586770_110_478 122
1644 3300049593 Ga0501077_0000017 Ga0501077_0000017_9218_9586 122
1645 3300049593 Ga0501077_0005748 Ga0501077_0005748_613_981 122
1646 3300049593 Ga0501077_0013601 Ga0501077_0013601_261_629 122
1647 3300049593 Ga0501077_0138932 Ga0501077_0138932_784_1152 122
1648 3300049593 Ga0501077_0182664 Ga0501077_0182664_255_623 122
1649 3300049593 Ga0501077_0477644 Ga0501077_0477644_330_710 122
1650 3300049649 Ga0501198_019554 Ga0501198_019554_620_988 122
1651 3300049661 Ga0501217_156633 Ga0501217_156633_146_514 122
1652 3300049679 Ga0501249_047500 Ga0501249_047500_352_720 122
1653 3300049682 Ga0501252_029041 Ga0501252_029041_229_597 122
1654 3300049687 Ga0501258_020947 Ga0501258_020947_171_539 122
1655 3300049741 Ga0501079_0000549 Ga0501079_0000549_18663_19031 122
1656 3300049741 Ga0501079_0039652 Ga0501079_0039652_2745_3122 122
1657 3300049741 Ga0501079_0219200 Ga0501079_0219200_388_756 122
1658 3300049741 Ga0501079_0338296 Ga0501079_0338296_56_436 122
1659 3300049742 Ga0501080_0004016 Ga0501080_0004016_8525_8896 122
1660 3300049742 Ga0501080_0054009 Ga0501080_0054009_2859_3227 122
1661 3300049742 Ga0501080_0058519 Ga0501080_0058519_504_884 122
1662 3300049742 Ga0501080_0169697 Ga0501080_0169697_950_1327 122
1663 3300049742 Ga0501080_0430265 Ga0501080_0430265_156_524 122
1664 3300049742 Ga0501080_1110040 Ga0501080_1110040_76_453 122
1665 3300049743 Ga0501081_0000105 Ga0501081_0000105_22979_23347 122
1666 3300049743 Ga0501081_0212764 Ga0501081_0212764_26_394 122
1667 3300049743 Ga0501081_0438763 Ga0501081_0438763_561_938 122
1668 3300049743 Ga0501081_0921357 Ga0501081_0921357_120_488 122
1669 3300049744 Ga0501083_0098494 Ga0501083_0098494_236_604 122
1670 3300049744 Ga0501083_0416796 Ga0501083_0416796_402_779 122
1671 3300049744 Ga0501083_0832287 Ga0501083_0832287_97_468 122
1672 3300049744 Ga0501083_0890704 Ga0501083_0890704_201_569 122
1673 3300049767 Ga0501270_003093 Ga0501270_003093_352_720 122
1674 3300049822 Ga0501035_0002385 Ga0501035_0002385_9812_10180 122
1675 3300049822 Ga0501035_0346800 Ga0501035_0346800_95_463 122
1676 3300049822 Ga0501035_0386792 Ga0501035_0386792_401_778 122
1677 3300049822 Ga0501035_0900218 Ga0501035_0900218_247_615 122
1678 3300049822 Ga0501035_1074586 Ga0501035_1074586_49_417 122
1679 3300049824 Ga0501045_0000113 Ga0501045_0000113_21733_22101 122
1680 3300049824 Ga0501045_0005535 Ga0501045_0005535_8049_8417 122
1681 3300049824 Ga0501045_0093809 Ga0501045_0093809_471_848 122
1682 3300049824 Ga0501045_0193347 Ga0501045_0193347_89_457 122
1683 3300049851 Ga0501212_038484 Ga0501212_038484_371_739 122
1684 3300050491 nmdc:mga00v17_852269_c1 nmdc:mga00v17_852269_c1_65_433 122
1685 3300050507 nmdc:mga05p37_1252235_c1 nmdc:mga05p37_1252235_c1_163_531 122
1686 3300050507 nmdc:mga05p37_1701_c1 nmdc:mga05p37_1701_c1_22543_22920 122
1687 3300050507 nmdc:mga05p37_1842889_c1 nmdc:mga05p37_1842889_c1_191_559 122
1688 3300050507 nmdc:mga05p37_1993750_c1 nmdc:mga05p37_1993750_c1_156_524 122
1689 3300050507 nmdc:mga05p37_217608_c1 nmdc:mga05p37_217608_c1_868_1236 122
1690 3300050507 nmdc:mga05p37_2357_c1 nmdc:mga05p37_2357_c1_1823_2191 122
1691 3300050507 nmdc:mga05p37_2405_c1 nmdc:mga05p37_2405_c1_5652_6029 122
1692 3300050507 nmdc:mga05p37_244065_c1 nmdc:mga05p37_244065_c1_619_987 122
1693 3300050507 nmdc:mga05p37_28557_c1 nmdc:mga05p37_28557_c1_1282_1659 122
1694 3300050507 nmdc:mga05p37_43119_c2 nmdc:mga05p37_43119_c2_1330_1698 122
1695 3300050507 nmdc:mga05p37_53231_c1 nmdc:mga05p37_53231_c1_1416_1787 122
1696 3300050507 nmdc:mga05p37_5571_c1 nmdc:mga05p37_5571_c1_5674_6042 122
1697 3300050508 nmdc:mga09592_1578074_c1 nmdc:mga09592_1578074_c1_117_485 122
1698 3300050508 nmdc:mga09592_194091_c1 nmdc:mga09592_194091_c1_1062_1430 122
1699 3300050508 nmdc:mga09592_47614_c1 nmdc:mga09592_47614_c1_1336_1704 122
1700 3300050508 nmdc:mga09592_7449_c1 nmdc:mga09592_7449_c1_2737_3105 122
1701 3300050508 nmdc:mga09592_845691_c1 nmdc:mga09592_845691_c1_83_451 122
1702 3300050508 nmdc:mga09592_88599_c1 nmdc:mga09592_88599_c1_212_583 122
1703 3300050509 nmdc:mga0qj67_222840_c1 nmdc:mga0qj67_222840_c1_230_598 122
1704 3300050509 nmdc:mga0qj67_263938_c1 nmdc:mga0qj67_263938_c1_806_1174 122
1705 3300050509 nmdc:mga0qj67_287621_c1 nmdc:mga0qj67_287621_c1_709_1077 122
1706 3300050509 nmdc:mga0qj67_36968_c1 nmdc:mga0qj67_36968_c1_1773_2141 122
1707 3300050509 nmdc:mga0qj67_610306_c1 nmdc:mga0qj67_610306_c1_318_686 122
1708 3300050510 nmdc:mga06r32_1302523_c1 nmdc:mga06r32_1302523_c1_189_557 122
1709 3300050510 nmdc:mga06r32_299928_c1 nmdc:mga06r32_299928_c1_551_919 122
1710 3300050510 nmdc:mga06r32_600_c2 nmdc:mga06r32_600_c2_5800_6168 122
1711 3300050510 nmdc:mga06r32_721966_c1 nmdc:mga06r32_721966_c1_301_669 122
1712 3300050511 nmdc:mga08y16_1403866_c1 nmdc:mga08y16_1403866_c1_277_645 122
1713 3300050511 nmdc:mga08y16_158966_c1 nmdc:mga08y16_158966_c1_550_927 122
1714 3300050511 nmdc:mga08y16_1650152_c1 nmdc:mga08y16_1650152_c1_41_412 122
1715 3300050511 nmdc:mga08y16_20950_c1 nmdc:mga08y16_20950_c1_4899_5267 122
1716 3300050511 nmdc:mga08y16_24_c1 nmdc:mga08y16_24_c1_59779_60150 122
1717 3300050511 nmdc:mga08y16_421972_c1 nmdc:mga08y16_421972_c1_934_1302 122
1718 3300050511 nmdc:mga08y16_692563_c1 nmdc:mga08y16_692563_c1_366_734 122
1719 3300050512 nmdc:mga0n895_116858_c1 nmdc:mga0n895_116858_c1_558_926 122
1720 3300050512 nmdc:mga0n895_124772_c1 nmdc:mga0n895_124772_c1_1337_1705 122
1721 3300050512 nmdc:mga0n895_15345_c1 nmdc:mga0n895_15345_c1_4334_4711 122
1722 3300050512 nmdc:mga0n895_157994_c1 nmdc:mga0n895_157994_c1_1199_1567 122
1723 3300050512 nmdc:mga0n895_16211_c1 nmdc:mga0n895_16211_c1_628_996 122
1724 3300050512 nmdc:mga0n895_165230_c1 nmdc:mga0n895_165230_c1_182_559 122
1725 3300050512 nmdc:mga0n895_248534_c1 nmdc:mga0n895_248534_c1_1383_1751 122
1726 3300050512 nmdc:mga0n895_32532_c1 nmdc:mga0n895_32532_c1_890_1258 122
1727 3300050512 nmdc:mga0n895_4227_c1 nmdc:mga0n895_4227_c1_6138_6515 122
1728 3300050513 nmdc:mga0rr50_15066_c1 nmdc:mga0rr50_15066_c1_262_630 122
1729 3300050513 nmdc:mga0rr50_1883_c1 nmdc:mga0rr50_1883_c1_2888_3265 122
1730 3300050513 nmdc:mga0rr50_309450_c1 nmdc:mga0rr50_309450_c1_884_1261 122
1731 3300050513 nmdc:mga0rr50_436178_c1 nmdc:mga0rr50_436178_c1_499_867 122
1732 3300050513 nmdc:mga0rr50_451926_c1 nmdc:mga0rr50_451926_c1_283_660 122
1733 3300050513 nmdc:mga0rr50_496957_c1 nmdc:mga0rr50_496957_c1_535_912 122
1734 3300050513 nmdc:mga0rr50_603694_c1 nmdc:mga0rr50_603694_c1_83_451 122
1735 3300050513 nmdc:mga0rr50_70361_c1 nmdc:mga0rr50_70361_c1_503_871 122
1736 3300050513 nmdc:mga0rr50_98517_c1 nmdc:mga0rr50_98517_c1_863_1231 122
1737 3300050514 nmdc:mga08x19_12242_c1 nmdc:mga08x19_12242_c1_4178_4546 122
1738 3300050514 nmdc:mga08x19_39582_c1 nmdc:mga08x19_39582_c1_1768_2136 122
1739 3300050514 nmdc:mga08x19_53364_c1 nmdc:mga08x19_53364_c1_1074_1451 122
1740 3300050514 nmdc:mga08x19_59650_c1 nmdc:mga08x19_59650_c1_104_472 122
1741 3300050514 nmdc:mga08x19_87268_c1 nmdc:mga08x19_87268_c1_325_702 122
1742 3300050514 nmdc:mga08x19_95363_c1 nmdc:mga08x19_95363_c1_1517_1894 122
1743 3300050515 nmdc:mga0a205_10723_c1 nmdc:mga0a205_10723_c1_5289_5666 122
1744 3300050515 nmdc:mga0a205_137179_c1 nmdc:mga0a205_137179_c1_24_401 122
1745 3300050515 nmdc:mga0a205_16417_c1 nmdc:mga0a205_16417_c1_625_993 122
1746 3300050515 nmdc:mga0a205_245638_c1 nmdc:mga0a205_245638_c1_328_705 122
1747 3300050515 nmdc:mga0a205_256160_c1 nmdc:mga0a205_256160_c1_481_858 122
1748 3300050515 nmdc:mga0a205_260474_c1 nmdc:mga0a205_260474_c1_1117_1494 122
1749 3300050515 nmdc:mga0a205_287318_c1 nmdc:mga0a205_287318_c1_486_854 122
1750 3300050515 nmdc:mga0a205_34611_c1 nmdc:mga0a205_34611_c1_478_846 122
1751 3300050515 nmdc:mga0a205_357051_c1 nmdc:mga0a205_357051_c1_153_524 122
1752 3300050515 nmdc:mga0a205_390_c1 nmdc:mga0a205_390_c1_14518_14886 122
1753 3300050515 nmdc:mga0a205_429315_c1 nmdc:mga0a205_429315_c1_625_993 122
1754 3300050515 nmdc:mga0a205_63533_c1 nmdc:mga0a205_63533_c1_569_937 122
1755 3300050515 nmdc:mga0a205_8807_c1 nmdc:mga0a205_8807_c1_2914_3291 122
1756 3300053077 Ga0495601_0016503 Ga0495601_0016503_1748_2116 122
1757 3300053077 Ga0495601_0460347 Ga0495601_0460347_139_507 122
1758 3300053077 Ga0495601_0493210 Ga0495601_0493210_110_478 122
1759 3300053077 Ga0495601_0562803 Ga0495601_0562803_251_628 122
1760 3300053078 Ga0495612_0246593 Ga0495612_0246593_80_457 122
1761 3300053084 Ga0495595_0015164 Ga0495595_0015164_1157_1534 122
1762 3300053084 Ga0495595_0466989 Ga0495595_0466989_47_424 122
1763 3300053085 Ga0495619_0027932 Ga0495619_0027932_1760_2128 122
1764 3300053085 Ga0495619_0032380 Ga0495619_0032380_972_1349 122
1765 3300053085 Ga0495619_0100730 Ga0495619_0100730_446_814 122
1766 3300053085 Ga0495619_0495056 Ga0495619_0495056_70_438 122
1767 3300053085 Ga0495619_0518105 Ga0495619_0518105_322_690 122
1768 3300053139 Ga0500568_0035391 Ga0500568_0035391_1188_1556 122
1769 3300054114 Ga0501084_0000159 Ga0501084_0000159_28579_28947 122
1770 3300054114 Ga0501084_0071866 Ga0501084_0071866_1367_1735 122
1771 3300054114 Ga0501084_0287098 Ga0501084_0287098_183_551 122
1772 3300054114 Ga0501084_0503695 Ga0501084_0503695_115_483 122
1773 3300054114 Ga0501084_0505832 Ga0501084_0505832_201_569 122
1774 3300059477 Ga0587084_041383 Ga0587084_041383_285_653 122
1775 3300060346 Ga0587111_0035651 Ga0587111_0035651_563_934 122
1776 3300060346 Ga0587111_0078441 Ga0587111_0078441_141_509 122
1777 3300060346 Ga0587111_0283623 Ga0587111_0283623_69_437 122
1778 3300060353 Ga0501082_0002410 Ga0501082_0002410_12229_12597 122
1779 3300060353 Ga0501082_0485350 Ga0501082_0485350_234_611 122
1780 3300060353 Ga0501082_0650476 Ga0501082_0650476_424_804 122
1781 3300061734 Ga0530510_0002449 Ga0530510_0002449_8611_8979 122
1782 3300061734 Ga0530510_0125550 Ga0530510_0125550_983_1351 122
1783 3300061734 Ga0530510_0194648 Ga0530510_0194648_16_393 122
1784 3300061734 Ga0530510_0298278 Ga0530510_0298278_660_1028 122
1785 3300061734 Ga0530510_0357705 Ga0530510_0357705_278_658 122
1786 3300061734 Ga0530510_0392298 Ga0530510_0392298_415_783 122
1787 3300061734 Ga0530510_0860580 Ga0530510_0860580_306_674 122

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00238

Ribosomal_L14

Ribosomal protein L14p/L23e

23

134

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v9a-assembly1.cif.gz_BN crystal structure of the 70s ribosome with tetracycline. 0.9959 1 122
7y41-assembly1.cif.gz_L mycobacterium smegmatis 50s ribosomal subunit from log phase of growth 0.9906 1 122
8fn2-assembly1.cif.gz_M the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi 0.9879 1 122
6n1d-assembly2.cif.gz_BL14 x-ray crystal complex showing spontaneous ribosomal translocation of mrna and trnas into a chimeric hybrid state 0.9875 1 122
8cvm-assembly1.cif.gz_j cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.9874 1 122
ID Description Score Start End Superfamily
6ddgW00 Mainly Beta;Beta Barrel;Ribosomal Protein L14;Ribosomal protein L14/L23 0.9827 2 121 2.40.150.20
6ddgW00 Mainly Beta;Beta Barrel;Ribosomal Protein L14;Ribosomal protein L14/L23 0.9747 2 121 2.40.150.20
3i1nK00 Mainly Beta;Beta Barrel;Ribosomal Protein L14;Ribosomal protein L14/L23 0.9509 1 121 2.40.150.20
1vw4I00 Mainly Beta;Beta Barrel;Ribosomal Protein L14;Ribosomal protein L14/L23 0.9437 1 122 2.40.150.20
1vw4I00 Mainly Beta;Beta Barrel;Ribosomal Protein L14;Ribosomal protein L14/L23 0.9362 1 122 2.40.150.20
ID Description Score Start End GO Terms
AF-A0A1M3KUM1-F1-model_v4 Large ribosomal subunit protein uL14 1.002 1 122 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A434CQN6-F1-model_v4 50S ribosomal protein L14 1.002 1 65 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-W4SMQ2-F1-model_v4 50S ribosomal protein L14 1.002 1 61 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A1T4WGJ1-F1-model_v4 Large ribosomal subunit protein uL14 1.001 1 122 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-E5Y766-F1-model_v4 Large ribosomal subunit protein uL14 1 1 122 GO:0003735
GO:0006412
GO:0022625
GO:0070180

Feature Viewer

pLDDT pTM Quality
95.99 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map