F495693

General Info

Members Datasets Scaffolds Average Seq Length
1785 566 1746 141

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0000133|Ga0395900_0000133_36234_36698
Length 154
Sequence MNFRRHHPEEPEINLIPFIDVLLVVLIFLMLSTTYSKFTELQVTLPTADAQAMHDQPAEVVVAVSADGRYAVNHKAVEGRSVDVLTAELAAAAAGQKDPVVIISADAAATHQSVINVLDAARRAGLPHLTFASQSGGGANGSAPPADEPAPATP

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
4 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
5 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
6 2643221556 Massilia sp. Root1485 Isolate Unclassified
7 2643221585 Pelomonas sp. Root662 Isolate Unclassified
8 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
9 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
10 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
11 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
12 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
13 2643221645 Massilia sp. Root351 Isolate Unclassified
14 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
15 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
16 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
17 2643221656 Pelomonas sp. Root405 Isolate Unclassified
18 2643221660 Methylibium sp. Root1272 Isolate Unclassified
19 2643221684 Massilia sp. Root133 Isolate Unclassified
20 2738541297 Duganella sp. GV083 Isolate Unclassified
21 2738541337 Pelomonas sp. BT06 Isolate Unclassified
22 2738541357 Duganella sp. GV053 Isolate Unclassified
23 2738543003 Duganella sp. GV066 Isolate Unclassified
24 2738543026 Duganella sp. GV089 Isolate Unclassified
25 2738543029 Duganella sp. GV039 Isolate Unclassified
26 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
27 2821131069 Duganella sp. 1224 Isolate Unclassified
28 2842711865 Duganella sp. R-73148 Isolate Unclassified
29 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
30 2857553236 Duganella sp. R-74557 Isolate Unclassified
31 2857558681 Duganella sp. R-74565 Isolate Unclassified
32 2857564685 Duganella sp. R-74599 Isolate Unclassified
33 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
34 2904424332 Duganella sp. 1411 Isolate Rhizosphere
35 2919476304 Duganella sp. 3397 Isolate Unclassified
36 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
37 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
38 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
39 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
40 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
41 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
42 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
43 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
44 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
45 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
46 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
47 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
48 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
49 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
50 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
51 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
52 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
53 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
54 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
55 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
56 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
57 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
58 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
59 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
60 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
61 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
62 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
63 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
64 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
65 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
66 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
67 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
68 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
69 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
70 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
71 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
72 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
73 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
74 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
75 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
76 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
77 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
78 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
79 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
80 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
81 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
82 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
83 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
84 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
85 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
86 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
87 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
88 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
89 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
90 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
91 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
92 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
93 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
94 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
95 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
96 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
97 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
98 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
99 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
100 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
101 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
102 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
103 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
104 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
105 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
106 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
107 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
108 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
109 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
110 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
111 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
112 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
113 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
114 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
115 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
116 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
117 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
118 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
119 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
120 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
121 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
122 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
123 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
124 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
125 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
126 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
127 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
128 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
129 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
130 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
131 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
132 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
133 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
134 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
135 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
136 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
137 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
138 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
139 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
140 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
141 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
142 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
143 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
144 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
145 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
146 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
147 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
148 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
149 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
150 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
151 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
152 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
153 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
154 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
155 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
156 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
157 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
158 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
159 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
160 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
161 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
162 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
163 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
164 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
165 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
166 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
167 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
168 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
169 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
170 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
171 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
175 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
177 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
178 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
179 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
182 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
183 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
185 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
186 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
187 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
188 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
189 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
190 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
191 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
245 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
248 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
249 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
252 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
253 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
255 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
259 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
260 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
261 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
262 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
263 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
264 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
265 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
266 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
267 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
268 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
269 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
270 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
271 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
272 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
273 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
274 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
275 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
276 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
277 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
278 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
279 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
280 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
281 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
282 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
283 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
284 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
285 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
286 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
287 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
288 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
289 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
290 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
291 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
292 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
293 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
294 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
295 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
296 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
297 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
298 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
299 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
300 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
301 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
302 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
303 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
304 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
305 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
306 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
307 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
308 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
309 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
310 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
311 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
312 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
313 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
314 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
315 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
316 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
317 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
318 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
319 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
320 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
321 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
322 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
323 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
324 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
325 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
326 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
327 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
328 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
329 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
330 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
331 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
332 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
333 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
334 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
335 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
336 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
337 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
338 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
339 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
340 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
341 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
342 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
343 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
344 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
345 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
346 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
347 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
348 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
349 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
350 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
351 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
352 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
353 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
354 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
355 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
356 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
357 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
358 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
359 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
360 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
361 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
362 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
363 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
364 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
365 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
366 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
367 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
368 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
369 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
370 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
371 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
372 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
373 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
374 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
375 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
376 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
377 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
378 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
379 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
380 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
381 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
382 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
383 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
384 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
385 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
386 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
387 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
388 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
389 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
390 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
391 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
392 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
393 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
394 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
395 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
396 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
397 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
398 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
399 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
400 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
401 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
402 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
403 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
404 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
405 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
406 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
407 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
408 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
409 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
410 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
411 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
412 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
413 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
414 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
415 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
416 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
417 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
418 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
419 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
420 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
421 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
422 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
423 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
424 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
425 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
426 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
427 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
428 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
429 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
430 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
431 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
432 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
433 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
434 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
435 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
436 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
437 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
438 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
439 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
440 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
441 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
442 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
443 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
444 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
445 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
446 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
447 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
448 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
449 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
450 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
451 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
452 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
453 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
454 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
455 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
456 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
457 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
458 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
459 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
460 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
461 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
462 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
463 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
464 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
465 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
466 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
467 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
468 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
469 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
470 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
471 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
472 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
473 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
474 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
475 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
476 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
477 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
478 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
479 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
480 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
481 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
482 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
483 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
484 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
485 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
486 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
487 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
488 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
489 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
490 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
491 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
492 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
493 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
494 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
495 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
496 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
497 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
498 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
499 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
500 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
501 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
502 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
503 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
504 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
505 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
506 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
507 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
508 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
509 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
510 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
511 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
512 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
513 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
514 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
515 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
516 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
517 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
518 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
519 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
520 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
521 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
522 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
523 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
524 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
525 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
526 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
527 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
528 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
529 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
530 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
531 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
532 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
533 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
534 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
535 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
536 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
537 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
538 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
539 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
540 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
541 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
542 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
543 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
544 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
545 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
546 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
547 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
548 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
549 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
550 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
551 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
552 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
553 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
554 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
555 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
556 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
557 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
558 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
559 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
560 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
561 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
562 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
563 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
564 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
565 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
566 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.25
Metatranscriptomes 0.56
Isolates 2.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.52
Nodule 0.39
Rhizoplane 4.09
Rhizosphere 79.55
Stem 0
Stem Tuber 0
Unclassified 7.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10016707 3300001979 Bacteria 2643
2 JGI25156J39149_1000114 3300002705 Bacteria 57756
3 JGI25154J39366_1002215 3300002738 Bacteria 5358
4 JGI25154J39366_1003246 3300002738 Bacteria 3542
5 JGI25157J39369_1000015 3300002741 Bacteria 194042
6 JGI25150J39212_1014060 3300002774 Bacteria 1369
7 JGI25159J45721_1006583 3300002987 Bacteria 3459
8 JGI25153J46596_10017655 3300003215 Bacteria 2803
9 rootH2_10058683 3300003320 Bacteria 2490
10 rootL2_10031669 3300003322 Bacteria 3117
11 rootH1_10010269 3300003323 Bacteria 2239
12 JGI26128J50194_1000617 3300003347 Bacteria 2036
13 Ga0055539_1000967 3300003752 Bacteria 6333
14 Ga0055533_1000010 3300003756 Bacteria 491196
15 Ga0055525_1000013 3300003759 Bacteria 440870
16 Ga0055525_1000074 3300003759 Bacteria 178058
17 Ga0055525_1001452 3300003759 Bacteria 4263
18 Ga0055535_1006711 3300003761 Bacteria 2292
19 Ga0055542_1019745 3300003762 Bacteria 1000
20 Ga0055529_1000100 3300003763 Bacteria 131049
21 Ga0055529_1000303 3300003763 Bacteria 56663
22 Ga0055526_1000010 3300003771 Bacteria 241512
23 Ga0055526_1000104 3300003771 Bacteria 73451
24 Ga0055526_1000410 3300003771 Bacteria 34678
25 Ga0055537_1000200 3300003773 Bacteria 44838
26 Ga0055524_1000025 3300003775 Bacteria 216427
27 Ga0055524_1005355 3300003775 Bacteria 5748
28 Ga0055524_1008185 3300003775 Bacteria 4365
29 Ga0055534_1000083 3300003784 Bacteria 74541
30 Ga0055528_1000372 3300003790 Bacteria 36454
31 Ga0055540_1103473 3300003792 Bacteria 529
32 Ga0055531_10000064 3300003794 Bacteria 117923
33 Ga0055543_1004761 3300004625 Bacteria 3615
34 Ga0055543_1049002 3300004625 Bacteria 696
35 Ga0065165_1000074 3300005262 Bacteria 164454
36 Ga0065165_1000120 3300005262 Bacteria 134211
37 Ga0065165_1000889 3300005262 Bacteria 38581
38 Ga0065165_1005640 3300005262 Bacteria 6921
39 Ga0065165_1028015 3300005262 Bacteria 1827
40 Ga0065165_1032237 3300005262 Bacteria 1645
41 Ga0065707_10107803 3300005295 Bacteria 2538
42 Ga0070658_10026499 3300005327 Bacteria 4651
43 Ga0070658_10037732 3300005327 Bacteria 3895
44 Ga0070658_10141993 3300005327 Bacteria 2006
45 Ga0070658_10170300 3300005327 Bacteria 1829
46 Ga0070658_11384646 3300005327 Bacteria 610
47 Ga0070676_10095269 3300005328 Bacteria 1830
48 Ga0070676_10155113 3300005328 Bacteria 1469
49 Ga0070676_10222677 3300005328 Bacteria 1247
50 Ga0070676_10366082 3300005328 Bacteria 995
51 Ga0070676_10726973 3300005328 Bacteria 727
52 Ga0070683_100005699 3300005329 Bacteria 10405
53 Ga0070683_100109501 3300005329 Bacteria 2605
54 Ga0070690_100001536 3300005330 Bacteria 12104
55 Ga0070670_100044272 3300005331 Bacteria 3827
56 Ga0070670_100045928 3300005331 Bacteria 3755
57 Ga0070670_100050278 3300005331 Bacteria 3582
58 Ga0070670_100156245 3300005331 Bacteria 1975
59 Ga0070670_100393495 3300005331 Bacteria 1222
60 Ga0070670_100811054 3300005331 Bacteria 845
61 Ga0070670_101519250 3300005331 Bacteria 615
62 Ga0070677_10007539 3300005333 Bacteria 3635
63 Ga0070677_10017613 3300005333 Bacteria 2560
64 Ga0070677_10226157 3300005333 Bacteria 917
65 Ga0070677_10269223 3300005333 Bacteria 853
66 Ga0068869_100036690 3300005334 Bacteria 3481
67 Ga0068869_100772992 3300005334 Bacteria 824
68 Ga0068869_101050214 3300005334 Bacteria 711
69 Ga0070666_10680537 3300005335 Bacteria 754
70 Ga0070680_100016692 3300005336 Bacteria 5780
71 Ga0070680_100593369 3300005336 Bacteria 951
72 Ga0070680_100815715 3300005336 Bacteria 804
73 Ga0070680_100835370 3300005336 Bacteria 794
74 Ga0070682_100050509 3300005337 Bacteria 2597
75 Ga0070682_100303495 3300005337 Bacteria 1173
76 Ga0068868_100078234 3300005338 Bacteria 2647
77 Ga0070660_100025792 3300005339 Bacteria 4371
78 Ga0070660_100061600 3300005339 Bacteria 2913
79 Ga0070660_100478924 3300005339 Bacteria 1034
80 Ga0070660_100806976 3300005339 Bacteria 789
81 Ga0070660_101071812 3300005339 Bacteria 682
82 Ga0070689_100674438 3300005340 Bacteria 901
83 Ga0070661_100004078 3300005344 Bacteria 10061
84 Ga0070661_100038941 3300005344 Bacteria 3462
85 Ga0070661_100211037 3300005344 Bacteria 1486
86 Ga0070661_100542839 3300005344 Bacteria 934
87 Ga0070668_100634446 3300005347 Bacteria 937
88 Ga0070669_100014248 3300005353 Bacteria 5657
89 Ga0070669_100037978 3300005353 Bacteria 3495
90 Ga0070669_100106693 3300005353 Bacteria 2121
91 Ga0070669_100188610 3300005353 Bacteria 1616
92 Ga0070669_100264513 3300005353 Bacteria 1373
93 Ga0070669_100281790 3300005353 Bacteria 1332
94 Ga0070675_100002690 3300005354 Bacteria 13361
95 Ga0070675_100011188 3300005354 Bacteria 7020
96 Ga0070675_100048103 3300005354 Bacteria 3496
97 Ga0070675_100053943 3300005354 Bacteria 3306
98 Ga0070675_100104159 3300005354 Bacteria 2393
99 Ga0070675_100232111 3300005354 Bacteria 1610
100 Ga0070675_100256119 3300005354 Bacteria 1533
101 Ga0070675_100301189 3300005354 Bacteria 1412
102 Ga0070675_100617491 3300005354 Bacteria 984
103 Ga0070671_100036807 3300005355 Bacteria 4057
104 Ga0070671_100038300 3300005355 Bacteria 3979
105 Ga0070671_100219491 3300005355 Bacteria 1613
106 Ga0070671_100358210 3300005355 Bacteria 1245
107 Ga0070671_100529714 3300005355 Bacteria 1015
108 Ga0070671_100634338 3300005355 Bacteria 924
109 Ga0070674_100005898 3300005356 Bacteria 7122
110 Ga0070674_100186772 3300005356 Bacteria 1591
111 Ga0070674_100299279 3300005356 Bacteria 1282
112 Ga0070674_100999724 3300005356 Bacteria 734
113 Ga0070674_101106421 3300005356 Bacteria 700
114 Ga0070673_100030293 3300005364 Bacteria 4046
115 Ga0070673_100048345 3300005364 Bacteria 3315
116 Ga0070673_100171447 3300005364 Bacteria 1852
117 Ga0070673_100612918 3300005364 Bacteria 994
118 Ga0070673_100753633 3300005364 Bacteria 897
119 Ga0070673_101552796 3300005364 Bacteria 625
120 Ga0070688_100387313 3300005365 Bacteria 1032
121 Ga0070688_100723293 3300005365 Bacteria 773
122 Ga0070659_100000666 3300005366 Bacteria 24947
123 Ga0070659_100038040 3300005366 Bacteria 3751
124 Ga0070659_100084714 3300005366 Bacteria 2534
125 Ga0070659_100203977 3300005366 Bacteria 1628
126 Ga0070667_100000677 3300005367 Bacteria 33094
127 Ga0070667_100041820 3300005367 Bacteria 3844
128 Ga0070667_100208611 3300005367 Bacteria 1736
129 Ga0070667_100591749 3300005367 Bacteria 1022
130 Ga0070667_101309330 3300005367 Bacteria 679
131 Ga0070714_100406359 3300005435 Bacteria 1288
132 Ga0070708_100199245 3300005445 Bacteria 1874
133 Ga0070663_100006532 3300005455 Bacteria 7022
134 Ga0070663_100280802 3300005455 Bacteria 1327
135 Ga0070663_100292332 3300005455 Bacteria 1302
136 Ga0070663_100351977 3300005455 Bacteria 1193
137 Ga0070663_100524025 3300005455 Bacteria 987
138 Ga0070663_101026899 3300005455 Bacteria 718
139 Ga0070678_100009538 3300005456 Bacteria 5886
140 Ga0070678_100009859 3300005456 Bacteria 5806
141 Ga0070678_100017043 3300005456 Bacteria 4665
142 Ga0070678_100557878 3300005456 Bacteria 1018
143 Ga0070678_101128244 3300005456 Bacteria 725
144 Ga0070678_101445105 3300005456 Bacteria 643
145 Ga0070662_100116572 3300005457 Bacteria 2041
146 Ga0070662_100181759 3300005457 Bacteria 1658
147 Ga0070662_100840551 3300005457 Bacteria 781
148 Ga0070662_101258287 3300005457 Bacteria 636
149 Ga0070681_10026267 3300005458 Bacteria 5853
150 Ga0070681_10358612 3300005458 Bacteria 1368
151 Ga0068867_100003972 3300005459 Bacteria 10404
152 Ga0068867_100004620 3300005459 Bacteria 9689
153 Ga0068867_100006451 3300005459 Bacteria 8284
154 Ga0068867_100012180 3300005459 Bacteria 6077
155 Ga0068867_100148304 3300005459 Bacteria 1840
156 Ga0068867_100221025 3300005459 Bacteria 1526
157 Ga0068867_100284181 3300005459 Bacteria 1358
158 Ga0068867_100847655 3300005459 Bacteria 818
159 Ga0070685_10991557 3300005466 Bacteria 630
160 Ga0070706_100013624 3300005467 Bacteria 7517
161 Ga0070706_100061300 3300005467 Bacteria 3474
162 Ga0070679_100028221 3300005530 Bacteria 5532
163 Ga0070684_100032261 3300005535 Bacteria 4463
164 Ga0070684_100110528 3300005535 Bacteria 2464
165 Ga0068853_100066374 3300005539 Bacteria 3133
166 Ga0068853_100137713 3300005539 Bacteria 2189
167 Ga0068853_100525537 3300005539 Bacteria 1119
168 Ga0068853_100542851 3300005539 Bacteria 1101
169 Ga0070672_100014390 3300005543 Bacteria 5606
170 Ga0070672_100014964 3300005543 Bacteria 5511
171 Ga0070672_100128138 3300005543 Bacteria 2084
172 Ga0070672_100219223 3300005543 Bacteria 1595
173 Ga0070686_100289447 3300005544 Bacteria 1211
174 Ga0070686_100630358 3300005544 Bacteria 848
175 Ga0070693_100064607 3300005547 Bacteria 2137
176 Ga0070693_100155581 3300005547 Bacteria 1451
177 Ga0070693_100418017 3300005547 Bacteria 934
178 Ga0070665_100056462 3300005548 Bacteria 3936
179 Ga0070665_100195862 3300005548 Bacteria 2021
180 Ga0070665_100257967 3300005548 Bacteria 1744
181 Ga0070665_100348547 3300005548 Bacteria 1486
182 Ga0070665_102019592 3300005548 Bacteria 582
183 Ga0068855_100019587 3300005563 Bacteria 8127
184 Ga0068855_100064421 3300005563 Bacteria 4275
185 Ga0068855_100139662 3300005563 Bacteria 2763
186 Ga0068855_100194335 3300005563 Bacteria 2287
187 Ga0068855_100621090 3300005563 Bacteria 1163
188 Ga0068855_100714985 3300005563 Bacteria 1071
189 Ga0070664_100027119 3300005564 Bacteria 4759
190 Ga0070664_100037626 3300005564 Bacteria 4069
191 Ga0070664_100043037 3300005564 Bacteria 3810
192 Ga0070664_100360173 3300005564 Bacteria 1324
193 Ga0070664_100403408 3300005564 Bacteria 1250
194 Ga0070664_100551765 3300005564 Bacteria 1065
195 Ga0070664_100618262 3300005564 Bacteria 1005
196 Ga0070664_100796299 3300005564 Bacteria 884
197 Ga0068857_100729936 3300005577 Bacteria 942
198 Ga0068857_101028775 3300005577 Bacteria 793
199 Ga0068854_100000903 3300005578 Bacteria 17876
200 Ga0068854_100040558 3300005578 Bacteria 3285
201 Ga0068854_100334516 3300005578 Bacteria 1235
202 Ga0068856_100016907 3300005614 Bacteria 7070
203 Ga0068856_100063174 3300005614 Bacteria 3658
204 Ga0068856_100945156 3300005614 Bacteria 881
205 Ga0068856_101153496 3300005614 Bacteria 792
206 Ga0068852_100024399 3300005616 Bacteria 4886
207 Ga0068852_100033409 3300005616 Bacteria 4270
208 Ga0068852_100063334 3300005616 Bacteria 3220
209 Ga0068852_100275484 3300005616 Bacteria 1620
210 Ga0068852_100294866 3300005616 Bacteria 1568
211 Ga0068852_100349956 3300005616 Bacteria 1442
212 Ga0068852_100455717 3300005616 Bacteria 1267
213 Ga0068852_100976152 3300005616 Bacteria 865
214 Ga0068852_101430659 3300005616 Bacteria 713
215 Ga0068859_100027031 3300005617 Bacteria 5755
216 Ga0068859_100035700 3300005617 Bacteria 4988
217 Ga0068859_100083488 3300005617 Bacteria 3238
218 Ga0068859_100272232 3300005617 Bacteria 1786
219 Ga0068859_101077292 3300005617 Bacteria 884
220 Ga0068864_100009238 3300005618 Bacteria 8129
221 Ga0068864_100069099 3300005618 Bacteria 3071
222 Ga0068866_10010005 3300005718 Bacteria 4051
223 Ga0068866_10033904 3300005718 Bacteria 2482
224 Ga0068866_10291282 3300005718 Bacteria 1015
225 Ga0068861_100001416 3300005719 Bacteria 15100
226 Ga0068861_100005119 3300005719 Bacteria 8841
227 Ga0068861_100013239 3300005719 Bacteria 5771
228 Ga0068851_10021738 3300005834 Bacteria 3116
229 Ga0068851_10036008 3300005834 Bacteria 2477
230 Ga0068851_10065777 3300005834 Bacteria 1866
231 Ga0068851_10594962 3300005834 Bacteria 673
232 Ga0068863_100087934 3300005841 Bacteria 2944
233 Ga0068863_100970866 3300005841 Bacteria 852
234 Ga0068863_102153713 3300005841 Bacteria 568
235 Ga0068858_100006788 3300005842 Bacteria 11135
236 Ga0068858_100073500 3300005842 Bacteria 3173
237 Ga0068858_101523109 3300005842 Bacteria 660
238 Ga0068860_100000903 3300005843 Bacteria 32899
239 Ga0068860_100008648 3300005843 Bacteria 10144
240 Ga0068860_100372371 3300005843 Bacteria 1409
241 Ga0068862_100007315 3300005844 Bacteria 9166
242 Ga0068862_100033939 3300005844 Bacteria 4316
243 Ga0068862_100100036 3300005844 Bacteria 2535
244 Ga0068862_100603560 3300005844 Bacteria 1054
245 Ga0068862_101903787 3300005844 Bacteria 605
246 Ga0081455_10154969 3300005937 Bacteria 1762
247 Ga0075363_100191580 3300006048 Bacteria 1166
248 Ga0075364_10686904 3300006051 Bacteria 699
249 Ga0075362_10105057 3300006177 Bacteria 1324
250 Ga0075362_10162763 3300006177 Bacteria 1075
251 Ga0075362_10169259 3300006177 Bacteria 1055
252 Ga0075362_10232140 3300006177 Bacteria 904
253 Ga0075367_10087101 3300006178 Bacteria 1896
254 Ga0075367_10485311 3300006178 Bacteria 784
255 Ga0075366_10023840 3300006195 Bacteria 3566
256 Ga0075366_10069763 3300006195 Bacteria 2092
257 Ga0075366_10161165 3300006195 Bacteria 1359
258 Ga0075366_10245148 3300006195 Bacteria 1092
259 Ga0075366_10506264 3300006195 Bacteria 747
260 Ga0075366_10820974 3300006195 Bacteria 578
261 Ga0075366_10975405 3300006195 Bacteria 528
262 Ga0097621_100098460 3300006237 Bacteria 2457
263 Ga0097621_100293346 3300006237 Bacteria 1434
264 Ga0097621_100806884 3300006237 Bacteria 870
265 Ga0097621_101655116 3300006237 Bacteria 609
266 Ga0075370_10011463 3300006353 Bacteria 4659
267 Ga0075370_10020006 3300006353 Bacteria 3651
268 Ga0075370_10051619 3300006353 Bacteria 2333
269 Ga0075370_10181382 3300006353 Bacteria 1239
270 Ga0075370_10498900 3300006353 Bacteria 734
271 Ga0075370_10647199 3300006353 Bacteria 641
272 Ga0068871_100014710 3300006358 Bacteria 5839
273 Ga0068871_100014932 3300006358 Bacteria 5806
274 Ga0068871_100049440 3300006358 Bacteria 3399
275 Ga0068871_100051168 3300006358 Bacteria 3344
276 Ga0068871_100330659 3300006358 Bacteria 1344
277 Ga0075430_100082328 3300006846 Bacteria 2697
278 Ga0075429_100008833 3300006880 Bacteria 8761
279 Ga0068865_100003663 3300006881 Bacteria 9226
280 Ga0068865_100233935 3300006881 Bacteria 1443
281 Ga0068865_100289236 3300006881 Bacteria 1307
282 Ga0068865_100437424 3300006881 Bacteria 1079
283 Ga0068865_100707074 3300006881 Bacteria 862
284 Ga0068865_100859153 3300006881 Bacteria 786
285 Ga0097620_100027032 3300006931 Bacteria 5755
286 Ga0097620_100035700 3300006931 Bacteria 4988
287 Ga0097620_100083487 3300006931 Bacteria 3238
288 Ga0097620_100272234 3300006931 Bacteria 1786
289 Ga0097620_101077262 3300006931 Bacteria 884
290 Ga0079104_1000273 3300006946 Bacteria 67267
291 Ga0079104_1003849 3300006946 Bacteria 6724
292 Ga0079104_1059468 3300006946 Bacteria 827
293 Ga0099826_10000005 3300006948 Bacteria 465206
294 Ga0075435_101387957 3300007076 Bacteria 616
295 Ga0105244_10002947 3300009036 Bacteria 12550
296 Ga0105244_10004312 3300009036 Bacteria 9842
297 Ga0105244_10162888 3300009036 Bacteria 1064
298 Ga0105244_10280324 3300009036 Bacteria 773
299 Ga0111539_10941517 3300009094 Bacteria 1004
300 Ga0105245_10036044 3300009098 Bacteria 4392
301 Ga0105245_10222432 3300009098 Bacteria 1822
302 Ga0105245_11116907 3300009098 Bacteria 835
303 Ga0114129_10137155 3300009147 Bacteria 3356
304 Ga0105243_10023700 3300009148 Bacteria 4677
305 Ga0105243_10063627 3300009148 Bacteria 2956
306 Ga0105243_10138979 3300009148 Bacteria 2070
307 Ga0105243_10435328 3300009148 Bacteria 1227
308 Ga0105243_10950944 3300009148 Bacteria 858
309 Ga0105241_10023999 3300009174 Bacteria 4527
310 Ga0105241_10242877 3300009174 Bacteria 1523
311 Ga0105241_11022846 3300009174 Bacteria 774
312 Ga0105242_10269981 3300009176 Bacteria 1540
313 Ga0105242_10365056 3300009176 Bacteria 1337
314 Ga0105242_11024226 3300009176 Bacteria 835
315 Ga0105242_11774809 3300009176 Bacteria 655
316 Ga0105248_10000595 3300009177 Bacteria 41224
317 Ga0105248_10027182 3300009177 Bacteria 6364
318 Ga0105248_10112431 3300009177 Bacteria 3071
319 Ga0105248_10204255 3300009177 Bacteria 2226
320 Ga0105248_10498071 3300009177 Bacteria 1373
321 Ga0105248_11331677 3300009177 Bacteria 812
322 Ga0105237_10172915 3300009545 Bacteria 2160
323 Ga0105237_10212870 3300009545 Bacteria 1932
324 Ga0105237_10399046 3300009545 Bacteria 1380
325 Ga0105237_11143531 3300009545 Bacteria 785
326 Ga0105238_10003253 3300009551 Bacteria 16214
327 Ga0105238_10052730 3300009551 Bacteria 4088
328 Ga0105238_10108100 3300009551 Bacteria 2762
329 Ga0105238_10275226 3300009551 Bacteria 1664
330 Ga0105249_10572519 3300009553 Bacteria 1182
331 Ga0105249_12040167 3300009553 Bacteria 646
332 Ga0105239_10080637 3300010375 Bacteria 3581
333 Ga0105239_10785653 3300010375 Bacteria 1090
334 Ga0105246_10400389 3300011119 Bacteria 1140
335 Ga0157324_1035756 3300012506 Bacteria 585
336 Ga0157326_1013205 3300012513 Bacteria 950
337 Ga0157373_10017629 3300013100 Bacteria 5200
338 Ga0157373_10877224 3300013100 Bacteria 665
339 Ga0157371_10171540 3300013102 Bacteria 1550
340 Ga0157371_10430578 3300013102 Bacteria 968
341 Ga0157370_10561401 3300013104 Bacteria 1046
342 Ga0157369_10018014 3300013105 Bacteria 7924
343 Ga0157369_10049207 3300013105 Bacteria 4570
344 Ga0157369_11075203 3300013105 Bacteria 823
345 Ga0157369_11119535 3300013105 Bacteria 804
346 Ga0157369_11530978 3300013105 Bacteria 678
347 Ga0157374_10075363 3300013296 Bacteria 3188
348 Ga0157374_10091458 3300013296 Bacteria 2902
349 Ga0157374_10136709 3300013296 Bacteria 2376
350 Ga0157374_10954611 3300013296 Bacteria 876
351 Ga0157374_11124861 3300013296 Bacteria 806
352 Ga0157374_12440091 3300013296 Bacteria 550
353 Ga0157378_10345680 3300013297 Bacteria 1452
354 Ga0157378_10648722 3300013297 Bacteria 1071
355 Ga0157378_11279228 3300013297 Bacteria 774
356 Ga0157378_11435357 3300013297 Bacteria 734
357 Ga0163162_10040290 3300013306 Bacteria 4671
358 Ga0163162_10154852 3300013306 Bacteria 2411
359 Ga0163162_11211092 3300013306 Bacteria 857
360 Ga0163162_11716639 3300013306 Bacteria 717
361 Ga0157372_10042427 3300013307 Bacteria 5032
362 Ga0157372_10334629 3300013307 Bacteria 1763
363 Ga0157372_10601169 3300013307 Bacteria 1282
364 Ga0157372_10986112 3300013307 Bacteria 976
365 Ga0157372_11281337 3300013307 Bacteria 846
366 Ga0157372_12697135 3300013307 Bacteria 570
367 Ga0157375_10045304 3300013308 Bacteria 4280
368 Ga0157375_10065030 3300013308 Bacteria 3634
369 Ga0157375_10112570 3300013308 Bacteria 2822
370 Ga0157375_10616094 3300013308 Bacteria 1244
371 Ga0163163_10190597 3300014325 Bacteria 2099
372 Ga0163163_11056694 3300014325 Bacteria 875
373 Ga0163163_11516962 3300014325 Bacteria 731
374 Ga0157380_10007364 3300014326 Bacteria 7813
375 Ga0157380_10013785 3300014326 Bacteria 5903
376 Ga0157380_10038853 3300014326 Bacteria 3698
377 Ga0157380_10256033 3300014326 Bacteria 1587
378 Ga0157380_10833381 3300014326 Bacteria 942
379 Ga0182008_10001405 3300014497 Bacteria 16197
380 Ga0182008_10388828 3300014497 Bacteria 747
381 Ga0157377_10000294 3300014745 Bacteria 23613
382 Ga0157377_10586265 3300014745 Bacteria 793
383 Ga0157379_10023168 3300014968 Bacteria 5507
384 Ga0157379_10025892 3300014968 Bacteria 5215
385 Ga0157379_10089602 3300014968 Bacteria 2760
386 Ga0157379_10107716 3300014968 Bacteria 2502
387 Ga0157376_10004653 3300014969 Bacteria 9562
388 Ga0157376_10079761 3300014969 Bacteria 2807
389 Ga0157376_10115009 3300014969 Bacteria 2375
390 Ga0157376_10202284 3300014969 Bacteria 1828
391 Ga0157376_10305066 3300014969 Bacteria 1508
392 Ga0157376_10663038 3300014969 Bacteria 1045
393 Ga0157376_12097438 3300014969 Bacteria 604
394 Ga0182006_1000004 3300015261 Bacteria 622190
395 Ga0182006_1000176 3300015261 Bacteria 67387
396 Ga0182007_10000017 3300015262 Bacteria 199097
397 Ga0182007_10127552 3300015262 Bacteria 854
398 Ga0182007_10189429 3300015262 Bacteria 715
399 Ga0182005_1000005 3300015265 Bacteria 537378
400 Ga0182005_1000030 3300015265 Bacteria 213092
401 Ga0182005_1099447 3300015265 Bacteria 814
402 Ga0163161_10020753 3300017792 Bacteria 4612
403 Ga0163161_10021914 3300017792 Bacteria 4492
404 Ga0163161_10048829 3300017792 Bacteria 3057
405 Ga0163161_10104696 3300017792 Bacteria 2109
406 Ga0163161_10180987 3300017792 Bacteria 1616
407 Ga0163161_10232114 3300017792 Bacteria 1432
408 Ga0163161_10694080 3300017792 Bacteria 847
409 Ga0163161_10722683 3300017792 Bacteria 831
410 Ga0163161_10889649 3300017792 Bacteria 754
411 Ga0213872_10000035 3300021361 Bacteria 133053
412 Ga0213872_10000127 3300021361 Bacteria 69204
413 Ga0213872_10000139 3300021361 Bacteria 65459
414 Ga0213872_10000160 3300021361 Bacteria 61551
415 Ga0213872_10000683 3300021361 Bacteria 25720
416 Ga0213872_10018814 3300021361 Bacteria 3183
417 Ga0213872_10028189 3300021361 Bacteria 2576
418 Ga0213872_10158072 3300021361 Bacteria 987
419 Ga0209674_100003 3300025226 Bacteria 2196646
420 Ga0209672_113998 3300025228 Bacteria 942
421 Ga0209563_100003 3300025230 Bacteria 1932942
422 Ga0209563_100010 3300025230 Bacteria 1337457
423 Ga0209563_100025 3300025230 Bacteria 596456
424 Ga0207427_104232 3300025231 Bacteria 2518
425 Ga0209258_100163 3300025242 Bacteria 149677
426 Ga0209258_100627 3300025242 Bacteria 27977
427 Ga0207425_1000376 3300025245 Bacteria 30569
428 Ga0209646_1000036 3300025246 Bacteria 358864
429 Ga0209646_1000138 3300025246 Bacteria 114892
430 Ga0209026_1000021 3300025250 Bacteria 375165
431 Ga0209677_100093 3300025253 Bacteria 101695
432 Ga0209677_100817 3300025253 Bacteria 15553
433 Ga0209677_102569 3300025253 Bacteria 6689
434 Ga0209677_102895 3300025253 Bacteria 6026
435 Ga0209148_1000203 3300025254 Bacteria 105950
436 Ga0209759_1000025 3300025256 Bacteria 317082
437 Ga0209759_1001158 3300025256 Bacteria 16724
438 Ga0209759_1013130 3300025256 Bacteria 2256
439 Ga0209565_1000068 3300025263 Bacteria 171201
440 Ga0209565_1011943 3300025263 Bacteria 2093
441 Ga0209455_1000047 3300025272 Bacteria 379709
442 Ga0209455_1000059 3300025272 Bacteria 339995
443 Ga0209673_1000119 3300025273 Bacteria 171203
444 Ga0209673_1006475 3300025273 Bacteria 5650
445 Ga0209130_1000057 3300025284 Bacteria 210593
446 Ga0209675_1000068 3300025291 Bacteria 171202
447 Ga0209675_1012938 3300025291 Bacteria 2649
448 Ga0209025_1004584 3300025294 Bacteria 11853
449 Ga0209564_1000060 3300025295 Bacteria 325890
450 Ga0209564_1000141 3300025295 Bacteria 179852
451 Ga0209564_1000149 3300025295 Bacteria 170958
452 Ga0209758_1000941 3300025297 Bacteria 39283
453 Ga0209256_1000024 3300025299 Bacteria 448909
454 Ga0209256_1000040 3300025299 Bacteria 366839
455 Ga0209256_1000173 3300025299 Bacteria 129001
456 Ga0209051_1003858 3300025303 Bacteria 9585
457 Ga0209051_1004022 3300025303 Bacteria 9305
458 Ga0209051_1011624 3300025303 Bacteria 4328
459 Ga0209257_1000032 3300025304 Bacteria 680354
460 Ga0207656_10083296 3300025321 Bacteria 1441
461 Ga0207655_1022557 3300025728 Bacteria 3150
462 Ga0207655_1024930 3300025728 Bacteria 2918
463 Ga0207682_10001255 3300025893 Bacteria 11730
464 Ga0207682_10114555 3300025893 Bacteria 1190
465 Ga0207682_10229071 3300025893 Bacteria 861
466 Ga0207682_10297195 3300025893 Bacteria 757
467 Ga0207642_10025093 3300025899 Bacteria 2406
468 Ga0207642_10075539 3300025899 Bacteria 1619
469 Ga0207710_10372598 3300025900 Bacteria 730
470 Ga0207688_10005290 3300025901 Bacteria 7013
471 Ga0207645_10031533 3300025907 Bacteria 3410
472 Ga0207645_10128376 3300025907 Bacteria 1649
473 Ga0207645_10219054 3300025907 Bacteria 1254
474 Ga0207645_10293283 3300025907 Bacteria 1082
475 Ga0207705_10011989 3300025909 Bacteria 6265
476 Ga0207705_11042357 3300025909 Bacteria 631
477 Ga0207654_10021482 3300025911 Bacteria 3432
478 Ga0207707_10108844 3300025912 Bacteria 2423
479 Ga0207695_10080700 3300025913 Bacteria 3294
480 Ga0207695_10084675 3300025913 Bacteria 3201
481 Ga0207671_10164373 3300025914 Bacteria 1720
482 Ga0207660_10004601 3300025917 Bacteria 8988
483 Ga0207660_10590952 3300025917 Bacteria 904
484 Ga0207657_10020777 3300025919 Bacteria 6197
485 Ga0207657_10084454 3300025919 Bacteria 2661
486 Ga0207657_10457320 3300025919 Bacteria 1001
487 Ga0207657_10982071 3300025919 Bacteria 648
488 Ga0207649_10010449 3300025920 Bacteria 5101
489 Ga0207649_10028943 3300025920 Bacteria 3267
490 Ga0207649_10154052 3300025920 Bacteria 1586
491 Ga0207649_10737776 3300025920 Bacteria 766
492 Ga0207652_10080840 3300025921 Bacteria 2842
493 Ga0207652_10452857 3300025921 Bacteria 1157
494 Ga0207681_10032182 3300025923 Bacteria 3432
495 Ga0207681_10037994 3300025923 Bacteria 3186
496 Ga0207681_10043789 3300025923 Bacteria 2997
497 Ga0207681_10061997 3300025923 Bacteria 2573
498 Ga0207681_10499004 3300025923 Bacteria 996
499 Ga0207681_10868202 3300025923 Bacteria 755
500 Ga0207650_10010814 3300025925 Bacteria 6268
501 Ga0207650_10019962 3300025925 Bacteria 4718
502 Ga0207659_10030843 3300025926 Bacteria 3666
503 Ga0207659_10211488 3300025926 Bacteria 1555
504 Ga0207659_10217458 3300025926 Bacteria 1534
505 Ga0207659_10302321 3300025926 Bacteria 1314
506 Ga0207659_10659996 3300025926 Bacteria 894
507 Ga0207687_10008809 3300025927 Bacteria 6594
508 Ga0207687_10406772 3300025927 Bacteria 1120
509 Ga0207687_10430098 3300025927 Bacteria 1091
510 Ga0207687_11132129 3300025927 Bacteria 672
511 Ga0207644_10033398 3300025931 Bacteria 3595
512 Ga0207644_10053041 3300025931 Bacteria 2917
513 Ga0207644_10062491 3300025931 Bacteria 2701
514 Ga0207644_10196003 3300025931 Bacteria 1591
515 Ga0207690_10004038 3300025932 Bacteria 8665
516 Ga0207690_10170685 3300025932 Bacteria 1629
517 Ga0207690_10268912 3300025932 Bacteria 1323
518 Ga0207706_10004089 3300025933 Bacteria 13782
519 Ga0207706_10058771 3300025933 Bacteria 3386
520 Ga0207706_10284462 3300025933 Bacteria 1442
521 Ga0207706_10438292 3300025933 Bacteria 1131
522 Ga0207706_10440688 3300025933 Bacteria 1128
523 Ga0207686_10032006 3300025934 Bacteria 3127
524 Ga0207686_10063522 3300025934 Bacteria 2348
525 Ga0207709_10025634 3300025935 Bacteria 3377
526 Ga0207709_10041325 3300025935 Bacteria 2766
527 Ga0207709_10064766 3300025935 Bacteria 2296
528 Ga0207709_11175023 3300025935 Bacteria 632
529 Ga0207670_10737083 3300025936 Bacteria 818
530 Ga0207669_10112485 3300025937 Bacteria 1828
531 Ga0207669_10611394 3300025937 Bacteria 887
532 Ga0207669_11947629 3300025937 Bacteria 502
533 Ga0207704_10005537 3300025938 Bacteria 5819
534 Ga0207704_10083314 3300025938 Bacteria 2075
535 Ga0207704_10517258 3300025938 Bacteria 965
536 Ga0207691_10011878 3300025940 Bacteria 8357
537 Ga0207691_10057109 3300025940 Bacteria 3554
538 Ga0207691_10272294 3300025940 Bacteria 1458
539 Ga0207691_10315262 3300025940 Bacteria 1341
540 Ga0207711_10001919 3300025941 Bacteria 18885
541 Ga0207711_10006066 3300025941 Bacteria 10211
542 Ga0207711_10749057 3300025941 Bacteria 911
543 Ga0207711_11612572 3300025941 Bacteria 592
544 Ga0207689_10008328 3300025942 Bacteria 9033
545 Ga0207689_10442637 3300025942 Bacteria 1086
546 Ga0207661_10840130 3300025944 Bacteria 845
547 Ga0207679_10016886 3300025945 Bacteria 4853
548 Ga0207679_10024101 3300025945 Bacteria 4169
549 Ga0207679_10060411 3300025945 Bacteria 2816
550 Ga0207679_10162791 3300025945 Bacteria 1828
551 Ga0207679_10376143 3300025945 Bacteria 1244
552 Ga0207679_10593518 3300025945 Bacteria 997
553 Ga0207667_10078788 3300025949 Bacteria 3414
554 Ga0207667_10115407 3300025949 Bacteria 2768
555 Ga0207667_10874050 3300025949 Bacteria 892
556 Ga0207667_11091962 3300025949 Bacteria 781
557 Ga0207651_10013982 3300025960 Bacteria 4619
558 Ga0207651_10134791 3300025960 Bacteria 1897
559 Ga0207651_10172606 3300025960 Bacteria 1707
560 Ga0207651_10198999 3300025960 Bacteria 1604
561 Ga0207651_10217888 3300025960 Bacteria 1541
562 Ga0207651_12023631 3300025960 Bacteria 517
563 Ga0207712_10219856 3300025961 Bacteria 1518
564 Ga0207668_10275466 3300025972 Bacteria 1377
565 Ga0207640_10216373 3300025981 Bacteria 1463
566 Ga0207658_10002360 3300025986 Bacteria 13877
567 Ga0207658_10515090 3300025986 Bacteria 1067
568 Ga0207658_10747993 3300025986 Bacteria 885
569 Ga0207658_10962500 3300025986 Bacteria 778
570 Ga0207658_11037347 3300025986 Bacteria 748
571 Ga0207677_10004412 3300026023 Bacteria 7546
572 Ga0207677_10211222 3300026023 Bacteria 1550
573 Ga0207677_10892895 3300026023 Bacteria 801
574 Ga0207677_11054321 3300026023 Bacteria 739
575 Ga0207677_11257016 3300026023 Bacteria 679
576 Ga0207703_10053412 3300026035 Bacteria 3284
577 Ga0207703_10141302 3300026035 Bacteria 2090
578 Ga0207703_10476025 3300026035 Bacteria 1170
579 Ga0207703_10565636 3300026035 Bacteria 1073
580 Ga0207639_10085207 3300026041 Bacteria 2512
581 Ga0207639_10744272 3300026041 Bacteria 911
582 Ga0207678_10003169 3300026067 Bacteria 14868
583 Ga0207678_10027797 3300026067 Bacteria 4939
584 Ga0207678_10082037 3300026067 Bacteria 2759
585 Ga0207678_10109071 3300026067 Bacteria 2361
586 Ga0207678_10174309 3300026067 Bacteria 1836
587 Ga0207678_10259657 3300026067 Bacteria 1489
588 Ga0207678_10407539 3300026067 Bacteria 1178
589 Ga0207702_10000227 3300026078 Bacteria 65464
590 Ga0207702_10250517 3300026078 Bacteria 1663
591 Ga0207702_10758403 3300026078 Bacteria 958
592 Ga0207702_11178159 3300026078 Bacteria 760
593 Ga0207702_11365627 3300026078 Bacteria 702
594 Ga0207641_10100139 3300026088 Bacteria 2552
595 Ga0207641_10119259 3300026088 Bacteria 2351
596 Ga0207641_10789438 3300026088 Bacteria 939
597 Ga0207648_10004504 3300026089 Bacteria 14286
598 Ga0207648_10010128 3300026089 Bacteria 8962
599 Ga0207648_10024243 3300026089 Bacteria 5418
600 Ga0207648_10074300 3300026089 Bacteria 2963
601 Ga0207648_10117298 3300026089 Bacteria 2340
602 Ga0207648_10363776 3300026089 Bacteria 1306
603 Ga0207676_10009240 3300026095 Bacteria 7014
604 Ga0207676_10080135 3300026095 Bacteria 2650
605 Ga0207674_10091585 3300026116 Bacteria 3030
606 Ga0207675_100001125 3300026118 Bacteria 26534
607 Ga0207675_100005766 3300026118 Bacteria 11845
608 Ga0207675_100105822 3300026118 Bacteria 2652
609 Ga0207675_100408557 3300026118 Bacteria 1339
610 Ga0207683_10007938 3300026121 Bacteria 9084
611 Ga0207683_10012078 3300026121 Bacteria 7373
612 Ga0207683_10215090 3300026121 Bacteria 1750
613 Ga0207683_10295538 3300026121 Bacteria 1482
614 Ga0207683_11291420 3300026121 Bacteria 676
615 Ga0207698_10042094 3300026142 Bacteria 3410
616 Ga0209281_1000416 3300027111 Bacteria 64290
617 Ga0209281_1050051 3300027111 Bacteria 670
618 Ga0209967_1001211 3300027364 Bacteria 3303
619 Ga0210000_1002227 3300027462 Bacteria 2749
620 Ga0209995_1014917 3300027471 Bacteria 1274
621 Ga0209968_1002465 3300027526 Bacteria 2796
622 Ga0209999_1023219 3300027543 Bacteria 1142
623 Ga0209970_1000174 3300027614 Bacteria 10132
624 Ga0209983_1032993 3300027665 Bacteria 1107
625 Ga0209282_1000003 3300027666 Bacteria 856377
626 Ga0209588_1051553 3300027671 Bacteria 1331
627 Ga0209966_1000303 3300027695 Bacteria 16183
628 Ga0268266_10297392 3300028379 Bacteria 1505
629 Ga0268266_10740279 3300028379 Bacteria 948
630 Ga0268265_10175003 3300028380 Bacteria 1838
631 Ga0268265_10180418 3300028380 Bacteria 1813
632 Ga0268265_10207139 3300028380 Bacteria 1706
633 Ga0268265_10558854 3300028380 Bacteria 1087
634 Ga0268265_11675532 3300028380 Bacteria 641
635 Ga0268264_10008380 3300028381 Bacteria 8594
636 Ga0268264_10521151 3300028381 Bacteria 1162
637 Ga0265336_10000051 3300028666 Bacteria 114796
638 Ga0307517_10000052 3300028786 Bacteria 155904
639 Ga0307517_10147490 3300028786 Bacteria 1627
640 Ga0307517_10396630 3300028786 Bacteria 732
641 Ga0307515_10000416 3300028794 Bacteria 102535
642 Ga0307515_10000645 3300028794 Bacteria 80548
643 Ga0307515_10001163 3300028794 Bacteria 60305
644 Ga0307515_10004048 3300028794 Bacteria 30591
645 Ga0307515_10004318 3300028794 Bacteria 29495
646 Ga0307515_10014143 3300028794 Bacteria 14834
647 Ga0307515_10026385 3300028794 Bacteria 10003
648 Ga0307515_10047081 3300028794 Bacteria 6569
649 Ga0307515_10102840 3300028794 Bacteria 3431
650 Ga0307515_10181532 3300028794 Bacteria 2052
651 Ga0307515_10335364 3300028794 Bacteria 1168
652 Ga0307515_10361979 3300028794 Bacteria 1091
653 Ga0265324_10000292 3300029957 Bacteria 37241
654 Ga0265324_10043351 3300029957 Bacteria 1553
655 Ga0307512_10072314 3300030522 Bacteria 2552
656 Ga0307512_10104738 3300030522 Bacteria 1896
657 Ga0316181_1032650 3300030744 Bacteria 4582
658 Ga0265328_10038853 3300031239 Bacteria 1756
659 Ga0265331_10002254 3300031250 Bacteria 13195
660 Ga0265327_10000309 3300031251 Bacteria 94387
661 Ga0265316_10000299 3300031344 Bacteria 55433
662 Ga0307513_10024348 3300031456 Bacteria 7043
663 Ga0307513_10127823 3300031456 Bacteria 2492
664 Ga0307513_10218597 3300031456 Bacteria 1729
665 Ga0307509_10012817 3300031507 Bacteria 9981
666 Ga0307509_10049892 3300031507 Bacteria 4484
667 Ga0307509_10108307 3300031507 Bacteria 2792
668 Ga0307509_10128511 3300031507 Bacteria 2495
669 Ga0307509_10131278 3300031507 Bacteria 2460
670 Ga0307509_10218808 3300031507 Bacteria 1720
671 Ga0307509_10351648 3300031507 Bacteria 1197
672 Ga0307408_100000010 3300031548 Bacteria 420048
673 Ga0307408_100002273 3300031548 Bacteria 13680
674 Ga0307408_100065404 3300031548 Bacteria 2667
675 Ga0307408_100272435 3300031548 Bacteria 1406
676 Ga0307408_100461417 3300031548 Bacteria 1104
677 Ga0307408_100647165 3300031548 Bacteria 945
678 Ga0307508_10000047 3300031616 Bacteria 137805
679 Ga0307508_10001110 3300031616 Bacteria 31159
680 Ga0307508_10012672 3300031616 Bacteria 7709
681 Ga0307508_10400903 3300031616 Bacteria 963
682 Ga0307514_10002133 3300031649 Bacteria 21325
683 Ga0307514_10017955 3300031649 Bacteria 5812
684 Ga0307514_10045424 3300031649 Bacteria 3438
685 Ga0265314_10062809 3300031711 Bacteria 2523
686 Ga0307516_10000038 3300031730 Bacteria 147103
687 Ga0307516_10001369 3300031730 Bacteria 33766
688 Ga0307516_10005900 3300031730 Bacteria 14498
689 Ga0307516_10254243 3300031730 Bacteria 1450
690 Ga0307516_10312345 3300031730 Bacteria 1245
691 Ga0307405_10018925 3300031731 Bacteria 3812
692 Ga0307405_10191108 3300031731 Bacteria 1479
693 Ga0307405_10348696 3300031731 Bacteria 1141
694 Ga0307413_10001478 3300031824 Bacteria 8945
695 Ga0307413_10034527 3300031824 Bacteria 2892
696 Ga0307413_11202310 3300031824 Bacteria 659
697 Ga0307518_10019478 3300031838 Bacteria 4874
698 Ga0307410_10130880 3300031852 Bacteria 1843
699 Ga0307410_10341775 3300031852 Bacteria 1193
700 Ga0307410_10414646 3300031852 Bacteria 1091
701 Ga0307410_10480113 3300031852 Bacteria 1019
702 Ga0307410_10559137 3300031852 Bacteria 949
703 Ga0307406_10007697 3300031901 Bacteria 5983
704 Ga0307406_10606605 3300031901 Bacteria 903
705 Ga0307412_10003056 3300031911 Bacteria 9276
706 Ga0307412_10134632 3300031911 Bacteria 1801
707 Ga0307409_100012773 3300031995 Bacteria 5367
708 Ga0307409_100244130 3300031995 Bacteria 1637
709 Ga0307409_100316229 3300031995 Bacteria 1459
710 Ga0307409_100754418 3300031995 Bacteria 977
711 Ga0307416_100376041 3300032002 Bacteria 1449
712 Ga0307416_100426917 3300032002 Bacteria 1371
713 Ga0307416_101093401 3300032002 Bacteria 902
714 Ga0307416_101355712 3300032002 Bacteria 817
715 Ga0307414_10099483 3300032004 Bacteria 2185
716 Ga0307414_10158522 3300032004 Bacteria 1794
717 Ga0307411_10002067 3300032005 Bacteria 8629
718 Ga0307411_10019462 3300032005 Bacteria 3922
719 Ga0307411_10156038 3300032005 Bacteria 1703
720 Ga0307411_10186301 3300032005 Bacteria 1580
721 Ga0307411_10268406 3300032005 Bacteria 1352
722 Ga0307411_10296460 3300032005 Bacteria 1295
723 Ga0307411_11675038 3300032005 Bacteria 588
724 Ga0307415_100043660 3300032126 Bacteria 2992
725 Ga0307415_100581294 3300032126 Bacteria 994
726 Ga0307415_102208059 3300032126 Bacteria 539
727 Ga0307510_10005294 3300033180 Bacteria 15345
728 Ga0307510_10037378 3300033180 Bacteria 5387
729 Ga0307510_10253556 3300033180 Bacteria 1245
730 Ga0307510_10468508 3300033180 Bacteria 701
731 Ga0373959_0049269 3300034820 Bacteria 905
732 Ga0373929_0090021 3300035085 Bacteria 760
733 Ga0373934_0097225 3300035086 Bacteria 1189
734 Ga0373944_0061421 3300035089 Bacteria 1206
735 Ga0373944_0112318 3300035089 Bacteria 932
736 Ga0373951_0018674 3300035091 Bacteria 1576
737 Ga0373939_0000579 3300035114 Bacteria 9136
738 Ga0373941_0061235 3300035115 Bacteria 1225
739 Ga0373941_0462326 3300035115 Bacteria 534
740 Ga0373943_0969621 3300035170 Bacteria 509
741 Ga0373962_0060087 3300035242 Bacteria 1114
742 Ga0373931_0000228 3300035691 Bacteria 23922
743 Ga0373931_0006809 3300035691 Bacteria 5370
744 Ga0373931_0011745 3300035691 Bacteria 4233
745 Ga0373931_0904443 3300035691 Bacteria 593
746 Ga0373927_0009397 3300035695 Bacteria 6558
747 Ga0373933_0043177 3300035724 Bacteria 2667
748 Ga0373925_0001850 3300037068 Bacteria 17621
749 Ga0373925_0497099 3300037068 Bacteria 1001
750 Ga0395899_0000370 3300037312 Bacteria 54053
751 Ga0395899_0038495 3300037312 Bacteria 3582
752 Ga0395899_0043349 3300037312 Bacteria 3356
753 Ga0395899_0113735 3300037312 Bacteria 1943
754 Ga0395899_0243257 3300037312 Bacteria 1237
755 Ga0395899_0362820 3300037312 Bacteria 966
756 Ga0395899_0494725 3300037312 Bacteria 794
757 Ga0395900_0000133 3300037418 Bacteria 124692
758 Ga0395900_0000640 3300037418 Bacteria 47118
759 Ga0395900_0033983 3300037418 Bacteria 5248
760 Ga0395900_0120467 3300037418 Bacteria 2692
761 Ga0395900_0123750 3300037418 Bacteria 2652
762 Ga0395900_0220142 3300037418 Bacteria 1913
763 Ga0395900_0617867 3300037418 Bacteria 1023
764 Ga0395898_0007053 3300037466 Bacteria 11937
765 Ga0395898_0070112 3300037466 Bacteria 3390
766 Ga0395898_1319919 3300037466 Bacteria 650
767 Ga0395905_0000676 3300037471 Bacteria 45246
768 Ga0395905_0008541 3300037471 Bacteria 10098
769 Ga0395905_0013220 3300037471 Bacteria 7921
770 Ga0395905_0018255 3300037471 Bacteria 6659
771 Ga0395905_0133785 3300037471 Bacteria 2332
772 Ga0395905_0140362 3300037471 Bacteria 2273
773 Ga0395905_0227962 3300037471 Bacteria 1742
774 Ga0395905_0284022 3300037471 Bacteria 1541
775 Ga0395905_0516473 3300037471 Bacteria 1095
776 Ga0395905_0747246 3300037471 Bacteria 880
777 Ga0395905_0873193 3300037471 Bacteria 802
778 Ga0395901_0000074 3300038443 Bacteria 138735
779 Ga0395901_0001733 3300038443 Bacteria 22534
780 Ga0395901_0244277 3300038443 Bacteria 1871
781 Ga0395901_0279774 3300038443 Bacteria 1733
782 Ga0395901_0323079 3300038443 Bacteria 1596
783 Ga0395901_0429941 3300038443 Bacteria 1353
784 Ga0395901_0961672 3300038443 Bacteria 832
785 Ga0436361_0048643 3300039447 Bacteria 3615
786 Ga0436361_0053671 3300039447 Bacteria 10745
787 Ga0436361_0062004 3300039447 Bacteria 42438
788 Ga0436361_0071334 3300039447 Bacteria 40702
789 Ga0436361_0144792 3300039447 Bacteria 34252
790 Ga0436361_0239153 3300039447 Bacteria 3627
791 Ga0436361_0362312 3300039447 Bacteria 55943
792 Ga0436361_0588758 3300039447 Bacteria 2463
793 Ga0436361_0615018 3300039447 Bacteria 2619
794 Ga0436361_0692200 3300039447 Bacteria 6235
795 Ga0436361_0749269 3300039447 Bacteria 121408
796 Ga0436361_1191441 3300039447 Bacteria 1913
797 Ga0436363_1606815 3300039450 Bacteria 546
798 Ga0439453_0015160 3300041408 Bacteria 1330
799 Ga0439465_0221247 3300041413 Bacteria 694
800 Ga0451791_1212493 3300041451 Bacteria 586
801 Ga0451791_1752511 3300041451 Bacteria 1317
802 Ga0451795_1328699 3300041456 Bacteria 937
803 Ga0451798_0266409 3300041458 Bacteria 709
804 Ga0451802_0610707 3300041460 Bacteria 559
805 Ga0451807_1373320 3300041486 Bacteria 1108
806 Ga0451835_1125194 3300041492 Bacteria 567
807 Ga0451837_1627762 3300041494 Bacteria 534
808 Ga0451845_0632488 3300041501 Bacteria 700
809 Ga0451847_0912814 3300041503 Bacteria 558
810 Ga0451849_1092259 3300041505 Bacteria 1980
811 Ga0451851_0023497 3300041507 Bacteria 1848
812 Ga0451851_0889618 3300041507 Bacteria 546
813 Ga0451843_0699320 3300041509 Bacteria 1896
814 Ga0451853_0907922 3300041512 Bacteria 896
815 Ga0439431_0006166 3300041997 Bacteria 2648
816 Ga0439433_0021226 3300041999 Bacteria 1452
817 Ga0439437_000360 3300042000 Bacteria 4343
818 Ga0439448_0003089 3300042005 Bacteria 4583
819 Ga0439448_0081905 3300042005 Bacteria 1084
820 Ga0439448_0127064 3300042005 Bacteria 877
821 Ga0439448_0172457 3300042005 Bacteria 755
822 Ga0439449_0016561 3300042007 Bacteria 2770
823 Ga0439449_0070323 3300042007 Bacteria 1290
824 Ga0439455_0012754 3300042012 Bacteria 1892
825 Ga0439455_0174098 3300042012 Bacteria 618
826 Ga0439462_0151164 3300042015 Bacteria 653
827 Ga0450911_014457 3300042115 Bacteria 1049
828 Ga0450913_016161 3300042117 Bacteria 650
829 Ga0450917_000369 3300042120 Bacteria 3371
830 Ga0450919_004025 3300042121 Bacteria 1807
831 Ga0450920_014429 3300042122 Bacteria 1495
832 Ga0450888_000895 3300042126 Bacteria 2838
833 Ga0450888_013430 3300042126 Unclassified 981
834 Ga0450890_037914 3300042127 Bacteria 705
835 Ga0450890_078507 3300042127 Bacteria 536
836 Ga0450891_000017 3300042129 Bacteria 12411
837 Ga0450895_006529 3300042132 Bacteria 956
838 Ga0450898_015726 3300042134 Bacteria 1285
839 Ga0450898_026984 3300042134 Bacteria 1037
840 Ga0450898_062501 3300042134 Bacteria 734
841 Ga0450898_084618 3300042134 Bacteria 648
842 Ga0450903_016707 3300042138 Bacteria 1150
843 Ga0450904_000117 3300042139 Bacteria 17632
844 Ga0450906_026774 3300042145 Bacteria 1024
845 Ga0439446_0237398 3300042156 Bacteria 625
846 Ga0439446_0282478 3300042156 Bacteria 579
847 Ga0450918_000764 3300042531 Bacteria 6808
848 Ga0450893_0002946 3300042532 Bacteria 2678
849 Ga0450893_0128648 3300042532 Bacteria 533
850 Ga0450901_017537 3300042533 Bacteria 758
851 Ga0451577_0043475 3300042876 Bacteria 4024
852 Ga0466969_0000037 3300044656 Bacteria 75663
853 Ga0466969_0034564 3300044656 Bacteria 2560
854 Ga0466969_0043321 3300044656 Bacteria 2243
855 Ga0466969_0464173 3300044656 Bacteria 576
856 Ga0466972_0002974 3300044658 Bacteria 8390
857 Ga0466972_0009008 3300044658 Bacteria 5009
858 Ga0466972_0059269 3300044658 Bacteria 1838
859 Ga0466972_0316178 3300044658 Bacteria 729
860 Ga0466982_0034801 3300044672 Bacteria 3016
861 Ga0466965_0004104 3300044683 Bacteria 6467
862 Ga0466965_0017071 3300044683 Bacteria 3465
863 Ga0466965_0030031 3300044683 Bacteria 2646
864 Ga0466965_0043171 3300044683 Bacteria 2225
865 Ga0466965_0077681 3300044683 Bacteria 1676
866 Ga0466965_0081903 3300044683 Bacteria 1632
867 Ga0466965_0125565 3300044683 Bacteria 1327
868 Ga0466965_0263412 3300044683 Bacteria 927
869 Ga0466966_0014648 3300044684 Bacteria 5190
870 Ga0466966_0032499 3300044684 Bacteria 3381
871 Ga0466966_0048223 3300044684 Bacteria 2713
872 Ga0466966_0114801 3300044684 Bacteria 1658
873 Ga0466966_0191066 3300044684 Bacteria 1240
874 Ga0466966_0286152 3300044684 Bacteria 991
875 Ga0466966_0417301 3300044684 Bacteria 806
876 Ga0466966_0444248 3300044684 Bacteria 779
877 Ga0466961_0015995 3300044693 Bacteria 4816
878 Ga0466961_0020395 3300044693 Bacteria 4263
879 Ga0466961_0022942 3300044693 Bacteria 4014
880 Ga0466961_0048858 3300044693 Bacteria 2704
881 Ga0466963_0024612 3300044694 Bacteria 3832
882 Ga0466963_0321315 3300044694 Bacteria 1089
883 Ga0466964_0005515 3300044706 Bacteria 4697
884 Ga0466964_0008450 3300044706 Bacteria 3868
885 Ga0466964_0022795 3300044706 Bacteria 2431
886 Ga0466964_0189517 3300044706 Bacteria 980
887 Ga0466964_0273959 3300044706 Bacteria 841
888 Ga0466964_0493591 3300044706 Bacteria 656
889 Ga0453684_0047302 3300044712 Bacteria 5707
890 Ga0453684_0103481 3300044712 Bacteria 3479
891 Ga0453684_0147265 3300044712 Bacteria 2803
892 Ga0453684_0158290 3300044712 Bacteria 2682
893 Ga0453684_0228640 3300044712 Bacteria 2149
894 Ga0453684_0428150 3300044712 Bacteria 1477
895 Ga0453684_0546938 3300044712 Bacteria 1276
896 Ga0453684_1324140 3300044712 Bacteria 750
897 Ga0466971_0008028 3300044719 Bacteria 4602
898 Ga0466971_0025492 3300044719 Bacteria 2640
899 Ga0466971_0031185 3300044719 Bacteria 2386
900 Ga0466968_0000503 3300044735 Bacteria 13277
901 Ga0466968_0026789 3300044735 Bacteria 2368
902 Ga0466968_0032257 3300044735 Bacteria 2178
903 Ga0466970_0028959 3300044765 Bacteria 2913
904 Ga0466970_0073793 3300044765 Bacteria 1836
905 Ga0466970_0085799 3300044765 Bacteria 1706
906 Ga0466970_0206437 3300044765 Bacteria 1094
907 Ga0466957_0006839 3300044842 Bacteria 6445
908 Ga0466957_0009983 3300044842 Bacteria 5432
909 Ga0466957_0020390 3300044842 Bacteria 3900
910 Ga0466957_0035356 3300044842 Bacteria 2998
911 Ga0466957_0082980 3300044842 Bacteria 1998
912 Ga0466957_0102870 3300044842 Bacteria 1802
913 Ga0466957_0701491 3300044842 Bacteria 714
914 Ga0466957_1018496 3300044842 Bacteria 595
915 Ga0466960_0146279 3300044901 Bacteria 1259
916 Ga0466960_0160039 3300044901 Bacteria 1208
917 Ga0466960_0168693 3300044901 Bacteria 1180
918 Ga0466960_0661791 3300044901 Bacteria 624
919 Ga0466960_0716203 3300044901 Bacteria 601
920 Ga0466959_0006252 3300045049 Bacteria 8227
921 Ga0466959_0110779 3300045049 Bacteria 1959
922 Ga0466959_0112723 3300045049 Bacteria 1939
923 Ga0466959_0117917 3300045049 Bacteria 1889
924 Ga0466959_0125799 3300045049 Bacteria 1819
925 Ga0466959_0528259 3300045049 Bacteria 796
926 Ga0466959_0735569 3300045049 Bacteria 660
927 Ga0451576_0002339 3300045051 Bacteria 28645
928 Ga0451576_0454819 3300045051 Bacteria 1344
929 Ga0451576_0819428 3300045051 Bacteria 977
930 Ga0451576_1458115 3300045051 Bacteria 711
931 Ga0451576_1686886 3300045051 Bacteria 656
932 Ga0466958_0077892 3300045836 Bacteria 2036
933 Ga0466958_0109142 3300045836 Bacteria 1727
934 Ga0466958_0113256 3300045836 Bacteria 1694
935 Ga0466958_0115744 3300045836 Bacteria 1675
936 Ga0466958_0156942 3300045836 Bacteria 1436
937 Ga0466958_0213387 3300045836 Bacteria 1230
938 Ga0466958_0233977 3300045836 Bacteria 1173
939 Ga0466967_0011205 3300045976 Bacteria 6777
940 Ga0466967_0020086 3300045976 Bacteria 5389
941 Ga0466967_0313540 3300045976 Bacteria 1511
942 Ga0466967_0376686 3300045976 Bacteria 1377
943 Ga0466967_0505951 3300045976 Bacteria 1186
944 Ga0495617_000005 3300046452 Bacteria 404687
945 Ga0495617_000026 3300046452 Bacteria 157675
946 Ga0495617_000362 3300046452 Bacteria 25053
947 Ga0495617_004468 3300046452 Bacteria 5088
948 Ga0495617_013150 3300046452 Bacteria 2818
949 Ga0495617_085770 3300046452 Bacteria 1030
950 Ga0495627_000038 3300046453 Bacteria 198316
951 Ga0495627_000043 3300046453 Bacteria 185855
952 Ga0495627_023622 3300046453 Bacteria 2011
953 Ga0495592_0000346 3300046454 Bacteria 37799
954 Ga0495603_0120676 3300046455 Bacteria 1527
955 Ga0495603_0157418 3300046455 Bacteria 1318
956 Ga0495603_0183569 3300046455 Bacteria 1210
957 Ga0495590_0000031 3300046457 Bacteria 143779
958 Ga0495590_0000041 3300046457 Bacteria 121084
959 Ga0495590_0006069 3300046457 Bacteria 4740
960 Ga0495590_0006704 3300046457 Bacteria 4483
961 Ga0495590_0123181 3300046457 Bacteria 929
962 Ga0495590_0195367 3300046457 Bacteria 742
963 Ga0495590_0227942 3300046457 Bacteria 689
964 Ga0495591_000213 3300046458 Bacteria 58510
965 Ga0495629_0001336 3300046459 Bacteria 19404
966 Ga0495629_0094490 3300046459 Bacteria 2086
967 Ga0495629_0182113 3300046459 Bacteria 1456
968 Ga0495629_0655730 3300046459 Bacteria 699
969 Ga0495629_0980435 3300046459 Bacteria 551
970 Ga0495638_0000101 3300046460 Bacteria 137331
971 Ga0495638_0018344 3300046460 Bacteria 4647
972 Ga0495638_0068193 3300046460 Bacteria 2182
973 Ga0495638_0078354 3300046460 Bacteria 2011
974 Ga0495638_0199792 3300046460 Bacteria 1129
975 Ga0495638_0228610 3300046460 Bacteria 1036
976 Ga0495638_0296130 3300046460 Bacteria 873
977 Ga0495638_0296595 3300046460 Bacteria 872
978 Ga0495638_0438618 3300046460 Bacteria 669
979 Ga0495638_0442370 3300046460 Bacteria 665
980 Ga0495638_0484298 3300046460 Bacteria 626
981 Ga0495653_0000031 3300046463 Bacteria 137159
982 Ga0495653_0012591 3300046463 Bacteria 6908
983 Ga0495653_0025416 3300046463 Bacteria 4760
984 Ga0495653_0072599 3300046463 Bacteria 2569
985 Ga0495653_0087730 3300046463 Bacteria 2284
986 Ga0495650_0000230 3300046471 Bacteria 114025
987 Ga0495650_0000274 3300046471 Bacteria 98605
988 Ga0495650_0000288 3300046471 Bacteria 93448
989 Ga0495650_0000504 3300046471 Bacteria 58448
990 Ga0495650_0001351 3300046471 Bacteria 24390
991 Ga0495650_0098457 3300046471 Bacteria 1101
992 Ga0495580_0006752 3300046472 Bacteria 9309
993 Ga0495580_0086525 3300046472 Bacteria 2183
994 Ga0495582_0017018 3300046473 Bacteria 3980
995 Ga0495605_0000071 3300046474 Bacteria 135203
996 Ga0495605_0000113 3300046474 Bacteria 103900
997 Ga0495605_0000186 3300046474 Bacteria 77457
998 Ga0495605_0001197 3300046474 Bacteria 17283
999 Ga0495605_0009878 3300046474 Bacteria 5352
1000 Ga0495605_0050343 3300046474 Bacteria 2032
1001 Ga0495605_0085279 3300046474 Bacteria 1471
1002 Ga0495605_0227370 3300046474 Bacteria 804
1003 Ga0495605_0281587 3300046474 Bacteria 706
1004 Ga0495605_0452653 3300046474 Bacteria 528
1005 Ga0495639_0047800 3300046475 Bacteria 1940
1006 Ga0495664_0225997 3300046477 Bacteria 1133
1007 Ga0495664_0490464 3300046477 Bacteria 734
1008 Ga0495584_0000007 3300046491 Bacteria 294820
1009 Ga0495584_0000252 3300046491 Bacteria 38603
1010 Ga0495584_0004963 3300046491 Bacteria 7093
1011 Ga0495584_0008099 3300046491 Bacteria 5461
1012 Ga0495584_0015762 3300046491 Bacteria 3853
1013 Ga0495584_0021355 3300046491 Bacteria 3289
1014 Ga0495584_0032557 3300046491 Bacteria 2638
1015 Ga0495584_0043442 3300046491 Bacteria 2268
1016 Ga0495584_0144931 3300046491 Bacteria 1206
1017 Ga0495584_0162952 3300046491 Bacteria 1133
1018 Ga0495584_0222395 3300046491 Bacteria 959
1019 Ga0495584_0355275 3300046491 Bacteria 744
1020 Ga0495584_0457278 3300046491 Bacteria 649
1021 Ga0495585_0000090 3300046492 Bacteria 95790
1022 Ga0495585_0000147 3300046492 Bacteria 76686
1023 Ga0495585_0000919 3300046492 Bacteria 24945
1024 Ga0495585_0006598 3300046492 Bacteria 7174
1025 Ga0495585_0012830 3300046492 Bacteria 4927
1026 Ga0495585_0016190 3300046492 Bacteria 4320
1027 Ga0495585_0024549 3300046492 Bacteria 3455
1028 Ga0495585_0025178 3300046492 Bacteria 3411
1029 Ga0495585_0029280 3300046492 Bacteria 3135
1030 Ga0495585_0041940 3300046492 Bacteria 2565
1031 Ga0495585_0058592 3300046492 Bacteria 2124
1032 Ga0495585_0092763 3300046492 Bacteria 1625
1033 Ga0495585_0113717 3300046492 Bacteria 1437
1034 Ga0495585_0189373 3300046492 Bacteria 1053
1035 Ga0495585_0217815 3300046492 Bacteria 964
1036 Ga0495585_0377688 3300046492 Bacteria 685
1037 Ga0495585_0554786 3300046492 Bacteria 542
1038 Ga0495594_0025128 3300046499 Bacteria 3201
1039 Ga0495594_0051651 3300046499 Bacteria 2262
1040 Ga0495594_0107383 3300046499 Bacteria 1572
1041 Ga0495594_0306657 3300046499 Bacteria 904
1042 Ga0495596_0000270 3300046500 Bacteria 34366
1043 Ga0495596_0001876 3300046500 Bacteria 11668
1044 Ga0495596_0001991 3300046500 Bacteria 11245
1045 Ga0495596_0006043 3300046500 Bacteria 5646
1046 Ga0495596_0013973 3300046500 Bacteria 3390
1047 Ga0495596_0015363 3300046500 Bacteria 3208
1048 Ga0495596_0019543 3300046500 Bacteria 2781
1049 Ga0495596_0063271 3300046500 Bacteria 1439
1050 Ga0495596_0079667 3300046500 Bacteria 1271
1051 Ga0495607_0000842 3300046501 Bacteria 29026
1052 Ga0495607_0001791 3300046501 Bacteria 18333
1053 Ga0495607_0002436 3300046501 Bacteria 15157
1054 Ga0495607_0006283 3300046501 Bacteria 8376
1055 Ga0495607_0008025 3300046501 Bacteria 7249
1056 Ga0495607_0010917 3300046501 Bacteria 6077
1057 Ga0495607_0018599 3300046501 Bacteria 4427
1058 Ga0495607_0023678 3300046501 Bacteria 3840
1059 Ga0495607_0083828 3300046501 Bacteria 1745
1060 Ga0495607_0093779 3300046501 Bacteria 1620
1061 Ga0495607_0093985 3300046501 Bacteria 1618
1062 Ga0495607_0096950 3300046501 Bacteria 1586
1063 Ga0495607_0111651 3300046501 Bacteria 1448
1064 Ga0495607_0141005 3300046501 Bacteria 1243
1065 Ga0495607_0215458 3300046501 Bacteria 942
1066 Ga0495607_0455918 3300046501 Bacteria 573
1067 Ga0495583_0000016 3300046506 Bacteria 312691
1068 Ga0495583_0000075 3300046506 Bacteria 177074
1069 Ga0495583_0000194 3300046506 Bacteria 101824
1070 Ga0495583_0000284 3300046506 Bacteria 81053
1071 Ga0495583_0000783 3300046506 Bacteria 39666
1072 Ga0495583_0001150 3300046506 Bacteria 28793
1073 Ga0495583_0005291 3300046506 Bacteria 8824
1074 Ga0495583_0005830 3300046506 Bacteria 8223
1075 Ga0495583_0005871 3300046506 Bacteria 8181
1076 Ga0495583_0012206 3300046506 Bacteria 4878
1077 Ga0495583_0019843 3300046506 Bacteria 3498
1078 Ga0495583_0023530 3300046506 Bacteria 3114
1079 Ga0495606_0000077 3300046507 Bacteria 166824
1080 Ga0495606_0000133 3300046507 Bacteria 126345
1081 Ga0495606_0000474 3300046507 Bacteria 65914
1082 Ga0495606_0001180 3300046507 Bacteria 36859
1083 Ga0495606_0001442 3300046507 Bacteria 31886
1084 Ga0495606_0006254 3300046507 Bacteria 11053
1085 Ga0495606_0006540 3300046507 Bacteria 10719
1086 Ga0495606_0010878 3300046507 Bacteria 7492
1087 Ga0495606_0016609 3300046507 Bacteria 5603
1088 Ga0495606_0022834 3300046507 Bacteria 4546
1089 Ga0495606_0027155 3300046507 Bacteria 4065
1090 Ga0495606_0062093 3300046507 Bacteria 2386
1091 Ga0495606_0287324 3300046507 Bacteria 896
1092 Ga0495606_0355959 3300046507 Bacteria 775
1093 Ga0495606_0442077 3300046507 Bacteria 668
1094 Ga0495608_0747823 3300046511 Bacteria 579
1095 Ga0495610_0000038 3300046512 Bacteria 181669
1096 Ga0495610_0001086 3300046512 Bacteria 24866
1097 Ga0495610_0009405 3300046512 Bacteria 6187
1098 Ga0495610_0016768 3300046512 Bacteria 4204
1099 Ga0495610_0033904 3300046512 Bacteria 2634
1100 Ga0495610_0043657 3300046512 Bacteria 2231
1101 Ga0495610_0078844 3300046512 Bacteria 1517
1102 Ga0495610_0095798 3300046512 Bacteria 1337
1103 Ga0495616_0000048 3300046513 Bacteria 108577
1104 Ga0495616_0002015 3300046513 Bacteria 13670
1105 Ga0495616_0004259 3300046513 Bacteria 9046
1106 Ga0495616_0006556 3300046513 Bacteria 7028
1107 Ga0495616_0010268 3300046513 Bacteria 5427
1108 Ga0495616_0011262 3300046513 Bacteria 5133
1109 Ga0495616_0016471 3300046513 Bacteria 4091
1110 Ga0495616_0030381 3300046513 Bacteria 2840
1111 Ga0495616_0031023 3300046513 Bacteria 2803
1112 Ga0495616_0036660 3300046513 Bacteria 2529
1113 Ga0495616_0067735 3300046513 Bacteria 1734
1114 Ga0495616_0074501 3300046513 Bacteria 1635
1115 Ga0495616_0259799 3300046513 Bacteria 743
1116 Ga0495616_0292678 3300046513 Bacteria 689
1117 Ga0495616_0334098 3300046513 Bacteria 634
1118 Ga0495620_0009384 3300046515 Bacteria 5208
1119 Ga0495620_0294975 3300046515 Bacteria 616
1120 Ga0495628_0212869 3300046516 Bacteria 1453
1121 Ga0495630_0144757 3300046517 Bacteria 1807
1122 Ga0495630_0654721 3300046517 Bacteria 804
1123 Ga0495630_0891788 3300046517 Bacteria 678
1124 Ga0495631_0000684 3300046518 Bacteria 21916
1125 Ga0495631_0002923 3300046518 Bacteria 9464
1126 Ga0495631_0003899 3300046518 Bacteria 8065
1127 Ga0495631_0006452 3300046518 Bacteria 6054
1128 Ga0495631_0014808 3300046518 Bacteria 3755
1129 Ga0495631_0035930 3300046518 Bacteria 2214
1130 Ga0495631_0066285 3300046518 Bacteria 1562
1131 Ga0495631_0181683 3300046518 Bacteria 901
1132 Ga0495632_0000098 3300046519 Bacteria 88691
1133 Ga0495632_0000152 3300046519 Bacteria 71699
1134 Ga0495632_0002349 3300046519 Bacteria 14506
1135 Ga0495632_0003810 3300046519 Bacteria 10511
1136 Ga0495632_0005546 3300046519 Bacteria 8318
1137 Ga0495632_0011269 3300046519 Bacteria 5229
1138 Ga0495632_0014466 3300046519 Bacteria 4462
1139 Ga0495632_0024146 3300046519 Bacteria 3236
1140 Ga0495632_0086630 3300046519 Bacteria 1489
1141 Ga0495632_0130761 3300046519 Bacteria 1168
1142 Ga0495637_0000013 3300046520 Bacteria 244837
1143 Ga0495637_0003644 3300046520 Bacteria 8158
1144 Ga0495637_0012166 3300046520 Bacteria 4120
1145 Ga0495637_0015193 3300046520 Bacteria 3615
1146 Ga0495637_0022638 3300046520 Bacteria 2864
1147 Ga0495637_0035358 3300046520 Bacteria 2182
1148 Ga0495643_0000115 3300046522 Bacteria 130423
1149 Ga0495643_0000204 3300046522 Bacteria 92222
1150 Ga0495643_0000206 3300046522 Bacteria 91463
1151 Ga0495643_0005635 3300046522 Bacteria 8400
1152 Ga0495643_0008875 3300046522 Bacteria 6322
1153 Ga0495643_0010126 3300046522 Bacteria 5815
1154 Ga0495643_0020187 3300046522 Bacteria 3847
1155 Ga0495643_0032309 3300046522 Bacteria 2906
1156 Ga0495643_0032526 3300046522 Bacteria 2895
1157 Ga0495643_0052450 3300046522 Bacteria 2190
1158 Ga0495643_0062241 3300046522 Bacteria 1976
1159 Ga0495643_0121146 3300046522 Bacteria 1321
1160 Ga0495643_0293703 3300046522 Bacteria 743
1161 Ga0495644_0006682 3300046523 Bacteria 4467
1162 Ga0495644_0010702 3300046523 Bacteria 3533
1163 Ga0495644_0012933 3300046523 Bacteria 3208
1164 Ga0495644_0025704 3300046523 Bacteria 2234
1165 Ga0495644_0043410 3300046523 Bacteria 1692
1166 Ga0495644_0051930 3300046523 Bacteria 1539
1167 Ga0495644_0062795 3300046523 Bacteria 1396
1168 Ga0495648_0000089 3300046524 Bacteria 115026
1169 Ga0495648_0000091 3300046524 Bacteria 113822
1170 Ga0495648_0000353 3300046524 Bacteria 50659
1171 Ga0495648_0001746 3300046524 Bacteria 21012
1172 Ga0495648_0010945 3300046524 Bacteria 6879
1173 Ga0495648_0019012 3300046524 Bacteria 4845
1174 Ga0495648_0023916 3300046524 Bacteria 4172
1175 Ga0495648_0032254 3300046524 Bacteria 3440
1176 Ga0495648_0034766 3300046524 Bacteria 3275
1177 Ga0495648_0041778 3300046524 Bacteria 2892
1178 Ga0495648_0076691 3300046524 Bacteria 1918
1179 Ga0495648_0117986 3300046524 Bacteria 1431
1180 Ga0495648_0158085 3300046524 Bacteria 1175
1181 Ga0495648_0177032 3300046524 Bacteria 1088
1182 Ga0495648_0295370 3300046524 Bacteria 761
1183 Ga0495648_0354105 3300046524 Bacteria 669
1184 Ga0495663_0178770 3300046525 Bacteria 734
1185 Ga0495663_0348303 3300046525 Bacteria 539
1186 Ga0495666_0000042 3300046526 Bacteria 47032
1187 Ga0495666_0000406 3300046526 Bacteria 18977
1188 Ga0495666_0066514 3300046526 Bacteria 1718
1189 Ga0495666_0218832 3300046526 Bacteria 872
1190 Ga0495642_0004297 3300046528 Bacteria 5538
1191 Ga0495642_0004327 3300046528 Bacteria 5515
1192 Ga0495642_0005729 3300046528 Bacteria 4766
1193 Ga0495642_0005832 3300046528 Bacteria 4725
1194 Ga0495642_0032927 3300046528 Bacteria 2082
1195 Ga0495642_0141799 3300046528 Bacteria 1037
1196 Ga0495642_0191297 3300046528 Bacteria 891
1197 Ga0495642_0220331 3300046528 Bacteria 828
1198 Ga0495642_0384232 3300046528 Bacteria 618
1199 Ga0495652_0008927 3300046529 Bacteria 9122
1200 Ga0495652_0644009 3300046529 Bacteria 718
1201 Ga0495652_0692160 3300046529 Bacteria 687
1202 Ga0495654_0000047 3300046530 Bacteria 147597
1203 Ga0495654_0010498 3300046530 Bacteria 5037
1204 Ga0495654_0047709 3300046530 Bacteria 2104
1205 Ga0495654_0054606 3300046530 Bacteria 1937
1206 Ga0495654_0108211 3300046530 Bacteria 1271
1207 Ga0495654_0164605 3300046530 Bacteria 971
1208 Ga0495665_0011224 3300046531 Bacteria 4851
1209 Ga0495665_0020612 3300046531 Bacteria 3539
1210 Ga0495665_0351615 3300046531 Bacteria 750
1211 Ga0495665_0430889 3300046531 Bacteria 667
1212 Ga0495640_0563530 3300046533 Bacteria 690
1213 Ga0495586_0003306 3300046535 Bacteria 8645
1214 Ga0495586_0029130 3300046535 Bacteria 2955
1215 Ga0495586_0041477 3300046535 Bacteria 2478
1216 Ga0495586_0068372 3300046535 Bacteria 1937
1217 Ga0495587_0025272 3300046536 Bacteria 3629
1218 Ga0495587_0222801 3300046536 Bacteria 1063
1219 Ga0495609_0000022 3300046538 Bacteria 279488
1220 Ga0495609_0000482 3300046538 Bacteria 31993
1221 Ga0495609_0000525 3300046538 Bacteria 30623
1222 Ga0495609_0000817 3300046538 Bacteria 23240
1223 Ga0495609_0004242 3300046538 Bacteria 7918
1224 Ga0495609_0011455 3300046538 Bacteria 4222
1225 Ga0495609_0015753 3300046538 Bacteria 3534
1226 Ga0495609_0027835 3300046538 Bacteria 2581
1227 Ga0495609_0040439 3300046538 Bacteria 2098
1228 Ga0495609_0045080 3300046538 Bacteria 1976
1229 Ga0495609_0064246 3300046538 Bacteria 1619
1230 Ga0495609_0092309 3300046538 Bacteria 1316
1231 Ga0495609_0129507 3300046538 Bacteria 1081
1232 Ga0495609_0212564 3300046538 Bacteria 805
1233 Ga0495621_0003510 3300046539 Bacteria 4327
1234 Ga0495597_0000104 3300046542 Bacteria 75532
1235 Ga0495597_0000246 3300046542 Bacteria 49396
1236 Ga0495597_0000771 3300046542 Bacteria 25342
1237 Ga0495597_0000806 3300046542 Bacteria 24735
1238 Ga0495597_0004134 3300046542 Bacteria 8071
1239 Ga0495597_0004503 3300046542 Bacteria 7633
1240 Ga0495597_0051448 3300046542 Bacteria 1816
1241 Ga0495597_0218038 3300046542 Bacteria 758
1242 Ga0495645_0519153 3300046543 Bacteria 742
1243 Ga0495622_0000015 3300046557 Bacteria 179054
1244 Ga0495622_0000598 3300046557 Bacteria 21004
1245 Ga0495622_0003085 3300046557 Bacteria 7901
1246 Ga0495622_0027127 3300046557 Bacteria 2673
1247 Ga0495622_0178754 3300046557 Bacteria 952
1248 Ga0495633_0000110 3300046558 Bacteria 110302
1249 Ga0495633_0000189 3300046558 Bacteria 80465
1250 Ga0495633_0000253 3300046558 Bacteria 63420
1251 Ga0495633_0003539 3300046558 Bacteria 10342
1252 Ga0495633_0004049 3300046558 Bacteria 9473
1253 Ga0495633_0005097 3300046558 Bacteria 8158
1254 Ga0495633_0006064 3300046558 Bacteria 7247
1255 Ga0495633_0019372 3300046558 Bacteria 3443
1256 Ga0495633_0024369 3300046558 Bacteria 2991
1257 Ga0495633_0027835 3300046558 Bacteria 2759
1258 Ga0495633_0045331 3300046558 Bacteria 2082
1259 Ga0495633_0053117 3300046558 Bacteria 1907
1260 Ga0495633_0058702 3300046558 Bacteria 1805
1261 Ga0495633_0077901 3300046558 Bacteria 1543
1262 Ga0495633_0186950 3300046558 Bacteria 953
1263 Ga0495667_0409249 3300046559 Bacteria 854
1264 Ga0495656_0046421 3300046615 Bacteria 1838
1265 Ga0495656_0295828 3300046615 Bacteria 828
1266 Ga0495656_0413918 3300046615 Bacteria 706
1267 Ga0495656_0542329 3300046615 Bacteria 619
1268 Ga0495656_0543884 3300046615 Bacteria 618
1269 Ga0495668_0000064 3300046616 Bacteria 180583
1270 Ga0495668_0000131 3300046616 Bacteria 112755
1271 Ga0495668_0000245 3300046616 Bacteria 77566
1272 Ga0495668_0000434 3300046616 Bacteria 53950
1273 Ga0495668_0001415 3300046616 Bacteria 23352
1274 Ga0495668_0001765 3300046616 Bacteria 19790
1275 Ga0495668_0005921 3300046616 Bacteria 8133
1276 Ga0495668_0006701 3300046616 Bacteria 7502
1277 Ga0495668_0037092 3300046616 Bacteria 2729
1278 Ga0495668_0112999 3300046616 Bacteria 1485
1279 Ga0495668_0181098 3300046616 Bacteria 1154
1280 Ga0495668_0574453 3300046616 Bacteria 622
1281 Ga0495668_0642286 3300046616 Bacteria 586
1282 Ga0495634_0006153 3300046642 Bacteria 9139
1283 Ga0495634_0420950 3300046642 Bacteria 791
1284 Ga0495611_0003458 3300046648 Bacteria 6962
1285 Ga0495611_0008445 3300046648 Bacteria 4360
1286 Ga0495611_0016209 3300046648 Bacteria 3185
1287 Ga0495611_0024536 3300046648 Bacteria 2623
1288 Ga0495625_0000188 3300046660 Bacteria 97649
1289 Ga0495625_0001292 3300046660 Bacteria 31449
1290 Ga0495625_0001624 3300046660 Bacteria 26504
1291 Ga0495625_0011006 3300046660 Bacteria 7423
1292 Ga0495625_0011060 3300046660 Bacteria 7395
1293 Ga0495625_0023122 3300046660 Bacteria 4751
1294 Ga0495625_0051373 3300046660 Bacteria 2955
1295 Ga0495625_0093430 3300046660 Bacteria 2077
1296 Ga0495625_0138509 3300046660 Bacteria 1643
1297 Ga0495625_0140960 3300046660 Bacteria 1626
1298 Ga0495625_0175871 3300046660 Bacteria 1426
1299 Ga0495625_0179402 3300046660 Bacteria 1409
1300 Ga0495625_0454015 3300046660 Bacteria 791
1301 Ga0495625_0463659 3300046660 Bacteria 780
1302 Ga0495635_0005244 3300046663 Bacteria 9016
1303 Ga0495659_0000679 3300046664 Bacteria 12343
1304 Ga0495659_0001640 3300046664 Bacteria 7513
1305 Ga0495661_0000502 3300046665 Bacteria 40792
1306 Ga0495661_0001265 3300046665 Bacteria 21757
1307 Ga0495661_0005726 3300046665 Bacteria 8799
1308 Ga0495661_0009038 3300046665 Bacteria 6857
1309 Ga0495661_0015856 3300046665 Bacteria 5016
1310 Ga0495661_0027532 3300046665 Bacteria 3647
1311 Ga0495661_0031420 3300046665 Bacteria 3370
1312 Ga0495661_0035252 3300046665 Bacteria 3141
1313 Ga0495661_0043898 3300046665 Bacteria 2744
1314 Ga0495661_0049104 3300046665 Bacteria 2560
1315 Ga0495661_0083814 3300046665 Bacteria 1831
1316 Ga0495661_0087827 3300046665 Bacteria 1776
1317 Ga0495661_0089152 3300046665 Bacteria 1759
1318 Ga0495661_0104665 3300046665 Bacteria 1586
1319 Ga0495661_0105438 3300046665 Bacteria 1578
1320 Ga0495661_0112456 3300046665 Bacteria 1515
1321 Ga0495661_0123683 3300046665 Bacteria 1425
1322 Ga0495661_0210079 3300046665 Bacteria 1014
1323 Ga0495661_0401328 3300046665 Bacteria 666
1324 Ga0495661_0437020 3300046665 Bacteria 631
1325 Ga0495588_0000148 3300046674 Bacteria 100600
1326 Ga0495588_0017071 3300046674 Bacteria 3518
1327 Ga0495588_0074754 3300046674 Bacteria 1764
1328 Ga0495588_0081574 3300046674 Bacteria 1688
1329 Ga0495588_0151054 3300046674 Bacteria 1227
1330 Ga0495599_0420424 3300046678 Bacteria 794
1331 Ga0495623_0023548 3300046679 Bacteria 3974
1332 Ga0495623_0030990 3300046679 Bacteria 3440
1333 Ga0495623_0033544 3300046679 Bacteria 3294
1334 Ga0495647_0082352 3300046681 Bacteria 1307
1335 Ga0495658_0678181 3300046683 Bacteria 660
1336 Ga0495669_0000355 3300046684 Bacteria 23402
1337 Ga0495669_0001964 3300046684 Bacteria 8448
1338 Ga0495669_0007315 3300046684 Bacteria 4625
1339 Ga0495669_0016714 3300046684 Bacteria 3145
1340 Ga0495669_0027926 3300046684 Bacteria 2469
1341 Ga0495613_0009841 3300046689 Bacteria 7111
1342 Ga0495613_0232461 3300046689 Bacteria 1291
1343 Ga0495613_0890572 3300046689 Bacteria 576
1344 Ga0495624_0018263 3300046690 Bacteria 4691
1345 Ga0495670_0003213 3300046691 Bacteria 8042
1346 Ga0495670_0011444 3300046691 Bacteria 4364
1347 Ga0495670_0030214 3300046691 Bacteria 2691
1348 Ga0495670_0086312 3300046691 Bacteria 1602
1349 Ga0495670_0108500 3300046691 Bacteria 1435
1350 Ga0495670_0156969 3300046691 Bacteria 1194
1351 Ga0495670_0374453 3300046691 Bacteria 768
1352 Ga0495670_0421203 3300046691 Bacteria 722
1353 Ga0495670_0440460 3300046691 Bacteria 706
1354 Ga0495670_0562660 3300046691 Bacteria 620
1355 Ga0495671_0000044 3300046692 Bacteria 160337
1356 Ga0495671_0000426 3300046692 Bacteria 33503
1357 Ga0495671_0019650 3300046692 Bacteria 3566
1358 Ga0495671_0028581 3300046692 Bacteria 2871
1359 Ga0495671_0038152 3300046692 Bacteria 2428
1360 Ga0495671_0073066 3300046692 Bacteria 1683
1361 Ga0495671_0290865 3300046692 Bacteria 786
1362 Ga0495671_0312540 3300046692 Bacteria 755
1363 Ga0495649_0000806 3300046694 Bacteria 25272
1364 Ga0495649_0005148 3300046694 Bacteria 8387
1365 Ga0495649_0019253 3300046694 Bacteria 3835
1366 Ga0495649_0040661 3300046694 Bacteria 2544
1367 Ga0495649_0102632 3300046694 Bacteria 1519
1368 Ga0495649_0110028 3300046694 Bacteria 1461
1369 Ga0495649_0218377 3300046694 Bacteria 986
1370 Ga0495649_0337019 3300046694 Bacteria 763
1371 Ga0495649_0480981 3300046694 Bacteria 618
1372 Ga0495589_0000017 3300046794 Bacteria 206113
1373 Ga0495589_0000508 3300046794 Bacteria 27530
1374 Ga0495589_0006901 3300046794 Bacteria 5969
1375 Ga0495589_0009727 3300046794 Bacteria 4995
1376 Ga0495589_0015977 3300046794 Bacteria 3859
1377 Ga0495589_0049188 3300046794 Bacteria 2086
1378 Ga0495589_0052782 3300046794 Bacteria 2007
1379 Ga0495589_0091798 3300046794 Bacteria 1474
1380 Ga0495600_0123284 3300046809 Bacteria 1685
1381 Ga0495660_0000162 3300046810 Bacteria 71874
1382 Ga0495660_0000403 3300046810 Bacteria 37269
1383 Ga0495660_0005437 3300046810 Bacteria 7627
1384 Ga0495660_0007545 3300046810 Bacteria 6385
1385 Ga0495660_0015676 3300046810 Bacteria 4376
1386 Ga0495660_0021946 3300046810 Bacteria 3650
1387 Ga0495660_0023195 3300046810 Bacteria 3541
1388 Ga0495660_0035577 3300046810 Bacteria 2781
1389 Ga0495660_0086023 3300046810 Bacteria 1641
1390 Ga0495660_0139169 3300046810 Bacteria 1209
1391 Ga0495660_0261881 3300046810 Bacteria 798
1392 Ga0495660_0314563 3300046810 Bacteria 705
1393 Ga0495660_0429093 3300046810 Bacteria 574
1394 Ga0495581_0027074 3300047315 Bacteria 3325
1395 Ga0495581_0068577 3300047315 Bacteria 2050
1396 Ga0495581_0138604 3300047315 Bacteria 1418
1397 Ga0495581_0351395 3300047315 Bacteria 860
1398 Ga0495604_0006708 3300047317 Bacteria 9127
1399 Ga0495604_0044087 3300047317 Bacteria 3488
1400 Ga0495604_0150900 3300047317 Bacteria 1651
1401 Ga0495604_0349592 3300047317 Bacteria 982
1402 Ga0495636_0005184 3300047318 Bacteria 5111
1403 Ga0495636_0050921 3300047318 Bacteria 1734
1404 Ga0495636_0163907 3300047318 Bacteria 1002
1405 Ga0495636_0339180 3300047318 Bacteria 708
1406 Ga0495674_0006559 3300047319 Bacteria 11166
1407 Ga0495672_0000111 3300047320 Bacteria 130829
1408 Ga0495672_0000142 3300047320 Bacteria 105843
1409 Ga0495672_0000152 3300047320 Bacteria 100381
1410 Ga0495672_0000167 3300047320 Bacteria 95937
1411 Ga0495672_0000559 3300047320 Bacteria 42288
1412 Ga0495672_0000581 3300047320 Bacteria 41296
1413 Ga0495672_0038378 3300047320 Bacteria 2922
1414 Ga0495672_0070711 3300047320 Bacteria 1976
1415 Ga0495672_0075445 3300047320 Bacteria 1896
1416 Ga0495672_0097259 3300047320 Bacteria 1603
1417 Ga0495676_0000123 3300047321 Bacteria 59710
1418 Ga0495676_0069412 3300047321 Bacteria 2719
1419 Ga0495676_0588180 3300047321 Bacteria 725
1420 Ga0495680_0007799 3300047322 Bacteria 9775
1421 Ga0495680_0060600 3300047322 Bacteria 2916
1422 Ga0495683_0000069 3300047323 Bacteria 110339
1423 Ga0495683_0000098 3300047323 Bacteria 88510
1424 Ga0495683_0002101 3300047323 Bacteria 12334
1425 Ga0495683_0014744 3300047323 Bacteria 4072
1426 Ga0495683_0019856 3300047323 Bacteria 3466
1427 Ga0495683_0026681 3300047323 Bacteria 2955
1428 Ga0495683_0044801 3300047323 Bacteria 2225
1429 Ga0495683_0046896 3300047323 Bacteria 2169
1430 Ga0495683_0068070 3300047323 Bacteria 1752
1431 Ga0495683_0116851 3300047323 Bacteria 1269
1432 Ga0495687_000113 3300047443 Bacteria 123712
1433 Ga0495687_000140 3300047443 Bacteria 109311
1434 Ga0495687_000175 3300047443 Bacteria 94911
1435 Ga0495687_000236 3300047443 Bacteria 76970
1436 Ga0495687_002221 3300047443 Bacteria 16034
1437 Ga0495687_007947 3300047443 Bacteria 6160
1438 Ga0495687_010281 3300047443 Bacteria 5141
1439 Ga0495687_044949 3300047443 Bacteria 1915
1440 Ga0495675_0012446 3300047444 Bacteria 5355
1441 Ga0495675_0109769 3300047444 Bacteria 1722
1442 Ga0495675_0113683 3300047444 Bacteria 1688
1443 Ga0495675_0200665 3300047444 Bacteria 1214
1444 Ga0495677_0000002 3300047445 Bacteria 346767
1445 Ga0495677_0000079 3300047445 Bacteria 49339
1446 Ga0495677_0000140 3300047445 Bacteria 34650
1447 Ga0495677_0000530 3300047445 Bacteria 15886
1448 Ga0495677_0002486 3300047445 Bacteria 7231
1449 Ga0495677_0004215 3300047445 Bacteria 5543
1450 Ga0495677_0005141 3300047445 Bacteria 4980
1451 Ga0495677_0006745 3300047445 Bacteria 4319
1452 Ga0495677_0056288 3300047445 Bacteria 1452
1453 Ga0495677_0100590 3300047445 Bacteria 1094
1454 Ga0495679_009955 3300047446 Bacteria 3766
1455 Ga0495679_011673 3300047446 Bacteria 3375
1456 Ga0495679_021210 3300047446 Bacteria 2248
1457 Ga0495679_034304 3300047446 Bacteria 1616
1458 Ga0495679_041740 3300047446 Bacteria 1418
1459 Ga0495679_048811 3300047446 Bacteria 1278
1460 Ga0495679_058770 3300047446 Bacteria 1133
1461 Ga0495679_173340 3300047446 Bacteria 573
1462 Ga0495685_000035 3300047447 Bacteria 55942
1463 Ga0495685_007306 3300047447 Bacteria 3644
1464 Ga0495685_017962 3300047447 Bacteria 2423
1465 Ga0495685_040764 3300047447 Bacteria 1587
1466 Ga0495685_068902 3300047447 Bacteria 1187
1467 Ga0495673_0000060 3300047469 Bacteria 231642
1468 Ga0495673_0000085 3300047469 Bacteria 193245
1469 Ga0495673_0000149 3300047469 Bacteria 122863
1470 Ga0495673_0002074 3300047469 Bacteria 14639
1471 Ga0495673_0011481 3300047469 Bacteria 4760
1472 Ga0495673_0138910 3300047469 Bacteria 949
1473 Ga0495681_0000824 3300047470 Bacteria 23910
1474 Ga0495681_0008558 3300047470 Bacteria 6401
1475 Ga0495681_0012074 3300047470 Bacteria 5094
1476 Ga0495681_0022943 3300047470 Bacteria 3327
1477 Ga0495681_0037046 3300047470 Bacteria 2406
1478 Ga0495681_0069635 3300047470 Bacteria 1597
1479 Ga0495681_0071377 3300047470 Bacteria 1572
1480 Ga0495681_0132533 3300047470 Bacteria 1059
1481 Ga0495686_0000169 3300047472 Bacteria 123511
1482 Ga0495686_0001301 3300047472 Bacteria 28115
1483 Ga0495686_0001456 3300047472 Bacteria 25789
1484 Ga0495686_0022113 3300047472 Bacteria 4210
1485 Ga0495686_0045233 3300047472 Bacteria 2785
1486 Ga0495686_0051556 3300047472 Bacteria 2581
1487 Ga0495686_0063418 3300047472 Bacteria 2290
1488 Ga0495686_0176616 3300047472 Bacteria 1239
1489 Ga0495686_0193354 3300047472 Bacteria 1171
1490 Ga0495686_0640205 3300047472 Bacteria 547
1491 Ga0495593_0007070 3300047673 Bacteria 6583
1492 Ga0495593_0027236 3300047673 Bacteria 3148
1493 Ga0495593_0334876 3300047673 Bacteria 756
1494 Ga0495602_0013704 3300048088 Bacteria 8268
1495 Ga0495602_0038029 3300048088 Bacteria 4456
1496 Ga0495602_1165652 3300048088 Bacteria 503
1497 Ga0495614_0005675 3300048089 Bacteria 5625
1498 Ga0495614_0259825 3300048089 Bacteria 796
1499 Ga0495614_0275022 3300048089 Bacteria 774
1500 Ga0495615_0251393 3300048090 Bacteria 560
1501 Ga0495626_0000076 3300048091 Bacteria 131125
1502 Ga0495626_0000170 3300048091 Bacteria 80445
1503 Ga0495626_0000882 3300048091 Bacteria 26543
1504 Ga0495626_0002487 3300048091 Bacteria 12748
1505 Ga0495626_0014577 3300048091 Bacteria 4049
1506 Ga0495626_0016369 3300048091 Bacteria 3768
1507 Ga0495626_0018299 3300048091 Bacteria 3521
1508 Ga0495626_0020538 3300048091 Bacteria 3288
1509 Ga0495626_0055268 3300048091 Bacteria 1820
1510 Ga0495626_0063415 3300048091 Bacteria 1676
1511 Ga0495626_0077862 3300048091 Bacteria 1477
1512 Ga0495626_0086070 3300048091 Bacteria 1389
1513 Ga0495626_0102698 3300048091 Bacteria 1245
1514 Ga0495626_0240270 3300048091 Bacteria 729
1515 Ga0495626_0294420 3300048091 Bacteria 642
1516 Ga0496100_0008425 3300048903 Bacteria 5749
1517 Ga0496100_0091449 3300048903 Bacteria 2077
1518 Ga0496100_0425875 3300048903 Bacteria 1014
1519 Ga0496101_0119689 3300048904 Bacteria 1989
1520 Ga0496101_0407770 3300048904 Bacteria 1071
1521 Ga0496101_0818837 3300048904 Bacteria 734
1522 Ga0496102_0000156 3300048905 Bacteria 92538
1523 Ga0496102_0026637 3300048905 Bacteria 5160
1524 Ga0496102_0035916 3300048905 Bacteria 4463
1525 Ga0496102_0040492 3300048905 Bacteria 4215
1526 Ga0496102_0241353 3300048905 Bacteria 1704
1527 Ga0496102_1601529 3300048905 Bacteria 569
1528 Ga0496103_0001871 3300048906 Bacteria 13677
1529 Ga0496103_0050964 3300048906 Bacteria 2561
1530 Ga0496103_0314841 3300048906 Bacteria 1007
1531 Ga0496103_0481771 3300048906 Bacteria 795
1532 Ga0496103_0685025 3300048906 Bacteria 650
1533 Ga0496104_0031258 3300048907 Bacteria 4951
1534 Ga0496104_0145130 3300048907 Bacteria 2279
1535 Ga0496104_0308104 3300048907 Bacteria 1496
1536 Ga0496104_0772260 3300048907 Bacteria 867
1537 Ga0496105_0086137 3300048908 Bacteria 2596
1538 Ga0496105_0115503 3300048908 Bacteria 2214
1539 Ga0496105_0277813 3300048908 Bacteria 1351
1540 Ga0496105_0336785 3300048908 Bacteria 1207
1541 Ga0496105_1046679 3300048908 Bacteria 608
1542 Ga0496106_0092083 3300048909 Bacteria 2341
1543 Ga0496106_0163178 3300048909 Bacteria 1763
1544 Ga0496106_0206902 3300048909 Bacteria 1562
1545 Ga0496106_0758867 3300048909 Bacteria 771
1546 Ga0496106_1265917 3300048909 Bacteria 573
1547 Ga0496107_0145371 3300048910 Bacteria 1753
1548 Ga0496107_0186240 3300048910 Bacteria 1542
1549 Ga0496107_0496247 3300048910 Bacteria 906
1550 Ga0496107_0705493 3300048910 Bacteria 742
1551 Ga0496108_0148228 3300048911 Bacteria 2024
1552 Ga0496108_0489275 3300048911 Bacteria 1075
1553 Ga0496108_1235550 3300048911 Bacteria 631
1554 Ga0496108_1759002 3300048911 Bacteria 509
1555 Ga0496109_0061400 3300048912 Bacteria 3436
1556 Ga0496109_0103067 3300048912 Bacteria 2648
1557 Ga0496109_0161761 3300048912 Bacteria 2097
1558 Ga0496109_0202296 3300048912 Bacteria 1867
1559 Ga0496109_0713198 3300048912 Bacteria 941
1560 Ga0496110_0015273 3300048913 Bacteria 6387
1561 Ga0496110_0317709 3300048913 Bacteria 1418
1562 Ga0496110_0759304 3300048913 Bacteria 873
1563 Ga0496110_1197560 3300048913 Bacteria 668
1564 Ga0496111_0133500 3300048914 Bacteria 1838
1565 Ga0496111_0403271 3300048914 Bacteria 1010
1566 Ga0496112_0059576 3300048915 Bacteria 3762
1567 Ga0496113_0040930 3300048916 Bacteria 3417
1568 Ga0496113_0050671 3300048916 Bacteria 3096
1569 Ga0496113_0065917 3300048916 Bacteria 2741
1570 Ga0496113_0358311 3300048916 Bacteria 1170
1571 Ga0496113_0375616 3300048916 Bacteria 1141
1572 Ga0496114_0005419 3300048917 Bacteria 9979
1573 Ga0496114_0017437 3300048917 Bacteria 5796
1574 Ga0496114_0065449 3300048917 Bacteria 3046
1575 Ga0496114_0517560 3300048917 Bacteria 1055
1576 Ga0496115_0031336 3300048918 Bacteria 4190
1577 Ga0496115_0118488 3300048918 Bacteria 2177
1578 Ga0496115_0169903 3300048918 Bacteria 1803
1579 Ga0496115_0189893 3300048918 Bacteria 1697
1580 Ga0496115_0502819 3300048918 Bacteria 974
1581 Ga0496115_0712322 3300048918 Bacteria 788
1582 Ga0496116_0026975 3300048919 Bacteria 4188
1583 Ga0496116_0075945 3300048919 Bacteria 2107
1584 Ga0496116_0207566 3300048919 Bacteria 1018
1585 Ga0496117_0000011 3300048920 Bacteria 610930
1586 Ga0496117_0389840 3300048920 Bacteria 706
1587 Ga0496118_0000010 3300048921 Bacteria 610930
1588 Ga0496118_0402302 3300048921 Bacteria 711
1589 Ga0496120_0055568 3300048923 Bacteria 2238
1590 Ga0496121_0014685 3300048924 Bacteria 8279
1591 Ga0496121_0020684 3300048924 Bacteria 6493
1592 Ga0496121_0072058 3300048924 Bacteria 2775
1593 Ga0496121_0089685 3300048924 Bacteria 2406
1594 Ga0496121_0091909 3300048924 Bacteria 2367
1595 Ga0496121_0537109 3300048924 Bacteria 734
1596 Ga0496122_0000653 3300048925 Bacteria 70150
1597 Ga0496122_0000691 3300048925 Bacteria 67209
1598 Ga0496122_0055165 3300048925 Bacteria 2976
1599 Ga0496122_0059591 3300048925 Bacteria 2817
1600 Ga0496123_0000196 3300048926 Bacteria 122955
1601 Ga0496123_0003602 3300048926 Bacteria 17162
1602 Ga0496123_0008397 3300048926 Bacteria 9492
1603 Ga0496123_0023456 3300048926 Bacteria 4721
1604 Ga0496123_0362392 3300048926 Bacteria 671
1605 Ga0496124_0001079 3300048927 Bacteria 43104
1606 Ga0496124_0007424 3300048927 Bacteria 11656
1607 Ga0496124_0047741 3300048927 Bacteria 3661
1608 Ga0496124_0280248 3300048927 Bacteria 1216
1609 Ga0496124_0295836 3300048927 Bacteria 1172
1610 Ga0496124_0342286 3300048927 Bacteria 1061
1611 Ga0496125_0003108 3300048928 Bacteria 20666
1612 Ga0496125_0052257 3300048928 Bacteria 3361
1613 Ga0496125_0052557 3300048928 Bacteria 3349
1614 Ga0496125_0200621 3300048928 Bacteria 1306
1615 Ga0496126_0011408 3300048929 Bacteria 9204
1616 Ga0496126_0324301 3300048929 Bacteria 1265
1617 Ga0496126_0565907 3300048929 Bacteria 900
1618 Ga0501306_031055 3300049127 Bacteria 794
1619 Ga0501308_012646 3300049128 Bacteria 967
1620 Ga0501304_014766 3300049160 Bacteria 726
1621 Ga0501304_017110 3300049160 Bacteria 691
1622 Ga0495678_000001 3300049459 Bacteria 1060340
1623 Ga0495678_000458 3300049459 Bacteria 40497
1624 Ga0495678_000745 3300049459 Bacteria 29532
1625 Ga0495678_001248 3300049459 Bacteria 20698
1626 Ga0495678_013374 3300049459 Bacteria 3856
1627 Ga0495678_016943 3300049459 Bacteria 3314
1628 Ga0495678_018139 3300049459 Bacteria 3171
1629 Ga0495678_055256 3300049459 Bacteria 1516
1630 Ga0495682_0002062 3300049460 Bacteria 9827
1631 Ga0495682_0002194 3300049460 Bacteria 9446
1632 Ga0495682_0003012 3300049460 Bacteria 7672
1633 Ga0495682_0036004 3300049460 Bacteria 1822
1634 Ga0501291_003206 3300049514 Bacteria 2022
1635 Ga0501297_008226 3300049520 Bacteria 1146
1636 Ga0501300_011751 3300049523 Bacteria 1275
1637 Ga0501301_018626 3300049524 Bacteria 649
1638 Ga0501303_017177 3300049526 Bacteria 739
1639 Ga0501314_002322 3300049530 Bacteria 1459
1640 Ga0501315_060558 3300049531 Bacteria 612
1641 Ga0501324_026192 3300049540 Bacteria 618
1642 Ga0501036_0833410 3300049572 Bacteria 759
1643 Ga0501041_0447632 3300049577 Bacteria 820
1644 Ga0501041_0955430 3300049577 Bacteria 551
1645 Ga0501198_000020 3300049649 Bacteria 75919
1646 Ga0501202_077752 3300049652 Bacteria 775
1647 Ga0501210_006741 3300049657 Bacteria 849
1648 Ga0501211_000342 3300049658 Bacteria 4336
1649 Ga0501222_000025 3300049662 Bacteria 64191
1650 Ga0501222_001535 3300049662 Bacteria 3221
1651 Ga0501222_008087 3300049662 Bacteria 1398
1652 Ga0501223_007317 3300049663 Bacteria 2262
1653 Ga0501227_060815 3300049665 Bacteria 968
1654 Ga0501233_013732 3300049668 Bacteria 1647
1655 Ga0501235_006749 3300049669 Bacteria 2499
1656 Ga0501238_026390 3300049671 Bacteria 833
1657 Ga0501257_089156 3300049686 Bacteria 801
1658 Ga0501258_003044 3300049687 Bacteria 1514
1659 Ga0501221_019756 3300049704 Bacteria 1311
1660 Ga0501229_002483 3300049706 Bacteria 2178
1661 Ga0501079_0175184 3300049741 Bacteria 1673
1662 Ga0501262_033377 3300049759 Bacteria 748
1663 Ga0501264_014637 3300049761 Bacteria 786
1664 Ga0501266_094602 3300049763 Bacteria 523
1665 Ga0501269_001764 3300049766 Bacteria 2754
1666 Ga0501272_010980 3300049769 Bacteria 1015
1667 Ga0501283_028357 3300049779 Bacteria 929
1668 Ga0501283_059939 3300049779 Bacteria 686
1669 Ga0501035_0018470 3300049822 Bacteria 6424
1670 Ga0501044_0164982 3300049823 Bacteria 2190
1671 nmdc:mga03683_106114_c1 3300050489 Bacteria 1238
1672 nmdc:mga03683_218867_c1 3300050489 Bacteria 878
1673 nmdc:mga03n38_95341_c1 3300050490 Bacteria 1425
1674 nmdc:mga00v17_823376_c1 3300050491 Bacteria 591
1675 nmdc:mga0k408_140886_c1 3300050493 Bacteria 1435
1676 nmdc:mga0k408_167711_c1 3300050493 Bacteria 1309
1677 nmdc:mga0k408_17968_c1 3300050493 Bacteria 3942
1678 nmdc:mga0k408_215628_c1 3300050493 Bacteria 1146
1679 nmdc:mga0k408_303971_c1 3300050493 Bacteria 952
1680 nmdc:mga0k408_432820_c1 3300050493 Bacteria 782
1681 nmdc:mga0k408_471718_c1 3300050493 Bacteria 745
1682 nmdc:mga0k408_48281_c1 3300050493 Bacteria 2462
1683 nmdc:mga06z11_388436_c1 3300050494 Bacteria 839
1684 nmdc:mga07m45_216290_c1 3300050496 Bacteria 1115
1685 nmdc:mga07m45_418293_c1 3300050496 Bacteria 778
1686 nmdc:mga07m45_602165_c1 3300050496 Bacteria 635
1687 nmdc:mga07m45_70331_c1 3300050496 Bacteria 1991
1688 nmdc:mga07m45_89189_c1 3300050496 Bacteria 1766
1689 nmdc:mga07m45_9660_c1 3300050496 Bacteria 5013
1690 nmdc:mga07m45_9841_c1 3300050496 Bacteria 4973
1691 nmdc:mga09592_1296_c1 3300050508 Bacteria 20095
1692 nmdc:mga0qj67_11367_c1 3300050509 Bacteria 6669
1693 nmdc:mga0qj67_142534_c1 3300050509 Bacteria 1943
1694 nmdc:mga0rr50_1435808_c1 3300050513 Bacteria 584
1695 Ga0500635_0000077 3300053080 Bacteria 63561
1696 Ga0500635_0191967 3300053080 Bacteria 792
1697 Ga0500578_0000013 3300053086 Bacteria 185921
1698 Ga0500644_0299089 3300053088 Bacteria 688
1699 Ga0500646_0058230 3300053090 Bacteria 1130
1700 Ga0500583_0302745 3300053092 Bacteria 782
1701 Ga0500651_0021759 3300053093 Bacteria 4001
1702 Ga0500650_0276913 3300053098 Bacteria 747
1703 Ga0500557_211979 3300053105 Bacteria 619
1704 Ga0500562_031435 3300053108 Bacteria 1401
1705 Ga0500569_016845 3300053109 Bacteria 1858
1706 Ga0500594_0001239 3300053118 Bacteria 5521
1707 Ga0500594_0003144 3300053118 Bacteria 3610
1708 Ga0500607_109745 3300053121 Bacteria 1355
1709 Ga0500618_004758 3300053125 Bacteria 4249
1710 Ga0500618_006553 3300053125 Bacteria 3405
1711 Ga0500621_258815 3300053126 Bacteria 580
1712 Ga0500642_0022296 3300053130 Bacteria 2524
1713 Ga0500642_0070947 3300053130 Bacteria 1585
1714 Ga0500652_001857 3300053131 Bacteria 6377
1715 Ga0500652_193579 3300053131 Bacteria 828
1716 Ga0500658_0025758 3300053134 Bacteria 2262
1717 Ga0500559_0003197 3300053136 Bacteria 8144
1718 Ga0500559_0043745 3300053136 Bacteria 1957
1719 Ga0500559_0490266 3300053136 Bacteria 565
1720 Ga0500564_124046 3300053138 Bacteria 1123
1721 Ga0500568_0001164 3300053139 Bacteria 17590
1722 Ga0500568_0013489 3300053139 Bacteria 3723
1723 Ga0500577_0003430 3300053142 Bacteria 4117
1724 Ga0500586_007537 3300053145 Bacteria 2909
1725 Ga0500589_202111 3300053147 Bacteria 762
1726 Ga0500604_0070068 3300053151 Bacteria 1116
1727 Ga0500604_0318967 3300053151 Bacteria 539
1728 Ga0500619_000008 3300053154 Bacteria 70273
1729 Ga0500619_054905 3300053154 Bacteria 1298
1730 Ga0500622_0007164 3300053156 Bacteria 6360
1731 Ga0500622_0073705 3300053156 Bacteria 1721
1732 Ga0500636_0088358 3300053177 Bacteria 1777
1733 Ga0500636_0133130 3300053177 Bacteria 1383
1734 Ga0500584_055439 3300053726 Bacteria 1779
1735 Ga0500645_008014 3300053730 Bacteria 3639
1736 Ga0500587_000059 3300053739 Bacteria 8925
1737 Ga0500587_003765 3300053739 Bacteria 2107
1738 Ga0500587_073475 3300053739 Bacteria 541
1739 Ga0500661_003928 3300055283 Bacteria 2783
1740 Ga0587083_0075842 3300059505 Bacteria 791
1741 Ga0587098_022566 3300059604 Bacteria 811
1742 Ga0587068_010424 3300059641 Bacteria 1386
1743 Ga0466962_0002387 3300061719 Bacteria 8901
1744 Ga0466962_0033691 3300061719 Bacteria 2451
1745 Ga0466962_0046950 3300061719 Bacteria 2063
1746 Ga0466962_0664925 3300061719 Bacteria 533

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045836 Ga0466958_0156942 Ga0466958_0156942_716_1132 103
2 3300005328 Ga0070676_10366082 Ga0070676_103660822 106
3 3300005329 Ga0070683_100109501 Ga0070683_1001095013 106
4 3300005331 Ga0070670_100393495 Ga0070670_1003934952 106
5 3300005333 Ga0070677_10017613 Ga0070677_100176133 106
6 3300005335 Ga0070666_10680537 Ga0070666_106805371 106
7 3300005456 Ga0070678_100017043 Ga0070678_1000170433 106
8 3300005459 Ga0068867_100148304 Ga0068867_1001483041 106
9 3300005547 Ga0070693_100155581 Ga0070693_1001555812 106
10 3300005564 Ga0070664_100360173 Ga0070664_1003601732 106
11 3300005564 Ga0070664_100551765 Ga0070664_1005517651 106
12 3300005616 Ga0068852_100275484 Ga0068852_1002754842 106
13 3300005718 Ga0068866_10291282 Ga0068866_102912822 106
14 3300006881 Ga0068865_100289236 Ga0068865_1002892362 106
15 3300009148 Ga0105243_10950944 Ga0105243_109509442 106
16 3300014326 Ga0157380_10256033 Ga0157380_102560332 106
17 3300025893 Ga0207682_10114555 Ga0207682_101145552 106
18 3300025907 Ga0207645_10293283 Ga0207645_102932832 106
19 3300025945 Ga0207679_10376143 Ga0207679_103761432 106
20 3300026035 Ga0207703_10565636 Ga0207703_105656362 106
21 3300026089 Ga0207648_10117298 Ga0207648_101172982 106
22 3300026121 Ga0207683_10012078 Ga0207683_100120787 106
23 3300046681 Ga0495647_0082352 Ga0495647_0082352_609_1043 106
24 3300046691 Ga0495670_0440460 Ga0495670_0440460_33_464 106
25 3300014969 Ga0157376_10115009 Ga0157376_101150092 107
26 3300031548 Ga0307408_100647165 Ga0307408_1006471652 107
27 3300032002 Ga0307416_101355712 Ga0307416_1013557121 107
28 3300005354 Ga0070675_100256119 Ga0070675_1002561192 108
29 3300025926 Ga0207659_10211488 Ga0207659_102114882 108
30 3300025937 Ga0207669_10611394 Ga0207669_106113942 108
31 3300005535 Ga0070684_100110528 Ga0070684_1001105282 110
32 3300031824 Ga0307413_11202310 Ga0307413_112023101 115
33 3300005262 Ga0065165_1005640 Ga0065165_10056406 117
34 3300025273 Ga0209673_1006475 Ga0209673_10064753 117
35 3300053086 Ga0500578_0000013 Ga0500578_0000013_181515_181949 117
36 3300005435 Ga0070714_100406359 Ga0070714_1004063591 118
37 3300009177 Ga0105248_10204255 Ga0105248_102042552 118
38 3300005329 Ga0070683_100005699 Ga0070683_10000569910 120
39 3300005331 Ga0070670_100044272 Ga0070670_1000442722 120
40 3300005331 Ga0070670_100050278 Ga0070670_1000502785 120
41 3300005336 Ga0070680_100815715 Ga0070680_1008157152 120
42 3300005338 Ga0068868_100078234 Ga0068868_1000782342 120
43 3300005339 Ga0070660_100025792 Ga0070660_1000257923 120
44 3300005344 Ga0070661_100038941 Ga0070661_1000389412 120
45 3300005353 Ga0070669_100188610 Ga0070669_1001886102 120
46 3300005353 Ga0070669_100264513 Ga0070669_1002645131 120
47 3300005354 Ga0070675_100301189 Ga0070675_1003011892 120
48 3300005355 Ga0070671_100358210 Ga0070671_1003582102 120
49 3300005355 Ga0070671_100529714 Ga0070671_1005297142 120
50 3300005355 Ga0070671_100634338 Ga0070671_1006343381 120
51 3300005366 Ga0070659_100038040 Ga0070659_1000380405 120
52 3300005367 Ga0070667_100041820 Ga0070667_1000418203 120
53 3300005458 Ga0070681_10358612 Ga0070681_103586122 120
54 3300005535 Ga0070684_100032261 Ga0070684_1000322612 120
55 3300005539 Ga0068853_100137713 Ga0068853_1001377132 120
56 3300005543 Ga0070672_100014390 Ga0070672_1000143906 120
57 3300005543 Ga0070672_100219223 Ga0070672_1002192232 120
58 3300005547 Ga0070693_100418017 Ga0070693_1004180172 120
59 3300005548 Ga0070665_100195862 Ga0070665_1001958623 120
60 3300005564 Ga0070664_100043037 Ga0070664_1000430374 120
61 3300005577 Ga0068857_101028775 Ga0068857_1010287752 120
62 3300005578 Ga0068854_100040558 Ga0068854_1000405585 120
63 3300005614 Ga0068856_100063174 Ga0068856_1000631741 120
64 3300005616 Ga0068852_100024399 Ga0068852_1000243994 120
65 3300005616 Ga0068852_100976152 Ga0068852_1009761522 120
66 3300005617 Ga0068859_100035700 Ga0068859_1000357003 120
67 3300005834 Ga0068851_10021738 Ga0068851_100217382 120
68 3300005834 Ga0068851_10065777 Ga0068851_100657773 120
69 3300005841 Ga0068863_100087934 Ga0068863_1000879343 120
70 3300005842 Ga0068858_100006788 Ga0068858_10000678812 120
71 3300005842 Ga0068858_101523109 Ga0068858_1015231092 120
72 3300005843 Ga0068860_100008648 Ga0068860_10000864810 120
73 3300006931 Ga0097620_100035700 Ga0097620_1000357003 120
74 3300009098 Ga0105245_11116907 Ga0105245_111169072 120
75 3300009551 Ga0105238_10052730 Ga0105238_100527306 120
76 3300013100 Ga0157373_10017629 Ga0157373_100176294 120
77 3300013102 Ga0157371_10171540 Ga0157371_101715403 120
78 3300013105 Ga0157369_10018014 Ga0157369_100180147 120
79 3300013296 Ga0157374_10136709 Ga0157374_101367093 120
80 3300013296 Ga0157374_12440091 Ga0157374_124400911 120
81 3300013307 Ga0157372_10042427 Ga0157372_100424277 120
82 3300013308 Ga0157375_10045304 Ga0157375_100453042 120
83 3300014325 Ga0163163_10190597 Ga0163163_101905973 120
84 3300014325 Ga0163163_11516962 Ga0163163_115169622 120
85 3300014326 Ga0157380_10038853 Ga0157380_100388532 120
86 3300014968 Ga0157379_10025892 Ga0157379_100258922 120
87 3300015265 Ga0182005_1099447 Ga0182005_10994472 120
88 3300039447 Ga0436361_1191441 Ga0436361_1191441_1318_1758 120
89 3300061719 Ga0466962_0664925 Ga0466962_0664925_58_474 120
90 3300025921 Ga0207652_10452857 Ga0207652_104528572 121
91 3300005339 Ga0070660_100478924 Ga0070660_1004789242 122
92 3300005344 Ga0070661_100004078 Ga0070661_1000040788 122
93 3300005366 Ga0070659_100000666 Ga0070659_1000006667 122
94 3300005457 Ga0070662_100181759 Ga0070662_1001817592 122
95 3300005459 Ga0068867_100004620 Ga0068867_1000046202 122
96 3300005548 Ga0070665_100257967 Ga0070665_1002579672 122
97 3300005548 Ga0070665_100348547 Ga0070665_1003485472 122
98 3300005564 Ga0070664_100027119 Ga0070664_1000271195 122
99 3300009148 Ga0105243_10023700 Ga0105243_100237005 122
100 3300014745 Ga0157377_10000294 Ga0157377_1000029420 122
101 3300017792 Ga0163161_10889649 Ga0163161_108896491 122
102 3300025919 Ga0207657_10457320 Ga0207657_104573202 122
103 3300025920 Ga0207649_10010449 Ga0207649_100104494 122
104 3300025932 Ga0207690_10004038 Ga0207690_100040382 122
105 3300025933 Ga0207706_10284462 Ga0207706_102844622 122
106 3300025935 Ga0207709_10025634 Ga0207709_100256342 122
107 3300025945 Ga0207679_10016886 Ga0207679_100168862 122
108 3300026089 Ga0207648_10004504 Ga0207648_100045048 122
109 3300028379 Ga0268266_10297392 Ga0268266_102973922 122
110 3300053080 Ga0500635_0191967 Ga0500635_0191967_57_491 122
111 3300053105 Ga0500557_211979 Ga0500557_211979_163_597 122
112 3300053130 Ga0500642_0070947 Ga0500642_0070947_691_1125 122
113 3300053151 Ga0500604_0070068 Ga0500604_0070068_639_1073 122
114 3300053726 Ga0500584_055439 Ga0500584_055439_712_1146 122
115 3300006178 Ga0075367_10087101 Ga0075367_100871012 123
116 3300025920 Ga0207649_10737776 Ga0207649_107377762 123
117 3300025960 Ga0207651_10217888 Ga0207651_102178882 123
118 3300031507 Ga0307509_10128511 Ga0307509_101285112 123
119 3300050496 nmdc:mga07m45_418293_c1 nmdc:mga07m45_418293_c1_309_731 123
120 3300005356 Ga0070674_100999724 Ga0070674_1009997241 124
121 3300005459 Ga0068867_100284181 Ga0068867_1002841812 124
122 3300005467 Ga0070706_100013624 Ga0070706_1000136245 124
123 3300005844 Ga0068862_100603560 Ga0068862_1006035602 124
124 3300009174 Ga0105241_11022846 Ga0105241_110228462 124
125 3300015262 Ga0182007_10189429 Ga0182007_101894292 124
126 3300025920 Ga0207649_10154052 Ga0207649_101540522 124
127 3300025933 Ga0207706_10004089 Ga0207706_100040899 124
128 3300025937 Ga0207669_10112485 Ga0207669_101124852 124
129 3300028380 Ga0268265_10207139 Ga0268265_102071392 124
130 3300035085 Ga0373929_0090021 Ga0373929_0090021_121_549 124
131 3300044658 Ga0466972_0009008 Ga0466972_0009008_2390_2812 124
132 3300044683 Ga0466965_0263412 Ga0466965_0263412_313_732 124
133 3300044706 Ga0466964_0273959 Ga0466964_0273959_157_579 124
134 3300046810 Ga0495660_0021946 Ga0495660_0021946_543_986 124
135 3300047320 Ga0495672_0000142 Ga0495672_0000142_49081_49524 124
136 3300050493 nmdc:mga0k408_17968_c1 nmdc:mga0k408_17968_c1_2823_3245 124
137 3300050496 nmdc:mga07m45_70331_c1 nmdc:mga07m45_70331_c1_343_777 124
138 3300005366 Ga0070659_100084714 Ga0070659_1000847144 125
139 3300005548 Ga0070665_100056462 Ga0070665_1000564626 125
140 3300005563 Ga0068855_100064421 Ga0068855_1000644214 125
141 3300005616 Ga0068852_100033409 Ga0068852_1000334096 125
142 3300005834 Ga0068851_10036008 Ga0068851_100360082 125
143 3300006358 Ga0068871_100014710 Ga0068871_1000147106 125
144 3300006358 Ga0068871_100330659 Ga0068871_1003306593 125
145 3300013296 Ga0157374_10075363 Ga0157374_100753634 125
146 3300013307 Ga0157372_11281337 Ga0157372_112813372 125
147 3300014968 Ga0157379_10107716 Ga0157379_101077164 125
148 3300014969 Ga0157376_10004653 Ga0157376_100046539 125
149 3300025321 Ga0207656_10083296 Ga0207656_100832962 125
150 3300025907 Ga0207645_10031533 Ga0207645_100315333 125
151 3300025927 Ga0207687_10430098 Ga0207687_104300982 125
152 3300025931 Ga0207644_10033398 Ga0207644_100333984 125
153 3300025932 Ga0207690_10268912 Ga0207690_102689122 125
154 3300025933 Ga0207706_10058771 Ga0207706_100587712 125
155 3300025941 Ga0207711_10006066 Ga0207711_100060666 125
156 3300025942 Ga0207689_10008328 Ga0207689_100083284 125
157 3300025981 Ga0207640_10216373 Ga0207640_102163732 125
158 3300026035 Ga0207703_10053412 Ga0207703_100534124 125
159 3300028379 Ga0268266_10740279 Ga0268266_107402792 125
160 3300031456 Ga0307513_10218597 Ga0307513_102185972 125
161 3300035115 Ga0373941_0061235 Ga0373941_0061235_195_626 125
162 3300035242 Ga0373962_0060087 Ga0373962_0060087_417_848 125
163 3300044658 Ga0466972_0059269 Ga0466972_0059269_1396_1818 125
164 3300044658 Ga0466972_0316178 Ga0466972_0316178_202_624 125
165 3300044683 Ga0466965_0030031 Ga0466965_0030031_1928_2350 125
166 3300044901 Ga0466960_0160039 Ga0466960_0160039_750_1172 125
167 3300046524 Ga0495648_0158085 Ga0495648_0158085_294_719 125
168 3300048909 Ga0496106_0092083 Ga0496106_0092083_1602_2027 125
169 3300048918 Ga0496115_0189893 Ga0496115_0189893_305_736 125
170 3300053730 Ga0500645_008014 Ga0500645_008014_3136_3561 125
171 3300005336 Ga0070680_100016692 Ga0070680_1000166923 126
172 3300005458 Ga0070681_10026267 Ga0070681_100262677 126
173 3300005530 Ga0070679_100028221 Ga0070679_1000282214 126
174 3300005614 Ga0068856_100945156 Ga0068856_1009451562 126
175 3300025912 Ga0207707_10108844 Ga0207707_101088442 126
176 3300025917 Ga0207660_10004601 Ga0207660_100046013 126
177 3300025919 Ga0207657_10982071 Ga0207657_109820712 126
178 3300025921 Ga0207652_10080840 Ga0207652_100808403 126
179 3300026078 Ga0207702_10758403 Ga0207702_107584032 126
180 3300046459 Ga0495629_0980435 Ga0495629_0980435_98_529 126
181 3300047315 Ga0495581_0138604 Ga0495581_0138604_849_1301 126
182 3300047444 Ga0495675_0200665 Ga0495675_0200665_739_1191 126
183 3300047673 Ga0495593_0007070 Ga0495593_0007070_1902_2354 126
184 3300049577 Ga0501041_0447632 Ga0501041_0447632_315_731 126
185 3300005295 Ga0065707_10107803 Ga0065707_101078032 127
186 3300005328 Ga0070676_10095269 Ga0070676_100952692 127
187 3300005328 Ga0070676_10222677 Ga0070676_102226772 127
188 3300005331 Ga0070670_100045928 Ga0070670_1000459283 127
189 3300005331 Ga0070670_100811054 Ga0070670_1008110541 127
190 3300005333 Ga0070677_10007539 Ga0070677_100075393 127
191 3300005334 Ga0068869_100772992 Ga0068869_1007729922 127
192 3300005334 Ga0068869_101050214 Ga0068869_1010502141 127
193 3300005340 Ga0070689_100674438 Ga0070689_1006744382 127
194 3300005353 Ga0070669_100014248 Ga0070669_1000142486 127
195 3300005353 Ga0070669_100037978 Ga0070669_1000379783 127
196 3300005354 Ga0070675_100011188 Ga0070675_1000111883 127
197 3300005355 Ga0070671_100036807 Ga0070671_1000368076 127
198 3300005356 Ga0070674_100005898 Ga0070674_1000058986 127
199 3300005356 Ga0070674_100186772 Ga0070674_1001867722 127
200 3300005364 Ga0070673_100030293 Ga0070673_1000302934 127
201 3300005365 Ga0070688_100387313 Ga0070688_1003873132 127
202 3300005367 Ga0070667_101309330 Ga0070667_1013093302 127
203 3300005455 Ga0070663_100351977 Ga0070663_1003519772 127
204 3300005455 Ga0070663_100524025 Ga0070663_1005240252 127
205 3300005456 Ga0070678_100009538 Ga0070678_1000095387 127
206 3300005456 Ga0070678_100009859 Ga0070678_1000098596 127
207 3300005459 Ga0068867_100003972 Ga0068867_1000039724 127
208 3300005459 Ga0068867_100006451 Ga0068867_1000064517 127
209 3300005459 Ga0068867_100012180 Ga0068867_1000121803 127
210 3300005539 Ga0068853_100525537 Ga0068853_1005255372 127
211 3300005543 Ga0070672_100014964 Ga0070672_1000149646 127
212 3300005544 Ga0070686_100630358 Ga0070686_1006303582 127
213 3300005616 Ga0068852_100294866 Ga0068852_1002948663 127
214 3300005617 Ga0068859_100027031 Ga0068859_1000270314 127
215 3300005617 Ga0068859_100083488 Ga0068859_1000834882 127
216 3300005618 Ga0068864_100069099 Ga0068864_1000690994 127
217 3300005718 Ga0068866_10010005 Ga0068866_100100052 127
218 3300005718 Ga0068866_10033904 Ga0068866_100339042 127
219 3300005719 Ga0068861_100001416 Ga0068861_10000141612 127
220 3300005841 Ga0068863_100970866 Ga0068863_1009708661 127
221 3300005842 Ga0068858_100073500 Ga0068858_1000735005 127
222 3300005843 Ga0068860_100000903 Ga0068860_10000090325 127
223 3300005843 Ga0068860_100372371 Ga0068860_1003723712 127
224 3300005844 Ga0068862_100007315 Ga0068862_1000073153 127
225 3300006237 Ga0097621_100098460 Ga0097621_1000984601 127
226 3300006358 Ga0068871_100049440 Ga0068871_1000494404 127
227 3300006358 Ga0068871_100051168 Ga0068871_1000511683 127
228 3300006881 Ga0068865_100003663 Ga0068865_1000036634 127
229 3300006931 Ga0097620_100027032 Ga0097620_1000270324 127
230 3300006931 Ga0097620_100083487 Ga0097620_1000834873 127
231 3300009177 Ga0105248_10112431 Ga0105248_101124314 127
232 3300013296 Ga0157374_10954611 Ga0157374_109546112 127
233 3300013297 Ga0157378_10345680 Ga0157378_103456802 127
234 3300013306 Ga0163162_10040290 Ga0163162_100402902 127
235 3300013306 Ga0163162_10154852 Ga0163162_101548522 127
236 3300013306 Ga0163162_11211092 Ga0163162_112110922 127
237 3300013308 Ga0157375_10065030 Ga0157375_100650302 127
238 3300013308 Ga0157375_10616094 Ga0157375_106160942 127
239 3300014326 Ga0157380_10007364 Ga0157380_100073645 127
240 3300014326 Ga0157380_10013785 Ga0157380_100137856 127
241 3300014968 Ga0157379_10023168 Ga0157379_100231683 127
242 3300014968 Ga0157379_10089602 Ga0157379_100896022 127
243 3300014969 Ga0157376_10079761 Ga0157376_100797613 127
244 3300014969 Ga0157376_10202284 Ga0157376_102022842 127
245 3300014969 Ga0157376_10305066 Ga0157376_103050662 127
246 3300017792 Ga0163161_10021914 Ga0163161_100219145 127
247 3300017792 Ga0163161_10232114 Ga0163161_102321142 127
248 3300025893 Ga0207682_10001255 Ga0207682_100012555 127
249 3300025893 Ga0207682_10297195 Ga0207682_102971952 127
250 3300025899 Ga0207642_10025093 Ga0207642_100250932 127
251 3300025899 Ga0207642_10075539 Ga0207642_100755392 127
252 3300025907 Ga0207645_10128376 Ga0207645_101283762 127
253 3300025907 Ga0207645_10219054 Ga0207645_102190542 127
254 3300025923 Ga0207681_10037994 Ga0207681_100379942 127
255 3300025923 Ga0207681_10043789 Ga0207681_100437895 127
256 3300025925 Ga0207650_10019962 Ga0207650_100199626 127
257 3300025926 Ga0207659_10217458 Ga0207659_102174582 127
258 3300025931 Ga0207644_10053041 Ga0207644_100530413 127
259 3300025933 Ga0207706_10438292 Ga0207706_104382922 127
260 3300025936 Ga0207670_10737083 Ga0207670_107370832 127
261 3300025938 Ga0207704_10005537 Ga0207704_100055374 127
262 3300025940 Ga0207691_10011878 Ga0207691_100118788 127
263 3300025942 Ga0207689_10442637 Ga0207689_104426372 127
264 3300025945 Ga0207679_10162791 Ga0207679_101627912 127
265 3300025960 Ga0207651_10198999 Ga0207651_101989992 127
266 3300025960 Ga0207651_12023631 Ga0207651_120236311 127
267 3300025986 Ga0207658_11037347 Ga0207658_110373472 127
268 3300026023 Ga0207677_10211222 Ga0207677_102112222 127
269 3300026023 Ga0207677_11054321 Ga0207677_110543212 127
270 3300026035 Ga0207703_10141302 Ga0207703_101413022 127
271 3300026035 Ga0207703_10476025 Ga0207703_104760252 127
272 3300026067 Ga0207678_10259657 Ga0207678_102596572 127
273 3300026067 Ga0207678_10407539 Ga0207678_104075392 127
274 3300026088 Ga0207641_10100139 Ga0207641_101001392 127
275 3300026089 Ga0207648_10010128 Ga0207648_100101288 127
276 3300026089 Ga0207648_10024243 Ga0207648_100242437 127
277 3300026095 Ga0207676_10080135 Ga0207676_100801353 127
278 3300026118 Ga0207675_100005766 Ga0207675_10000576610 127
279 3300026121 Ga0207683_10007938 Ga0207683_100079386 127
280 3300026121 Ga0207683_10215090 Ga0207683_102150902 127
281 3300028380 Ga0268265_10180418 Ga0268265_101804183 127
282 3300028381 Ga0268264_10008380 Ga0268264_100083808 127
283 3300028381 Ga0268264_10521151 Ga0268264_105211511 127
284 3300035089 Ga0373944_0061421 Ga0373944_0061421_675_1103 127
285 3300035115 Ga0373941_0462326 Ga0373941_0462326_17_445 127
286 3300035170 Ga0373943_0969621 Ga0373943_0969621_33_461 127
287 3300035695 Ga0373927_0009397 Ga0373927_0009397_1973_2401 127
288 3300037068 Ga0373925_0001850 Ga0373925_0001850_7649_8077 127
289 3300037471 Ga0395905_0018255 Ga0395905_0018255_4800_5228 127
290 3300046477 Ga0495664_0225997 Ga0495664_0225997_606_1034 127
291 3300046516 Ga0495628_0212869 Ga0495628_0212869_217_651 127
292 3300046535 Ga0495586_0068372 Ga0495586_0068372_278_706 127
293 3300046558 Ga0495633_0186950 Ga0495633_0186950_340_768 127
294 3300046674 Ga0495588_0017071 Ga0495588_0017071_64_519 127
295 3300047321 Ga0495676_0069412 Ga0495676_0069412_1017_1451 127
296 3300049572 Ga0501036_0833410 Ga0501036_0833410_293_721 127
297 3300049577 Ga0501041_0955430 Ga0501041_0955430_70_498 127
298 3300049741 Ga0501079_0175184 Ga0501079_0175184_1139_1567 127
299 3300003322 rootL2_10031669 rootL2_100316694 128
300 3300005354 Ga0070675_100104159 Ga0070675_1001041592 128
301 3300005455 Ga0070663_100006532 Ga0070663_1000065328 128
302 3300005616 Ga0068852_100063334 Ga0068852_1000633345 128
303 3300005617 Ga0068859_101077292 Ga0068859_1010772922 128
304 3300005844 Ga0068862_101903787 Ga0068862_1019037871 128
305 3300005937 Ga0081455_10154969 Ga0081455_101549692 128
306 3300006931 Ga0097620_101077262 Ga0097620_1010772622 128
307 3300009176 Ga0105242_10365056 Ga0105242_103650562 128
308 3300013105 Ga0157369_11075203 Ga0157369_110752032 128
309 3300013296 Ga0157374_10091458 Ga0157374_100914583 128
310 3300013297 Ga0157378_11279228 Ga0157378_112792281 128
311 3300025923 Ga0207681_10868202 Ga0207681_108682021 128
312 3300025926 Ga0207659_10302321 Ga0207659_103023212 128
313 3300026067 Ga0207678_10003169 Ga0207678_100031695 128
314 3300026142 Ga0207698_10042094 Ga0207698_100420942 128
315 3300027364 Ga0209967_1001211 Ga0209967_10012112 128
316 3300027462 Ga0210000_1002227 Ga0210000_10022272 128
317 3300027471 Ga0209995_1014917 Ga0209995_10149172 128
318 3300027543 Ga0209999_1023219 Ga0209999_10232192 128
319 3300028380 Ga0268265_11675532 Ga0268265_116755321 128
320 3300005331 Ga0070670_100156245 Ga0070670_1001562452 129
321 3300005333 Ga0070677_10269223 Ga0070677_102692232 129
322 3300005354 Ga0070675_100053943 Ga0070675_1000539433 129
323 3300005364 Ga0070673_100048345 Ga0070673_1000483452 129
324 3300005467 Ga0070706_100061300 Ga0070706_1000613004 129
325 3300006195 Ga0075366_10069763 Ga0075366_100697634 129
326 3300015262 Ga0182007_10127552 Ga0182007_101275521 129
327 3300025893 Ga0207682_10229071 Ga0207682_102290712 129
328 3300025925 Ga0207650_10010814 Ga0207650_100108147 129
329 3300025945 Ga0207679_10593518 Ga0207679_105935182 129
330 3300025960 Ga0207651_10134791 Ga0207651_101347912 129
331 3300026067 Ga0207678_10082037 Ga0207678_100820372 129
332 3300026116 Ga0207674_10091585 Ga0207674_100915854 129
333 3300028786 Ga0307517_10147490 Ga0307517_101474902 129
334 3300031548 Ga0307408_100461417 Ga0307408_1004614172 129
335 3300031730 Ga0307516_10312345 Ga0307516_103123452 129
336 3300031852 Ga0307410_10414646 Ga0307410_104146462 129
337 3300032002 Ga0307416_100426917 Ga0307416_1004269172 129
338 3300038443 Ga0395901_0961672 Ga0395901_0961672_317_766 129
339 3300041997 Ga0439431_0006166 Ga0439431_0006166_1273_1704 129
340 3300042007 Ga0439449_0070323 Ga0439449_0070323_845_1270 129
341 3300042134 Ga0450898_026984 Ga0450898_026984_11_436 129
342 3300042134 Ga0450898_084618 Ga0450898_084618_155_586 129
343 3300049526 Ga0501303_017177 Ga0501303_017177_43_468 129
344 3300049779 Ga0501283_028357 Ga0501283_028357_257_682 129
345 3300050493 nmdc:mga0k408_167711_c1 nmdc:mga0k408_167711_c1_202_630 129
346 3300053108 Ga0500562_031435 Ga0500562_031435_616_1050 129
347 3300005334 Ga0068869_100036690 Ga0068869_1000366904 130
348 3300005339 Ga0070660_100061600 Ga0070660_1000616004 130
349 3300005344 Ga0070661_100211037 Ga0070661_1002110372 130
350 3300005354 Ga0070675_100002690 Ga0070675_10000269010 130
351 3300005355 Ga0070671_100038300 Ga0070671_1000383002 130
352 3300005455 Ga0070663_100292332 Ga0070663_1002923322 130
353 3300005457 Ga0070662_100116572 Ga0070662_1001165723 130
354 3300005539 Ga0068853_100066374 Ga0068853_1000663742 130
355 3300005564 Ga0070664_100618262 Ga0070664_1006182622 130
356 3300005577 Ga0068857_100729936 Ga0068857_1007299362 130
357 3300005618 Ga0068864_100009238 Ga0068864_1000092384 130
358 3300005719 Ga0068861_100005119 Ga0068861_1000051198 130
359 3300005841 Ga0068863_102153713 Ga0068863_1021537131 130
360 3300005844 Ga0068862_100100036 Ga0068862_1001000362 130
361 3300006237 Ga0097621_100293346 Ga0097621_1002933462 130
362 3300007076 Ga0075435_101387957 Ga0075435_1013879571 130
363 3300009098 Ga0105245_10036044 Ga0105245_100360442 130
364 3300009177 Ga0105248_10027182 Ga0105248_100271822 130
365 3300009551 Ga0105238_10108100 Ga0105238_101081004 130
366 3300009553 Ga0105249_10572519 Ga0105249_105725192 130
367 3300010375 Ga0105239_10785653 Ga0105239_107856532 130
368 3300017792 Ga0163161_10180987 Ga0163161_101809871 130
369 3300025901 Ga0207688_10005290 Ga0207688_100052907 130
370 3300025919 Ga0207657_10084454 Ga0207657_100844542 130
371 3300025920 Ga0207649_10028943 Ga0207649_100289432 130
372 3300025923 Ga0207681_10061997 Ga0207681_100619972 130
373 3300025926 Ga0207659_10030843 Ga0207659_100308435 130
374 3300025927 Ga0207687_10008809 Ga0207687_100088098 130
375 3300025944 Ga0207661_10840130 Ga0207661_108401301 130
376 3300025972 Ga0207668_10275466 Ga0207668_102754662 130
377 3300026023 Ga0207677_10004412 Ga0207677_100044128 130
378 3300026041 Ga0207639_10085207 Ga0207639_100852073 130
379 3300026067 Ga0207678_10027797 Ga0207678_100277975 130
380 3300026088 Ga0207641_10119259 Ga0207641_101192593 130
381 3300026095 Ga0207676_10009240 Ga0207676_100092405 130
382 3300026118 Ga0207675_100001125 Ga0207675_10000112512 130
383 3300028380 Ga0268265_10175003 Ga0268265_101750032 130
384 3300034820 Ga0373959_0049269 Ga0373959_0049269_13_444 130
385 3300035691 Ga0373931_0006809 Ga0373931_0006809_1686_2117 130
386 3300037068 Ga0373925_0497099 Ga0373925_0497099_504_932 130
387 3300046539 Ga0495621_0003510 Ga0495621_0003510_2294_2731 130
388 3300048903 Ga0496100_0091449 Ga0496100_0091449_1273_1704 130
389 3300048904 Ga0496101_0818837 Ga0496101_0818837_26_454 130
390 3300048905 Ga0496102_0040492 Ga0496102_0040492_3632_4063 130
391 3300048907 Ga0496104_0031258 Ga0496104_0031258_1342_1770 130
392 3300048907 Ga0496104_0308104 Ga0496104_0308104_764_1195 130
393 3300048908 Ga0496105_0115503 Ga0496105_0115503_1376_1804 130
394 3300048909 Ga0496106_0206902 Ga0496106_0206902_805_1236 130
395 3300048910 Ga0496107_0145371 Ga0496107_0145371_223_654 130
396 3300048911 Ga0496108_0148228 Ga0496108_0148228_663_1094 130
397 3300048912 Ga0496109_0103067 Ga0496109_0103067_2001_2432 130
398 3300048913 Ga0496110_0317709 Ga0496110_0317709_411_842 130
399 3300048916 Ga0496113_0358311 Ga0496113_0358311_83_514 130
400 3300048917 Ga0496114_0017437 Ga0496114_0017437_4002_4433 130
401 3300050513 nmdc:mga0rr50_1435808_c1 nmdc:mga0rr50_1435808_c1_79_510 130
402 3300053138 Ga0500564_124046 Ga0500564_124046_670_1089 130
403 3300005365 Ga0070688_100723293 Ga0070688_1007232932 131
404 3300014326 Ga0157380_10833381 Ga0157380_108333812 131
405 3300025986 Ga0207658_10962500 Ga0207658_109625002 131
406 3300028666 Ga0265336_10000051 Ga0265336_1000005134 131
407 3300029957 Ga0265324_10000292 Ga0265324_100002924 131
408 3300031344 Ga0265316_10000299 Ga0265316_100002995 131
409 iso_pu_bacteria 2600255292 2601669595 131
410 iso_pu_bacteria 2643221544 2643742287 131
411 iso_pu_bacteria 2643221585 2643937108 131
412 iso_pu_bacteria 2643221603 2644030419 131
413 iso_pu_bacteria 2643221639 2644217914 131
414 iso_pu_bacteria 2643221646 2644258344 131
415 iso_pu_bacteria 2643221656 2644318273 131
416 iso_pu_bacteria 2738541337 2739057000 131
417 iso_pu_bacteria 2857547612 2857549717 131
418 3300005327 Ga0070658_10037732 Ga0070658_100377322 132
419 3300005328 Ga0070676_10726973 Ga0070676_107269731 132
420 3300005563 Ga0068855_100194335 Ga0068855_1001943354 132
421 3300006195 Ga0075366_10506264 Ga0075366_105062642 132
422 3300025253 Ga0209677_102569 Ga0209677_1025696 132
423 3300025949 Ga0207667_11091962 Ga0207667_110919621 132
424 3300031730 Ga0307516_10001369 Ga0307516_1000136912 132
425 3300037471 Ga0395905_0013220 Ga0395905_0013220_5742_6203 132
426 3300044712 Ga0453684_0047302 Ga0453684_0047302_2628_3050 132
427 3300046475 Ga0495639_0047800 Ga0495639_0047800_653_1078 132
428 3300046511 Ga0495608_0747823 Ga0495608_0747823_13_438 132
429 3300046529 Ga0495652_0692160 Ga0495652_0692160_195_620 132
430 3300050493 nmdc:mga0k408_432820_c1 nmdc:mga0k408_432820_c1_178_609 132
431 iso_pu_bacteria 2738541297 2738827181 132
432 iso_pu_bacteria 2738541357 2739150978 132
433 iso_pu_bacteria 2738543003 2739192897 132
434 iso_pu_bacteria 2738543026 2739319374 132
435 iso_pu_bacteria 2738543029 2739337615 132
436 iso_pu_bacteria 2821131069 2821134538 132
437 iso_pu_bacteria 2842711865 2842715045 132
438 iso_pu_bacteria 2857553236 2857557133 132
439 iso_pu_bacteria 2857558681 2857560562 132
440 iso_pu_bacteria 2857564685 2857570061 132
441 iso_pu_bacteria 2885080285 2885082327 132
442 iso_pu_bacteria 2904424332 2904430318 132
443 iso_pu_bacteria 2919476304 2919480887 132
444 iso_pu_bacteria 2932410948 2932415799 132
445 iso_pu_bacteria 2932416698 2932421789 132
446 3300002705 JGI25156J39149_1000114 JGI25156J39149_10001145 133
447 3300002738 JGI25154J39366_1002215 JGI25154J39366_10022151 133
448 3300002741 JGI25157J39369_1000015 JGI25157J39369_1000015159 133
449 3300003752 Ga0055539_1000967 Ga0055539_10009674 133
450 3300003761 Ga0055535_1006711 Ga0055535_10067111 133
451 3300003763 Ga0055529_1000303 Ga0055529_100030318 133
452 3300005330 Ga0070690_100001536 Ga0070690_1000015369 133
453 3300005337 Ga0070682_100303495 Ga0070682_1003034952 133
454 3300005356 Ga0070674_101106421 Ga0070674_1011064211 133
455 3300005364 Ga0070673_100171447 Ga0070673_1001714472 133
456 3300005367 Ga0070667_100591749 Ga0070667_1005917492 133
457 3300005455 Ga0070663_101026899 Ga0070663_1010268991 133
458 3300005456 Ga0070678_100557878 Ga0070678_1005578782 133
459 3300005459 Ga0068867_100221025 Ga0068867_1002210252 133
460 3300005466 Ga0070685_10991557 Ga0070685_109915571 133
461 3300005539 Ga0068853_100542851 Ga0068853_1005428512 133
462 3300005564 Ga0070664_100796299 Ga0070664_1007962992 133
463 3300005578 Ga0068854_100000903 Ga0068854_1000009038 133
464 3300005616 Ga0068852_100349956 Ga0068852_1003499562 133
465 3300005719 Ga0068861_100013239 Ga0068861_1000132395 133
466 3300005834 Ga0068851_10594962 Ga0068851_105949622 133
467 3300006195 Ga0075366_10023840 Ga0075366_100238404 133
468 3300009174 Ga0105241_10242877 Ga0105241_102428772 133
469 3300009176 Ga0105242_10269981 Ga0105242_102699812 133
470 3300009545 Ga0105237_10399046 Ga0105237_103990462 133
471 3300009551 Ga0105238_10003253 Ga0105238_100032539 133
472 3300010375 Ga0105239_10080637 Ga0105239_100806374 133
473 3300013105 Ga0157369_10049207 Ga0157369_100492073 133
474 3300013297 Ga0157378_10648722 Ga0157378_106487222 133
475 3300013307 Ga0157372_10601169 Ga0157372_106011692 133
476 3300013308 Ga0157375_10112570 Ga0157375_101125702 133
477 3300014745 Ga0157377_10586265 Ga0157377_105862651 133
478 3300025228 Ga0209672_113998 Ga0209672_1139982 133
479 3300025242 Ga0209258_100163 Ga0209258_10016384 133
480 3300025242 Ga0209258_100627 Ga0209258_1006277 133
481 3300025246 Ga0209646_1000138 Ga0209646_10001381 133
482 3300025250 Ga0209026_1000021 Ga0209026_1000021160 133
483 3300025253 Ga0209677_100817 Ga0209677_10081710 133
484 3300025256 Ga0209759_1000025 Ga0209759_1000025160 133
485 3300025256 Ga0209759_1001158 Ga0209759_10011583 133
486 3300025256 Ga0209759_1013130 Ga0209759_10131302 133
487 3300025272 Ga0209455_1000059 Ga0209455_1000059209 133
488 3300025919 Ga0207657_10020777 Ga0207657_100207774 133
489 3300025934 Ga0207686_10063522 Ga0207686_100635223 133
490 3300025940 Ga0207691_10272294 Ga0207691_102722942 133
491 3300025949 Ga0207667_10078788 Ga0207667_100787883 133
492 3300025960 Ga0207651_10013982 Ga0207651_100139822 133
493 3300026067 Ga0207678_10174309 Ga0207678_101743092 133
494 3300026078 Ga0207702_10000227 Ga0207702_1000022743 133
495 3300026089 Ga0207648_10074300 Ga0207648_100743002 133
496 3300026118 Ga0207675_100105822 Ga0207675_1001058223 133
497 3300027671 Ga0209588_1051553 Ga0209588_10515532 133
498 3300031507 Ga0307509_10351648 Ga0307509_103516482 133
499 3300035086 Ga0373934_0097225 Ga0373934_0097225_422_850 133
500 3300035691 Ga0373931_0904443 Ga0373931_0904443_130_558 133
501 3300037312 Ga0395899_0494725 Ga0395899_0494725_200_628 133
502 3300037466 Ga0395898_0070112 Ga0395898_0070112_2072_2500 133
503 3300038443 Ga0395901_0001733 Ga0395901_0001733_5510_5938 133
504 3300039450 Ga0436363_1606815 Ga0436363_1606815_27_458 133
505 3300044683 Ga0466965_0081903 Ga0466965_0081903_523_960 133
506 3300044684 Ga0466966_0048223 Ga0466966_0048223_1905_2342 133
507 3300044693 Ga0466961_0048858 Ga0466961_0048858_1257_1694 133
508 3300044706 Ga0466964_0189517 Ga0466964_0189517_461_898 133
509 3300044719 Ga0466971_0025492 Ga0466971_0025492_2007_2444 133
510 3300044735 Ga0466968_0032257 Ga0466968_0032257_1600_2037 133
511 3300044765 Ga0466970_0073793 Ga0466970_0073793_185_622 133
512 3300044842 Ga0466957_0102870 Ga0466957_0102870_424_861 133
513 3300044842 Ga0466957_1018496 Ga0466957_1018496_140_574 133
514 3300045049 Ga0466959_0112723 Ga0466959_0112723_1445_1882 133
515 3300045836 Ga0466958_0115744 Ga0466958_0115744_1123_1560 133
516 3300045976 Ga0466967_0505951 Ga0466967_0505951_534_971 133
517 3300046506 Ga0495583_0000284 Ga0495583_0000284_60228_60656 133
518 3300046507 Ga0495606_0010878 Ga0495606_0010878_4171_4599 133
519 3300046660 Ga0495625_0138509 Ga0495625_0138509_1161_1589 133
520 3300046684 Ga0495669_0027926 Ga0495669_0027926_679_1107 133
521 3300046694 Ga0495649_0040661 Ga0495649_0040661_1271_1699 133
522 3300046794 Ga0495589_0091798 Ga0495589_0091798_166_594 133
523 3300047323 Ga0495683_0116851 Ga0495683_0116851_143_571 133
524 3300048905 Ga0496102_1601529 Ga0496102_1601529_49_492 133
525 3300048929 Ga0496126_0565907 Ga0496126_0565907_50_481 133
526 3300050493 nmdc:mga0k408_48281_c1 nmdc:mga0k408_48281_c1_214_642 133
527 3300050496 nmdc:mga07m45_9841_c1 nmdc:mga07m45_9841_c1_4414_4842 133
528 3300053136 Ga0500559_0043745 Ga0500559_0043745_84_512 133
529 3300053177 Ga0500636_0088358 Ga0500636_0088358_144_572 133
530 3300055283 Ga0500661_003928 Ga0500661_003928_160_588 133
531 3300061719 Ga0466962_0033691 Ga0466962_0033691_1048_1485 133
532 iso_pu_bacteria 2643221556 2643800340 133
533 iso_pu_bacteria 2643221684 2644471880 133
534 iso_pu_bacteria 2808606418 2809142318 133
535 iso_pu_bacteria 8047673197 8047675198 133
536 3300003756 Ga0055533_1000010 Ga0055533_1000010135 134
537 3300003759 Ga0055525_1001452 Ga0055525_10014523 134
538 3300005327 Ga0070658_10026499 Ga0070658_100264992 134
539 3300005544 Ga0070686_100289447 Ga0070686_1002894472 134
540 3300005547 Ga0070693_100064607 Ga0070693_1000646072 134
541 3300006881 Ga0068865_100859153 Ga0068865_1008591532 134
542 3300006946 Ga0079104_1059468 Ga0079104_10594682 134
543 3300009148 Ga0105243_10435328 Ga0105243_104353282 134
544 3300025226 Ga0209674_100003 Ga0209674_1000031472 134
545 3300025230 Ga0209563_100010 Ga0209563_1000101199 134
546 3300025231 Ga0207427_104232 Ga0207427_1042322 134
547 3300025253 Ga0209677_100093 Ga0209677_10009354 134
548 3300025913 Ga0207695_10084675 Ga0207695_100846755 134
549 3300025935 Ga0207709_11175023 Ga0207709_111750232 134
550 3300031838 Ga0307518_10019478 Ga0307518_100194786 134
551 3300035724 Ga0373933_0043177 Ga0373933_0043177_1358_1777 134
552 3300039447 Ga0436361_0615018 Ga0436361_0615018_857_1303 134
553 3300041507 Ga0451851_0889618 Ga0451851_0889618_17_451 134
554 3300044672 Ga0466982_0034801 Ga0466982_0034801_1459_1881 134
555 3300046522 Ga0495643_0052450 Ga0495643_0052450_1325_1747 134
556 3300046694 Ga0495649_0110028 Ga0495649_0110028_424_846 134
557 3300047472 Ga0495686_0051556 Ga0495686_0051556_1597_2028 134
558 3300049459 Ga0495678_001248 Ga0495678_001248_3350_3793 134
559 iso_pu_bacteria 2643221644 2644247931 134
560 iso_pu_bacteria 2643221645 2644255300 134
561 iso_pu_bacteria 2919704043 2919704584 134
562 3300003323 rootH1_10010269 rootH1_100102692 135
563 3300003792 Ga0055540_1103473 Ga0055540_11034731 135
564 3300003794 Ga0055531_10000064 Ga0055531_1000006441 135
565 3300005337 Ga0070682_100050509 Ga0070682_1000505093 135
566 3300005614 Ga0068856_101153496 Ga0068856_1011534962 135
567 3300009148 Ga0105243_10138979 Ga0105243_101389792 135
568 3300013102 Ga0157371_10430578 Ga0157371_104305782 135
569 3300014497 Ga0182008_10001405 Ga0182008_1000140511 135
570 3300015261 Ga0182006_1000004 Ga0182006_1000004445 135
571 3300015262 Ga0182007_10000017 Ga0182007_1000001762 135
572 3300015265 Ga0182005_1000030 Ga0182005_1000030115 135
573 3300017792 Ga0163161_10104696 Ga0163161_101046964 135
574 3300021361 Ga0213872_10000127 Ga0213872_1000012718 135
575 3300025303 Ga0209051_1004022 Ga0209051_10040222 135
576 3300025303 Ga0209051_1011624 Ga0209051_10116242 135
577 3300025304 Ga0209257_1000032 Ga0209257_1000032560 135
578 3300025935 Ga0207709_10041325 Ga0207709_100413253 135
579 3300026078 Ga0207702_10250517 Ga0207702_102505172 135
580 3300027665 Ga0209983_1032993 Ga0209983_10329932 135
581 3300028794 Ga0307515_10102840 Ga0307515_101028403 135
582 3300031548 Ga0307408_100000010 Ga0307408_10000001025 135
583 3300031995 Ga0307409_100316229 Ga0307409_1003162292 135
584 3300032005 Ga0307411_10002067 Ga0307411_1000206711 135
585 3300035091 Ga0373951_0018674 Ga0373951_0018674_574_990 135
586 3300035114 Ga0373939_0000579 Ga0373939_0000579_4583_4999 135
587 3300035691 Ga0373931_0000228 Ga0373931_0000228_627_1043 135
588 3300037471 Ga0395905_0000676 Ga0395905_0000676_4341_4757 135
589 3300039447 Ga0436361_0144792 Ga0436361_0144792_14624_15037 135
590 3300041451 Ga0451791_1212493 Ga0451791_1212493_131_547 135
591 3300041460 Ga0451802_0610707 Ga0451802_0610707_16_432 135
592 3300041492 Ga0451835_1125194 Ga0451835_1125194_77_493 135
593 3300041494 Ga0451837_1627762 Ga0451837_1627762_84_500 135
594 3300041503 Ga0451847_0912814 Ga0451847_0912814_89_505 135
595 3300041512 Ga0451853_0907922 Ga0451853_0907922_239_655 135
596 3300042000 Ga0439437_000360 Ga0439437_000360_2415_2831 135
597 3300042117 Ga0450913_016161 Ga0450913_016161_141_557 135
598 3300042120 Ga0450917_000369 Ga0450917_000369_334_750 135
599 3300042126 Ga0450888_000895 Ga0450888_000895_1925_2341 135
600 3300042129 Ga0450891_000017 Ga0450891_000017_7318_7734 135
601 3300042138 Ga0450903_016707 Ga0450903_016707_611_1027 135
602 3300042156 Ga0439446_0282478 Ga0439446_0282478_149_565 135
603 3300042532 Ga0450893_0002946 Ga0450893_0002946_1144_1560 135
604 3300042533 Ga0450901_017537 Ga0450901_017537_209_625 135
605 3300044712 Ga0453684_0103481 Ga0453684_0103481_726_1142 135
606 3300044901 Ga0466960_0661791 Ga0466960_0661791_174_590 135
607 3300045051 Ga0451576_1458115 Ga0451576_1458115_220_636 135
608 3300046530 Ga0495654_0164605 Ga0495654_0164605_285_725 135
609 3300046557 Ga0495622_0027127 Ga0495622_0027127_884_1324 135
610 3300046558 Ga0495633_0000253 Ga0495633_0000253_32316_32756 135
611 3300048919 Ga0496116_0026975 Ga0496116_0026975_28_468 135
612 3300048920 Ga0496117_0000011 Ga0496117_0000011_484184_484624 135
613 3300048921 Ga0496118_0000010 Ga0496118_0000010_126307_126747 135
614 3300048924 Ga0496121_0020684 Ga0496121_0020684_5142_5582 135
615 3300048925 Ga0496122_0000691 Ga0496122_0000691_61954_62394 135
616 3300048926 Ga0496123_0003602 Ga0496123_0003602_13459_13899 135
617 3300048928 Ga0496125_0052557 Ga0496125_0052557_1361_1801 135
618 3300049460 Ga0495682_0002194 Ga0495682_0002194_2142_2582 135
619 3300049514 Ga0501291_003206 Ga0501291_003206_118_534 135
620 3300049520 Ga0501297_008226 Ga0501297_008226_260_676 135
621 3300049523 Ga0501300_011751 Ga0501300_011751_389_805 135
622 3300049524 Ga0501301_018626 Ga0501301_018626_60_476 135
623 3300049530 Ga0501314_002322 Ga0501314_002322_1017_1433 135
624 3300049652 Ga0501202_077752 Ga0501202_077752_316_732 135
625 3300049657 Ga0501210_006741 Ga0501210_006741_276_692 135
626 3300049658 Ga0501211_000342 Ga0501211_000342_1573_1989 135
627 3300049662 Ga0501222_001535 Ga0501222_001535_1894_2310 135
628 3300049663 Ga0501223_007317 Ga0501223_007317_476_892 135
629 3300049665 Ga0501227_060815 Ga0501227_060815_190_606 135
630 3300049668 Ga0501233_013732 Ga0501233_013732_767_1183 135
631 3300049669 Ga0501235_006749 Ga0501235_006749_12_428 135
632 3300049686 Ga0501257_089156 Ga0501257_089156_302_718 135
633 3300049687 Ga0501258_003044 Ga0501258_003044_1024_1440 135
634 3300049704 Ga0501221_019756 Ga0501221_019756_457_873 135
635 3300049706 Ga0501229_002483 Ga0501229_002483_1610_2026 135
636 3300049759 Ga0501262_033377 Ga0501262_033377_309_725 135
637 3300049761 Ga0501264_014637 Ga0501264_014637_326_742 135
638 3300049769 Ga0501272_010980 Ga0501272_010980_517_933 135
639 3300049779 Ga0501283_059939 Ga0501283_059939_174_590 135
640 iso_pu_bacteria 2643221654 2644304505 135
641 3300002738 JGI25154J39366_1003246 JGI25154J39366_10032463 136
642 3300002774 JGI25150J39212_1014060 JGI25150J39212_10140602 136
643 3300003215 JGI25153J46596_10017655 JGI25153J46596_100176552 136
644 3300003320 rootH2_10058683 rootH2_100586831 136
645 3300003762 Ga0055542_1019745 Ga0055542_10197451 136
646 3300003763 Ga0055529_1000100 Ga0055529_100010053 136
647 3300003771 Ga0055526_1000010 Ga0055526_1000010124 136
648 3300003771 Ga0055526_1000104 Ga0055526_100010424 136
649 3300003775 Ga0055524_1005355 Ga0055524_10053552 136
650 3300004625 Ga0055543_1049002 Ga0055543_10490021 136
651 3300005262 Ga0065165_1000074 Ga0065165_100007443 136
652 3300005328 Ga0070676_10155113 Ga0070676_101551132 136
653 3300005331 Ga0070670_101519250 Ga0070670_1015192501 136
654 3300005336 Ga0070680_100835370 Ga0070680_1008353702 136
655 3300005353 Ga0070669_100106693 Ga0070669_1001066934 136
656 3300005354 Ga0070675_100048103 Ga0070675_1000481033 136
657 3300005355 Ga0070671_100219491 Ga0070671_1002194912 136
658 3300005455 Ga0070663_100280802 Ga0070663_1002808022 136
659 3300006048 Ga0075363_100191580 Ga0075363_1001915802 136
660 3300006177 Ga0075362_10162763 Ga0075362_101627632 136
661 3300006195 Ga0075366_10820974 Ga0075366_108209741 136
662 3300006195 Ga0075366_10975405 Ga0075366_109754051 136
663 3300006353 Ga0075370_10498900 Ga0075370_104989002 136
664 3300006353 Ga0075370_10647199 Ga0075370_106471992 136
665 3300006946 Ga0079104_1000273 Ga0079104_100027320 136
666 3300006946 Ga0079104_1003849 Ga0079104_10038496 136
667 3300009036 Ga0105244_10002947 Ga0105244_1000294714 136
668 3300009036 Ga0105244_10004312 Ga0105244_100043124 136
669 3300009036 Ga0105244_10280324 Ga0105244_102803241 136
670 3300009094 Ga0111539_10941517 Ga0111539_109415172 136
671 3300009177 Ga0105248_10498071 Ga0105248_104980712 136
672 3300013105 Ga0157369_11119535 Ga0157369_111195351 136
673 3300013307 Ga0157372_10986112 Ga0157372_109861122 136
674 3300014497 Ga0182008_10388828 Ga0182008_103888282 136
675 3300015261 Ga0182006_1000176 Ga0182006_100017611 136
676 3300015265 Ga0182005_1000005 Ga0182005_1000005350 136
677 3300017792 Ga0163161_10020753 Ga0163161_100207533 136
678 3300021361 Ga0213872_10000035 Ga0213872_1000003553 136
679 3300021361 Ga0213872_10000160 Ga0213872_1000016055 136
680 3300021361 Ga0213872_10000683 Ga0213872_1000068310 136
681 3300021361 Ga0213872_10018814 Ga0213872_100188142 136
682 3300021361 Ga0213872_10028189 Ga0213872_100281892 136
683 3300021361 Ga0213872_10158072 Ga0213872_101580722 136
684 3300025245 Ga0207425_1000376 Ga0207425_100037631 136
685 3300025246 Ga0209646_1000036 Ga0209646_1000036128 136
686 3300025263 Ga0209565_1011943 Ga0209565_10119432 136
687 3300025272 Ga0209455_1000047 Ga0209455_1000047251 136
688 3300025291 Ga0209675_1012938 Ga0209675_10129382 136
689 3300025294 Ga0209025_1004584 Ga0209025_10045847 136
690 3300025295 Ga0209564_1000060 Ga0209564_1000060165 136
691 3300025295 Ga0209564_1000141 Ga0209564_100014146 136
692 3300025297 Ga0209758_1000941 Ga0209758_100094136 136
693 3300025299 Ga0209256_1000024 Ga0209256_100002475 136
694 3300025728 Ga0207655_1022557 Ga0207655_10225573 136
695 3300025728 Ga0207655_1024930 Ga0207655_10249304 136
696 3300025923 Ga0207681_10032182 Ga0207681_100321822 136
697 3300025931 Ga0207644_10196003 Ga0207644_101960032 136
698 3300025940 Ga0207691_10057109 Ga0207691_100571094 136
699 3300025941 Ga0207711_11612572 Ga0207711_116125721 136
700 3300025961 Ga0207712_10219856 Ga0207712_102198562 136
701 3300026023 Ga0207677_11257016 Ga0207677_112570162 136
702 3300026121 Ga0207683_10295538 Ga0207683_102955382 136
703 3300027111 Ga0209281_1000416 Ga0209281_100041646 136
704 3300027111 Ga0209281_1050051 Ga0209281_10500511 136
705 3300028794 Ga0307515_10000416 Ga0307515_1000041681 136
706 3300028794 Ga0307515_10000645 Ga0307515_1000064543 136
707 3300028794 Ga0307515_10001163 Ga0307515_1000116352 136
708 3300028794 Ga0307515_10004048 Ga0307515_1000404826 136
709 3300028794 Ga0307515_10181532 Ga0307515_101815322 136
710 3300030744 Ga0316181_1032650 Ga0316181_10326501 136
711 3300031456 Ga0307513_10024348 Ga0307513_100243483 136
712 3300031507 Ga0307509_10108307 Ga0307509_101083073 136
713 3300031616 Ga0307508_10000047 Ga0307508_1000004724 136
714 3300031649 Ga0307514_10017955 Ga0307514_100179553 136
715 3300031711 Ga0265314_10062809 Ga0265314_100628094 136
716 3300031730 Ga0307516_10005900 Ga0307516_1000590017 136
717 3300031731 Ga0307405_10191108 Ga0307405_101911082 136
718 3300031852 Ga0307410_10559137 Ga0307410_105591372 136
719 3300032004 Ga0307414_10158522 Ga0307414_101585222 136
720 3300032005 Ga0307411_10268406 Ga0307411_102684062 136
721 3300039447 Ga0436361_0048643 Ga0436361_0048643_2473_2889 136
722 3300039447 Ga0436361_0053671 Ga0436361_0053671_8570_9004 136
723 3300039447 Ga0436361_0071334 Ga0436361_0071334_27422_27856 136
724 3300039447 Ga0436361_0362312 Ga0436361_0362312_34306_34722 136
725 3300039447 Ga0436361_0588758 Ga0436361_0588758_811_1227 136
726 3300039447 Ga0436361_0749269 Ga0436361_0749269_2473_2889 136
727 3300041408 Ga0439453_0015160 Ga0439453_0015160_587_1003 136
728 3300042121 Ga0450919_004025 Ga0450919_004025_916_1335 136
729 3300042122 Ga0450920_014429 Ga0450920_014429_757_1176 136
730 3300042126 Ga0450888_013430 Ga0450888_013430_345_767 136
731 3300042132 Ga0450895_006529 Ga0450895_006529_105_521 136
732 3300042134 Ga0450898_015726 Ga0450898_015726_776_1192 136
733 3300042156 Ga0439446_0237398 Ga0439446_0237398_74_493 136
734 3300042531 Ga0450918_000764 Ga0450918_000764_4189_4608 136
735 3300044712 Ga0453684_0428150 Ga0453684_0428150_1006_1428 136
736 3300044842 Ga0466957_0006839 Ga0466957_0006839_2468_2896 136
737 3300046452 Ga0495617_000005 Ga0495617_000005_125695_126129 136
738 3300046452 Ga0495617_004468 Ga0495617_004468_4131_4565 136
739 3300046452 Ga0495617_085770 Ga0495617_085770_108_542 136
740 3300046453 Ga0495627_000038 Ga0495627_000038_60852_61286 136
741 3300046457 Ga0495590_0000031 Ga0495590_0000031_43722_44156 136
742 3300046457 Ga0495590_0006069 Ga0495590_0006069_4091_4543 136
743 3300046460 Ga0495638_0000101 Ga0495638_0000101_40061_40495 136
744 3300046460 Ga0495638_0068193 Ga0495638_0068193_1246_1680 136
745 3300046460 Ga0495638_0078354 Ga0495638_0078354_1440_1880 136
746 3300046460 Ga0495638_0296595 Ga0495638_0296595_170_604 136
747 3300046460 Ga0495638_0438618 Ga0495638_0438618_10_453 136
748 3300046463 Ga0495653_0000031 Ga0495653_0000031_73852_74286 136
749 3300046471 Ga0495650_0000230 Ga0495650_0000230_44287_44721 136
750 3300046471 Ga0495650_0000274 Ga0495650_0000274_37230_37673 136
751 3300046471 Ga0495650_0000288 Ga0495650_0000288_7417_7857 136
752 3300046471 Ga0495650_0000504 Ga0495650_0000504_45701_46135 136
753 3300046474 Ga0495605_0000071 Ga0495605_0000071_51860_52294 136
754 3300046474 Ga0495605_0050343 Ga0495605_0050343_361_813 136
755 3300046492 Ga0495585_0000919 Ga0495585_0000919_4236_4688 136
756 3300046492 Ga0495585_0006598 Ga0495585_0006598_2207_2641 136
757 3300046492 Ga0495585_0092763 Ga0495585_0092763_1127_1579 136
758 3300046492 Ga0495585_0113717 Ga0495585_0113717_30_482 136
759 3300046499 Ga0495594_0107383 Ga0495594_0107383_686_1138 136
760 3300046501 Ga0495607_0006283 Ga0495607_0006283_3918_4361 136
761 3300046501 Ga0495607_0018599 Ga0495607_0018599_527_961 136
762 3300046501 Ga0495607_0083828 Ga0495607_0083828_974_1408 136
763 3300046501 Ga0495607_0215458 Ga0495607_0215458_338_790 136
764 3300046506 Ga0495583_0000194 Ga0495583_0000194_20504_20938 136
765 3300046507 Ga0495606_0000077 Ga0495606_0000077_33247_33681 136
766 3300046507 Ga0495606_0000133 Ga0495606_0000133_74569_75003 136
767 3300046507 Ga0495606_0000474 Ga0495606_0000474_29855_30298 136
768 3300046507 Ga0495606_0001180 Ga0495606_0001180_4547_4981 136
769 3300046507 Ga0495606_0001442 Ga0495606_0001442_12284_12724 136
770 3300046507 Ga0495606_0006254 Ga0495606_0006254_279_713 136
771 3300046507 Ga0495606_0006540 Ga0495606_0006540_3837_4271 136
772 3300046512 Ga0495610_0009405 Ga0495610_0009405_2788_3222 136
773 3300046512 Ga0495610_0016768 Ga0495610_0016768_3728_4162 136
774 3300046512 Ga0495610_0043657 Ga0495610_0043657_1057_1491 136
775 3300046512 Ga0495610_0078844 Ga0495610_0078844_657_1091 136
776 3300046512 Ga0495610_0095798 Ga0495610_0095798_352_786 136
777 3300046513 Ga0495616_0000048 Ga0495616_0000048_34264_34704 136
778 3300046513 Ga0495616_0292678 Ga0495616_0292678_146_586 136
779 3300046513 Ga0495616_0334098 Ga0495616_0334098_134_574 136
780 3300046517 Ga0495630_0654721 Ga0495630_0654721_286_738 136
781 3300046520 Ga0495637_0003644 Ga0495637_0003644_4770_5204 136
782 3300046520 Ga0495637_0022638 Ga0495637_0022638_2020_2454 136
783 3300046522 Ga0495643_0000115 Ga0495643_0000115_77700_78134 136
784 3300046522 Ga0495643_0000204 Ga0495643_0000204_21175_21609 136
785 3300046522 Ga0495643_0062241 Ga0495643_0062241_355_807 136
786 3300046522 Ga0495643_0293703 Ga0495643_0293703_125_559 136
787 3300046523 Ga0495644_0043410 Ga0495644_0043410_998_1432 136
788 3300046524 Ga0495648_0000089 Ga0495648_0000089_74274_74708 136
789 3300046524 Ga0495648_0034766 Ga0495648_0034766_2745_3179 136
790 3300046524 Ga0495648_0076691 Ga0495648_0076691_27_461 136
791 3300046525 Ga0495663_0348303 Ga0495663_0348303_21_458 136
792 3300046528 Ga0495642_0005832 Ga0495642_0005832_2619_3053 136
793 3300046528 Ga0495642_0191297 Ga0495642_0191297_22_462 136
794 3300046530 Ga0495654_0000047 Ga0495654_0000047_91230_91664 136
795 3300046530 Ga0495654_0108211 Ga0495654_0108211_416_850 136
796 3300046538 Ga0495609_0027835 Ga0495609_0027835_698_1132 136
797 3300046538 Ga0495609_0045080 Ga0495609_0045080_403_837 136
798 3300046538 Ga0495609_0129507 Ga0495609_0129507_626_1060 136
799 3300046542 Ga0495597_0000246 Ga0495597_0000246_44474_44908 136
800 3300046542 Ga0495597_0004503 Ga0495597_0004503_6071_6505 136
801 3300046542 Ga0495597_0218038 Ga0495597_0218038_193_645 136
802 3300046557 Ga0495622_0000015 Ga0495622_0000015_65062_65502 136
803 3300046557 Ga0495622_0000598 Ga0495622_0000598_700_1134 136
804 3300046558 Ga0495633_0000110 Ga0495633_0000110_29589_30029 136
805 3300046558 Ga0495633_0000189 Ga0495633_0000189_19939_20373 136
806 3300046558 Ga0495633_0003539 Ga0495633_0003539_4869_5303 136
807 3300046558 Ga0495633_0024369 Ga0495633_0024369_75_527 136
808 3300046558 Ga0495633_0027835 Ga0495633_0027835_668_1102 136
809 3300046558 Ga0495633_0077901 Ga0495633_0077901_601_1035 136
810 3300046616 Ga0495668_0000064 Ga0495668_0000064_55029_55463 136
811 3300046616 Ga0495668_0000245 Ga0495668_0000245_42064_42498 136
812 3300046616 Ga0495668_0001415 Ga0495668_0001415_22151_22585 136
813 3300046616 Ga0495668_0001765 Ga0495668_0001765_5443_5877 136
814 3300046616 Ga0495668_0574453 Ga0495668_0574453_130_582 136
815 3300046660 Ga0495625_0000188 Ga0495625_0000188_19868_20302 136
816 3300046660 Ga0495625_0001292 Ga0495625_0001292_3625_4068 136
817 3300046660 Ga0495625_0011060 Ga0495625_0011060_5970_6404 136
818 3300046660 Ga0495625_0463659 Ga0495625_0463659_208_660 136
819 3300046665 Ga0495661_0009038 Ga0495661_0009038_47_499 136
820 3300046665 Ga0495661_0031420 Ga0495661_0031420_2462_2896 136
821 3300046665 Ga0495661_0035252 Ga0495661_0035252_2637_3077 136
822 3300046665 Ga0495661_0089152 Ga0495661_0089152_1271_1723 136
823 3300046665 Ga0495661_0210079 Ga0495661_0210079_530_970 136
824 3300046665 Ga0495661_0401328 Ga0495661_0401328_168_620 136
825 3300046674 Ga0495588_0074754 Ga0495588_0074754_588_1040 136
826 3300046678 Ga0495599_0420424 Ga0495599_0420424_259_711 136
827 3300046691 Ga0495670_0086312 Ga0495670_0086312_642_1094 136
828 3300046691 Ga0495670_0108500 Ga0495670_0108500_980_1414 136
829 3300046691 Ga0495670_0374453 Ga0495670_0374453_95_529 136
830 3300046692 Ga0495671_0038152 Ga0495671_0038152_1314_1748 136
831 3300046692 Ga0495671_0290865 Ga0495671_0290865_118_552 136
832 3300046694 Ga0495649_0102632 Ga0495649_0102632_238_690 136
833 3300046694 Ga0495649_0337019 Ga0495649_0337019_149_583 136
834 3300046810 Ga0495660_0000403 Ga0495660_0000403_1125_1559 136
835 3300046810 Ga0495660_0005437 Ga0495660_0005437_5946_6380 136
836 3300046810 Ga0495660_0007545 Ga0495660_0007545_5144_5578 136
837 3300046810 Ga0495660_0023195 Ga0495660_0023195_2941_3375 136
838 3300046810 Ga0495660_0261881 Ga0495660_0261881_184_618 136
839 3300047315 Ga0495581_0068577 Ga0495581_0068577_587_1039 136
840 3300047318 Ga0495636_0339180 Ga0495636_0339180_109_546 136
841 3300047320 Ga0495672_0000111 Ga0495672_0000111_53683_54117 136
842 3300047323 Ga0495683_0068070 Ga0495683_0068070_296_730 136
843 3300047443 Ga0495687_000140 Ga0495687_000140_42267_42719 136
844 3300047443 Ga0495687_044949 Ga0495687_044949_791_1225 136
845 3300047444 Ga0495675_0109769 Ga0495675_0109769_44_496 136
846 3300047445 Ga0495677_0100590 Ga0495677_0100590_291_725 136
847 3300047446 Ga0495679_041740 Ga0495679_041740_965_1399 136
848 3300047446 Ga0495679_048811 Ga0495679_048811_768_1202 136
849 3300047446 Ga0495679_173340 Ga0495679_173340_29_463 136
850 3300047469 Ga0495673_0000060 Ga0495673_0000060_99574_100008 136
851 3300047469 Ga0495673_0000085 Ga0495673_0000085_125733_126167 136
852 3300047469 Ga0495673_0000149 Ga0495673_0000149_46869_47303 136
853 3300047470 Ga0495681_0000824 Ga0495681_0000824_1030_1464 136
854 3300047470 Ga0495681_0132533 Ga0495681_0132533_515_967 136
855 3300047472 Ga0495686_0022113 Ga0495686_0022113_746_1180 136
856 3300047472 Ga0495686_0063418 Ga0495686_0063418_346_798 136
857 3300048906 Ga0496103_0001871 Ga0496103_0001871_5186_5620 136
858 3300048908 Ga0496105_0336785 Ga0496105_0336785_439_882 136
859 3300048911 Ga0496108_1235550 Ga0496108_1235550_14_466 136
860 3300048914 Ga0496111_0403271 Ga0496111_0403271_395_829 136
861 3300048917 Ga0496114_0065449 Ga0496114_0065449_1300_1734 136
862 3300048918 Ga0496115_0502819 Ga0496115_0502819_293_727 136
863 3300048919 Ga0496116_0075945 Ga0496116_0075945_1278_1712 136
864 3300048919 Ga0496116_0207566 Ga0496116_0207566_119_553 136
865 3300048921 Ga0496118_0402302 Ga0496118_0402302_20_454 136
866 3300048923 Ga0496120_0055568 Ga0496120_0055568_1553_1987 136
867 3300048924 Ga0496121_0014685 Ga0496121_0014685_4748_5191 136
868 3300048924 Ga0496121_0089685 Ga0496121_0089685_649_1083 136
869 3300048924 Ga0496121_0537109 Ga0496121_0537109_178_612 136
870 3300048925 Ga0496122_0059591 Ga0496122_0059591_1090_1524 136
871 3300048926 Ga0496123_0008397 Ga0496123_0008397_4225_4659 136
872 3300048927 Ga0496124_0295836 Ga0496124_0295836_107_541 136
873 3300048929 Ga0496126_0011408 Ga0496126_0011408_2617_3051 136
874 3300048929 Ga0496126_0324301 Ga0496126_0324301_600_1013 136
875 3300049459 Ga0495678_000001 Ga0495678_000001_131603_132037 136
876 3300049459 Ga0495678_000458 Ga0495678_000458_15840_16274 136
877 3300049459 Ga0495678_000745 Ga0495678_000745_25732_26184 136
878 3300049459 Ga0495678_018139 Ga0495678_018139_710_1144 136
879 3300049763 Ga0501266_094602 Ga0501266_094602_23_457 136
880 3300049766 Ga0501269_001764 Ga0501269_001764_393_827 136
881 3300050489 nmdc:mga03683_218867_c1 nmdc:mga03683_218867_c1_278_697 136
882 3300053118 Ga0500594_0003144 Ga0500594_0003144_2006_2440 136
883 3300053125 Ga0500618_004758 Ga0500618_004758_698_1132 136
884 3300053125 Ga0500618_006553 Ga0500618_006553_2882_3316 136
885 3300053145 Ga0500586_007537 Ga0500586_007537_785_1219 136
886 3300003759 Ga0055525_1000013 Ga0055525_1000013159 137
887 3300003759 Ga0055525_1000074 Ga0055525_1000074137 137
888 3300003775 Ga0055524_1000025 Ga0055524_100002566 137
889 3300005262 Ga0065165_1000889 Ga0065165_100088940 137
890 3300005262 Ga0065165_1028015 Ga0065165_10280152 137
891 3300005262 Ga0065165_1032237 Ga0065165_10322372 137
892 3300005327 Ga0070658_10141993 Ga0070658_101419932 137
893 3300005327 Ga0070658_10170300 Ga0070658_101703002 137
894 3300005327 Ga0070658_11384646 Ga0070658_113846461 137
895 3300005333 Ga0070677_10226157 Ga0070677_102261571 137
896 3300005336 Ga0070680_100593369 Ga0070680_1005933691 137
897 3300005339 Ga0070660_100806976 Ga0070660_1008069761 137
898 3300005344 Ga0070661_100542839 Ga0070661_1005428392 137
899 3300005347 Ga0070668_100634446 Ga0070668_1006344462 137
900 3300005353 Ga0070669_100281790 Ga0070669_1002817901 137
901 3300005354 Ga0070675_100232111 Ga0070675_1002321111 137
902 3300005354 Ga0070675_100617491 Ga0070675_1006174912 137
903 3300005364 Ga0070673_100612918 Ga0070673_1006129182 137
904 3300005364 Ga0070673_100753633 Ga0070673_1007536332 137
905 3300005364 Ga0070673_101552796 Ga0070673_1015527962 137
906 3300005366 Ga0070659_100203977 Ga0070659_1002039771 137
907 3300005445 Ga0070708_100199245 Ga0070708_1001992452 137
908 3300005456 Ga0070678_101128244 Ga0070678_1011282442 137
909 3300005457 Ga0070662_100840551 Ga0070662_1008405512 137
910 3300005457 Ga0070662_101258287 Ga0070662_1012582871 137
911 3300005459 Ga0068867_100847655 Ga0068867_1008476551 137
912 3300005543 Ga0070672_100128138 Ga0070672_1001281382 137
913 3300005563 Ga0068855_100019587 Ga0068855_1000195872 137
914 3300005563 Ga0068855_100621090 Ga0068855_1006210902 137
915 3300005564 Ga0070664_100403408 Ga0070664_1004034081 137
916 3300005616 Ga0068852_101430659 Ga0068852_1014306592 137
917 3300006195 Ga0075366_10245148 Ga0075366_102451482 137
918 3300006237 Ga0097621_100806884 Ga0097621_1008068842 137
919 3300006846 Ga0075430_100082328 Ga0075430_1000823282 137
920 3300006880 Ga0075429_100008833 Ga0075429_1000088334 137
921 3300006881 Ga0068865_100707074 Ga0068865_1007070742 137
922 3300006948 Ga0099826_10000005 Ga0099826_10000005119 137
923 3300009036 Ga0105244_10162888 Ga0105244_101628882 137
924 3300009098 Ga0105245_10222432 Ga0105245_102224322 137
925 3300009147 Ga0114129_10137155 Ga0114129_101371553 137
926 3300009148 Ga0105243_10063627 Ga0105243_100636274 137
927 3300009174 Ga0105241_10023999 Ga0105241_100239992 137
928 3300009176 Ga0105242_11024226 Ga0105242_110242262 137
929 3300009177 Ga0105248_11331677 Ga0105248_113316772 137
930 3300009545 Ga0105237_10172915 Ga0105237_101729152 137
931 3300009551 Ga0105238_10275226 Ga0105238_102752262 137
932 3300009553 Ga0105249_12040167 Ga0105249_120401672 137
933 3300011119 Ga0105246_10400389 Ga0105246_104003892 137
934 3300013100 Ga0157373_10877224 Ga0157373_108772242 137
935 3300013104 Ga0157370_10561401 Ga0157370_105614012 137
936 3300013105 Ga0157369_11530978 Ga0157369_115309782 137
937 3300013296 Ga0157374_11124861 Ga0157374_111248612 137
938 3300013307 Ga0157372_10334629 Ga0157372_103346291 137
939 3300013307 Ga0157372_12697135 Ga0157372_126971351 137
940 3300017792 Ga0163161_10694080 Ga0163161_106940802 137
941 3300025230 Ga0209563_100003 Ga0209563_100003136 137
942 3300025230 Ga0209563_100025 Ga0209563_100025427 137
943 3300025253 Ga0209677_102895 Ga0209677_1028954 137
944 3300025254 Ga0209148_1000203 Ga0209148_100020368 137
945 3300025299 Ga0209256_1000040 Ga0209256_1000040119 137
946 3300025909 Ga0207705_10011989 Ga0207705_100119894 137
947 3300025909 Ga0207705_11042357 Ga0207705_110423571 137
948 3300025911 Ga0207654_10021482 Ga0207654_100214823 137
949 3300025913 Ga0207695_10080700 Ga0207695_100807005 137
950 3300025914 Ga0207671_10164373 Ga0207671_101643731 137
951 3300025917 Ga0207660_10590952 Ga0207660_105909522 137
952 3300025923 Ga0207681_10499004 Ga0207681_104990042 137
953 3300025926 Ga0207659_10659996 Ga0207659_106599961 137
954 3300025927 Ga0207687_11132129 Ga0207687_111321292 137
955 3300025932 Ga0207690_10170685 Ga0207690_101706851 137
956 3300025933 Ga0207706_10440688 Ga0207706_104406881 137
957 3300025934 Ga0207686_10032006 Ga0207686_100320061 137
958 3300025935 Ga0207709_10064766 Ga0207709_100647662 137
959 3300025938 Ga0207704_10517258 Ga0207704_105172582 137
960 3300025940 Ga0207691_10315262 Ga0207691_103152622 137
961 3300025941 Ga0207711_10749057 Ga0207711_107490572 137
962 3300025945 Ga0207679_10060411 Ga0207679_100604112 137
963 3300025949 Ga0207667_10874050 Ga0207667_108740501 137
964 3300025960 Ga0207651_10172606 Ga0207651_101726063 137
965 3300025986 Ga0207658_10515090 Ga0207658_105150901 137
966 3300026067 Ga0207678_10109071 Ga0207678_101090712 137
967 3300026089 Ga0207648_10363776 Ga0207648_103637762 137
968 3300027666 Ga0209282_1000003 Ga0209282_1000003681 137
969 3300028794 Ga0307515_10014143 Ga0307515_100141433 137
970 3300031239 Ga0265328_10038853 Ga0265328_100388532 137
971 3300031250 Ga0265331_10002254 Ga0265331_100022545 137
972 3300031251 Ga0265327_10000309 Ga0265327_1000030943 137
973 3300031548 Ga0307408_100272435 Ga0307408_1002724352 137
974 3300031824 Ga0307413_10034527 Ga0307413_100345274 137
975 3300031852 Ga0307410_10130880 Ga0307410_101308802 137
976 3300031852 Ga0307410_10341775 Ga0307410_103417752 137
977 3300031901 Ga0307406_10606605 Ga0307406_106066052 137
978 3300031995 Ga0307409_100754418 Ga0307409_1007544182 137
979 3300032002 Ga0307416_100376041 Ga0307416_1003760412 137
980 3300032002 Ga0307416_101093401 Ga0307416_1010934012 137
981 3300032005 Ga0307411_10186301 Ga0307411_101863012 137
982 3300032005 Ga0307411_11675038 Ga0307411_116750382 137
983 3300032126 Ga0307415_100581294 Ga0307415_1005812942 137
984 3300032126 Ga0307415_102208059 Ga0307415_1022080591 137
985 3300037312 Ga0395899_0000370 Ga0395899_0000370_16516_16971 137
986 3300037312 Ga0395899_0038495 Ga0395899_0038495_3066_3521 137
987 3300037312 Ga0395899_0043349 Ga0395899_0043349_2854_3309 137
988 3300037312 Ga0395899_0113735 Ga0395899_0113735_672_1127 137
989 3300037312 Ga0395899_0243257 Ga0395899_0243257_743_1198 137
990 3300037312 Ga0395899_0362820 Ga0395899_0362820_411_866 137
991 3300037418 Ga0395900_0000640 Ga0395900_0000640_44389_44844 137
992 3300037418 Ga0395900_0033983 Ga0395900_0033983_672_1127 137
993 3300037418 Ga0395900_0120467 Ga0395900_0120467_2179_2634 137
994 3300037418 Ga0395900_0123750 Ga0395900_0123750_39_494 137
995 3300037418 Ga0395900_0220142 Ga0395900_0220142_462_917 137
996 3300037418 Ga0395900_0617867 Ga0395900_0617867_509_964 137
997 3300037466 Ga0395898_1319919 Ga0395898_1319919_87_542 137
998 3300037471 Ga0395905_0133785 Ga0395905_0133785_22_477 137
999 3300037471 Ga0395905_0140362 Ga0395905_0140362_1363_1782 137
1000 3300037471 Ga0395905_0227962 Ga0395905_0227962_1058_1513 137
1001 3300037471 Ga0395905_0284022 Ga0395905_0284022_592_1047 137
1002 3300037471 Ga0395905_0516473 Ga0395905_0516473_93_548 137
1003 3300037471 Ga0395905_0747246 Ga0395905_0747246_434_853 137
1004 3300037471 Ga0395905_0873193 Ga0395905_0873193_206_661 137
1005 3300038443 Ga0395901_0000074 Ga0395901_0000074_91207_91662 137
1006 3300038443 Ga0395901_0244277 Ga0395901_0244277_177_632 137
1007 3300038443 Ga0395901_0279774 Ga0395901_0279774_1192_1647 137
1008 3300038443 Ga0395901_0323079 Ga0395901_0323079_14_469 137
1009 3300038443 Ga0395901_0429941 Ga0395901_0429941_778_1233 137
1010 3300041413 Ga0439465_0221247 Ga0439465_0221247_245_664 137
1011 3300041456 Ga0451795_1328699 Ga0451795_1328699_494_913 137
1012 3300041999 Ga0439433_0021226 Ga0439433_0021226_393_848 137
1013 3300042005 Ga0439448_0003089 Ga0439448_0003089_3594_4049 137
1014 3300042005 Ga0439448_0081905 Ga0439448_0081905_176_631 137
1015 3300042005 Ga0439448_0127064 Ga0439448_0127064_20_475 137
1016 3300042005 Ga0439448_0172457 Ga0439448_0172457_201_656 137
1017 3300042007 Ga0439449_0016561 Ga0439449_0016561_44_463 137
1018 3300042012 Ga0439455_0012754 Ga0439455_0012754_1404_1859 137
1019 3300042012 Ga0439455_0174098 Ga0439455_0174098_11_466 137
1020 3300042015 Ga0439462_0151164 Ga0439462_0151164_60_479 137
1021 3300042115 Ga0450911_014457 Ga0450911_014457_346_801 137
1022 3300042127 Ga0450890_078507 Ga0450890_078507_41_496 137
1023 3300042139 Ga0450904_000117 Ga0450904_000117_4635_5078 137
1024 3300042145 Ga0450906_026774 Ga0450906_026774_307_762 137
1025 3300044656 Ga0466969_0000037 Ga0466969_0000037_68685_69116 137
1026 3300044656 Ga0466969_0464173 Ga0466969_0464173_26_481 137
1027 3300044658 Ga0466972_0002974 Ga0466972_0002974_3715_4170 137
1028 3300044683 Ga0466965_0004104 Ga0466965_0004104_1640_2095 137
1029 3300044683 Ga0466965_0043171 Ga0466965_0043171_1183_1638 137
1030 3300044684 Ga0466966_0014648 Ga0466966_0014648_2645_3100 137
1031 3300044684 Ga0466966_0114801 Ga0466966_0114801_645_1076 137
1032 3300044684 Ga0466966_0286152 Ga0466966_0286152_61_516 137
1033 3300044684 Ga0466966_0417301 Ga0466966_0417301_257_712 137
1034 3300044684 Ga0466966_0444248 Ga0466966_0444248_307_762 137
1035 3300044693 Ga0466961_0015995 Ga0466961_0015995_3612_4043 137
1036 3300044694 Ga0466963_0321315 Ga0466963_0321315_52_507 137
1037 3300044706 Ga0466964_0005515 Ga0466964_0005515_190_645 137
1038 3300044706 Ga0466964_0008450 Ga0466964_0008450_3363_3818 137
1039 3300044706 Ga0466964_0493591 Ga0466964_0493591_172_627 137
1040 3300044712 Ga0453684_0158290 Ga0453684_0158290_1439_1858 137
1041 3300044735 Ga0466968_0000503 Ga0466968_0000503_3380_3835 137
1042 3300044735 Ga0466968_0026789 Ga0466968_0026789_1933_2352 137
1043 3300044765 Ga0466970_0206437 Ga0466970_0206437_440_871 137
1044 3300044842 Ga0466957_0009983 Ga0466957_0009983_4176_4631 137
1045 3300044842 Ga0466957_0020390 Ga0466957_0020390_1208_1663 137
1046 3300044842 Ga0466957_0082980 Ga0466957_0082980_1184_1639 137
1047 3300044842 Ga0466957_0701491 Ga0466957_0701491_179_634 137
1048 3300044901 Ga0466960_0146279 Ga0466960_0146279_730_1185 137
1049 3300045049 Ga0466959_0110779 Ga0466959_0110779_406_861 137
1050 3300045049 Ga0466959_0125799 Ga0466959_0125799_989_1444 137
1051 3300045049 Ga0466959_0528259 Ga0466959_0528259_199_654 137
1052 3300045049 Ga0466959_0735569 Ga0466959_0735569_157_612 137
1053 3300045836 Ga0466958_0113256 Ga0466958_0113256_22_477 137
1054 3300045836 Ga0466958_0213387 Ga0466958_0213387_361_816 137
1055 3300045836 Ga0466958_0233977 Ga0466958_0233977_19_474 137
1056 3300045976 Ga0466967_0011205 Ga0466967_0011205_3617_4072 137
1057 3300045976 Ga0466967_0376686 Ga0466967_0376686_17_472 137
1058 3300046452 Ga0495617_000026 Ga0495617_000026_102920_103375 137
1059 3300046452 Ga0495617_000362 Ga0495617_000362_17636_18091 137
1060 3300046453 Ga0495627_000043 Ga0495627_000043_80886_81341 137
1061 3300046453 Ga0495627_023622 Ga0495627_023622_1103_1558 137
1062 3300046455 Ga0495603_0120676 Ga0495603_0120676_801_1256 137
1063 3300046455 Ga0495603_0157418 Ga0495603_0157418_718_1173 137
1064 3300046455 Ga0495603_0183569 Ga0495603_0183569_231_686 137
1065 3300046457 Ga0495590_0000041 Ga0495590_0000041_58163_58618 137
1066 3300046457 Ga0495590_0006704 Ga0495590_0006704_650_1105 137
1067 3300046457 Ga0495590_0123181 Ga0495590_0123181_316_771 137
1068 3300046457 Ga0495590_0195367 Ga0495590_0195367_199_654 137
1069 3300046457 Ga0495590_0227942 Ga0495590_0227942_156_611 137
1070 3300046458 Ga0495591_000213 Ga0495591_000213_58032_58487 137
1071 3300046459 Ga0495629_0001336 Ga0495629_0001336_5490_5945 137
1072 3300046459 Ga0495629_0094490 Ga0495629_0094490_1609_2064 137
1073 3300046460 Ga0495638_0228610 Ga0495638_0228610_552_1001 137
1074 3300046460 Ga0495638_0442370 Ga0495638_0442370_95_550 137
1075 3300046460 Ga0495638_0484298 Ga0495638_0484298_75_530 137
1076 3300046463 Ga0495653_0012591 Ga0495653_0012591_1415_1870 137
1077 3300046463 Ga0495653_0025416 Ga0495653_0025416_2077_2532 137
1078 3300046463 Ga0495653_0072599 Ga0495653_0072599_2073_2528 137
1079 3300046463 Ga0495653_0087730 Ga0495653_0087730_799_1254 137
1080 3300046471 Ga0495650_0001351 Ga0495650_0001351_12285_12740 137
1081 3300046471 Ga0495650_0098457 Ga0495650_0098457_92_547 137
1082 3300046472 Ga0495580_0006752 Ga0495580_0006752_5179_5634 137
1083 3300046472 Ga0495580_0086525 Ga0495580_0086525_1509_1964 137
1084 3300046473 Ga0495582_0017018 Ga0495582_0017018_482_937 137
1085 3300046474 Ga0495605_0000113 Ga0495605_0000113_49318_49773 137
1086 3300046474 Ga0495605_0000186 Ga0495605_0000186_66660_67115 137
1087 3300046474 Ga0495605_0001197 Ga0495605_0001197_48_503 137
1088 3300046474 Ga0495605_0085279 Ga0495605_0085279_939_1394 137
1089 3300046474 Ga0495605_0227370 Ga0495605_0227370_18_473 137
1090 3300046474 Ga0495605_0281587 Ga0495605_0281587_158_613 137
1091 3300046474 Ga0495605_0452653 Ga0495605_0452653_26_481 137
1092 3300046477 Ga0495664_0490464 Ga0495664_0490464_235_690 137
1093 3300046491 Ga0495584_0000007 Ga0495584_0000007_82613_83068 137
1094 3300046491 Ga0495584_0000252 Ga0495584_0000252_22194_22649 137
1095 3300046491 Ga0495584_0004963 Ga0495584_0004963_1209_1643 137
1096 3300046491 Ga0495584_0008099 Ga0495584_0008099_1239_1694 137
1097 3300046491 Ga0495584_0015762 Ga0495584_0015762_37_492 137
1098 3300046491 Ga0495584_0021355 Ga0495584_0021355_2347_2802 137
1099 3300046491 Ga0495584_0043442 Ga0495584_0043442_476_931 137
1100 3300046491 Ga0495584_0144931 Ga0495584_0144931_335_790 137
1101 3300046491 Ga0495584_0162952 Ga0495584_0162952_193_648 137
1102 3300046491 Ga0495584_0222395 Ga0495584_0222395_256_711 137
1103 3300046491 Ga0495584_0355275 Ga0495584_0355275_171_626 137
1104 3300046491 Ga0495584_0457278 Ga0495584_0457278_173_628 137
1105 3300046492 Ga0495585_0000090 Ga0495585_0000090_58784_59239 137
1106 3300046492 Ga0495585_0000147 Ga0495585_0000147_51500_51955 137
1107 3300046492 Ga0495585_0012830 Ga0495585_0012830_1266_1721 137
1108 3300046492 Ga0495585_0016190 Ga0495585_0016190_203_658 137
1109 3300046492 Ga0495585_0024549 Ga0495585_0024549_2185_2640 137
1110 3300046492 Ga0495585_0029280 Ga0495585_0029280_1621_2076 137
1111 3300046492 Ga0495585_0041940 Ga0495585_0041940_709_1164 137
1112 3300046492 Ga0495585_0058592 Ga0495585_0058592_659_1093 137
1113 3300046492 Ga0495585_0189373 Ga0495585_0189373_500_955 137
1114 3300046492 Ga0495585_0217815 Ga0495585_0217815_250_705 137
1115 3300046492 Ga0495585_0377688 Ga0495585_0377688_18_473 137
1116 3300046492 Ga0495585_0554786 Ga0495585_0554786_55_489 137
1117 3300046499 Ga0495594_0025128 Ga0495594_0025128_2290_2745 137
1118 3300046499 Ga0495594_0051651 Ga0495594_0051651_627_1082 137
1119 3300046499 Ga0495594_0306657 Ga0495594_0306657_419_874 137
1120 3300046500 Ga0495596_0000270 Ga0495596_0000270_21692_22147 137
1121 3300046500 Ga0495596_0001876 Ga0495596_0001876_10685_11140 137
1122 3300046500 Ga0495596_0001991 Ga0495596_0001991_191_646 137
1123 3300046500 Ga0495596_0006043 Ga0495596_0006043_914_1369 137
1124 3300046500 Ga0495596_0013973 Ga0495596_0013973_343_798 137
1125 3300046500 Ga0495596_0015363 Ga0495596_0015363_2730_3185 137
1126 3300046500 Ga0495596_0019543 Ga0495596_0019543_2309_2764 137
1127 3300046500 Ga0495596_0063271 Ga0495596_0063271_21_476 137
1128 3300046500 Ga0495596_0079667 Ga0495596_0079667_658_1113 137
1129 3300046501 Ga0495607_0000842 Ga0495607_0000842_670_1125 137
1130 3300046501 Ga0495607_0001791 Ga0495607_0001791_14533_14988 137
1131 3300046501 Ga0495607_0002436 Ga0495607_0002436_6827_7282 137
1132 3300046501 Ga0495607_0008025 Ga0495607_0008025_6738_7193 137
1133 3300046501 Ga0495607_0023678 Ga0495607_0023678_3154_3609 137
1134 3300046501 Ga0495607_0093779 Ga0495607_0093779_1128_1583 137
1135 3300046501 Ga0495607_0093985 Ga0495607_0093985_1125_1559 137
1136 3300046501 Ga0495607_0096950 Ga0495607_0096950_38_493 137
1137 3300046501 Ga0495607_0111651 Ga0495607_0111651_762_1196 137
1138 3300046501 Ga0495607_0141005 Ga0495607_0141005_648_1103 137
1139 3300046501 Ga0495607_0455918 Ga0495607_0455918_76_531 137
1140 3300046506 Ga0495583_0000075 Ga0495583_0000075_116680_117135 137
1141 3300046506 Ga0495583_0000783 Ga0495583_0000783_3711_4166 137
1142 3300046506 Ga0495583_0001150 Ga0495583_0001150_8463_8906 137
1143 3300046506 Ga0495583_0005291 Ga0495583_0005291_3332_3787 137
1144 3300046506 Ga0495583_0005830 Ga0495583_0005830_5859_6314 137
1145 3300046506 Ga0495583_0012206 Ga0495583_0012206_778_1233 137
1146 3300046506 Ga0495583_0019843 Ga0495583_0019843_1072_1527 137
1147 3300046506 Ga0495583_0023530 Ga0495583_0023530_21_476 137
1148 3300046507 Ga0495606_0016609 Ga0495606_0016609_4197_4652 137
1149 3300046507 Ga0495606_0022834 Ga0495606_0022834_1274_1729 137
1150 3300046507 Ga0495606_0027155 Ga0495606_0027155_1444_1899 137
1151 3300046507 Ga0495606_0062093 Ga0495606_0062093_632_1087 137
1152 3300046507 Ga0495606_0287324 Ga0495606_0287324_37_492 137
1153 3300046507 Ga0495606_0355959 Ga0495606_0355959_136_591 137
1154 3300046512 Ga0495610_0001086 Ga0495610_0001086_9968_10423 137
1155 3300046513 Ga0495616_0002015 Ga0495616_0002015_10095_10550 137
1156 3300046513 Ga0495616_0004259 Ga0495616_0004259_1975_2430 137
1157 3300046513 Ga0495616_0006556 Ga0495616_0006556_4447_4881 137
1158 3300046513 Ga0495616_0010268 Ga0495616_0010268_4878_5333 137
1159 3300046513 Ga0495616_0011262 Ga0495616_0011262_117_572 137
1160 3300046513 Ga0495616_0016471 Ga0495616_0016471_3366_3821 137
1161 3300046513 Ga0495616_0030381 Ga0495616_0030381_1394_1849 137
1162 3300046513 Ga0495616_0031023 Ga0495616_0031023_2194_2649 137
1163 3300046513 Ga0495616_0067735 Ga0495616_0067735_123_578 137
1164 3300046513 Ga0495616_0074501 Ga0495616_0074501_123_578 137
1165 3300046515 Ga0495620_0009384 Ga0495620_0009384_4066_4521 137
1166 3300046517 Ga0495630_0144757 Ga0495630_0144757_199_654 137
1167 3300046518 Ga0495631_0000684 Ga0495631_0000684_4406_4861 137
1168 3300046518 Ga0495631_0002923 Ga0495631_0002923_5664_6119 137
1169 3300046518 Ga0495631_0003899 Ga0495631_0003899_4248_4703 137
1170 3300046518 Ga0495631_0006452 Ga0495631_0006452_5480_5935 137
1171 3300046518 Ga0495631_0014808 Ga0495631_0014808_262_717 137
1172 3300046518 Ga0495631_0035930 Ga0495631_0035930_1587_2042 137
1173 3300046518 Ga0495631_0066285 Ga0495631_0066285_995_1450 137
1174 3300046518 Ga0495631_0181683 Ga0495631_0181683_370_825 137
1175 3300046519 Ga0495632_0000098 Ga0495632_0000098_53197_53652 137
1176 3300046519 Ga0495632_0000152 Ga0495632_0000152_33602_34057 137
1177 3300046519 Ga0495632_0002349 Ga0495632_0002349_21_476 137
1178 3300046519 Ga0495632_0003810 Ga0495632_0003810_3313_3768 137
1179 3300046519 Ga0495632_0005546 Ga0495632_0005546_4556_5011 137
1180 3300046519 Ga0495632_0014466 Ga0495632_0014466_49_504 137
1181 3300046519 Ga0495632_0024146 Ga0495632_0024146_1833_2288 137
1182 3300046520 Ga0495637_0000013 Ga0495637_0000013_37594_38049 137
1183 3300046520 Ga0495637_0012166 Ga0495637_0012166_1198_1641 137
1184 3300046520 Ga0495637_0015193 Ga0495637_0015193_2215_2670 137
1185 3300046520 Ga0495637_0035358 Ga0495637_0035358_1516_1971 137
1186 3300046522 Ga0495643_0000206 Ga0495643_0000206_72042_72485 137
1187 3300046522 Ga0495643_0005635 Ga0495643_0005635_6618_7073 137
1188 3300046522 Ga0495643_0008875 Ga0495643_0008875_5829_6284 137
1189 3300046522 Ga0495643_0010126 Ga0495643_0010126_5250_5705 137
1190 3300046522 Ga0495643_0020187 Ga0495643_0020187_3361_3816 137
1191 3300046522 Ga0495643_0032309 Ga0495643_0032309_82_537 137
1192 3300046522 Ga0495643_0121146 Ga0495643_0121146_828_1283 137
1193 3300046523 Ga0495644_0010702 Ga0495644_0010702_1850_2305 137
1194 3300046523 Ga0495644_0012933 Ga0495644_0012933_1123_1578 137
1195 3300046523 Ga0495644_0025704 Ga0495644_0025704_821_1276 137
1196 3300046523 Ga0495644_0051930 Ga0495644_0051930_992_1447 137
1197 3300046523 Ga0495644_0062795 Ga0495644_0062795_43_498 137
1198 3300046524 Ga0495648_0000091 Ga0495648_0000091_59225_59680 137
1199 3300046524 Ga0495648_0000353 Ga0495648_0000353_47824_48279 137
1200 3300046524 Ga0495648_0010945 Ga0495648_0010945_5020_5475 137
1201 3300046524 Ga0495648_0019012 Ga0495648_0019012_4364_4819 137
1202 3300046524 Ga0495648_0023916 Ga0495648_0023916_3601_4056 137
1203 3300046524 Ga0495648_0032254 Ga0495648_0032254_2632_3087 137
1204 3300046524 Ga0495648_0041778 Ga0495648_0041778_2053_2508 137
1205 3300046524 Ga0495648_0177032 Ga0495648_0177032_289_744 137
1206 3300046524 Ga0495648_0295370 Ga0495648_0295370_56_511 137
1207 3300046524 Ga0495648_0354105 Ga0495648_0354105_13_459 137
1208 3300046525 Ga0495663_0178770 Ga0495663_0178770_141_596 137
1209 3300046526 Ga0495666_0000042 Ga0495666_0000042_35703_36158 137
1210 3300046526 Ga0495666_0000406 Ga0495666_0000406_17010_17465 137
1211 3300046526 Ga0495666_0066514 Ga0495666_0066514_138_593 137
1212 3300046526 Ga0495666_0218832 Ga0495666_0218832_63_518 137
1213 3300046528 Ga0495642_0004297 Ga0495642_0004297_3818_4273 137
1214 3300046528 Ga0495642_0004327 Ga0495642_0004327_1279_1734 137
1215 3300046528 Ga0495642_0005729 Ga0495642_0005729_1652_2107 137
1216 3300046528 Ga0495642_0032927 Ga0495642_0032927_480_935 137
1217 3300046528 Ga0495642_0141799 Ga0495642_0141799_480_935 137
1218 3300046528 Ga0495642_0220331 Ga0495642_0220331_325_780 137
1219 3300046528 Ga0495642_0384232 Ga0495642_0384232_153_608 137
1220 3300046529 Ga0495652_0008927 Ga0495652_0008927_7981_8436 137
1221 3300046529 Ga0495652_0644009 Ga0495652_0644009_105_560 137
1222 3300046530 Ga0495654_0010498 Ga0495654_0010498_3540_3995 137
1223 3300046530 Ga0495654_0054606 Ga0495654_0054606_893_1348 137
1224 3300046531 Ga0495665_0011224 Ga0495665_0011224_1829_2284 137
1225 3300046531 Ga0495665_0020612 Ga0495665_0020612_2465_2920 137
1226 3300046531 Ga0495665_0351615 Ga0495665_0351615_114_569 137
1227 3300046531 Ga0495665_0430889 Ga0495665_0430889_187_642 137
1228 3300046533 Ga0495640_0563530 Ga0495640_0563530_111_566 137
1229 3300046535 Ga0495586_0003306 Ga0495586_0003306_5920_6375 137
1230 3300046535 Ga0495586_0029130 Ga0495586_0029130_1256_1711 137
1231 3300046535 Ga0495586_0041477 Ga0495586_0041477_1524_1979 137
1232 3300046536 Ga0495587_0025272 Ga0495587_0025272_1071_1526 137
1233 3300046536 Ga0495587_0222801 Ga0495587_0222801_488_943 137
1234 3300046538 Ga0495609_0000022 Ga0495609_0000022_39298_39753 137
1235 3300046538 Ga0495609_0000482 Ga0495609_0000482_5401_5856 137
1236 3300046538 Ga0495609_0004242 Ga0495609_0004242_5700_6155 137
1237 3300046538 Ga0495609_0011455 Ga0495609_0011455_105_560 137
1238 3300046538 Ga0495609_0015753 Ga0495609_0015753_1320_1775 137
1239 3300046538 Ga0495609_0040439 Ga0495609_0040439_1344_1799 137
1240 3300046538 Ga0495609_0064246 Ga0495609_0064246_1057_1512 137
1241 3300046538 Ga0495609_0092309 Ga0495609_0092309_833_1288 137
1242 3300046538 Ga0495609_0212564 Ga0495609_0212564_198_653 137
1243 3300046542 Ga0495597_0000104 Ga0495597_0000104_59_514 137
1244 3300046542 Ga0495597_0000771 Ga0495597_0000771_3369_3824 137
1245 3300046542 Ga0495597_0000806 Ga0495597_0000806_12810_13265 137
1246 3300046542 Ga0495597_0004134 Ga0495597_0004134_1575_2030 137
1247 3300046542 Ga0495597_0051448 Ga0495597_0051448_847_1290 137
1248 3300046543 Ga0495645_0519153 Ga0495645_0519153_186_641 137
1249 3300046557 Ga0495622_0003085 Ga0495622_0003085_6245_6700 137
1250 3300046557 Ga0495622_0178754 Ga0495622_0178754_201_635 137
1251 3300046558 Ga0495633_0004049 Ga0495633_0004049_4044_4499 137
1252 3300046558 Ga0495633_0006064 Ga0495633_0006064_2125_2580 137
1253 3300046558 Ga0495633_0019372 Ga0495633_0019372_886_1341 137
1254 3300046558 Ga0495633_0045331 Ga0495633_0045331_1012_1467 137
1255 3300046558 Ga0495633_0053117 Ga0495633_0053117_72_527 137
1256 3300046558 Ga0495633_0058702 Ga0495633_0058702_1135_1569 137
1257 3300046559 Ga0495667_0409249 Ga0495667_0409249_196_651 137
1258 3300046615 Ga0495656_0046421 Ga0495656_0046421_391_846 137
1259 3300046615 Ga0495656_0295828 Ga0495656_0295828_87_542 137
1260 3300046615 Ga0495656_0542329 Ga0495656_0542329_29_472 137
1261 3300046615 Ga0495656_0543884 Ga0495656_0543884_34_489 137
1262 3300046616 Ga0495668_0000131 Ga0495668_0000131_68195_68650 137
1263 3300046616 Ga0495668_0005921 Ga0495668_0005921_4172_4627 137
1264 3300046616 Ga0495668_0006701 Ga0495668_0006701_3759_4214 137
1265 3300046616 Ga0495668_0037092 Ga0495668_0037092_1956_2411 137
1266 3300046616 Ga0495668_0181098 Ga0495668_0181098_504_959 137
1267 3300046616 Ga0495668_0642286 Ga0495668_0642286_120_575 137
1268 3300046642 Ga0495634_0006153 Ga0495634_0006153_196_651 137
1269 3300046642 Ga0495634_0420950 Ga0495634_0420950_127_582 137
1270 3300046648 Ga0495611_0003458 Ga0495611_0003458_4404_4859 137
1271 3300046648 Ga0495611_0008445 Ga0495611_0008445_745_1200 137
1272 3300046648 Ga0495611_0016209 Ga0495611_0016209_1578_2033 137
1273 3300046648 Ga0495611_0024536 Ga0495611_0024536_1149_1604 137
1274 3300046660 Ga0495625_0011006 Ga0495625_0011006_1406_1861 137
1275 3300046660 Ga0495625_0140960 Ga0495625_0140960_468_923 137
1276 3300046660 Ga0495625_0175871 Ga0495625_0175871_24_458 137
1277 3300046660 Ga0495625_0179402 Ga0495625_0179402_139_594 137
1278 3300046660 Ga0495625_0454015 Ga0495625_0454015_289_744 137
1279 3300046663 Ga0495635_0005244 Ga0495635_0005244_5096_5551 137
1280 3300046665 Ga0495661_0000502 Ga0495661_0000502_39096_39551 137
1281 3300046665 Ga0495661_0001265 Ga0495661_0001265_19937_20392 137
1282 3300046665 Ga0495661_0005726 Ga0495661_0005726_7337_7792 137
1283 3300046665 Ga0495661_0015856 Ga0495661_0015856_3305_3760 137
1284 3300046665 Ga0495661_0027532 Ga0495661_0027532_1735_2190 137
1285 3300046665 Ga0495661_0043898 Ga0495661_0043898_1018_1473 137
1286 3300046665 Ga0495661_0049104 Ga0495661_0049104_434_889 137
1287 3300046665 Ga0495661_0083814 Ga0495661_0083814_1195_1629 137
1288 3300046665 Ga0495661_0087827 Ga0495661_0087827_27_482 137
1289 3300046665 Ga0495661_0104665 Ga0495661_0104665_1094_1549 137
1290 3300046665 Ga0495661_0105438 Ga0495661_0105438_38_493 137
1291 3300046665 Ga0495661_0123683 Ga0495661_0123683_123_578 137
1292 3300046665 Ga0495661_0437020 Ga0495661_0437020_24_479 137
1293 3300046674 Ga0495588_0000148 Ga0495588_0000148_56713_57168 137
1294 3300046674 Ga0495588_0081574 Ga0495588_0081574_294_749 137
1295 3300046674 Ga0495588_0151054 Ga0495588_0151054_440_895 137
1296 3300046679 Ga0495623_0023548 Ga0495623_0023548_785_1240 137
1297 3300046679 Ga0495623_0030990 Ga0495623_0030990_2119_2574 137
1298 3300046679 Ga0495623_0033544 Ga0495623_0033544_90_545 137
1299 3300046684 Ga0495669_0001964 Ga0495669_0001964_2104_2559 137
1300 3300046684 Ga0495669_0007315 Ga0495669_0007315_3738_4193 137
1301 3300046684 Ga0495669_0016714 Ga0495669_0016714_1226_1681 137
1302 3300046689 Ga0495613_0009841 Ga0495613_0009841_1840_2295 137
1303 3300046689 Ga0495613_0232461 Ga0495613_0232461_353_808 137
1304 3300046689 Ga0495613_0890572 Ga0495613_0890572_108_563 137
1305 3300046690 Ga0495624_0018263 Ga0495624_0018263_4126_4581 137
1306 3300046691 Ga0495670_0003213 Ga0495670_0003213_2704_3159 137
1307 3300046691 Ga0495670_0011444 Ga0495670_0011444_1496_1939 137
1308 3300046691 Ga0495670_0030214 Ga0495670_0030214_2131_2586 137
1309 3300046691 Ga0495670_0156969 Ga0495670_0156969_611_1066 137
1310 3300046691 Ga0495670_0421203 Ga0495670_0421203_162_617 137
1311 3300046691 Ga0495670_0562660 Ga0495670_0562660_156_590 137
1312 3300046692 Ga0495671_0000426 Ga0495671_0000426_26756_27211 137
1313 3300046692 Ga0495671_0019650 Ga0495671_0019650_1064_1519 137
1314 3300046694 Ga0495649_0000806 Ga0495649_0000806_22535_22990 137
1315 3300046694 Ga0495649_0005148 Ga0495649_0005148_3458_3913 137
1316 3300046694 Ga0495649_0218377 Ga0495649_0218377_311_766 137
1317 3300046694 Ga0495649_0480981 Ga0495649_0480981_100_555 137
1318 3300046794 Ga0495589_0000017 Ga0495589_0000017_3799_4254 137
1319 3300046794 Ga0495589_0000508 Ga0495589_0000508_13842_14297 137
1320 3300046794 Ga0495589_0006901 Ga0495589_0006901_3444_3899 137
1321 3300046794 Ga0495589_0009727 Ga0495589_0009727_356_811 137
1322 3300046794 Ga0495589_0015977 Ga0495589_0015977_42_497 137
1323 3300046794 Ga0495589_0049188 Ga0495589_0049188_629_1084 137
1324 3300046794 Ga0495589_0052782 Ga0495589_0052782_269_724 137
1325 3300046809 Ga0495600_0123284 Ga0495600_0123284_443_898 137
1326 3300046810 Ga0495660_0000162 Ga0495660_0000162_70695_71150 137
1327 3300046810 Ga0495660_0015676 Ga0495660_0015676_2132_2587 137
1328 3300046810 Ga0495660_0035577 Ga0495660_0035577_2207_2662 137
1329 3300046810 Ga0495660_0086023 Ga0495660_0086023_425_880 137
1330 3300046810 Ga0495660_0139169 Ga0495660_0139169_450_905 137
1331 3300046810 Ga0495660_0314563 Ga0495660_0314563_142_597 137
1332 3300046810 Ga0495660_0429093 Ga0495660_0429093_75_530 137
1333 3300047315 Ga0495581_0027074 Ga0495581_0027074_1728_2183 137
1334 3300047315 Ga0495581_0351395 Ga0495581_0351395_318_773 137
1335 3300047317 Ga0495604_0006708 Ga0495604_0006708_3349_3804 137
1336 3300047317 Ga0495604_0044087 Ga0495604_0044087_764_1219 137
1337 3300047317 Ga0495604_0150900 Ga0495604_0150900_481_936 137
1338 3300047317 Ga0495604_0349592 Ga0495604_0349592_465_920 137
1339 3300047318 Ga0495636_0050921 Ga0495636_0050921_1019_1474 137
1340 3300047319 Ga0495674_0006559 Ga0495674_0006559_10456_10911 137
1341 3300047320 Ga0495672_0000152 Ga0495672_0000152_12249_12704 137
1342 3300047320 Ga0495672_0000167 Ga0495672_0000167_76305_76760 137
1343 3300047320 Ga0495672_0000559 Ga0495672_0000559_5324_5779 137
1344 3300047320 Ga0495672_0000581 Ga0495672_0000581_16785_17240 137
1345 3300047320 Ga0495672_0038378 Ga0495672_0038378_1805_2260 137
1346 3300047320 Ga0495672_0070711 Ga0495672_0070711_342_797 137
1347 3300047320 Ga0495672_0075445 Ga0495672_0075445_95_550 137
1348 3300047321 Ga0495676_0000123 Ga0495676_0000123_5679_6134 137
1349 3300047321 Ga0495676_0588180 Ga0495676_0588180_72_527 137
1350 3300047322 Ga0495680_0007799 Ga0495680_0007799_9071_9526 137
1351 3300047322 Ga0495680_0060600 Ga0495680_0060600_776_1231 137
1352 3300047323 Ga0495683_0000069 Ga0495683_0000069_58438_58893 137
1353 3300047323 Ga0495683_0000098 Ga0495683_0000098_56019_56474 137
1354 3300047323 Ga0495683_0014744 Ga0495683_0014744_2210_2665 137
1355 3300047323 Ga0495683_0019856 Ga0495683_0019856_2099_2554 137
1356 3300047323 Ga0495683_0026681 Ga0495683_0026681_2355_2810 137
1357 3300047323 Ga0495683_0044801 Ga0495683_0044801_964_1419 137
1358 3300047323 Ga0495683_0046896 Ga0495683_0046896_1076_1531 137
1359 3300047443 Ga0495687_000113 Ga0495687_000113_86644_87099 137
1360 3300047443 Ga0495687_000175 Ga0495687_000175_39272_39727 137
1361 3300047443 Ga0495687_000236 Ga0495687_000236_64413_64868 137
1362 3300047443 Ga0495687_002221 Ga0495687_002221_14483_14938 137
1363 3300047443 Ga0495687_010281 Ga0495687_010281_934_1389 137
1364 3300047444 Ga0495675_0012446 Ga0495675_0012446_1632_2087 137
1365 3300047444 Ga0495675_0113683 Ga0495675_0113683_512_967 137
1366 3300047445 Ga0495677_0000002 Ga0495677_0000002_27893_28348 137
1367 3300047445 Ga0495677_0000079 Ga0495677_0000079_3321_3776 137
1368 3300047445 Ga0495677_0000140 Ga0495677_0000140_33680_34135 137
1369 3300047445 Ga0495677_0000530 Ga0495677_0000530_14813_15268 137
1370 3300047445 Ga0495677_0002486 Ga0495677_0002486_3196_3651 137
1371 3300047445 Ga0495677_0005141 Ga0495677_0005141_3301_3756 137
1372 3300047445 Ga0495677_0056288 Ga0495677_0056288_807_1262 137
1373 3300047446 Ga0495679_009955 Ga0495679_009955_3282_3737 137
1374 3300047446 Ga0495679_011673 Ga0495679_011673_2176_2631 137
1375 3300047446 Ga0495679_021210 Ga0495679_021210_88_543 137
1376 3300047446 Ga0495679_034304 Ga0495679_034304_1000_1455 137
1377 3300047447 Ga0495685_007306 Ga0495685_007306_14_469 137
1378 3300047447 Ga0495685_040764 Ga0495685_040764_1065_1520 137
1379 3300047447 Ga0495685_068902 Ga0495685_068902_501_956 137
1380 3300047469 Ga0495673_0002074 Ga0495673_0002074_2007_2462 137
1381 3300047469 Ga0495673_0138910 Ga0495673_0138910_388_843 137
1382 3300047470 Ga0495681_0012074 Ga0495681_0012074_3746_4201 137
1383 3300047470 Ga0495681_0022943 Ga0495681_0022943_719_1174 137
1384 3300047470 Ga0495681_0037046 Ga0495681_0037046_968_1423 137
1385 3300047470 Ga0495681_0069635 Ga0495681_0069635_807_1262 137
1386 3300047470 Ga0495681_0071377 Ga0495681_0071377_994_1449 137
1387 3300047472 Ga0495686_0000169 Ga0495686_0000169_37610_38065 137
1388 3300047472 Ga0495686_0001456 Ga0495686_0001456_1325_1780 137
1389 3300047472 Ga0495686_0045233 Ga0495686_0045233_1068_1523 137
1390 3300047472 Ga0495686_0176616 Ga0495686_0176616_349_804 137
1391 3300047472 Ga0495686_0640205 Ga0495686_0640205_65_520 137
1392 3300047673 Ga0495593_0027236 Ga0495593_0027236_2658_3113 137
1393 3300047673 Ga0495593_0334876 Ga0495593_0334876_102_557 137
1394 3300048088 Ga0495602_0013704 Ga0495602_0013704_1341_1796 137
1395 3300048088 Ga0495602_0038029 Ga0495602_0038029_3977_4432 137
1396 3300048089 Ga0495614_0005675 Ga0495614_0005675_553_1008 137
1397 3300048089 Ga0495614_0275022 Ga0495614_0275022_307_762 137
1398 3300048090 Ga0495615_0251393 Ga0495615_0251393_38_493 137
1399 3300048091 Ga0495626_0000076 Ga0495626_0000076_86927_87382 137
1400 3300048091 Ga0495626_0000170 Ga0495626_0000170_62972_63427 137
1401 3300048091 Ga0495626_0000882 Ga0495626_0000882_3073_3516 137
1402 3300048091 Ga0495626_0002487 Ga0495626_0002487_7617_8072 137
1403 3300048091 Ga0495626_0014577 Ga0495626_0014577_3363_3818 137
1404 3300048091 Ga0495626_0016369 Ga0495626_0016369_1271_1726 137
1405 3300048091 Ga0495626_0018299 Ga0495626_0018299_1251_1706 137
1406 3300048091 Ga0495626_0020538 Ga0495626_0020538_1201_1656 137
1407 3300048091 Ga0495626_0055268 Ga0495626_0055268_241_696 137
1408 3300048091 Ga0495626_0063415 Ga0495626_0063415_133_588 137
1409 3300048091 Ga0495626_0077862 Ga0495626_0077862_715_1170 137
1410 3300048091 Ga0495626_0086070 Ga0495626_0086070_706_1161 137
1411 3300048091 Ga0495626_0240270 Ga0495626_0240270_75_530 137
1412 3300048091 Ga0495626_0294420 Ga0495626_0294420_132_575 137
1413 3300048903 Ga0496100_0008425 Ga0496100_0008425_3665_4120 137
1414 3300048904 Ga0496101_0119689 Ga0496101_0119689_1228_1683 137
1415 3300048904 Ga0496101_0407770 Ga0496101_0407770_594_1049 137
1416 3300048905 Ga0496102_0000156 Ga0496102_0000156_91554_92009 137
1417 3300048905 Ga0496102_0026637 Ga0496102_0026637_3472_3927 137
1418 3300048905 Ga0496102_0035916 Ga0496102_0035916_913_1362 137
1419 3300048905 Ga0496102_0241353 Ga0496102_0241353_159_608 137
1420 3300048906 Ga0496103_0050964 Ga0496103_0050964_1098_1547 137
1421 3300048906 Ga0496103_0314841 Ga0496103_0314841_130_585 137
1422 3300048906 Ga0496103_0481771 Ga0496103_0481771_330_779 137
1423 3300048906 Ga0496103_0685025 Ga0496103_0685025_34_483 137
1424 3300048907 Ga0496104_0772260 Ga0496104_0772260_394_849 137
1425 3300048908 Ga0496105_0277813 Ga0496105_0277813_606_1061 137
1426 3300048908 Ga0496105_1046679 Ga0496105_1046679_72_527 137
1427 3300048909 Ga0496106_1265917 Ga0496106_1265917_47_502 137
1428 3300048910 Ga0496107_0186240 Ga0496107_0186240_1055_1510 137
1429 3300048910 Ga0496107_0496247 Ga0496107_0496247_333_788 137
1430 3300048912 Ga0496109_0202296 Ga0496109_0202296_887_1342 137
1431 3300048913 Ga0496110_0015273 Ga0496110_0015273_2265_2720 137
1432 3300048913 Ga0496110_0759304 Ga0496110_0759304_296_751 137
1433 3300048913 Ga0496110_1197560 Ga0496110_1197560_151_606 137
1434 3300048916 Ga0496113_0040930 Ga0496113_0040930_17_472 137
1435 3300048916 Ga0496113_0050671 Ga0496113_0050671_2577_3032 137
1436 3300048917 Ga0496114_0517560 Ga0496114_0517560_450_905 137
1437 3300048918 Ga0496115_0031336 Ga0496115_0031336_1622_2077 137
1438 3300048918 Ga0496115_0118488 Ga0496115_0118488_907_1362 137
1439 3300048918 Ga0496115_0169903 Ga0496115_0169903_487_942 137
1440 3300048918 Ga0496115_0712322 Ga0496115_0712322_218_673 137
1441 3300048920 Ga0496117_0389840 Ga0496117_0389840_236_661 137
1442 3300048924 Ga0496121_0072058 Ga0496121_0072058_352_807 137
1443 3300048924 Ga0496121_0091909 Ga0496121_0091909_687_1112 137
1444 3300048925 Ga0496122_0000653 Ga0496122_0000653_43086_43541 137
1445 3300048925 Ga0496122_0055165 Ga0496122_0055165_31_486 137
1446 3300048926 Ga0496123_0000196 Ga0496123_0000196_43154_43609 137
1447 3300048926 Ga0496123_0023456 Ga0496123_0023456_1066_1521 137
1448 3300048927 Ga0496124_0001079 Ga0496124_0001079_27006_27431 137
1449 3300048927 Ga0496124_0007424 Ga0496124_0007424_9054_9509 137
1450 3300048927 Ga0496124_0047741 Ga0496124_0047741_1184_1639 137
1451 3300048927 Ga0496124_0280248 Ga0496124_0280248_711_1166 137
1452 3300048927 Ga0496124_0342286 Ga0496124_0342286_107_562 137
1453 3300048928 Ga0496125_0003108 Ga0496125_0003108_17005_17460 137
1454 3300048928 Ga0496125_0052257 Ga0496125_0052257_685_1110 137
1455 3300048928 Ga0496125_0200621 Ga0496125_0200621_266_721 137
1456 3300049127 Ga0501306_031055 Ga0501306_031055_252_707 137
1457 3300049128 Ga0501308_012646 Ga0501308_012646_291_746 137
1458 3300049160 Ga0501304_017110 Ga0501304_017110_142_597 137
1459 3300049459 Ga0495678_013374 Ga0495678_013374_2616_3071 137
1460 3300049459 Ga0495678_016943 Ga0495678_016943_1039_1494 137
1461 3300049460 Ga0495682_0002062 Ga0495682_0002062_9295_9750 137
1462 3300049460 Ga0495682_0036004 Ga0495682_0036004_1107_1562 137
1463 3300049531 Ga0501315_060558 Ga0501315_060558_58_513 137
1464 3300049540 Ga0501324_026192 Ga0501324_026192_68_523 137
1465 3300049822 Ga0501035_0018470 Ga0501035_0018470_3779_4234 137
1466 3300049823 Ga0501044_0164982 Ga0501044_0164982_19_474 137
1467 3300050508 nmdc:mga09592_1296_c1 nmdc:mga09592_1296_c1_12907_13335 137
1468 3300050509 nmdc:mga0qj67_11367_c1 nmdc:mga0qj67_11367_c1_2035_2463 137
1469 3300059505 Ga0587083_0075842 Ga0587083_0075842_224_679 137
1470 3300059604 Ga0587098_022566 Ga0587098_022566_94_549 137
1471 3300059641 Ga0587068_010424 Ga0587068_010424_886_1341 137
1472 3300061719 Ga0466962_0046950 Ga0466962_0046950_1311_1766 137
1473 iso_pu_bacteria 2585428057 2587730469 137
1474 iso_pu_bacteria 2585428058 2587736072 137
1475 iso_pu_bacteria 2588253510 2588293334 137
1476 iso_pu_bacteria 2643221592 2643969066 137
1477 iso_pu_bacteria 2643221625 2644139666 137
1478 iso_pu_bacteria 2643221648 2644275402 137
1479 iso_pu_bacteria 2643221660 2644341358 137
1480 3300002987 JGI25159J45721_1006583 JGI25159J45721_10065833 138
1481 3300003771 Ga0055526_1000410 Ga0055526_10004108 138
1482 3300003773 Ga0055537_1000200 Ga0055537_100020046 138
1483 3300003775 Ga0055524_1008185 Ga0055524_10081854 138
1484 3300003784 Ga0055534_1000083 Ga0055534_100008350 138
1485 3300003790 Ga0055528_1000372 Ga0055528_100037211 138
1486 3300004625 Ga0055543_1004761 Ga0055543_10047612 138
1487 3300005262 Ga0065165_1000120 Ga0065165_100012046 138
1488 3300005339 Ga0070660_101071812 Ga0070660_1010718122 138
1489 3300005548 Ga0070665_102019592 Ga0070665_1020195922 138
1490 3300005564 Ga0070664_100037626 Ga0070664_1000376262 138
1491 3300006177 Ga0075362_10169259 Ga0075362_101692592 138
1492 3300006353 Ga0075370_10181382 Ga0075370_101813822 138
1493 3300009176 Ga0105242_11774809 Ga0105242_117748092 138
1494 3300012506 Ga0157324_1035756 Ga0157324_10357561 138
1495 3300014969 Ga0157376_12097438 Ga0157376_120974381 138
1496 3300025263 Ga0209565_1000068 Ga0209565_1000068111 138
1497 3300025273 Ga0209673_1000119 Ga0209673_1000119111 138
1498 3300025284 Ga0209130_1000057 Ga0209130_1000057153 138
1499 3300025291 Ga0209675_1000068 Ga0209675_1000068111 138
1500 3300025295 Ga0209564_1000149 Ga0209564_100014950 138
1501 3300025299 Ga0209256_1000173 Ga0209256_100017373 138
1502 3300025945 Ga0207679_10024101 Ga0207679_100241015 138
1503 3300026041 Ga0207639_10744272 Ga0207639_107442722 138
1504 3300027614 Ga0209970_1000174 Ga0209970_10001746 138
1505 3300031548 Ga0307408_100002273 Ga0307408_10000227311 138
1506 3300031911 Ga0307412_10134632 Ga0307412_101346322 138
1507 3300037418 Ga0395900_0000133 Ga0395900_0000133_36234_36698 138
1508 3300037466 Ga0395898_0007053 Ga0395898_0007053_5037_5501 138
1509 3300041451 Ga0451791_1752511 Ga0451791_1752511_268_693 138
1510 3300041458 Ga0451798_0266409 Ga0451798_0266409_72_497 138
1511 3300041486 Ga0451807_1373320 Ga0451807_1373320_616_1041 138
1512 3300041505 Ga0451849_1092259 Ga0451849_1092259_1180_1605 138
1513 3300041507 Ga0451851_0023497 Ga0451851_0023497_1266_1691 138
1514 3300041509 Ga0451843_0699320 Ga0451843_0699320_605_1030 138
1515 3300042127 Ga0450890_037914 Ga0450890_037914_186_614 138
1516 3300042134 Ga0450898_062501 Ga0450898_062501_114_542 138
1517 3300042532 Ga0450893_0128648 Ga0450893_0128648_37_465 138
1518 3300044656 Ga0466969_0034564 Ga0466969_0034564_438_875 138
1519 3300044656 Ga0466969_0043321 Ga0466969_0043321_809_1237 138
1520 3300044683 Ga0466965_0017071 Ga0466965_0017071_1875_2312 138
1521 3300044683 Ga0466965_0077681 Ga0466965_0077681_326_754 138
1522 3300044683 Ga0466965_0125565 Ga0466965_0125565_139_570 138
1523 3300044684 Ga0466966_0032499 Ga0466966_0032499_2596_3024 138
1524 3300044684 Ga0466966_0191066 Ga0466966_0191066_102_539 138
1525 3300044693 Ga0466961_0020395 Ga0466961_0020395_196_624 138
1526 3300044693 Ga0466961_0022942 Ga0466961_0022942_1632_2069 138
1527 3300044694 Ga0466963_0024612 Ga0466963_0024612_1438_1875 138
1528 3300044706 Ga0466964_0022795 Ga0466964_0022795_1653_2090 138
1529 3300044712 Ga0453684_0228640 Ga0453684_0228640_995_1423 138
1530 3300044719 Ga0466971_0008028 Ga0466971_0008028_2476_2904 138
1531 3300044719 Ga0466971_0031185 Ga0466971_0031185_1285_1722 138
1532 3300044765 Ga0466970_0028959 Ga0466970_0028959_250_687 138
1533 3300044765 Ga0466970_0085799 Ga0466970_0085799_524_952 138
1534 3300044842 Ga0466957_0035356 Ga0466957_0035356_929_1357 138
1535 3300044901 Ga0466960_0168693 Ga0466960_0168693_30_461 138
1536 3300045049 Ga0466959_0006252 Ga0466959_0006252_7455_7892 138
1537 3300045049 Ga0466959_0117917 Ga0466959_0117917_596_1024 138
1538 3300045051 Ga0451576_0002339 Ga0451576_0002339_12233_12661 138
1539 3300045051 Ga0451576_1686886 Ga0451576_1686886_197_637 138
1540 3300045836 Ga0466958_0077892 Ga0466958_0077892_212_649 138
1541 3300045836 Ga0466958_0109142 Ga0466958_0109142_1231_1659 138
1542 3300045976 Ga0466967_0020086 Ga0466967_0020086_2529_2966 138
1543 3300046452 Ga0495617_013150 Ga0495617_013150_1224_1661 138
1544 3300046459 Ga0495629_0655730 Ga0495629_0655730_21_446 138
1545 3300046460 Ga0495638_0018344 Ga0495638_0018344_285_713 138
1546 3300046460 Ga0495638_0296130 Ga0495638_0296130_113_550 138
1547 3300046474 Ga0495605_0009878 Ga0495605_0009878_2915_3352 138
1548 3300046491 Ga0495584_0032557 Ga0495584_0032557_268_696 138
1549 3300046492 Ga0495585_0025178 Ga0495585_0025178_252_686 138
1550 3300046501 Ga0495607_0010917 Ga0495607_0010917_4301_4729 138
1551 3300046506 Ga0495583_0000016 Ga0495583_0000016_281581_282018 138
1552 3300046506 Ga0495583_0005871 Ga0495583_0005871_513_941 138
1553 3300046507 Ga0495606_0442077 Ga0495606_0442077_176_610 138
1554 3300046512 Ga0495610_0000038 Ga0495610_0000038_125675_126121 138
1555 3300046512 Ga0495610_0033904 Ga0495610_0033904_743_1168 138
1556 3300046513 Ga0495616_0036660 Ga0495616_0036660_1697_2125 138
1557 3300046513 Ga0495616_0259799 Ga0495616_0259799_284_721 138
1558 3300046515 Ga0495620_0294975 Ga0495620_0294975_140_565 138
1559 3300046519 Ga0495632_0086630 Ga0495632_0086630_995_1420 138
1560 3300046522 Ga0495643_0032526 Ga0495643_0032526_569_994 138
1561 3300046523 Ga0495644_0006682 Ga0495644_0006682_2031_2468 138
1562 3300046524 Ga0495648_0001746 Ga0495648_0001746_20421_20858 138
1563 3300046524 Ga0495648_0117986 Ga0495648_0117986_959_1405 138
1564 3300046530 Ga0495654_0047709 Ga0495654_0047709_1613_2053 138
1565 3300046538 Ga0495609_0000525 Ga0495609_0000525_14791_15228 138
1566 3300046538 Ga0495609_0000817 Ga0495609_0000817_19028_19456 138
1567 3300046558 Ga0495633_0005097 Ga0495633_0005097_2912_3349 138
1568 3300046615 Ga0495656_0413918 Ga0495656_0413918_141_578 138
1569 3300046616 Ga0495668_0000434 Ga0495668_0000434_27519_27947 138
1570 3300046616 Ga0495668_0112999 Ga0495668_0112999_790_1218 138
1571 3300046660 Ga0495625_0001624 Ga0495625_0001624_4568_4993 138
1572 3300046660 Ga0495625_0023122 Ga0495625_0023122_2732_3160 138
1573 3300046660 Ga0495625_0051373 Ga0495625_0051373_24_461 138
1574 3300046664 Ga0495659_0000679 Ga0495659_0000679_2172_2600 138
1575 3300046664 Ga0495659_0001640 Ga0495659_0001640_2329_2766 138
1576 3300046665 Ga0495661_0112456 Ga0495661_0112456_420_857 138
1577 3300046683 Ga0495658_0678181 Ga0495658_0678181_81_506 138
1578 3300046684 Ga0495669_0000355 Ga0495669_0000355_19324_19752 138
1579 3300046692 Ga0495671_0000044 Ga0495671_0000044_129439_129885 138
1580 3300046692 Ga0495671_0028581 Ga0495671_0028581_2100_2528 138
1581 3300046692 Ga0495671_0073066 Ga0495671_0073066_1067_1504 138
1582 3300046694 Ga0495649_0019253 Ga0495649_0019253_2605_3033 138
1583 3300047318 Ga0495636_0005184 Ga0495636_0005184_4166_4603 138
1584 3300047318 Ga0495636_0163907 Ga0495636_0163907_513_941 138
1585 3300047320 Ga0495672_0097259 Ga0495672_0097259_31_468 138
1586 3300047323 Ga0495683_0002101 Ga0495683_0002101_7404_7841 138
1587 3300047443 Ga0495687_007947 Ga0495687_007947_2495_2932 138
1588 3300047445 Ga0495677_0004215 Ga0495677_0004215_262_699 138
1589 3300047445 Ga0495677_0006745 Ga0495677_0006745_3783_4211 138
1590 3300047446 Ga0495679_058770 Ga0495679_058770_131_568 138
1591 3300047447 Ga0495685_000035 Ga0495685_000035_32961_33398 138
1592 3300047447 Ga0495685_017962 Ga0495685_017962_232_660 138
1593 3300047469 Ga0495673_0011481 Ga0495673_0011481_2914_3351 138
1594 3300047470 Ga0495681_0008558 Ga0495681_0008558_5579_6007 138
1595 3300047472 Ga0495686_0001301 Ga0495686_0001301_4243_4671 138
1596 3300047472 Ga0495686_0193354 Ga0495686_0193354_661_1089 138
1597 3300048909 Ga0496106_0163178 Ga0496106_0163178_1017_1442 138
1598 3300048911 Ga0496108_1759002 Ga0496108_1759002_67_495 138
1599 3300048912 Ga0496109_0713198 Ga0496109_0713198_80_502 138
1600 3300048917 Ga0496114_0005419 Ga0496114_0005419_2617_3042 138
1601 3300049459 Ga0495678_055256 Ga0495678_055256_933_1361 138
1602 3300049460 Ga0495682_0003012 Ga0495682_0003012_690_1127 138
1603 3300049649 Ga0501198_000020 Ga0501198_000020_41591_42019 138
1604 3300049662 Ga0501222_000025 Ga0501222_000025_33744_34172 138
1605 3300050493 nmdc:mga0k408_303971_c1 nmdc:mga0k408_303971_c1_33_458 138
1606 3300050493 nmdc:mga0k408_471718_c1 nmdc:mga0k408_471718_c1_21_446 138
1607 3300050496 nmdc:mga07m45_216290_c1 nmdc:mga07m45_216290_c1_286_711 138
1608 3300050496 nmdc:mga07m45_602165_c1 nmdc:mga07m45_602165_c1_103_528 138
1609 3300050496 nmdc:mga07m45_89189_c1 nmdc:mga07m45_89189_c1_808_1233 138
1610 3300053088 Ga0500644_0299089 Ga0500644_0299089_104_529 138
1611 3300053134 Ga0500658_0025758 Ga0500658_0025758_524_949 138
1612 3300053739 Ga0500587_000059 Ga0500587_000059_5936_6361 138
1613 3300053739 Ga0500587_073475 Ga0500587_073475_83_508 138
1614 3300061719 Ga0466962_0002387 Ga0466962_0002387_4894_5322 138
1615 3300003347 JGI26128J50194_1000617 JGI26128J50194_10006173 139
1616 3300005356 Ga0070674_100299279 Ga0070674_1002992792 139
1617 3300005367 Ga0070667_100000677 Ga0070667_10000067721 139
1618 3300005367 Ga0070667_100208611 Ga0070667_1002086113 139
1619 3300005456 Ga0070678_101445105 Ga0070678_1014451052 139
1620 3300005578 Ga0068854_100334516 Ga0068854_1003345162 139
1621 3300005614 Ga0068856_100016907 Ga0068856_1000169078 139
1622 3300005617 Ga0068859_100272232 Ga0068859_1002722322 139
1623 3300005844 Ga0068862_100033939 Ga0068862_1000339392 139
1624 3300006237 Ga0097621_101655116 Ga0097621_1016551161 139
1625 3300006358 Ga0068871_100014932 Ga0068871_1000149326 139
1626 3300006881 Ga0068865_100233935 Ga0068865_1002339352 139
1627 3300006881 Ga0068865_100437424 Ga0068865_1004374242 139
1628 3300006931 Ga0097620_100272234 Ga0097620_1002722342 139
1629 3300009545 Ga0105237_10212870 Ga0105237_102128701 139
1630 3300009545 Ga0105237_11143531 Ga0105237_111435312 139
1631 3300012513 Ga0157326_1013205 Ga0157326_10132052 139
1632 3300013297 Ga0157378_11435357 Ga0157378_114353572 139
1633 3300013306 Ga0163162_11716639 Ga0163162_117166392 139
1634 3300014969 Ga0157376_10663038 Ga0157376_106630382 139
1635 3300017792 Ga0163161_10722683 Ga0163161_107226832 139
1636 3300021361 Ga0213872_10000139 Ga0213872_1000013959 139
1637 3300025303 Ga0209051_1003858 Ga0209051_10038587 139
1638 3300025927 Ga0207687_10406772 Ga0207687_104067722 139
1639 3300025937 Ga0207669_11947629 Ga0207669_119476291 139
1640 3300025938 Ga0207704_10083314 Ga0207704_100833142 139
1641 3300025986 Ga0207658_10002360 Ga0207658_100023609 139
1642 3300025986 Ga0207658_10747993 Ga0207658_107479932 139
1643 3300026023 Ga0207677_10892895 Ga0207677_108928951 139
1644 3300026078 Ga0207702_11178159 Ga0207702_111781592 139
1645 3300026088 Ga0207641_10789438 Ga0207641_107894382 139
1646 3300026118 Ga0207675_100408557 Ga0207675_1004085572 139
1647 3300026121 Ga0207683_11291420 Ga0207683_112914202 139
1648 3300027526 Ga0209968_1002465 Ga0209968_10024653 139
1649 3300027695 Ga0209966_1000303 Ga0209966_100030314 139
1650 3300028380 Ga0268265_10558854 Ga0268265_105588542 139
1651 3300028786 Ga0307517_10000052 Ga0307517_1000005253 139
1652 3300028786 Ga0307517_10396630 Ga0307517_103966302 139
1653 3300028794 Ga0307515_10004318 Ga0307515_100043188 139
1654 3300028794 Ga0307515_10026385 Ga0307515_1002638510 139
1655 3300028794 Ga0307515_10047081 Ga0307515_100470818 139
1656 3300028794 Ga0307515_10335364 Ga0307515_103353642 139
1657 3300029957 Ga0265324_10043351 Ga0265324_100433513 139
1658 3300030522 Ga0307512_10072314 Ga0307512_100723142 139
1659 3300030522 Ga0307512_10104738 Ga0307512_101047383 139
1660 3300031456 Ga0307513_10127823 Ga0307513_101278232 139
1661 3300031507 Ga0307509_10012817 Ga0307509_100128179 139
1662 3300031507 Ga0307509_10049892 Ga0307509_100498923 139
1663 3300031507 Ga0307509_10131278 Ga0307509_101312783 139
1664 3300031507 Ga0307509_10218808 Ga0307509_102188082 139
1665 3300031548 Ga0307408_100065404 Ga0307408_1000654043 139
1666 3300031616 Ga0307508_10001110 Ga0307508_1000111019 139
1667 3300031616 Ga0307508_10012672 Ga0307508_100126727 139
1668 3300031616 Ga0307508_10400903 Ga0307508_104009031 139
1669 3300031649 Ga0307514_10002133 Ga0307514_100021334 139
1670 3300031649 Ga0307514_10045424 Ga0307514_100454241 139
1671 3300031730 Ga0307516_10000038 Ga0307516_1000003823 139
1672 3300031731 Ga0307405_10018925 Ga0307405_100189253 139
1673 3300031731 Ga0307405_10348696 Ga0307405_103486962 139
1674 3300031824 Ga0307413_10001478 Ga0307413_1000147812 139
1675 3300031852 Ga0307410_10480113 Ga0307410_104801132 139
1676 3300031901 Ga0307406_10007697 Ga0307406_100076976 139
1677 3300031911 Ga0307412_10003056 Ga0307412_100030567 139
1678 3300031995 Ga0307409_100012773 Ga0307409_1000127732 139
1679 3300031995 Ga0307409_100244130 Ga0307409_1002441302 139
1680 3300032004 Ga0307414_10099483 Ga0307414_100994832 139
1681 3300032005 Ga0307411_10019462 Ga0307411_100194624 139
1682 3300032005 Ga0307411_10156038 Ga0307411_101560382 139
1683 3300032005 Ga0307411_10296460 Ga0307411_102964602 139
1684 3300032126 Ga0307415_100043660 Ga0307415_1000436603 139
1685 3300033180 Ga0307510_10005294 Ga0307510_100052943 139
1686 3300033180 Ga0307510_10253556 Ga0307510_102535562 139
1687 3300035089 Ga0373944_0112318 Ga0373944_0112318_217_651 139
1688 3300035691 Ga0373931_0011745 Ga0373931_0011745_3497_3934 139
1689 3300039447 Ga0436361_0062004 Ga0436361_0062004_8111_8560 139
1690 3300039447 Ga0436361_0239153 Ga0436361_0239153_335_772 139
1691 3300039447 Ga0436361_0692200 Ga0436361_0692200_3556_3993 139
1692 3300041501 Ga0451845_0632488 Ga0451845_0632488_136_570 139
1693 3300042876 Ga0451577_0043475 Ga0451577_0043475_3420_3845 139
1694 3300044712 Ga0453684_0546938 Ga0453684_0546938_525_959 139
1695 3300044712 Ga0453684_1324140 Ga0453684_1324140_94_519 139
1696 3300044901 Ga0466960_0716203 Ga0466960_0716203_33_473 139
1697 3300045051 Ga0451576_0454819 Ga0451576_0454819_231_674 139
1698 3300045051 Ga0451576_0819428 Ga0451576_0819428_37_462 139
1699 3300045976 Ga0466967_0313540 Ga0466967_0313540_1039_1476 139
1700 3300046454 Ga0495592_0000346 Ga0495592_0000346_4513_4947 139
1701 3300046459 Ga0495629_0182113 Ga0495629_0182113_325_759 139
1702 3300046517 Ga0495630_0891788 Ga0495630_0891788_26_460 139
1703 3300046519 Ga0495632_0130761 Ga0495632_0130761_260_694 139
1704 3300046692 Ga0495671_0312540 Ga0495671_0312540_31_465 139
1705 3300048088 Ga0495602_1165652 Ga0495602_1165652_52_486 139
1706 3300048089 Ga0495614_0259825 Ga0495614_0259825_344_778 139
1707 3300048091 Ga0495626_0102698 Ga0495626_0102698_27_461 139
1708 3300048910 Ga0496107_0705493 Ga0496107_0705493_282_713 139
1709 3300048911 Ga0496108_0489275 Ga0496108_0489275_552_983 139
1710 3300048926 Ga0496123_0362392 Ga0496123_0362392_84_518 139
1711 3300049160 Ga0501304_014766 Ga0501304_014766_65_490 139
1712 3300049662 Ga0501222_008087 Ga0501222_008087_289_714 139
1713 3300050493 nmdc:mga0k408_215628_c1 nmdc:mga0k408_215628_c1_671_1099 139
1714 3300050509 nmdc:mga0qj67_142534_c1 nmdc:mga0qj67_142534_c1_425_853 139
1715 3300053080 Ga0500635_0000077 Ga0500635_0000077_741_1169 139
1716 3300053092 Ga0500583_0302745 Ga0500583_0302745_310_744 139
1717 3300053093 Ga0500651_0021759 Ga0500651_0021759_521_955 139
1718 3300053098 Ga0500650_0276913 Ga0500650_0276913_70_504 139
1719 3300053118 Ga0500594_0001239 Ga0500594_0001239_4039_4473 139
1720 3300053126 Ga0500621_258815 Ga0500621_258815_64_498 139
1721 3300053136 Ga0500559_0003197 Ga0500559_0003197_4452_4886 139
1722 3300053139 Ga0500568_0001164 Ga0500568_0001164_568_1002 139
1723 3300053154 Ga0500619_000008 Ga0500619_000008_65106_65534 139
1724 3300053154 Ga0500619_054905 Ga0500619_054905_744_1178 139
1725 3300053156 Ga0500622_0073705 Ga0500622_0073705_924_1358 139
1726 3300053177 Ga0500636_0133130 Ga0500636_0133130_495_929 139
1727 3300053739 Ga0500587_003765 Ga0500587_003765_748_1182 139
1728 3300005563 Ga0068855_100714985 Ga0068855_1007149852 140
1729 3300006353 Ga0075370_10051619 Ga0075370_100516192 140
1730 3300017792 Ga0163161_10048829 Ga0163161_100488292 140
1731 3300026078 Ga0207702_11365627 Ga0207702_113656271 140
1732 3300033180 Ga0307510_10037378 Ga0307510_100373785 140
1733 3300049671 Ga0501238_026390 Ga0501238_026390_151_591 140
1734 3300053121 Ga0500607_109745 Ga0500607_109745_577_1014 140
1735 3300053131 Ga0500652_193579 Ga0500652_193579_364_801 140
1736 3300053136 Ga0500559_0490266 Ga0500559_0490266_96_533 140
1737 3300001979 JGI24740J21852_10016707 JGI24740J21852_100167073 141
1738 3300005563 Ga0068855_100139662 Ga0068855_1001396623 141
1739 3300005616 Ga0068852_100455717 Ga0068852_1004557171 141
1740 3300006051 Ga0075364_10686904 Ga0075364_106869042 141
1741 3300006177 Ga0075362_10105057 Ga0075362_101050572 141
1742 3300006177 Ga0075362_10232140 Ga0075362_102321402 141
1743 3300006178 Ga0075367_10485311 Ga0075367_104853112 141
1744 3300006195 Ga0075366_10161165 Ga0075366_101611652 141
1745 3300006353 Ga0075370_10011463 Ga0075370_100114636 141
1746 3300006353 Ga0075370_10020006 Ga0075370_100200063 141
1747 3300009177 Ga0105248_10000595 Ga0105248_1000059515 141
1748 3300014325 Ga0163163_11056694 Ga0163163_110566942 141
1749 3300025900 Ga0207710_10372598 Ga0207710_103725981 141
1750 3300025931 Ga0207644_10062491 Ga0207644_100624911 141
1751 3300025941 Ga0207711_10001919 Ga0207711_1000191912 141
1752 3300025949 Ga0207667_10115407 Ga0207667_101154073 141
1753 3300028794 Ga0307515_10361979 Ga0307515_103619792 141
1754 3300031730 Ga0307516_10254243 Ga0307516_102542432 141
1755 3300033180 Ga0307510_10468508 Ga0307510_104685081 141
1756 3300037471 Ga0395905_0008541 Ga0395905_0008541_6557_6994 141
1757 3300044712 Ga0453684_0147265 Ga0453684_0147265_80_517 141
1758 3300046460 Ga0495638_0199792 Ga0495638_0199792_670_1104 141
1759 3300046519 Ga0495632_0011269 Ga0495632_0011269_2614_3048 141
1760 3300046660 Ga0495625_0093430 Ga0495625_0093430_1259_1693 141
1761 3300048903 Ga0496100_0425875 Ga0496100_0425875_510_947 141
1762 3300048907 Ga0496104_0145130 Ga0496104_0145130_845_1282 141
1763 3300048908 Ga0496105_0086137 Ga0496105_0086137_1178_1615 141
1764 3300048909 Ga0496106_0758867 Ga0496106_0758867_175_609 141
1765 3300048912 Ga0496109_0061400 Ga0496109_0061400_2783_3220 141
1766 3300048912 Ga0496109_0161761 Ga0496109_0161761_952_1389 141
1767 3300048914 Ga0496111_0133500 Ga0496111_0133500_987_1424 141
1768 3300048915 Ga0496112_0059576 Ga0496112_0059576_885_1322 141
1769 3300048916 Ga0496113_0065917 Ga0496113_0065917_73_510 141
1770 3300048916 Ga0496113_0375616 Ga0496113_0375616_224_661 141
1771 3300050489 nmdc:mga03683_106114_c1 nmdc:mga03683_106114_c1_664_1098 141
1772 3300050490 nmdc:mga03n38_95341_c1 nmdc:mga03n38_95341_c1_49_483 141
1773 3300050491 nmdc:mga00v17_823376_c1 nmdc:mga00v17_823376_c1_69_503 141
1774 3300050493 nmdc:mga0k408_140886_c1 nmdc:mga0k408_140886_c1_324_758 141
1775 3300050494 nmdc:mga06z11_388436_c1 nmdc:mga06z11_388436_c1_327_761 141
1776 3300050496 nmdc:mga07m45_9660_c1 nmdc:mga07m45_9660_c1_3056_3490 141
1777 3300053090 Ga0500646_0058230 Ga0500646_0058230_427_861 141
1778 3300053109 Ga0500569_016845 Ga0500569_016845_1397_1831 141
1779 3300053130 Ga0500642_0022296 Ga0500642_0022296_55_489 141
1780 3300053131 Ga0500652_001857 Ga0500652_001857_2085_2519 141
1781 3300053139 Ga0500568_0013489 Ga0500568_0013489_2898_3332 141
1782 3300053142 Ga0500577_0003430 Ga0500577_0003430_202_636 141
1783 3300053147 Ga0500589_202111 Ga0500589_202111_194_628 141
1784 3300053151 Ga0500604_0318967 Ga0500604_0318967_79_513 141
1785 3300053156 Ga0500622_0007164 Ga0500622_0007164_3859_4293 141

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

6

136

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.9011 60 135
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.89 60 135
8pek-assembly1.cif.gz_B structure of the dimeric, periplasmic domain of exbd 0.7508 44 141
4ipt-assembly1.cif.gz_A the crystal structure of a short-chain dehydrogenases/reductase (ethylated) from veillonella parvula dsm 2008 0.7484 82 138
2jwl-assembly1.cif.gz_B solution structure of periplasmic domain of tolr from h. influenzae with saxs data 0.7258 60 128
ID Description Score Start End Superfamily
2jwlB00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.7258 60 128 3.30.420.270
1u04A03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7141 80 134 3.40.50.2300
af_Q86IH8_5_206_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7104 77 134 3.30.420.40
af_Q6L4S6_46_242_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7021 78 134 3.30.420.40
2b3yB02 Alpha Beta;3-Layer(aba) Sandwich;Aconitase; Domain 2;Aconitase, Domain 2 0.7012 84 133 3.40.1060.10
ID Description Score Start End GO Terms
AF-A0A1Y5Q6K5-F1-model_v4 Biopolymer transport protein ExbD/TolR 0.9508 63 134 GO:0005886
GO:0015031
GO:0022857
AF-A0A5C7VJF9-F1-model_v4 Biopolymer transporter ExbD 0.9411 62 139 GO:0005886
GO:0015031
GO:0022857
AF-A0A3B9DG87-F1-model_v4 Biopolymer transporter ExbD 0.9021 56 139 GO:0005886
GO:0015031
GO:0022857
AF-A0A139DB72-F1-model_v4 Biopolymer transport protein ExbD 0.9011 60 141 GO:0005886
GO:0015031
GO:0022857
AF-F3LFH7-F1-model_v4 Biopolymer transport protein ExbD/TolR 0.8989 60 141 GO:0005886
GO:0015031
GO:0022857

Feature Viewer

pLDDT pTM Quality
77.24 0.53 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map