F495567

General Info

Members Datasets Scaffolds Average Seq Length
1749 623 1624 347

Family's Representative Sequence

Representative Sequence 3300035410|Ga0373924_0001379|Ga0373924_0001379_2658_3896
Length 412
Sequence MRPLWLTTASEPRALNQNNQSEATRGERFLDQQRSPERLGATETPSWTARRSPLGFDPTWREPLKHWTTLAAAGVIAAVAFVPAKAADISGAGATFPYPIYAKWADAYRKVTGNGLNYQSIGSGGGIKQIKAKTVTFGASDAPLPGKELDEAGLAQFPMVMGGIVPVVNLDGVNPGDLTIDGPTLAKIFLGEIKTWDDPAIKKLNPNVKLPSQAIAIVHRSDGSGTTYNFAYYLAEVSPDWKSQVGVNTSVQWPSGIGAKGNEGVANNVANTKGSIGYVEYAYAKQNKLTYTKMVNKAGKAVAPTSEAFQAAAANADWKSQPGYGVILANQAGDSSWPMTAATWILVYKQPSDAAATGEALKFFAWAYKNGGKMAEELDYVPMPANVVKDVEKTWSGEIKDASGKPVFAMTN

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
3 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
4 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
5 2512875024 Mesorhizobium loti R88b Isolate Nodule
6 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
7 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
8 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
9 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
10 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
11 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
12 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
13 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
14 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
15 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
16 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
17 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
18 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
19 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
20 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
21 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
22 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
23 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
24 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
25 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
26 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
27 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
28 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
29 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
30 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
31 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
32 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
33 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
34 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
35 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
36 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
37 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
38 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
39 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
40 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
41 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
42 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
43 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
44 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
45 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
46 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
47 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
48 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
49 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
50 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
51 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
52 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
53 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
54 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
55 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
56 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
57 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
58 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
59 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
60 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
61 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
62 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
63 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
64 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
65 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
66 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
67 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
68 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
69 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
70 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
71 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
72 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
73 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
74 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
75 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
76 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
77 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
78 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
79 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
80 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
81 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
82 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
83 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
84 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
85 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
86 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
87 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
88 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
89 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
90 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
91 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
92 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
93 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
94 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
95 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
96 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
97 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
98 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
99 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
100 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
101 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
102 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
103 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
104 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
105 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
106 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
107 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
108 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
109 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
110 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
111 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
112 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
113 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
114 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
115 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
116 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
117 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
118 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
119 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
120 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
121 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
122 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
123 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
124 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
125 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
126 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
127 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
128 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
129 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
130 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
131 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
132 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
133 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
134 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
135 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
136 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
137 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
138 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
139 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
140 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
141 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
142 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
143 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
144 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
145 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
146 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
147 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
148 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
149 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
150 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
151 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
152 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
153 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
154 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
155 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
156 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
157 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
158 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
159 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
160 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
161 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
162 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
163 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
164 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
165 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
166 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
167 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
168 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
169 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
170 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
171 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
172 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
173 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
174 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
175 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
176 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
177 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
178 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
179 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
180 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
181 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
182 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
183 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
184 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
185 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
186 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
187 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
188 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
189 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
190 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
191 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
192 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
193 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
194 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
195 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
196 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
197 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
198 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
199 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
200 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
201 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
202 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
203 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
204 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
205 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
206 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
207 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
208 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
209 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
210 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
211 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
212 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
213 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
214 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
215 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
216 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
217 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
218 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
219 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
220 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
221 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
222 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
223 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
224 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
225 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
226 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
227 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
228 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
229 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
230 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
231 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
232 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
233 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
234 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
235 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
236 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
237 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
238 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
239 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
240 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
241 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
242 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
243 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
244 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
245 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
246 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
247 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
248 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
249 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
250 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
251 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
252 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
253 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
254 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
255 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
256 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
257 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
258 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
259 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
260 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
261 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
262 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
263 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
264 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
265 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
266 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
267 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
268 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
269 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
270 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
271 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
272 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
273 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
274 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
275 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
276 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
277 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
278 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
279 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
280 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
281 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
282 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
283 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
284 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
285 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
286 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
287 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
288 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
289 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
290 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
291 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
292 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
293 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
294 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
295 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
296 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
297 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
298 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
299 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
300 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
301 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
302 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
303 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
305 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
306 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
307 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
308 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
309 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
363 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
364 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
365 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
368 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
369 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
370 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
371 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
372 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
373 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
375 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
376 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
377 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
378 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
379 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
380 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
382 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
383 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
384 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
385 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
386 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
387 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
388 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
389 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
390 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
391 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
392 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
393 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
394 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
395 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
396 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
397 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
398 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
399 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
400 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
401 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
402 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
403 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
404 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
405 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
406 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
408 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
409 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
410 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
411 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
412 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
413 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
414 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
415 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
416 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
417 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
418 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
419 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
420 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
421 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
422 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
423 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
424 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
425 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
426 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
427 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
428 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
429 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
430 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
431 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
432 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
433 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
434 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
435 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
436 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
437 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
438 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
439 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
440 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
441 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
442 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
443 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
444 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
445 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
446 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
447 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
448 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
449 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
450 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
451 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
452 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
453 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
454 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
455 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
456 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
457 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
458 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
459 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
460 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
461 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
462 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
463 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
464 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
465 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
466 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
467 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
468 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
469 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
470 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
471 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
472 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
473 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
474 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
475 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
476 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
477 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
478 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
479 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
480 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
481 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
482 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
483 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
484 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
485 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
486 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
487 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
488 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
489 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
490 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
491 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
492 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
493 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
494 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
495 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
496 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
497 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
498 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
499 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
500 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
501 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
502 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
503 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
504 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
505 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
506 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
507 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
508 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
509 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
510 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
511 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
512 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
513 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
514 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
515 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
516 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
517 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
518 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
519 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
520 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
521 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
522 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
523 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
524 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
525 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
526 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
527 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
528 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
529 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
530 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
531 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
532 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
533 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
534 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
535 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
536 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
537 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
538 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
539 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
540 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
541 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
542 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
543 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
544 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
545 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
546 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
547 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
548 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
549 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
550 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
551 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
552 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
553 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
554 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
555 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
556 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
557 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
558 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
559 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
560 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
561 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
562 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
563 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
564 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
565 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
566 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
567 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
568 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
569 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
570 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
571 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
572 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
573 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
574 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
575 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
576 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
577 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
578 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
579 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
580 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
581 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
582 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
583 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
584 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
585 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
586 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
587 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
588 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
589 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
590 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
591 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
592 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
593 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
594 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
595 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
596 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
597 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
598 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
599 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
600 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
601 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
602 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
603 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
604 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
605 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
606 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
607 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
608 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
609 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
610 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
611 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
612 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
613 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
614 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
615 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
616 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
617 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
618 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
619 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
620 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
621 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
622 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
623 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.34
Metatranscriptomes 0.51
Isolates 7.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.4
Nodule 5.26
Rhizoplane 6.63
Rhizosphere 80.85
Stem 0
Stem Tuber 0
Unclassified 2.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214745216 2209111006 Bacteria 14541
2 ARcpr5yngRDRAFT_c000295 3300000043 Bacteria 7045
3 ARSoilOldRDRAFT_c000016 3300000044 Bacteria 39308
4 ARCol0yngRDRAFT_1000324 3300000652 Bacteria 7130
5 JGI24741J21665_1010360 3300001915 Bacteria 1671
6 JGI24746J21847_1000674 3300001977 Bacteria 5230
7 JGI24740J21852_10003708 3300001979 Bacteria 6659
8 JGI24737J22298_10005956 3300001990 Bacteria 4187
9 JGI24737J22298_10014252 3300001990 Bacteria 2582
10 JGI24737J22298_10019789 3300001990 Bacteria 2152
11 JGI24735J21928_10036479 3300002067 Bacteria 1442
12 JGI24750J21931_1000863 3300002070 Bacteria 4166
13 JGI24738J21930_10011175 3300002075 Bacteria 1980
14 JGI24749J21850_1000794 3300002076 Bacteria 4538
15 JGI24033J26618_1001038 3300002155 Bacteria 2691
16 JGI24034J26672_10000405 3300002239 Bacteria 5579
17 JGI24742J22300_10000245 3300002244 Bacteria 8087
18 JGI24751J29686_10024238 3300002459 Bacteria 1258
19 JGI25156J39149_1002724 3300002705 Bacteria 6156
20 JGI25162J39368_1006977 3300002737 Bacteria 1834
21 JGI25157J39369_1001000 3300002741 Bacteria 13134
22 JGI25159J45721_1017140 3300002987 Bacteria 1510
23 JGI25151J46595_10000212 3300003187 Bacteria 70741
24 JGI25406J46586_10035163 3300003203 Bacteria 1831
25 JGI25165J46597_1001163 3300003214 Bacteria 16237
26 JGI25160J50197_1003644 3300003354 Bacteria 6831
27 Ga0055538_1000013 3300003751 Bacteria 348596
28 Ga0055539_1000018 3300003752 Bacteria 348596
29 Ga0055533_1000022 3300003756 Bacteria 348596
30 Ga0055525_1000024 3300003759 Bacteria 348596
31 Ga0055541_1000013 3300003841 Bacteria 348596
32 Ga0065165_1001551 3300005262 Bacteria 23972
33 Ga0065712_10001131 3300005290 Bacteria 11020
34 Ga0065712_10074595 3300005290 Bacteria 4053
35 Ga0065715_10000410 3300005293 Bacteria 12175
36 Ga0065715_10100594 3300005293 Bacteria 3287
37 Ga0070658_10001834 3300005327 Bacteria 17883
38 Ga0070658_10009761 3300005327 Bacteria 7709
39 Ga0070676_10000464 3300005328 Bacteria 19426
40 Ga0070676_10019390 3300005328 Bacteria 3784
41 Ga0070683_100000585 3300005329 Bacteria 26003
42 Ga0070683_100250422 3300005329 Bacteria 1685
43 Ga0070690_100004127 3300005330 Bacteria 8043
44 Ga0070690_100009515 3300005330 Bacteria 5633
45 Ga0070690_100028137 3300005330 Bacteria 3480
46 Ga0070690_100039896 3300005330 Bacteria 2968
47 Ga0070690_100065207 3300005330 Bacteria 2355
48 Ga0070670_100007178 3300005331 Bacteria 9436
49 Ga0070670_100056455 3300005331 Bacteria 3369
50 Ga0070670_100076571 3300005331 Bacteria 2874
51 Ga0070670_100217389 3300005331 Bacteria 1662
52 Ga0070677_10000046 3300005333 Bacteria 38785
53 Ga0068869_100021357 3300005334 Bacteria 4452
54 Ga0068869_100022382 3300005334 Bacteria 4355
55 Ga0068869_100216213 3300005334 Bacteria 1517
56 Ga0070666_10012206 3300005335 Bacteria 5413
57 Ga0070666_10051877 3300005335 Bacteria 2763
58 Ga0070666_10072158 3300005335 Bacteria 2350
59 Ga0070666_10117387 3300005335 Bacteria 1843
60 Ga0070666_10139618 3300005335 Bacteria 1687
61 Ga0070680_100006747 3300005336 Bacteria 8746
62 Ga0070680_100031728 3300005336 Bacteria 4248
63 Ga0070680_100037082 3300005336 Bacteria 3939
64 Ga0070680_100037705 3300005336 Bacteria 3906
65 Ga0070680_100048950 3300005336 Bacteria 3445
66 Ga0070682_100001270 3300005337 Bacteria 14321
67 Ga0070682_100001743 3300005337 Bacteria 12102
68 Ga0070682_100004957 3300005337 Bacteria 7395
69 Ga0068868_100002324 3300005338 Bacteria 13150
70 Ga0068868_100177126 3300005338 Bacteria 1767
71 Ga0070660_100001207 3300005339 Bacteria 17536
72 Ga0070660_100001439 3300005339 Bacteria 16241
73 Ga0070660_100005336 3300005339 Bacteria 8894
74 Ga0070660_100034495 3300005339 Bacteria 3823
75 Ga0070660_100092923 3300005339 Bacteria 2381
76 Ga0070660_100093896 3300005339 Bacteria 2369
77 Ga0070689_100005142 3300005340 Bacteria 8898
78 Ga0070689_100022920 3300005340 Bacteria 4668
79 Ga0070689_100027162 3300005340 Bacteria 4314
80 Ga0070689_100029436 3300005340 Bacteria 4157
81 Ga0070689_100031553 3300005340 Bacteria 4027
82 Ga0070691_10003924 3300005341 Bacteria 6729
83 Ga0070691_10022648 3300005341 Bacteria 2916
84 Ga0070691_10038763 3300005341 Bacteria 2251
85 Ga0070691_10054484 3300005341 Bacteria 1914
86 Ga0070687_100010425 3300005343 Bacteria 4019
87 Ga0070661_100003067 3300005344 Bacteria 11489
88 Ga0070661_100008310 3300005344 Bacteria 7169
89 Ga0070661_100054000 3300005344 Bacteria 2942
90 Ga0070661_100080466 3300005344 Bacteria 2405
91 Ga0070692_10000143 3300005345 Bacteria 17327
92 Ga0070692_10000212 3300005345 Bacteria 15753
93 Ga0070692_10019851 3300005345 Bacteria 3249
94 Ga0070692_10145410 3300005345 Bacteria 1346
95 Ga0070668_100009504 3300005347 Bacteria 7213
96 Ga0070668_100033083 3300005347 Bacteria 3935
97 Ga0070668_100129203 3300005347 Bacteria 2026
98 Ga0070669_100001661 3300005353 Bacteria 16093
99 Ga0070669_100055900 3300005353 Bacteria 2892
100 Ga0070675_100041716 3300005354 Bacteria 3748
101 Ga0070675_100223164 3300005354 Bacteria 1642
102 Ga0070671_100008864 3300005355 Bacteria 8071
103 Ga0070671_100061481 3300005355 Bacteria 3128
104 Ga0070671_100107968 3300005355 Bacteria 2337
105 Ga0070671_100170379 3300005355 Bacteria 1841
106 Ga0070673_100000632 3300005364 Bacteria 19293
107 Ga0070673_100002974 3300005364 Bacteria 10456
108 Ga0070673_100062830 3300005364 Bacteria 2952
109 Ga0070688_100001875 3300005365 Bacteria 10531
110 Ga0070688_100004634 3300005365 Bacteria 7178
111 Ga0070688_100036157 3300005365 Bacteria 3003
112 Ga0070688_100048065 3300005365 Bacteria 2649
113 Ga0070659_100001512 3300005366 Bacteria 16767
114 Ga0070659_100001860 3300005366 Bacteria 15172
115 Ga0070659_100002503 3300005366 Bacteria 13048
116 Ga0070659_100010095 3300005366 Bacteria 6951
117 Ga0070659_100207364 3300005366 Bacteria 1614
118 Ga0070667_100002378 3300005367 Bacteria 16480
119 Ga0070667_100007002 3300005367 Bacteria 9373
120 Ga0070667_100067331 3300005367 Bacteria 3044
121 Ga0070667_100084453 3300005367 Bacteria 2721
122 Ga0070667_100104480 3300005367 Bacteria 2450
123 Ga0070667_100438524 3300005367 Bacteria 1192
124 Ga0070703_10003660 3300005406 Bacteria 4362
125 Ga0070703_10005029 3300005406 Bacteria 3690
126 Ga0070703_10020423 3300005406 Bacteria 1927
127 Ga0070709_10003370 3300005434 Bacteria 8589
128 Ga0070709_10012359 3300005434 Bacteria 4777
129 Ga0070709_10040424 3300005434 Bacteria 2867
130 Ga0070709_10235677 3300005434 Bacteria 1312
131 Ga0070714_100033879 3300005435 Bacteria 4274
132 Ga0070714_100103416 3300005435 Bacteria 2512
133 Ga0070714_100226559 3300005435 Bacteria 1720
134 Ga0070713_100000386 3300005436 Bacteria 28227
135 Ga0070713_100030406 3300005436 Bacteria 4288
136 Ga0070713_100043416 3300005436 Bacteria 3675
137 Ga0070713_100171755 3300005436 Bacteria 1942
138 Ga0070710_10003608 3300005437 Bacteria 7327
139 Ga0070710_10035957 3300005437 Bacteria 2704
140 Ga0070710_10042117 3300005437 Bacteria 2523
141 Ga0070701_10000116 3300005438 Bacteria 23157
142 Ga0070701_10006855 3300005438 Bacteria 4821
143 Ga0070701_10007667 3300005438 Bacteria 4627
144 Ga0070701_10090486 3300005438 Bacteria 1675
145 Ga0070711_100008865 3300005439 Bacteria 6172
146 Ga0070711_100017123 3300005439 Bacteria 4610
147 Ga0070711_100096113 3300005439 Bacteria 2145
148 Ga0070711_100101069 3300005439 Bacteria 2098
149 Ga0070705_100000435 3300005440 Bacteria 23909
150 Ga0070705_100001613 3300005440 Bacteria 11828
151 Ga0070705_100006545 3300005440 Bacteria 5718
152 Ga0070700_100004259 3300005441 Bacteria 7469
153 Ga0070700_100007519 3300005441 Bacteria 5889
154 Ga0070700_100247718 3300005441 Bacteria 1276
155 Ga0070694_100000368 3300005444 Bacteria 24171
156 Ga0070694_100001961 3300005444 Bacteria 12202
157 Ga0070694_100003022 3300005444 Bacteria 10020
158 Ga0070694_100047632 3300005444 Bacteria 2882
159 Ga0070708_100065234 3300005445 Bacteria 3265
160 Ga0070708_100157380 3300005445 Bacteria 2116
161 Ga0070663_100003744 3300005455 Bacteria 8822
162 Ga0070663_100011775 3300005455 Bacteria 5506
163 Ga0070663_100033747 3300005455 Bacteria 3538
164 Ga0070663_100043766 3300005455 Bacteria 3152
165 Ga0070663_100191582 3300005455 Bacteria 1591
166 Ga0070678_100008297 3300005456 Bacteria 6217
167 Ga0070678_100101399 3300005456 Bacteria 2232
168 Ga0070678_100359909 3300005456 Bacteria 1253
169 Ga0070662_100007732 3300005457 Bacteria 6978
170 Ga0070662_100018718 3300005457 Bacteria 4689
171 Ga0070662_100027626 3300005457 Bacteria 3941
172 Ga0070662_100080659 3300005457 Bacteria 2423
173 Ga0070662_100197186 3300005457 Bacteria 1595
174 Ga0070662_100275103 3300005457 Bacteria 1361
175 Ga0070681_10004628 3300005458 Bacteria 13135
176 Ga0070681_10010068 3300005458 Bacteria 9320
177 Ga0070681_10021669 3300005458 Bacteria 6444
178 Ga0070681_10045357 3300005458 Bacteria 4398
179 Ga0070681_10118690 3300005458 Bacteria 2582
180 Ga0070681_10166828 3300005458 Bacteria 2124
181 Ga0068867_100000619 3300005459 Bacteria 23562
182 Ga0068867_100044695 3300005459 Bacteria 3245
183 Ga0068867_100192542 3300005459 Bacteria 1628
184 Ga0068867_100286889 3300005459 Bacteria 1352
185 Ga0070685_10036947 3300005466 Bacteria 2764
186 Ga0070685_10049384 3300005466 Bacteria 2426
187 Ga0070685_10085586 3300005466 Bacteria 1899
188 Ga0070706_100105127 3300005467 Bacteria 2626
189 Ga0070707_100125319 3300005468 Bacteria 2495
190 Ga0070698_100013388 3300005471 Bacteria 8681
191 Ga0070699_100003034 3300005518 Bacteria 14900
192 Ga0070679_100008124 3300005530 Bacteria 9857
193 Ga0070679_100043337 3300005530 Bacteria 4482
194 Ga0070679_100057897 3300005530 Bacteria 3862
195 Ga0070679_100082575 3300005530 Bacteria 3203
196 Ga0070679_100110921 3300005530 Bacteria 2729
197 Ga0070679_100137078 3300005530 Bacteria 2428
198 Ga0070679_100211017 3300005530 Bacteria 1906
199 Ga0070679_100433478 3300005530 Bacteria 1259
200 Ga0070684_100006410 3300005535 Bacteria 9104
201 Ga0070684_100007789 3300005535 Bacteria 8354
202 Ga0070684_100028223 3300005535 Bacteria 4746
203 Ga0070697_100052206 3300005536 Bacteria 3322
204 Ga0070697_100069495 3300005536 Bacteria 2885
205 Ga0068853_100000648 3300005539 Bacteria 23884
206 Ga0068853_100001956 3300005539 Bacteria 15182
207 Ga0068853_100011111 3300005539 Bacteria 7304
208 Ga0068853_100014654 3300005539 Bacteria 6429
209 Ga0068853_100083538 3300005539 Bacteria 2798
210 Ga0068853_100089534 3300005539 Bacteria 2703
211 Ga0070672_100026958 3300005543 Bacteria 4283
212 Ga0070672_100052367 3300005543 Bacteria 3186
213 Ga0070672_100227059 3300005543 Bacteria 1567
214 Ga0070686_100003905 3300005544 Bacteria 8194
215 Ga0070686_100004208 3300005544 Bacteria 7923
216 Ga0070695_100003941 3300005545 Bacteria 8665
217 Ga0070695_100004414 3300005545 Bacteria 8258
218 Ga0070695_100007956 3300005545 Bacteria 6278
219 Ga0070695_100014292 3300005545 Bacteria 4785
220 Ga0070695_100021946 3300005545 Bacteria 3912
221 Ga0070695_100042543 3300005545 Bacteria 2884
222 Ga0070695_100049811 3300005545 Bacteria 2682
223 Ga0070695_100094242 3300005545 Bacteria 2005
224 Ga0070696_100000223 3300005546 Bacteria 34303
225 Ga0070696_100013073 3300005546 Bacteria 5570
226 Ga0070696_100021646 3300005546 Bacteria 4360
227 Ga0070696_100038171 3300005546 Bacteria 3314
228 Ga0070696_100058339 3300005546 Bacteria 2695
229 Ga0070696_100264393 3300005546 Bacteria 1306
230 Ga0070693_100001308 3300005547 Bacteria 11215
231 Ga0070693_100001925 3300005547 Bacteria 9497
232 Ga0070693_100079910 3300005547 Bacteria 1947
233 Ga0070693_100144298 3300005547 Bacteria 1502
234 Ga0070665_100256158 3300005548 Bacteria 1751
235 Ga0070665_100274845 3300005548 Bacteria 1686
236 Ga0070665_100352391 3300005548 Bacteria 1477
237 Ga0070704_100000828 3300005549 Bacteria 15365
238 Ga0070704_100018448 3300005549 Bacteria 4462
239 Ga0070704_100060594 3300005549 Bacteria 2704
240 Ga0070704_100079940 3300005549 Bacteria 2403
241 Ga0070704_100119912 3300005549 Bacteria 2019
242 Ga0068855_100000899 3300005563 Bacteria 36852
243 Ga0068855_100004004 3300005563 Bacteria 17986
244 Ga0068855_100004638 3300005563 Bacteria 16774
245 Ga0068855_100009214 3300005563 Bacteria 11924
246 Ga0068855_100011187 3300005563 Bacteria 10836
247 Ga0068855_100021137 3300005563 Bacteria 7803
248 Ga0068855_100053507 3300005563 Bacteria 4749
249 Ga0068855_100060803 3300005563 Bacteria 4416
250 Ga0068855_100080155 3300005563 Bacteria 3786
251 Ga0068855_100090060 3300005563 Bacteria 3541
252 Ga0070664_100017145 3300005564 Bacteria 5946
253 Ga0070664_100032140 3300005564 Bacteria 4389
254 Ga0070664_100043313 3300005564 Bacteria 3798
255 Ga0068857_100000410 3300005577 Bacteria 30246
256 Ga0068857_100016636 3300005577 Bacteria 6443
257 Ga0068857_100037380 3300005577 Bacteria 4301
258 Ga0068857_100052140 3300005577 Bacteria 3630
259 Ga0068857_100057062 3300005577 Bacteria 3466
260 Ga0068857_100070302 3300005577 Bacteria 3118
261 Ga0068854_100002119 3300005578 Bacteria 12172
262 Ga0068854_100007930 3300005578 Bacteria 6797
263 Ga0068854_100108048 3300005578 Bacteria 2095
264 Ga0068854_100156525 3300005578 Bacteria 1761
265 Ga0068856_100001929 3300005614 Bacteria 21620
266 Ga0068856_100004841 3300005614 Bacteria 13344
267 Ga0068856_100154628 3300005614 Bacteria 2304
268 Ga0068856_100267164 3300005614 Bacteria 1726
269 Ga0068856_100331220 3300005614 Bacteria 1540
270 Ga0070702_100002188 3300005615 Bacteria 8332
271 Ga0070702_100009688 3300005615 Bacteria 4724
272 Ga0070702_100028826 3300005615 Bacteria 3012
273 Ga0070702_100040401 3300005615 Bacteria 2610
274 Ga0070702_100053891 3300005615 Bacteria 2312
275 Ga0068852_100005642 3300005616 Bacteria 8977
276 Ga0068852_100024277 3300005616 Bacteria 4897
277 Ga0068852_100025918 3300005616 Bacteria 4758
278 Ga0068852_100039982 3300005616 Bacteria 3953
279 Ga0068859_100004306 3300005617 Bacteria 14521
280 Ga0068859_100005293 3300005617 Bacteria 13119
281 Ga0068859_100011499 3300005617 Bacteria 8898
282 Ga0068859_100037056 3300005617 Bacteria 4895
283 Ga0068859_100087393 3300005617 Bacteria 3165
284 Ga0068859_100127127 3300005617 Bacteria 2618
285 Ga0068864_100000501 3300005618 Bacteria 33748
286 Ga0068864_100022809 3300005618 Bacteria 5250
287 Ga0068864_100075952 3300005618 Bacteria 2934
288 Ga0068864_100126771 3300005618 Bacteria 2288
289 Ga0068864_100240374 3300005618 Bacteria 1678
290 Ga0068866_10004992 3300005718 Bacteria 5463
291 Ga0068866_10077661 3300005718 Bacteria 1774
292 Ga0068861_100024530 3300005719 Bacteria 4362
293 Ga0068861_100028822 3300005719 Bacteria 4054
294 Ga0068851_10179234 3300005834 Bacteria 1173
295 Ga0068870_10000104 3300005840 Bacteria 28590
296 Ga0068870_10089933 3300005840 Bacteria 1714
297 Ga0068863_100029050 3300005841 Bacteria 5281
298 Ga0068863_100068930 3300005841 Bacteria 3345
299 Ga0068863_100094817 3300005841 Bacteria 2832
300 Ga0068863_100105499 3300005841 Bacteria 2681
301 Ga0068863_100112033 3300005841 Bacteria 2599
302 Ga0068863_100142159 3300005841 Bacteria 2294
303 Ga0068858_100033292 3300005842 Bacteria 4785
304 Ga0068858_100057367 3300005842 Bacteria 3599
305 Ga0068858_100068794 3300005842 Bacteria 3281
306 Ga0068858_100172578 3300005842 Bacteria 2039
307 Ga0068860_100006221 3300005843 Bacteria 12003
308 Ga0068860_100011137 3300005843 Bacteria 8860
309 Ga0068860_100012678 3300005843 Bacteria 8293
310 Ga0068860_100142487 3300005843 Bacteria 2304
311 Ga0068860_100155082 3300005843 Bacteria 2206
312 Ga0068860_100362834 3300005843 Bacteria 1427
313 Ga0068862_100002625 3300005844 Bacteria 15832
314 Ga0068862_100002741 3300005844 Bacteria 15462
315 Ga0068862_100030924 3300005844 Bacteria 4514
316 Ga0068862_100040405 3300005844 Bacteria 3964
317 Ga0068862_100074436 3300005844 Bacteria 2935
318 Ga0068862_100123498 3300005844 Bacteria 2284
319 Ga0081455_10000058 3300005937 Bacteria 119171
320 Ga0081455_10000313 3300005937 Bacteria 63616
321 Ga0081455_10003030 3300005937 Bacteria 19580
322 Ga0081455_10016037 3300005937 Bacteria 7248
323 Ga0081455_10019695 3300005937 Bacteria 6374
324 Ga0081455_10039469 3300005937 Bacteria 4171
325 Ga0081455_10045499 3300005937 Bacteria 3818
326 Ga0081455_10056050 3300005937 Bacteria 3349
327 Ga0081455_10070225 3300005937 Bacteria 2909
328 Ga0081455_10073457 3300005937 Bacteria 2827
329 Ga0081540_1000040 3300005983 Bacteria 136968
330 Ga0081540_1001455 3300005983 Bacteria 20460
331 Ga0081540_1001972 3300005983 Bacteria 17123
332 Ga0081540_1028965 3300005983 Bacteria 3096
333 Ga0081539_10001588 3300005985 Bacteria 37550
334 Ga0081539_10005661 3300005985 Bacteria 12551
335 Ga0070717_10004117 3300006028 Bacteria 10484
336 Ga0075365_10005892 3300006038 Bacteria 6672
337 Ga0075365_10039103 3300006038 Bacteria 3087
338 Ga0075365_10067727 3300006038 Bacteria 2397
339 Ga0075365_10111229 3300006038 Bacteria 1882
340 Ga0075365_10139243 3300006038 Bacteria 1684
341 Ga0075368_10025068 3300006042 Bacteria 2288
342 Ga0075368_10035481 3300006042 Bacteria 1946
343 Ga0075363_100006563 3300006048 Bacteria 5299
344 Ga0075363_100007241 3300006048 Bacteria 5088
345 Ga0075363_100053502 3300006048 Bacteria 2157
346 Ga0075363_100098897 3300006048 Bacteria 1613
347 Ga0075364_10030197 3300006051 Bacteria 3478
348 Ga0075364_10030667 3300006051 Bacteria 3451
349 Ga0075432_10010658 3300006058 Bacteria 3124
350 Ga0070715_10000372 3300006163 Bacteria 11249
351 Ga0070716_100000521 3300006173 Bacteria 16062
352 Ga0070716_100035807 3300006173 Bacteria 2731
353 Ga0070712_100008526 3300006175 Bacteria 6450
354 Ga0070712_100052271 3300006175 Bacteria 2848
355 Ga0070712_100053437 3300006175 Bacteria 2820
356 Ga0070712_100110385 3300006175 Bacteria 2051
357 Ga0070712_100293572 3300006175 Bacteria 1313
358 Ga0075367_10003833 3300006178 Bacteria 7250
359 Ga0075367_10024719 3300006178 Bacteria 3389
360 Ga0075367_10029139 3300006178 Bacteria 3155
361 Ga0075367_10065902 3300006178 Bacteria 2170
362 Ga0075369_10005732 3300006186 Bacteria 4661
363 Ga0075366_10152162 3300006195 Bacteria 1401
364 Ga0097621_100000435 3300006237 Bacteria 29115
365 Ga0097621_100026110 3300006237 Bacteria 4578
366 Ga0097621_100086354 3300006237 Bacteria 2618
367 Ga0097621_100118825 3300006237 Bacteria 2240
368 Ga0075370_10008027 3300006353 Bacteria 5413
369 Ga0075370_10034541 3300006353 Bacteria 2834
370 Ga0075370_10042670 3300006353 Bacteria 2562
371 Ga0068871_100000485 3300006358 Bacteria 27172
372 Ga0068871_100017854 3300006358 Bacteria 5379
373 Ga0068871_100064053 3300006358 Bacteria 3008
374 Ga0068871_100078866 3300006358 Bacteria 2723
375 Ga0068871_100240854 3300006358 Bacteria 1573
376 Ga0075428_100003602 3300006844 Bacteria 16977
377 Ga0075428_100093373 3300006844 Bacteria 3280
378 Ga0075428_100373095 3300006844 Bacteria 1530
379 Ga0075430_100000367 3300006846 Bacteria 33161
380 Ga0075430_100001911 3300006846 Bacteria 17092
381 Ga0075431_100007593 3300006847 Bacteria 10798
382 Ga0075433_10000501 3300006852 Bacteria 25541
383 Ga0075433_10009783 3300006852 Bacteria 7681
384 Ga0075433_10033635 3300006852 Bacteria 4397
385 Ga0075433_10111249 3300006852 Bacteria 2430
386 Ga0075434_100005781 3300006871 Bacteria 11302
387 Ga0075434_100015803 3300006871 Bacteria 7246
388 Ga0075434_100032299 3300006871 Bacteria 5162
389 Ga0075429_100001022 3300006880 Bacteria 22312
390 Ga0068865_100001438 3300006881 Bacteria 13857
391 Ga0068865_100020005 3300006881 Bacteria 4339
392 Ga0068865_100063742 3300006881 Bacteria 2592
393 Ga0068865_100099572 3300006881 Bacteria 2125
394 Ga0068865_100173433 3300006881 Unclassified 1655
395 Ga0075436_100003601 3300006914 Bacteria 10617
396 Ga0075436_100136239 3300006914 Bacteria 1724
397 Ga0075436_100166490 3300006914 Bacteria 1555
398 Ga0097620_100004306 3300006931 Bacteria 14521
399 Ga0097620_100005293 3300006931 Bacteria 13119
400 Ga0097620_100011499 3300006931 Bacteria 8898
401 Ga0097620_100037053 3300006931 Bacteria 4895
402 Ga0097620_100087394 3300006931 Bacteria 3165
403 Ga0097620_100127127 3300006931 Bacteria 2618
404 Ga0075435_100039937 3300007076 Bacteria 3746
405 Ga0075435_100160471 3300007076 Bacteria 1893
406 Ga0075435_100219108 3300007076 Bacteria 1616
407 Ga0105251_10016129 3300009011 Bacteria 4050
408 Ga0105244_10060181 3300009036 Bacteria 1914
409 Ga0105244_10089489 3300009036 Bacteria 1515
410 Ga0105240_10010579 3300009093 Bacteria 12962
411 Ga0105240_10014906 3300009093 Bacteria 10589
412 Ga0105240_10050958 3300009093 Bacteria 5213
413 Ga0105240_10169492 3300009093 Bacteria 2587
414 Ga0111539_10002680 3300009094 Bacteria 23585
415 Ga0111539_10003452 3300009094 Bacteria 20813
416 Ga0111539_10004667 3300009094 Bacteria 17913
417 Ga0111539_10053404 3300009094 Bacteria 4809
418 Ga0111539_10103752 3300009094 Bacteria 3336
419 Ga0111539_10112285 3300009094 Bacteria 3197
420 Ga0111539_10242837 3300009094 Bacteria 2097
421 Ga0111539_10394337 3300009094 Bacteria 1612
422 Ga0105245_10001240 3300009098 Bacteria 23019
423 Ga0105245_10004478 3300009098 Bacteria 12348
424 Ga0105245_10026459 3300009098 Bacteria 5106
425 Ga0105245_10034000 3300009098 Bacteria 4519
426 Ga0105245_10089875 3300009098 Bacteria 2824
427 Ga0105245_10106286 3300009098 Bacteria 2604
428 Ga0105245_10482679 3300009098 Bacteria 1253
429 Ga0105247_10002403 3300009101 Bacteria 12733
430 Ga0105247_10035475 3300009101 Bacteria 3040
431 Ga0114129_10005976 3300009147 Bacteria 17239
432 Ga0114129_10090836 3300009147 Bacteria 4232
433 Ga0114129_10114122 3300009147 Bacteria 3725
434 Ga0114129_10164133 3300009147 Bacteria 3032
435 Ga0114129_10551892 3300009147 Bacteria 1498
436 Ga0114129_10620922 3300009147 Bacteria 1398
437 Ga0105243_10004647 3300009148 Bacteria 10825
438 Ga0105243_10007567 3300009148 Bacteria 8346
439 Ga0105243_10013397 3300009148 Bacteria 6201
440 Ga0105243_10030511 3300009148 Bacteria 4151
441 Ga0105243_10124868 3300009148 Bacteria 2175
442 Ga0105243_10243265 3300009148 Bacteria 1602
443 Ga0105243_10367149 3300009148 Bacteria 1327
444 Ga0105241_10000805 3300009174 Bacteria 23823
445 Ga0105241_10011629 3300009174 Bacteria 6456
446 Ga0105241_10017686 3300009174 Bacteria 5242
447 Ga0105241_10030825 3300009174 Bacteria 4011
448 Ga0105241_10042788 3300009174 Bacteria 3429
449 Ga0105241_10120078 3300009174 Bacteria 2115
450 Ga0105242_10006128 3300009176 Bacteria 9267
451 Ga0105242_10013092 3300009176 Bacteria 6399
452 Ga0105242_10018520 3300009176 Bacteria 5445
453 Ga0105242_10025798 3300009176 Bacteria 4654
454 Ga0105248_10001221 3300009177 Bacteria 28680
455 Ga0105248_10002578 3300009177 Bacteria 20136
456 Ga0105248_10031967 3300009177 Bacteria 5880
457 Ga0105248_10046280 3300009177 Bacteria 4876
458 Ga0105248_10208726 3300009177 Bacteria 2200
459 Ga0105248_10241410 3300009177 Bacteria 2034
460 Ga0105237_10008546 3300009545 Bacteria 11068
461 Ga0105237_10011149 3300009545 Bacteria 9529
462 Ga0105237_10027358 3300009545 Bacteria 5822
463 Ga0105237_10050562 3300009545 Bacteria 4176
464 Ga0105237_10068994 3300009545 Bacteria 3530
465 Ga0105237_10082473 3300009545 Bacteria 3206
466 Ga0105237_10220060 3300009545 Bacteria 1899
467 Ga0105238_10007560 3300009551 Bacteria 10886
468 Ga0105238_10010402 3300009551 Bacteria 9338
469 Ga0105238_10010426 3300009551 Bacteria 9329
470 Ga0105238_10024153 3300009551 Bacteria 6197
471 Ga0105238_10032621 3300009551 Bacteria 5299
472 Ga0105238_10050151 3300009551 Bacteria 4202
473 Ga0105249_10002352 3300009553 Bacteria 16432
474 Ga0105249_10007611 3300009553 Bacteria 9450
475 Ga0105249_10017076 3300009553 Bacteria 6440
476 Ga0105249_10109986 3300009553 Bacteria 2603
477 Ga0105249_10117597 3300009553 Bacteria 2521
478 Ga0105249_10213350 3300009553 Bacteria 1895
479 Ga0105239_10031376 3300010375 Bacteria 5845
480 Ga0105239_10052250 3300010375 Bacteria 4481
481 Ga0105239_10077992 3300010375 Bacteria 3646
482 Ga0105239_10089074 3300010375 Bacteria 3403
483 Ga0105239_10115602 3300010375 Bacteria 2976
484 Ga0105239_10205019 3300010375 Bacteria 2210
485 Ga0105246_10001159 3300011119 Bacteria 15299
486 Ga0105246_10005008 3300011119 Bacteria 8054
487 Ga0105246_10016595 3300011119 Bacteria 4665
488 Ga0105246_10099889 3300011119 Bacteria 2110
489 Ga0105246_10318265 3300011119 Bacteria 1263
490 Ga0157342_1001578 3300012507 Bacteria 1722
491 Ga0157373_10014274 3300013100 Bacteria 5825
492 Ga0157373_10056793 3300013100 Bacteria 2778
493 Ga0157371_10011034 3300013102 Bacteria 6999
494 Ga0157371_10014946 3300013102 Bacteria 5841
495 Ga0157371_10016708 3300013102 Bacteria 5469
496 Ga0157371_10027373 3300013102 Bacteria 4135
497 Ga0157371_10101753 3300013102 Bacteria 2038
498 Ga0157370_10016367 3300013104 Bacteria 7507
499 Ga0157370_10041151 3300013104 Bacteria 4461
500 Ga0157370_10059405 3300013104 Bacteria 3633
501 Ga0157370_10209979 3300013104 Bacteria 1804
502 Ga0157369_10085321 3300013105 Bacteria 3374
503 Ga0157369_10095863 3300013105 Bacteria 3165
504 Ga0157369_10175656 3300013105 Bacteria 2255
505 Ga0157369_10277423 3300013105 Bacteria 1746
506 Ga0157369_10420709 3300013105 Bacteria 1385
507 Ga0157374_10007740 3300013296 Bacteria 9173
508 Ga0157374_10025598 3300013296 Bacteria 5301
509 Ga0157374_10039970 3300013296 Bacteria 4319
510 Ga0157374_10090291 3300013296 Bacteria 2921
511 Ga0157378_10037264 3300013297 Bacteria 4306
512 Ga0157378_10039571 3300013297 Bacteria 4182
513 Ga0157378_10083826 3300013297 Bacteria 2885
514 Ga0157378_10295418 3300013297 Bacteria 1566
515 Ga0163162_10017661 3300013306 Bacteria 6980
516 Ga0163162_10022100 3300013306 Bacteria 6268
517 Ga0163162_10058241 3300013306 Bacteria 3892
518 Ga0163162_10448517 3300013306 Bacteria 1422
519 Ga0157372_10007136 3300013307 Bacteria 11892
520 Ga0157372_10516025 3300013307 Unclassified 1393
521 Ga0157375_10001241 3300013308 Bacteria 22040
522 Ga0157375_10008574 3300013308 Bacteria 8951
523 Ga0157375_10035534 3300013308 Bacteria 4757
524 Ga0157375_10063050 3300013308 Bacteria 3686
525 Ga0157375_10126028 3300013308 Bacteria 2675
526 Ga0157375_10134002 3300013308 Bacteria 2599
527 Ga0163163_10009906 3300014325 Bacteria 8543
528 Ga0163163_10017983 3300014325 Bacteria 6603
529 Ga0163163_10089265 3300014325 Bacteria 3095
530 Ga0163163_10148670 3300014325 Bacteria 2387
531 Ga0163163_10159958 3300014325 Bacteria 2297
532 Ga0157380_10001249 3300014326 Bacteria 16513
533 Ga0157380_10008714 3300014326 Bacteria 7248
534 Ga0157380_10168704 3300014326 Bacteria 1910
535 Ga0182008_10139299 3300014497 Bacteria 1213
536 Ga0157379_10002254 3300014968 Bacteria 16055
537 Ga0157379_10025886 3300014968 Bacteria 5216
538 Ga0157379_10054471 3300014968 Bacteria 3574
539 Ga0157379_10057308 3300014968 Bacteria 3482
540 Ga0157379_10078527 3300014968 Bacteria 2956
541 Ga0157379_10116499 3300014968 Bacteria 2403
542 Ga0157379_10261538 3300014968 Bacteria 1572
543 Ga0157376_10000696 3300014969 Bacteria 21738
544 Ga0157376_10001084 3300014969 Bacteria 17833
545 Ga0157376_10017349 3300014969 Bacteria 5489
546 Ga0157376_10152226 3300014969 Bacteria 2087
547 Ga0157376_10239744 3300014969 Bacteria 1689
548 Ga0182007_10001553 3300015262 Bacteria 12234
549 Ga0182005_1041840 3300015265 Bacteria 1246
550 Ga0163161_10005280 3300017792 Bacteria 8992
551 Ga0163161_10023248 3300017792 Bacteria 4371
552 Ga0213872_10032107 3300021361 Bacteria 2407
553 Ga0213874_10018511 3300021377 Bacteria 1883
554 Ga0213876_10019646 3300021384 Bacteria 3568
555 Ga0213876_10092539 3300021384 Bacteria 1601
556 Ga0213875_10001666 3300021388 Bacteria 13985
557 Ga0213871_10003648 3300021441 Bacteria 2995
558 Ga0209784_100005 3300025224 Bacteria 1040422
559 Ga0209566_100005 3300025225 Bacteria 1040422
560 Ga0209674_100009 3300025226 Bacteria 1040422
561 Ga0209563_100012 3300025230 Bacteria 1040422
562 Ga0209026_1000041 3300025250 Bacteria 275745
563 Ga0209677_100006 3300025253 Bacteria 1040422
564 Ga0209148_1000165 3300025254 Bacteria 136396
565 Ga0209759_1000823 3300025256 Bacteria 24559
566 Ga0209233_1000030 3300025261 Bacteria 636702
567 Ga0207666_1000085 3300025271 Bacteria 15395
568 Ga0207666_1007172 3300025271 Bacteria 1462
569 Ga0207666_1009299 3300025271 Bacteria 1326
570 Ga0209455_1000143 3300025272 Bacteria 137976
571 Ga0209130_1000804 3300025284 Bacteria 26631
572 Ga0209025_1000779 3300025294 Bacteria 52611
573 Ga0209758_1007126 3300025297 Bacteria 7728
574 Ga0207426_1000066 3300025302 Bacteria 351182
575 Ga0207426_1010418 3300025302 Bacteria 3606
576 Ga0207697_10002998 3300025315 Bacteria 8507
577 Ga0207697_10014060 3300025315 Bacteria 3332
578 Ga0207656_10131455 3300025321 Bacteria 1173
579 Ga0207653_10001759 3300025885 Bacteria 6921
580 Ga0207653_10016842 3300025885 Bacteria 2298
581 Ga0207682_10020561 3300025893 Bacteria 2592
582 Ga0207692_10006606 3300025898 Bacteria 4711
583 Ga0207692_10016030 3300025898 Bacteria 3308
584 Ga0207692_10027201 3300025898 Bacteria 2692
585 Ga0207710_10001201 3300025900 Bacteria 13142
586 Ga0207710_10002518 3300025900 Bacteria 8472
587 Ga0207710_10022129 3300025900 Bacteria 2727
588 Ga0207688_10000088 3300025901 Bacteria 35438
589 Ga0207688_10027021 3300025901 Bacteria 3157
590 Ga0207680_10008516 3300025903 Bacteria 5040
591 Ga0207680_10019207 3300025903 Bacteria 3650
592 Ga0207647_10005612 3300025904 Bacteria 9167
593 Ga0207647_10008915 3300025904 Bacteria 7154
594 Ga0207647_10011501 3300025904 Bacteria 6205
595 Ga0207647_10022521 3300025904 Bacteria 4182
596 Ga0207647_10066062 3300025904 Bacteria 2194
597 Ga0207647_10082384 3300025904 Bacteria 1927
598 Ga0207685_10001213 3300025905 Bacteria 5224
599 Ga0207685_10017035 3300025905 Bacteria 2339
600 Ga0207699_10000314 3300025906 Bacteria 25916
601 Ga0207699_10013430 3300025906 Bacteria 4192
602 Ga0207699_10140312 3300025906 Bacteria 1587
603 Ga0207645_10000668 3300025907 Bacteria 28444
604 Ga0207645_10013792 3300025907 Bacteria 5423
605 Ga0207645_10087452 3300025907 Bacteria 2003
606 Ga0207645_10094800 3300025907 Bacteria 1921
607 Ga0207643_10000085 3300025908 Bacteria 61372
608 Ga0207705_10014540 3300025909 Bacteria 5662
609 Ga0207705_10017922 3300025909 Bacteria 5065
610 Ga0207705_10044591 3300025909 Bacteria 3187
611 Ga0207705_10074918 3300025909 Bacteria 2457
612 Ga0207705_10135035 3300025909 Bacteria 1838
613 Ga0207654_10000373 3300025911 Bacteria 26098
614 Ga0207654_10055426 3300025911 Bacteria 2295
615 Ga0207654_10182538 3300025911 Bacteria 1370
616 Ga0207654_10236515 3300025911 Bacteria 1219
617 Ga0207707_10017090 3300025912 Bacteria 6321
618 Ga0207707_10024982 3300025912 Bacteria 5228
619 Ga0207707_10027206 3300025912 Bacteria 5001
620 Ga0207707_10029968 3300025912 Bacteria 4757
621 Ga0207707_10034736 3300025912 Bacteria 4411
622 Ga0207695_10024575 3300025913 Bacteria 6772
623 Ga0207695_10064850 3300025913 Bacteria 3758
624 Ga0207671_10012676 3300025914 Bacteria 6764
625 Ga0207671_10027636 3300025914 Bacteria 4241
626 Ga0207671_10038319 3300025914 Bacteria 3552
627 Ga0207671_10058235 3300025914 Bacteria 2864
628 Ga0207671_10205306 3300025914 Bacteria 1540
629 Ga0207671_10219942 3300025914 Bacteria 1488
630 Ga0207671_10310726 3300025914 Bacteria 1246
631 Ga0207693_10000893 3300025915 Bacteria 26744
632 Ga0207693_10003902 3300025915 Bacteria 12694
633 Ga0207693_10027451 3300025915 Bacteria 4501
634 Ga0207693_10079502 3300025915 Bacteria 2566
635 Ga0207693_10137852 3300025915 Bacteria 1918
636 Ga0207693_10138590 3300025915 Bacteria 1913
637 Ga0207693_10161805 3300025915 Bacteria 1761
638 Ga0207663_10022472 3300025916 Bacteria 3605
639 Ga0207663_10056550 3300025916 Bacteria 2467
640 Ga0207660_10000370 3300025917 Bacteria 29368
641 Ga0207660_10024283 3300025917 Bacteria 4103
642 Ga0207660_10024958 3300025917 Bacteria 4052
643 Ga0207660_10063518 3300025917 Bacteria 2662
644 Ga0207660_10217157 3300025917 Bacteria 1499
645 Ga0207662_10003085 3300025918 Bacteria 8502
646 Ga0207662_10003118 3300025918 Bacteria 8462
647 Ga0207662_10041330 3300025918 Bacteria 2714
648 Ga0207657_10000527 3300025919 Bacteria 40544
649 Ga0207657_10008168 3300025919 Bacteria 10666
650 Ga0207657_10009104 3300025919 Bacteria 10015
651 Ga0207657_10011290 3300025919 Bacteria 8871
652 Ga0207657_10015522 3300025919 Bacteria 7378
653 Ga0207649_10004450 3300025920 Bacteria 7606
654 Ga0207649_10012523 3300025920 Bacteria 4709
655 Ga0207649_10146006 3300025920 Bacteria 1624
656 Ga0207652_10026265 3300025921 Bacteria 4847
657 Ga0207652_10040106 3300025921 Bacteria 3975
658 Ga0207652_10069429 3300025921 Bacteria 3059
659 Ga0207652_10076662 3300025921 Bacteria 2916
660 Ga0207652_10083382 3300025921 Bacteria 2799
661 Ga0207652_10109553 3300025921 Bacteria 2448
662 Ga0207652_10127941 3300025921 Bacteria 2264
663 Ga0207652_10130034 3300025921 Bacteria 2245
664 Ga0207652_10184106 3300025921 Bacteria 1878
665 Ga0207652_10186716 3300025921 Bacteria 1864
666 Ga0207646_10234315 3300025922 Bacteria 1659
667 Ga0207681_10003402 3300025923 Bacteria 9950
668 Ga0207681_10023297 3300025923 Bacteria 3958
669 Ga0207681_10080013 3300025923 Bacteria 2304
670 Ga0207694_10035398 3300025924 Bacteria 3830
671 Ga0207694_10048354 3300025924 Bacteria 3291
672 Ga0207694_10059284 3300025924 Bacteria 2977
673 Ga0207694_10072111 3300025924 Bacteria 2700
674 Ga0207694_10190274 3300025924 Bacteria 1667
675 Ga0207694_10310487 3300025924 Bacteria 1300
676 Ga0207650_10008626 3300025925 Bacteria 6961
677 Ga0207650_10013399 3300025925 Bacteria 5677
678 Ga0207650_10069440 3300025925 Bacteria 2647
679 Ga0207650_10103672 3300025925 Bacteria 2193
680 Ga0207659_10000200 3300025926 Bacteria 35764
681 Ga0207659_10010586 3300025926 Bacteria 5800
682 Ga0207659_10025147 3300025926 Bacteria 3997
683 Ga0207659_10289166 3300025926 Bacteria 1342
684 Ga0207687_10009189 3300025927 Bacteria 6466
685 Ga0207687_10012599 3300025927 Bacteria 5524
686 Ga0207687_10012727 3300025927 Bacteria 5497
687 Ga0207687_10191540 3300025927 Bacteria 1592
688 Ga0207687_10314645 3300025927 Bacteria 1265
689 Ga0207700_10000516 3300025928 Bacteria 22674
690 Ga0207700_10026232 3300025928 Bacteria 4061
691 Ga0207700_10215229 3300025928 Bacteria 1626
692 Ga0207700_10275507 3300025928 Bacteria 1445
693 Ga0207664_10025720 3300025929 Bacteria 4438
694 Ga0207664_10106602 3300025929 Bacteria 2324
695 Ga0207664_10165523 3300025929 Bacteria 1889
696 Ga0207644_10066275 3300025931 Bacteria 2628
697 Ga0207690_10003081 3300025932 Bacteria 10046
698 Ga0207690_10007237 3300025932 Bacteria 6590
699 Ga0207690_10040734 3300025932 Bacteria 3039
700 Ga0207690_10056690 3300025932 Bacteria 2644
701 Ga0207690_10144852 3300025932 Bacteria 1755
702 Ga0207690_10163203 3300025932 Bacteria 1663
703 Ga0207706_10000724 3300025933 Bacteria 34452
704 Ga0207706_10010392 3300025933 Bacteria 8502
705 Ga0207706_10048288 3300025933 Bacteria 3764
706 Ga0207706_10164137 3300025933 Bacteria 1952
707 Ga0207686_10014950 3300025934 Bacteria 4331
708 Ga0207709_10024665 3300025935 Bacteria 3436
709 Ga0207709_10055805 3300025935 Bacteria 2442
710 Ga0207709_10069608 3300025935 Bacteria 2228
711 Ga0207709_10152221 3300025935 Bacteria 1603
712 Ga0207670_10002721 3300025936 Bacteria 9300
713 Ga0207670_10010668 3300025936 Bacteria 5302
714 Ga0207670_10015281 3300025936 Bacteria 4583
715 Ga0207670_10069959 3300025936 Bacteria 2422
716 Ga0207670_10089913 3300025936 Bacteria 2168
717 Ga0207670_10145489 3300025936 Bacteria 1752
718 Ga0207670_10284853 3300025936 Bacteria 1289
719 Ga0207669_10000129 3300025937 Bacteria 37620
720 Ga0207704_10009256 3300025938 Bacteria 4742
721 Ga0207704_10068712 3300025938 Bacteria 2235
722 Ga0207704_10248310 3300025938 Bacteria 1334
723 Ga0207704_10288429 3300025938 Bacteria 1251
724 Ga0207665_10001119 3300025939 Bacteria 18000
725 Ga0207665_10001387 3300025939 Bacteria 16312
726 Ga0207665_10021523 3300025939 Bacteria 4240
727 Ga0207691_10006204 3300025940 Bacteria 11547
728 Ga0207691_10006943 3300025940 Bacteria 10919
729 Ga0207691_10012408 3300025940 Bacteria 8169
730 Ga0207691_10072104 3300025940 Bacteria 3116
731 Ga0207691_10076919 3300025940 Bacteria 3007
732 Ga0207691_10096678 3300025940 Bacteria 2640
733 Ga0207711_10002466 3300025941 Bacteria 16510
734 Ga0207711_10003715 3300025941 Bacteria 13155
735 Ga0207711_10007782 3300025941 Bacteria 8956
736 Ga0207711_10092833 3300025941 Bacteria 2657
737 Ga0207711_10286774 3300025941 Bacteria 1517
738 Ga0207689_10000547 3300025942 Bacteria 35807
739 Ga0207689_10014379 3300025942 Bacteria 6733
740 Ga0207689_10037034 3300025942 Bacteria 4048
741 Ga0207689_10251963 3300025942 Bacteria 1460
742 Ga0207661_10000373 3300025944 Bacteria 28733
743 Ga0207679_10000558 3300025945 Bacteria 25037
744 Ga0207679_10021305 3300025945 Bacteria 4393
745 Ga0207679_10101637 3300025945 Bacteria 2249
746 Ga0207667_10000053 3300025949 Bacteria 226712
747 Ga0207667_10007935 3300025949 Bacteria 12667
748 Ga0207667_10011550 3300025949 Bacteria 10256
749 Ga0207667_10012666 3300025949 Bacteria 9692
750 Ga0207667_10017718 3300025949 Bacteria 8011
751 Ga0207667_10051857 3300025949 Bacteria 4323
752 Ga0207667_10062323 3300025949 Bacteria 3900
753 Ga0207667_10064488 3300025949 Bacteria 3824
754 Ga0207667_10083772 3300025949 Bacteria 3302
755 Ga0207667_10098252 3300025949 Bacteria 3021
756 Ga0207651_10000709 3300025960 Bacteria 14279
757 Ga0207651_10008936 3300025960 Bacteria 5442
758 Ga0207651_10014831 3300025960 Bacteria 4511
759 Ga0207651_10167102 3300025960 Bacteria 1731
760 Ga0207712_10001313 3300025961 Bacteria 17039
761 Ga0207712_10002613 3300025961 Bacteria 11551
762 Ga0207712_10065985 3300025961 Bacteria 2586
763 Ga0207712_10225868 3300025961 Bacteria 1500
764 Ga0207668_10043061 3300025972 Bacteria 3060
765 Ga0207640_10004814 3300025981 Bacteria 7334
766 Ga0207640_10039433 3300025981 Bacteria 2989
767 Ga0207640_10048971 3300025981 Bacteria 2734
768 Ga0207640_10114872 3300025981 Bacteria 1916
769 Ga0207640_10231133 3300025981 Bacteria 1423
770 Ga0207658_10021810 3300025986 Bacteria 4451
771 Ga0207658_10274471 3300025986 Bacteria 1443
772 Ga0207658_10290847 3300025986 Bacteria 1404
773 Ga0207677_10004798 3300026023 Bacteria 7296
774 Ga0207677_10035790 3300026023 Bacteria 3228
775 Ga0207703_10000644 3300026035 Bacteria 35023
776 Ga0207703_10013473 3300026035 Bacteria 6369
777 Ga0207703_10151577 3300026035 Bacteria 2022
778 Ga0207639_10016724 3300026041 Bacteria 5196
779 Ga0207639_10025582 3300026041 Bacteria 4280
780 Ga0207639_10096724 3300026041 Bacteria 2376
781 Ga0207639_10304695 3300026041 Bacteria 1409
782 Ga0207678_10000869 3300026067 Bacteria 27725
783 Ga0207678_10002381 3300026067 Bacteria 17073
784 Ga0207678_10005937 3300026067 Bacteria 10876
785 Ga0207678_10052562 3300026067 Bacteria 3514
786 Ga0207678_10113809 3300026067 Bacteria 2308
787 Ga0207708_10000596 3300026075 Bacteria 27813
788 Ga0207708_10008554 3300026075 Bacteria 7572
789 Ga0207708_10019753 3300026075 Bacteria 5081
790 Ga0207708_10027764 3300026075 Bacteria 4286
791 Ga0207708_10041554 3300026075 Bacteria 3505
792 Ga0207702_10040353 3300026078 Bacteria 3914
793 Ga0207702_10048402 3300026078 Bacteria 3585
794 Ga0207702_10108689 3300026078 Bacteria 2461
795 Ga0207702_10145308 3300026078 Bacteria 2151
796 Ga0207702_10258556 3300026078 Bacteria 1638
797 Ga0207702_10370650 3300026078 Bacteria 1375
798 Ga0207641_10007032 3300026088 Bacteria 9402
799 Ga0207641_10019914 3300026088 Bacteria 5507
800 Ga0207641_10067424 3300026088 Bacteria 3065
801 Ga0207648_10006768 3300026089 Bacteria 11365
802 Ga0207648_10040413 3300026089 Bacteria 4099
803 Ga0207648_10045391 3300026089 Bacteria 3854
804 Ga0207648_10327238 3300026089 Bacteria 1378
805 Ga0207676_10014297 3300026095 Bacteria 5707
806 Ga0207676_10040193 3300026095 Bacteria 3583
807 Ga0207676_10044107 3300026095 Bacteria 3438
808 Ga0207676_10113411 3300026095 Bacteria 2272
809 Ga0207674_10001458 3300026116 Bacteria 30574
810 Ga0207674_10005267 3300026116 Bacteria 15394
811 Ga0207674_10013187 3300026116 Bacteria 9192
812 Ga0207674_10020898 3300026116 Bacteria 7064
813 Ga0207674_10021107 3300026116 Bacteria 7022
814 Ga0207674_10025701 3300026116 Bacteria 6270
815 Ga0207674_10107462 3300026116 Bacteria 2767
816 Ga0207674_10257860 3300026116 Bacteria 1691
817 Ga0207674_10289723 3300026116 Bacteria 1586
818 Ga0207675_100002798 3300026118 Bacteria 17145
819 Ga0207675_100011076 3300026118 Bacteria 8448
820 Ga0207675_100017895 3300026118 Bacteria 6608
821 Ga0207675_100068558 3300026118 Bacteria 3315
822 Ga0207675_100073676 3300026118 Bacteria 3195
823 Ga0207675_100195549 3300026118 Bacteria 1941
824 Ga0207683_10000778 3300026121 Bacteria 29074
825 Ga0207683_10001220 3300026121 Bacteria 23334
826 Ga0207683_10007446 3300026121 Bacteria 9386
827 Ga0207683_10015649 3300026121 Bacteria 6456
828 Ga0207683_10044386 3300026121 Bacteria 3886
829 Ga0207683_10180815 3300026121 Bacteria 1912
830 Ga0207698_10011844 3300026142 Bacteria 5678
831 Ga0207698_10030316 3300026142 Bacteria 3887
832 Ga0207698_10036394 3300026142 Bacteria 3613
833 Ga0209970_1008087 3300027614 Bacteria 1727
834 Ga0209966_1000401 3300027695 Bacteria 12728
835 Ga0209998_10003905 3300027717 Bacteria 3219
836 Ga0209998_10004196 3300027717 Bacteria 3071
837 Ga0209974_10003102 3300027876 Bacteria 6014
838 Ga0209974_10005343 3300027876 Bacteria 4527
839 Ga0209974_10023552 3300027876 Bacteria 2037
840 Ga0207428_10000141 3300027907 Bacteria 97064
841 Ga0207428_10000664 3300027907 Bacteria 40266
842 Ga0207428_10000896 3300027907 Bacteria 33348
843 Ga0207428_10007120 3300027907 Bacteria 10233
844 Ga0268266_10048222 3300028379 Bacteria 3650
845 Ga0268265_10008023 3300028380 Bacteria 7129
846 Ga0268265_10025201 3300028380 Bacteria 4218
847 Ga0268265_10044645 3300028380 Bacteria 3301
848 Ga0268265_10108231 3300028380 Bacteria 2262
849 Ga0268265_10275013 3300028380 Bacteria 1504
850 Ga0268265_10348892 3300028380 Bacteria 1351
851 Ga0268265_10390677 3300028380 Bacteria 1283
852 Ga0268264_10001202 3300028381 Bacteria 24970
853 Ga0268264_10017561 3300028381 Bacteria 5860
854 Ga0268264_10017823 3300028381 Bacteria 5812
855 Ga0268264_10080828 3300028381 Bacteria 2776
856 Ga0268264_10432270 3300028381 Bacteria 1272
857 Ga0268264_10441663 3300028381 Bacteria 1259
858 Ga0265337_1000071 3300028556 Bacteria 47429
859 Ga0265337_1000905 3300028556 Bacteria 15601
860 Ga0265334_10001642 3300028573 Bacteria 10727
861 Ga0265334_10002089 3300028573 Bacteria 9430
862 Ga0265318_10008960 3300028577 Bacteria 4429
863 Ga0265338_10012346 3300028800 Bacteria 9741
864 Ga0265332_10020847 3300031238 Bacteria 2895
865 Ga0265328_10004547 3300031239 Bacteria 6015
866 Ga0265328_10008652 3300031239 Bacteria 4185
867 Ga0265325_10000119 3300031241 Bacteria 54195
868 Ga0265325_10005776 3300031241 Bacteria 7589
869 Ga0265325_10040264 3300031241 Bacteria 2454
870 Ga0265325_10047121 3300031241 Bacteria 2232
871 Ga0265325_10112471 3300031241 Bacteria 1321
872 Ga0265329_10046785 3300031242 Bacteria 1382
873 Ga0265340_10004425 3300031247 Bacteria 7853
874 Ga0265340_10010607 3300031247 Bacteria 4927
875 Ga0265340_10012517 3300031247 Bacteria 4478
876 Ga0265340_10021950 3300031247 Bacteria 3268
877 Ga0265340_10026353 3300031247 Bacteria 2940
878 Ga0265340_10065786 3300031247 Bacteria 1726
879 Ga0265339_10005156 3300031249 Bacteria 8756
880 Ga0265339_10062948 3300031249 Bacteria 1993
881 Ga0265331_10000066 3300031250 Bacteria 163571
882 Ga0265331_10040257 3300031250 Bacteria 2275
883 Ga0265316_10049686 3300031344 Bacteria 3302
884 Ga0265316_10077968 3300031344 Bacteria 2544
885 Ga0265316_10140445 3300031344 Bacteria 1815
886 Ga0265316_10158956 3300031344 Bacteria 1690
887 Ga0307513_10279610 3300031456 Bacteria 1447
888 Ga0265313_10000007 3300031595 Bacteria 178640
889 Ga0265313_10004012 3300031595 Bacteria 11517
890 Ga0265313_10009685 3300031595 Bacteria 6219
891 Ga0265313_10014650 3300031595 Bacteria 4620
892 Ga0265313_10015432 3300031595 Bacteria 4447
893 Ga0265313_10038559 3300031595 Bacteria 2378
894 Ga0265313_10040439 3300031595 Bacteria 2305
895 Ga0265313_10086865 3300031595 Bacteria 1411
896 Ga0307508_10042520 3300031616 Bacteria 4076
897 Ga0316575_10001860 3300031665 Bacteria 6940
898 Ga0316575_10011176 3300031665 Bacteria 3317
899 Ga0316579_10001617 3300031691 Bacteria 8250
900 Ga0316579_10041051 3300031691 Bacteria 2147
901 Ga0265314_10001283 3300031711 Bacteria 28552
902 Ga0265314_10026132 3300031711 Bacteria 4392
903 Ga0265314_10080024 3300031711 Bacteria 2159
904 Ga0265314_10153779 3300031711 Unclassified 1407
905 Ga0265342_10000717 3300031712 Bacteria 34273
906 Ga0265342_10125768 3300031712 Bacteria 1440
907 Ga0265342_10176858 3300031712 Bacteria 1171
908 Ga0316578_10005806 3300031728 Bacteria 6032
909 Ga0316577_10014000 3300031733 Bacteria 4399
910 Ga0307406_10210881 3300031901 Bacteria 1437
911 Ga0316583_10000114 3300032133 Bacteria 18718
912 Ga0316583_10051704 3300032133 Bacteria 1446
913 Ga0316593_10001959 3300032168 Bacteria 4733
914 Ga0316593_10067672 3300032168 Bacteria 1231
915 Ga0316593_10069802 3300032168 Bacteria 1214
916 Ga0316592_1031727 3300033524 Bacteria 1151
917 Ga0316587_1011377 3300033529 Bacteria 1435
918 Ga0316596_1042051 3300033541 Bacteria 1202
919 Ga0316596_1045316 3300033541 Bacteria 1160
920 Ga0373930_0016934 3300034816 Bacteria 1384
921 Ga0373948_0000055 3300034817 Bacteria 12096
922 Ga0373948_0000864 3300034817 Bacteria 4037
923 Ga0373948_0001422 3300034817 Bacteria 3313
924 Ga0373950_0000535 3300034818 Bacteria 4665
925 Ga0373958_0000216 3300034819 Bacteria 6783
926 Ga0373959_0008925 3300034820 Bacteria 1718
927 Ga0373938_0000124 3300034957 Bacteria 10815
928 Ga0373938_0000788 3300034957 Bacteria 5154
929 Ga0373938_0008045 3300034957 Bacteria 1874
930 Ga0373926_0016522 3300035083 Bacteria 2526
931 Ga0373928_0000110 3300035084 Bacteria 14944
932 Ga0373928_0002179 3300035084 Bacteria 3818
933 Ga0373928_0025506 3300035084 Bacteria 1275
934 Ga0373929_0001063 3300035085 Bacteria 5328
935 Ga0373934_0001670 3300035086 Bacteria 8148
936 Ga0373940_0002009 3300035088 Bacteria 3855
937 Ga0373944_0003628 3300035089 Bacteria 3991
938 Ga0373944_0058131 3300035089 Bacteria 1234
939 Ga0373949_0000761 3300035090 Bacteria 10377
940 Ga0373949_0001658 3300035090 Bacteria 6217
941 Ga0373951_0000329 3300035091 Bacteria 14769
942 Ga0373951_0001516 3300035091 Bacteria 6074
943 Ga0373952_0000070 3300035092 Bacteria 13102
944 Ga0373923_0005698 3300035111 Bacteria 4243
945 Ga0373932_0000433 3300035112 Bacteria 12778
946 Ga0373932_0000963 3300035112 Bacteria 8409
947 Ga0373932_0008232 3300035112 Bacteria 2491
948 Ga0373932_0031209 3300035112 Bacteria 1483
949 Ga0373936_0004576 3300035113 Bacteria 5234
950 Ga0373936_0072021 3300035113 Bacteria 1426
951 Ga0373936_0105241 3300035113 Bacteria 1194
952 Ga0373939_0000855 3300035114 Bacteria 7531
953 Ga0373939_0001546 3300035114 Bacteria 5585
954 Ga0373939_0003350 3300035114 Bacteria 3761
955 Ga0373939_0014509 3300035114 Bacteria 2046
956 Ga0373939_0025147 3300035114 Bacteria 1666
957 Ga0373941_0000305 3300035115 Bacteria 9524
958 Ga0373941_0004557 3300035115 Bacteria 3209
959 Ga0373945_0005146 3300035116 Bacteria 4177
960 Ga0373953_0011810 3300035117 Bacteria 3077
961 Ga0373954_0045399 3300035118 Bacteria 2053
962 Ga0373954_0110839 3300035118 Bacteria 1327
963 Ga0373956_0005026 3300035119 Bacteria 5299
964 Ga0373956_0006332 3300035119 Bacteria 4738
965 Ga0373956_0010100 3300035119 Bacteria 3855
966 Ga0373956_0036257 3300035119 Bacteria 2176
967 Ga0373956_0125173 3300035119 Bacteria 1202
968 Ga0373957_0000983 3300035120 Bacteria 7489
969 Ga0373960_0000546 3300035121 Bacteria 7574
970 Ga0373960_0042215 3300035121 Bacteria 1323
971 Ga0373943_0017856 3300035170 Bacteria 3252
972 Ga0373946_0031747 3300035171 Bacteria 2118
973 Ga0373955_0001661 3300035172 Bacteria 9511
974 Ga0373955_0004688 3300035172 Bacteria 6073
975 Ga0373955_0031456 3300035172 Bacteria 2780
976 Ga0373955_0045719 3300035172 Bacteria 2363
977 Ga0373942_0001944 3300035207 Bacteria 5171
978 Ga0373961_0001228 3300035241 Bacteria 7882
979 Ga0373961_0021487 3300035241 Bacteria 1717
980 Ga0373962_0000078 3300035242 Bacteria 21523
981 Ga0316574_0000319 3300035398 Bacteria 18374
982 Ga0316574_0009783 3300035398 Bacteria 5388
983 Ga0373924_0001379 3300035410 Bacteria 7855
984 Ga0373924_0021037 3300035410 Bacteria 2542
985 Ga0373931_0006061 3300035691 Bacteria 5630
986 Ga0373931_0008963 3300035691 Bacteria 4768
987 Ga0373931_0013241 3300035691 Bacteria 4013
988 Ga0373931_0019902 3300035691 Bacteria 3354
989 Ga0373931_0032688 3300035691 Bacteria 2693
990 Ga0373931_0067187 3300035691 Bacteria 1948
991 Ga0373935_0090949 3300035692 Bacteria 1998
992 Ga0373927_0004764 3300035695 Bacteria 9445
993 Ga0373927_0064957 3300035695 Bacteria 2361
994 Ga0373927_0222576 3300035695 Bacteria 1239
995 Ga0373927_0245578 3300035695 Bacteria 1177
996 Ga0373927_0257955 3300035695 Bacteria 1146
997 Ga0373933_0007273 3300035724 Bacteria 6037
998 Ga0373933_0012150 3300035724 Bacteria 4756
999 Ga0373933_0055552 3300035724 Bacteria 2376
1000 Ga0373947_0056337 3300035725 Bacteria 2375
1001 Ga0373947_0081181 3300035725 Bacteria 2007
1002 Ga0373937_0004370 3300036401 Bacteria 12001
1003 Ga0373937_0019345 3300036401 Bacteria 6093
1004 Ga0373937_0027569 3300036401 Bacteria 5137
1005 Ga0373937_0360643 3300036401 Bacteria 1377
1006 Ga0373937_0429426 3300036401 Bacteria 1254
1007 Ga0316582_0000730 3300036647 Bacteria 13083
1008 Ga0316582_0002562 3300036647 Bacteria 8603
1009 Ga0316582_0007218 3300036647 Bacteria 5908
1010 Ga0316582_0011650 3300036647 Bacteria 4871
1011 Ga0316582_0023784 3300036647 Bacteria 3655
1012 Ga0316584_0013465 3300036712 Bacteria 5789
1013 Ga0316584_0027897 3300036712 Bacteria 4158
1014 Ga0373925_0002927 3300037068 Bacteria 13472
1015 Ga0373925_0008898 3300037068 Bacteria 7316
1016 Ga0373925_0037967 3300037068 Bacteria 3558
1017 Ga0373925_0182452 3300037068 Bacteria 1662
1018 Ga0373925_0186013 3300037068 Bacteria 1647
1019 Ga0395899_0002076 3300037312 Bacteria 16462
1020 Ga0395899_0006301 3300037312 Bacteria 9180
1021 Ga0395899_0062305 3300037312 Bacteria 2747
1022 Ga0395899_0186938 3300037312 Bacteria 1451
1023 Ga0395900_0001933 3300037418 Bacteria 23481
1024 Ga0395900_0068502 3300037418 Bacteria 3647
1025 Ga0395900_0071597 3300037418 Bacteria 3564
1026 Ga0395900_0172049 3300037418 Bacteria 2204
1027 Ga0395900_0239598 3300037418 Bacteria 1820
1028 Ga0395898_0011487 3300037466 Bacteria 9195
1029 Ga0395898_0088853 3300037466 Bacteria 2974
1030 Ga0395898_0212239 3300037466 Bacteria 1846
1031 Ga0395905_0068444 3300037471 Bacteria 3325
1032 Ga0395905_0129877 3300037471 Bacteria 2370
1033 Ga0395905_0158266 3300037471 Bacteria 2130
1034 Ga0436364_0036618 3300037853 Bacteria 7303
1035 Ga0436364_0857514 3300037853 Bacteria 2890
1036 Ga0395901_0004832 3300038443 Bacteria 13598
1037 Ga0395901_0016566 3300038443 Bacteria 7510
1038 Ga0395901_0041730 3300038443 Bacteria 4756
1039 Ga0395901_0109712 3300038443 Bacteria 2897
1040 Ga0395901_0133484 3300038443 Bacteria 2609
1041 Ga0436365_0105297 3300039437 Bacteria 2485
1042 Ga0436365_0459631 3300039437 Bacteria 25364
1043 Ga0436365_0692767 3300039437 Bacteria 2111
1044 Ga0436365_1117139 3300039437 Bacteria 26783
1045 Ga0436365_1201344 3300039437 Bacteria 2744
1046 Ga0436365_1240810 3300039437 Bacteria 4325
1047 Ga0436360_0230815 3300039438 Bacteria 4251
1048 Ga0436360_0883006 3300039438 Bacteria 1743
1049 Ga0436361_0200318 3300039447 Bacteria 12914
1050 Ga0436361_0259398 3300039447 Bacteria 3987
1051 Ga0436361_0372175 3300039447 Bacteria 6682
1052 Ga0436363_0450541 3300039450 Bacteria 1389
1053 Ga0436363_0473328 3300039450 Bacteria 7286
1054 Ga0436363_1172772 3300039450 Bacteria 18869
1055 Ga0436362_1155470 3300039453 Bacteria 10535
1056 Ga0439450_007850 3300042008 Bacteria 1970
1057 Ga0466966_0037433 3300044684 Bacteria 3129
1058 Ga0466961_0170254 3300044693 Bacteria 1355
1059 Ga0466963_0005297 3300044694 Bacteria 7538
1060 Ga0466963_0015991 3300044694 Bacteria 4658
1061 Ga0466963_0098823 3300044694 Bacteria 1996
1062 Ga0466957_0025628 3300044842 Bacteria 3496
1063 Ga0466957_0035271 3300044842 Bacteria 3002
1064 Ga0466957_0046875 3300044842 Bacteria 2625
1065 Ga0466957_0102590 3300044842 Bacteria 1805
1066 Ga0466957_0155382 3300044842 Bacteria 1482
1067 Ga0451576_0013427 3300045051 Bacteria 9164
1068 Ga0466958_0010304 3300045836 Bacteria 5233
1069 Ga0466958_0132747 3300045836 Bacteria 1564
1070 Ga0466958_0267711 3300045836 Bacteria 1094
1071 Ga0466967_0002811 3300045976 Bacteria 11040
1072 Ga0466967_0030503 3300045976 Bacteria 4526
1073 Ga0466967_0091017 3300045976 Bacteria 2772
1074 Ga0466967_0368073 3300045976 Bacteria 1394
1075 Ga0466967_0432787 3300045976 Bacteria 1284
1076 Ga0466967_0442481 3300045976 Bacteria 1269
1077 Ga0495592_0001529 3300046454 Bacteria 16130
1078 Ga0495603_0000670 3300046455 Bacteria 19398
1079 Ga0495629_0000393 3300046459 Bacteria 36754
1080 Ga0495629_0001375 3300046459 Bacteria 19174
1081 Ga0495629_0012826 3300046459 Bacteria 6064
1082 Ga0495629_0080038 3300046459 Bacteria 2281
1083 Ga0495629_0207898 3300046459 Bacteria 1352
1084 Ga0495641_0025422 3300046461 Bacteria 2907
1085 Ga0495641_0033775 3300046461 Bacteria 2424
1086 Ga0495641_0047353 3300046461 Bacteria 1974
1087 Ga0495651_0006087 3300046462 Bacteria 9213
1088 Ga0495651_0008573 3300046462 Bacteria 7836
1089 Ga0495653_0002726 3300046463 Bacteria 14071
1090 Ga0495653_0004466 3300046463 Bacteria 11299
1091 Ga0495580_0034851 3300046472 Bacteria 3622
1092 Ga0495582_0000779 3300046473 Bacteria 17659
1093 Ga0495582_0001937 3300046473 Bacteria 11623
1094 Ga0495582_0008531 3300046473 Bacteria 5652
1095 Ga0495639_0009849 3300046475 Bacteria 4103
1096 Ga0495639_0036987 3300046475 Bacteria 2187
1097 Ga0495662_0016674 3300046476 Bacteria 3559
1098 Ga0495664_0061378 3300046477 Bacteria 2238
1099 Ga0495664_0068131 3300046477 Bacteria 2123
1100 Ga0495584_0019743 3300046491 Bacteria 3424
1101 Ga0495584_0022014 3300046491 Bacteria 3236
1102 Ga0495585_0001185 3300046492 Bacteria 21166
1103 Ga0495594_0005668 3300046499 Bacteria 6424
1104 Ga0495594_0009696 3300046499 Bacteria 4981
1105 Ga0495607_0005231 3300046501 Bacteria 9339
1106 Ga0495608_0000910 3300046511 Bacteria 20753
1107 Ga0495608_0035043 3300046511 Bacteria 3387
1108 Ga0495608_0159942 3300046511 Bacteria 1432
1109 Ga0495610_0022275 3300046512 Bacteria 3469
1110 Ga0495618_0007318 3300046514 Bacteria 6679
1111 Ga0495618_0108847 3300046514 Bacteria 1774
1112 Ga0495628_0005038 3300046516 Bacteria 11611
1113 Ga0495628_0010765 3300046516 Bacteria 7744
1114 Ga0495628_0012779 3300046516 Bacteria 7069
1115 Ga0495630_0029846 3300046517 Bacteria 4054
1116 Ga0495630_0088181 3300046517 Bacteria 2343
1117 Ga0495644_0000958 3300046523 Bacteria 11936
1118 Ga0495652_0007044 3300046529 Bacteria 10390
1119 Ga0495652_0007383 3300046529 Bacteria 10132
1120 Ga0495652_0026173 3300046529 Bacteria 5156
1121 Ga0495652_0216386 3300046529 Bacteria 1442
1122 Ga0495652_0312341 3300046529 Bacteria 1138
1123 Ga0495665_0091900 3300046531 Bacteria 1595
1124 Ga0495640_0015973 3300046533 Bacteria 5631
1125 Ga0495640_0024347 3300046533 Bacteria 4406
1126 Ga0495586_0015728 3300046535 Bacteria 4025
1127 Ga0495586_0017379 3300046535 Bacteria 3823
1128 Ga0495587_0005121 3300046536 Bacteria 8567
1129 Ga0495587_0040487 3300046536 Bacteria 2785
1130 Ga0495587_0078657 3300046536 Bacteria 1913
1131 Ga0495609_0008204 3300046538 Bacteria 5126
1132 Ga0495645_0000411 3300046543 Bacteria 29443
1133 Ga0495645_0043834 3300046543 Bacteria 3263
1134 Ga0495645_0189828 3300046543 Bacteria 1401
1135 Ga0495622_0002612 3300046557 Bacteria 8691
1136 Ga0495633_0001515 3300046558 Bacteria 17958
1137 Ga0495667_0001630 3300046559 Bacteria 14860
1138 Ga0495667_0007962 3300046559 Bacteria 7186
1139 Ga0495667_0010461 3300046559 Bacteria 6276
1140 Ga0495656_0000318 3300046615 Bacteria 16638
1141 Ga0495634_0002031 3300046642 Bacteria 17183
1142 Ga0495634_0036809 3300046642 Bacteria 3345
1143 Ga0495634_0060188 3300046642 Bacteria 2527
1144 Ga0495634_0122527 3300046642 Bacteria 1664
1145 Ga0495634_0174407 3300046642 Bacteria 1350
1146 Ga0495611_0074564 3300046648 Bacteria 1554
1147 Ga0495625_0152320 3300046660 Bacteria 1554
1148 Ga0495635_0001031 3300046663 Bacteria 18442
1149 Ga0495635_0005256 3300046663 Bacteria 9007
1150 Ga0495635_0011792 3300046663 Bacteria 6129
1151 Ga0495635_0012085 3300046663 Bacteria 6051
1152 Ga0495635_0062737 3300046663 Bacteria 2552
1153 Ga0495661_0001616 3300046665 Bacteria 18468
1154 Ga0495661_0095256 3300046665 Bacteria 1686
1155 Ga0495588_0001427 3300046674 Bacteria 10216
1156 Ga0495588_0129404 3300046674 Bacteria 1331
1157 Ga0495657_0001810 3300046675 Bacteria 18276
1158 Ga0495657_0045983 3300046675 Bacteria 2959
1159 Ga0495599_0003947 3300046678 Bacteria 8723
1160 Ga0495623_0015056 3300046679 Bacteria 4999
1161 Ga0495623_0019658 3300046679 Bacteria 4366
1162 Ga0495646_0001814 3300046680 Bacteria 12814
1163 Ga0495647_0003738 3300046681 Bacteria 4889
1164 Ga0495647_0006768 3300046681 Bacteria 3816
1165 Ga0495658_0005085 3300046683 Bacteria 6462
1166 Ga0495658_0009265 3300046683 Bacteria 4897
1167 Ga0495658_0025773 3300046683 Bacteria 3147
1168 Ga0495658_0083082 3300046683 Bacteria 1883
1169 Ga0495613_0000828 3300046689 Bacteria 23929
1170 Ga0495613_0038239 3300046689 Bacteria 3556
1171 Ga0495613_0099705 3300046689 Bacteria 2098
1172 Ga0495624_0012537 3300046690 Bacteria 5789
1173 Ga0495670_0000124 3300046691 Bacteria 33461
1174 Ga0495600_0023253 3300046809 Bacteria 3986
1175 Ga0495581_0001264 3300047315 Bacteria 13919
1176 Ga0495581_0053539 3300047315 Bacteria 2330
1177 Ga0495581_0149215 3300047315 Bacteria 1365
1178 Ga0495604_0002346 3300047317 Bacteria 15172
1179 Ga0495604_0004303 3300047317 Bacteria 11269
1180 Ga0495604_0015527 3300047317 Bacteria 6078
1181 Ga0495604_0088587 3300047317 Bacteria 2302
1182 Ga0495674_0026260 3300047319 Bacteria 5330
1183 Ga0495674_0074287 3300047319 Bacteria 2928
1184 Ga0495672_0109837 3300047320 Bacteria 1482
1185 Ga0495676_0006475 3300047321 Bacteria 10797
1186 Ga0495676_0007659 3300047321 Bacteria 9906
1187 Ga0495680_0004228 3300047322 Bacteria 13784
1188 Ga0495680_0013913 3300047322 Bacteria 7000
1189 Ga0495680_0014386 3300047322 Bacteria 6854
1190 Ga0495680_0087672 3300047322 Bacteria 2340
1191 Ga0495687_002811 3300047443 Bacteria 13429
1192 Ga0495687_029624 3300047443 Bacteria 2530
1193 Ga0495675_0001356 3300047444 Bacteria 14820
1194 Ga0495675_0060436 3300047444 Bacteria 2402
1195 Ga0495684_0026014 3300047471 Bacteria 4497
1196 Ga0495684_0026180 3300047471 Bacteria 4481
1197 Ga0495593_0001300 3300047673 Bacteria 14648
1198 Ga0495593_0007472 3300047673 Bacteria 6391
1199 Ga0495602_0000965 3300048088 Bacteria 27818
1200 Ga0495602_0016070 3300048088 Bacteria 7531
1201 Ga0495602_0160353 3300048088 Bacteria 1757
1202 Ga0495614_0007782 3300048089 Bacteria 4763
1203 Ga0495614_0013377 3300048089 Bacteria 3599
1204 Ga0496100_0001803 3300048903 Bacteria 10692
1205 Ga0496100_0006007 3300048903 Bacteria 6588
1206 Ga0496100_0009382 3300048903 Bacteria 5500
1207 Ga0496100_0009831 3300048903 Bacteria 5389
1208 Ga0496100_0011212 3300048903 Bacteria 5096
1209 Ga0496100_0035057 3300048903 Bacteria 3154
1210 Ga0496101_0005494 3300048904 Bacteria 8085
1211 Ga0496101_0010712 3300048904 Bacteria 6061
1212 Ga0496101_0012308 3300048904 Bacteria 5705
1213 Ga0496101_0016075 3300048904 Bacteria 5051
1214 Ga0496101_0092387 3300048904 Bacteria 2253
1215 Ga0496102_0002383 3300048905 Bacteria 16038
1216 Ga0496102_0002581 3300048905 Bacteria 15446
1217 Ga0496102_0014552 3300048905 Bacteria 6836
1218 Ga0496102_0027670 3300048905 Bacteria 5063
1219 Ga0496102_0057895 3300048905 Bacteria 3540
1220 Ga0496102_0165086 3300048905 Bacteria 2083
1221 Ga0496102_0226202 3300048905 Bacteria 1764
1222 Ga0496103_0001467 3300048906 Bacteria 15796
1223 Ga0496103_0044861 3300048906 Bacteria 2725
1224 Ga0496103_0048265 3300048906 Bacteria 2630
1225 Ga0496103_0092876 3300048906 Bacteria 1905
1226 Ga0496103_0120944 3300048906 Bacteria 1667
1227 Ga0496103_0207986 3300048906 Bacteria 1258
1228 Ga0496104_0000140 3300048907 Bacteria 67259
1229 Ga0496104_0001380 3300048907 Bacteria 21003
1230 Ga0496104_0002385 3300048907 Bacteria 16189
1231 Ga0496104_0003723 3300048907 Bacteria 13167
1232 Ga0496104_0011140 3300048907 Bacteria 8046
1233 Ga0496104_0023064 3300048907 Bacteria 5719
1234 Ga0496104_0063858 3300048907 Bacteria 3493
1235 Ga0496104_0070545 3300048907 Bacteria 3321
1236 Ga0496104_0074567 3300048907 Bacteria 3230
1237 Ga0496104_0127335 3300048907 Bacteria 2445
1238 Ga0496104_0128547 3300048907 Bacteria 2433
1239 Ga0496105_0000576 3300048908 Bacteria 24313
1240 Ga0496105_0011644 3300048908 Bacteria 6959
1241 Ga0496105_0015883 3300048908 Bacteria 6005
1242 Ga0496105_0037931 3300048908 Bacteria 3969
1243 Ga0496105_0046617 3300048908 Bacteria 3577
1244 Ga0496105_0078450 3300048908 Bacteria 2726
1245 Ga0496105_0118052 3300048908 Bacteria 2188
1246 Ga0496105_0248493 3300048908 Bacteria 1441
1247 Ga0496105_0291550 3300048908 Bacteria 1313
1248 Ga0496106_0005139 3300048909 Bacteria 9698
1249 Ga0496106_0006169 3300048909 Bacteria 8864
1250 Ga0496106_0088672 3300048909 Bacteria 2384
1251 Ga0496106_0172924 3300048909 Bacteria 1713
1252 Ga0496107_0003075 3300048910 Bacteria 11075
1253 Ga0496107_0007600 3300048910 Bacteria 7480
1254 Ga0496107_0011594 3300048910 Bacteria 6143
1255 Ga0496107_0031611 3300048910 Bacteria 3779
1256 Ga0496107_0039598 3300048910 Bacteria 3381
1257 Ga0496107_0055432 3300048910 Bacteria 2863
1258 Ga0496107_0058907 3300048910 Bacteria 2778
1259 Ga0496107_0065927 3300048910 Bacteria 2625
1260 Ga0496108_0001916 3300048911 Bacteria 16653
1261 Ga0496108_0001956 3300048911 Bacteria 16502
1262 Ga0496108_0008567 3300048911 Bacteria 8292
1263 Ga0496108_0015479 3300048911 Bacteria 6221
1264 Ga0496108_0033980 3300048911 Bacteria 4235
1265 Ga0496108_0167849 3300048911 Bacteria 1898
1266 Ga0496108_0189295 3300048911 Bacteria 1783
1267 Ga0496109_0002403 3300048912 Bacteria 15675
1268 Ga0496109_0003867 3300048912 Bacteria 12504
1269 Ga0496109_0008536 3300048912 Bacteria 8713
1270 Ga0496109_0016699 3300048912 Bacteria 6422
1271 Ga0496109_0020933 3300048912 Bacteria 5781
1272 Ga0496109_0032254 3300048912 Bacteria 4709
1273 Ga0496109_0058311 3300048912 Bacteria 3526
1274 Ga0496109_0070470 3300048912 Bacteria 3208
1275 Ga0496109_0114739 3300048912 Bacteria 2506
1276 Ga0496109_0127659 3300048912 Bacteria 2371
1277 Ga0496110_0001138 3300048913 Bacteria 18809
1278 Ga0496110_0018836 3300048913 Bacteria 5798
1279 Ga0496110_0020613 3300048913 Bacteria 5569
1280 Ga0496110_0021179 3300048913 Bacteria 5498
1281 Ga0496110_0039121 3300048913 Bacteria 4128
1282 Ga0496110_0073283 3300048913 Bacteria 3039
1283 Ga0496110_0101020 3300048913 Bacteria 2585
1284 Ga0496110_0255543 3300048913 Bacteria 1595
1285 Ga0496110_0260936 3300048913 Bacteria 1577
1286 Ga0496110_0261954 3300048913 Bacteria 1574
1287 Ga0496111_0000953 3300048914 Bacteria 15828
1288 Ga0496111_0008508 3300048914 Bacteria 6796
1289 Ga0496111_0009164 3300048914 Bacteria 6589
1290 Ga0496111_0012862 3300048914 Bacteria 5679
1291 Ga0496111_0013771 3300048914 Bacteria 5511
1292 Ga0496111_0056098 3300048914 Bacteria 2850
1293 Ga0496111_0164006 3300048914 Bacteria 1650
1294 Ga0496111_0241353 3300048914 Bacteria 1342
1295 Ga0496112_0002442 3300048915 Bacteria 14981
1296 Ga0496112_0011458 3300048915 Bacteria 8098
1297 Ga0496112_0012548 3300048915 Bacteria 7785
1298 Ga0496112_0013917 3300048915 Bacteria 7442
1299 Ga0496112_0066084 3300048915 Bacteria 3569
1300 Ga0496112_0076113 3300048915 Bacteria 3319
1301 Ga0496113_0000507 3300048916 Bacteria 19242
1302 Ga0496113_0007014 3300048916 Bacteria 7204
1303 Ga0496113_0008248 3300048916 Bacteria 6773
1304 Ga0496113_0016856 3300048916 Bacteria 5056
1305 Ga0496113_0090131 3300048916 Bacteria 2362
1306 Ga0496113_0276990 3300048916 Bacteria 1341
1307 Ga0496114_0001691 3300048917 Bacteria 16757
1308 Ga0496114_0021688 3300048917 Bacteria 5226
1309 Ga0496114_0060291 3300048917 Bacteria 3171
1310 Ga0496114_0451102 3300048917 Bacteria 1139
1311 Ga0496115_0001108 3300048918 Bacteria 19446
1312 Ga0496115_0022877 3300048918 Bacteria 4848
1313 Ga0496115_0030806 3300048918 Bacteria 4223
1314 Ga0496115_0035840 3300048918 Bacteria 3927
1315 Ga0496115_0047564 3300048918 Bacteria 3431
1316 Ga0496115_0087821 3300048918 Bacteria 2538
1317 Ga0496115_0094061 3300048918 Bacteria 2451
1318 Ga0496115_0115263 3300048918 Bacteria 2209
1319 Ga0496115_0132013 3300048918 Bacteria 2059
1320 Ga0496125_0090083 3300048928 Bacteria 2304
1321 Ga0496126_0147504 3300048929 Bacteria 2019
1322 Ga0496126_0283871 3300048929 Bacteria 1370
1323 Ga0496126_0318472 3300048929 Bacteria 1279
1324 Ga0501031_0002979 3300049568 Bacteria 10841
1325 Ga0501031_0042937 3300049568 Bacteria 2952
1326 Ga0501032_0023557 3300049569 Bacteria 4250
1327 Ga0501032_0033838 3300049569 Bacteria 3501
1328 Ga0501032_0038608 3300049569 Bacteria 3251
1329 Ga0501032_0041098 3300049569 Bacteria 3142
1330 Ga0501032_0129986 3300049569 Bacteria 1662
1331 Ga0501032_0140772 3300049569 Bacteria 1588
1332 Ga0501033_0000293 3300049570 Bacteria 48186
1333 Ga0501033_0053706 3300049570 Bacteria 2983
1334 Ga0501033_0136525 3300049570 Bacteria 1774
1335 Ga0501033_0138876 3300049570 Bacteria 1757
1336 Ga0501033_0175263 3300049570 Bacteria 1539
1337 Ga0501033_0204422 3300049570 Bacteria 1410
1338 Ga0501034_0000673 3300049571 Bacteria 51868
1339 Ga0501034_0000933 3300049571 Bacteria 42599
1340 Ga0501034_0004047 3300049571 Bacteria 16450
1341 Ga0501034_0005512 3300049571 Bacteria 13810
1342 Ga0501034_0017759 3300049571 Bacteria 7296
1343 Ga0501034_0022347 3300049571 Bacteria 6446
1344 Ga0501034_0026343 3300049571 Bacteria 5922
1345 Ga0501034_0034216 3300049571 Bacteria 5152
1346 Ga0501034_0060934 3300049571 Bacteria 3790
1347 Ga0501034_0073445 3300049571 Bacteria 3429
1348 Ga0501034_0078952 3300049571 Bacteria 3295
1349 Ga0501034_0079168 3300049571 Bacteria 3290
1350 Ga0501034_0106109 3300049571 Bacteria 2802
1351 Ga0501034_0143476 3300049571 Bacteria 2366
1352 Ga0501034_0161489 3300049571 Bacteria 2211
1353 Ga0501034_0187870 3300049571 Bacteria 2029
1354 Ga0501036_0006497 3300049572 Bacteria 9500
1355 Ga0501036_0011259 3300049572 Bacteria 7401
1356 Ga0501036_0016088 3300049572 Bacteria 6250
1357 Ga0501036_0019692 3300049572 Bacteria 5665
1358 Ga0501036_0020547 3300049572 Bacteria 5545
1359 Ga0501036_0029776 3300049572 Bacteria 4613
1360 Ga0501036_0146710 3300049572 Bacteria 1990
1361 Ga0501036_0167829 3300049572 Bacteria 1849
1362 Ga0501036_0255386 3300049572 Bacteria 1468
1363 Ga0501036_0304425 3300049572 Bacteria 1333
1364 Ga0501036_0308220 3300049572 Bacteria 1324
1365 Ga0501036_0374447 3300049572 Bacteria 1188
1366 Ga0501037_0000007 3300049573 Bacteria 215187
1367 Ga0501037_0064865 3300049573 Bacteria 2660
1368 Ga0501037_0108630 3300049573 Bacteria 1999
1369 Ga0501037_0132829 3300049573 Bacteria 1784
1370 Ga0501037_0214393 3300049573 Bacteria 1357
1371 Ga0501038_0005137 3300049574 Bacteria 12159
1372 Ga0501038_0012390 3300049574 Bacteria 7794
1373 Ga0501038_0036503 3300049574 Bacteria 4312
1374 Ga0501038_0090297 3300049574 Bacteria 2568
1375 Ga0501038_0118921 3300049574 Bacteria 2181
1376 Ga0501038_0128188 3300049574 Bacteria 2086
1377 Ga0501038_0143883 3300049574 Bacteria 1948
1378 Ga0501038_0202252 3300049574 Bacteria 1593
1379 Ga0501038_0222729 3300049574 Bacteria 1504
1380 Ga0501039_0008139 3300049575 Bacteria 7988
1381 Ga0501039_0016843 3300049575 Bacteria 5602
1382 Ga0501039_0031185 3300049575 Bacteria 4109
1383 Ga0501039_0079972 3300049575 Bacteria 2543
1384 Ga0501039_0288684 3300049575 Bacteria 1290
1385 Ga0501040_0157384 3300049576 Bacteria 1605
1386 Ga0501041_0073998 3300049577 Bacteria 2093
1387 Ga0501043_0000034 3300049579 Bacteria 133724
1388 Ga0501043_0006067 3300049579 Bacteria 9711
1389 Ga0501043_0017750 3300049579 Bacteria 5579
1390 Ga0501043_0041542 3300049579 Bacteria 3613
1391 Ga0501043_0060758 3300049579 Bacteria 2967
1392 Ga0501043_0063709 3300049579 Bacteria 2895
1393 Ga0501043_0146257 3300049579 Bacteria 1850
1394 Ga0501043_0189572 3300049579 Bacteria 1599
1395 Ga0501046_0079460 3300049580 Bacteria 2535
1396 Ga0501047_0000073 3300049581 Bacteria 125990
1397 Ga0501047_0000774 3300049581 Bacteria 33424
1398 Ga0501047_0030634 3300049581 Bacteria 5186
1399 Ga0501047_0038907 3300049581 Bacteria 4600
1400 Ga0501047_0119127 3300049581 Bacteria 2522
1401 Ga0501047_0152823 3300049581 Bacteria 2183
1402 Ga0501047_0177234 3300049581 Bacteria 1999
1403 Ga0501047_0198354 3300049581 Bacteria 1868
1404 Ga0501047_0271932 3300049581 Bacteria 1540
1405 Ga0501047_0409409 3300049581 Bacteria 1188
1406 Ga0501047_0409420 3300049581 Bacteria 1188
1407 Ga0501048_0000014 3300049582 Bacteria 75001
1408 Ga0501048_0079945 3300049582 Bacteria 2307
1409 Ga0501048_0194541 3300049582 Bacteria 1437
1410 Ga0501048_0239835 3300049582 Bacteria 1286
1411 Ga0501048_0267366 3300049582 Bacteria 1215
1412 Ga0501067_0034182 3300049583 Bacteria 2821
1413 Ga0501067_0060130 3300049583 Bacteria 2103
1414 Ga0501068_0001787 3300049584 Bacteria 11449
1415 Ga0501068_0031102 3300049584 Bacteria 3169
1416 Ga0501068_0031777 3300049584 Bacteria 3137
1417 Ga0501068_0054503 3300049584 Bacteria 2422
1418 Ga0501068_0108677 3300049584 Bacteria 1723
1419 Ga0501069_0000017 3300049585 Bacteria 141492
1420 Ga0501069_0033135 3300049585 Bacteria 2844
1421 Ga0501069_0034669 3300049585 Bacteria 2779
1422 Ga0501069_0131486 3300049585 Bacteria 1433
1423 Ga0501070_0000519 3300049586 Bacteria 35280
1424 Ga0501070_0000541 3300049586 Bacteria 34684
1425 Ga0501070_0002868 3300049586 Bacteria 15015
1426 Ga0501070_0003489 3300049586 Bacteria 13638
1427 Ga0501070_0005928 3300049586 Bacteria 10420
1428 Ga0501070_0011719 3300049586 Bacteria 7405
1429 Ga0501070_0012906 3300049586 Bacteria 7041
1430 Ga0501070_0027817 3300049586 Bacteria 4742
1431 Ga0501070_0030671 3300049586 Bacteria 4504
1432 Ga0501070_0058049 3300049586 Bacteria 3208
1433 Ga0501070_0074797 3300049586 Bacteria 2804
1434 Ga0501070_0084019 3300049586 Bacteria 2636
1435 Ga0501070_0097175 3300049586 Bacteria 2436
1436 Ga0501070_0142245 3300049586 Bacteria 1981
1437 Ga0501070_0166002 3300049586 Bacteria 1819
1438 Ga0501070_0233141 3300049586 Bacteria 1508
1439 Ga0501071_0080632 3300049587 Bacteria 2380
1440 Ga0501071_0128264 3300049587 Bacteria 1883
1441 Ga0501071_0244357 3300049587 Bacteria 1354
1442 Ga0501072_0136528 3300049588 Bacteria 1955
1443 Ga0501073_0003588 3300049589 Bacteria 11672
1444 Ga0501073_0021568 3300049589 Bacteria 4643
1445 Ga0501073_0036994 3300049589 Bacteria 3467
1446 Ga0501073_0039844 3300049589 Bacteria 3327
1447 Ga0501073_0040675 3300049589 Bacteria 3288
1448 Ga0501073_0057598 3300049589 Bacteria 2716
1449 Ga0501073_0070335 3300049589 Bacteria 2438
1450 Ga0501073_0095525 3300049589 Bacteria 2064
1451 Ga0501073_0136002 3300049589 Bacteria 1703
1452 Ga0501074_0000060 3300049590 Bacteria 54314
1453 Ga0501074_0001948 3300049590 Bacteria 14198
1454 Ga0501074_0018695 3300049590 Bacteria 5035
1455 Ga0501074_0044865 3300049590 Bacteria 3199
1456 Ga0501074_0050782 3300049590 Bacteria 2994
1457 Ga0501074_0102239 3300049590 Bacteria 2051
1458 Ga0501074_0121566 3300049590 Bacteria 1867
1459 Ga0501074_0159199 3300049590 Bacteria 1612
1460 Ga0501076_0083499 3300049592 Bacteria 2565
1461 Ga0501077_0015722 3300049593 Bacteria 4766
1462 Ga0501077_0098888 3300049593 Bacteria 1849
1463 Ga0501079_0014973 3300049741 Bacteria 5912
1464 Ga0501079_0106535 3300049741 Bacteria 2175
1465 Ga0501079_0125506 3300049741 Bacteria 1997
1466 Ga0501080_0004582 3300049742 Bacteria 12318
1467 Ga0501080_0006500 3300049742 Bacteria 10498
1468 Ga0501080_0006919 3300049742 Bacteria 10230
1469 Ga0501080_0023300 3300049742 Bacteria 5740
1470 Ga0501080_0045860 3300049742 Bacteria 4070
1471 Ga0501080_0047871 3300049742 Bacteria 3980
1472 Ga0501080_0071138 3300049742 Bacteria 3235
1473 Ga0501080_0075568 3300049742 Bacteria 3133
1474 Ga0501080_0104034 3300049742 Bacteria 2633
1475 Ga0501080_0282933 3300049742 Bacteria 1507
1476 Ga0501080_0347892 3300049742 Bacteria 1339
1477 Ga0501081_0119398 3300049743 Bacteria 1877
1478 Ga0501083_0000901 3300049744 Bacteria 19671
1479 Ga0501083_0004883 3300049744 Bacteria 9487
1480 Ga0501083_0013908 3300049744 Bacteria 5627
1481 Ga0501083_0047539 3300049744 Bacteria 2899
1482 Ga0501083_0085333 3300049744 Bacteria 2089
1483 Ga0501083_0092153 3300049744 Bacteria 2000
1484 Ga0501083_0112212 3300049744 Bacteria 1791
1485 Ga0501083_0115820 3300049744 Bacteria 1760
1486 Ga0501083_0140556 3300049744 Bacteria 1581
1487 Ga0501083_0232747 3300049744 Bacteria 1200
1488 Ga0501035_0000159 3300049822 Bacteria 82264
1489 Ga0501035_0000600 3300049822 Bacteria 39660
1490 Ga0501035_0000646 3300049822 Bacteria 38403
1491 Ga0501035_0001203 3300049822 Bacteria 26985
1492 Ga0501035_0002346 3300049822 Bacteria 18647
1493 Ga0501035_0019888 3300049822 Bacteria 6167
1494 Ga0501035_0020702 3300049822 Bacteria 6045
1495 Ga0501035_0032064 3300049822 Bacteria 4783
1496 Ga0501035_0037929 3300049822 Bacteria 4363
1497 Ga0501035_0038854 3300049822 Bacteria 4309
1498 Ga0501035_0051674 3300049822 Bacteria 3678
1499 Ga0501035_0066697 3300049822 Bacteria 3194
1500 Ga0501035_0212306 3300049822 Bacteria 1655
1501 Ga0501035_0300110 3300049822 Bacteria 1353
1502 Ga0501044_0000010 3300049823 Bacteria 260121
1503 Ga0501044_0003755 3300049823 Bacteria 17071
1504 Ga0501044_0004404 3300049823 Bacteria 15755
1505 Ga0501044_0006201 3300049823 Bacteria 13213
1506 Ga0501044_0024781 3300049823 Bacteria 6364
1507 Ga0501044_0030118 3300049823 Bacteria 5720
1508 Ga0501044_0051021 3300049823 Bacteria 4267
1509 Ga0501044_0068227 3300049823 Bacteria 3622
1510 Ga0501044_0086293 3300049823 Bacteria 3170
1511 Ga0501044_0093675 3300049823 Bacteria 3028
1512 Ga0501044_0095572 3300049823 Bacteria 2994
1513 Ga0501044_0101567 3300049823 Bacteria 2893
1514 Ga0501044_0108024 3300049823 Bacteria 2793
1515 Ga0501044_0162683 3300049823 Bacteria 2207
1516 Ga0501044_0222159 3300049823 Bacteria 1839
1517 Ga0501044_0231993 3300049823 Bacteria 1793
1518 Ga0501044_0251416 3300049823 Bacteria 1708
1519 Ga0501044_0283961 3300049823 Bacteria 1588
1520 Ga0501044_0284153 3300049823 Bacteria 1587
1521 Ga0501045_0026466 3300049824 Bacteria 4173
1522 Ga0501045_0133694 3300049824 Bacteria 1844
1523 nmdc:mga03n38_2293_c1 3300050490 Bacteria 5864
1524 nmdc:mga03n38_42272_c1 3300050490 Bacteria 1991
1525 nmdc:mga00v17_39835_c1 3300050491 Bacteria 2815
1526 nmdc:mga00v17_56125_c1 3300050491 Bacteria 2407
1527 nmdc:mga0yw44_45934_c1 3300050492 Bacteria 2621
1528 nmdc:mga0yw44_85251_c1 3300050492 Bacteria 1987
1529 nmdc:mga0k408_8357_c1 3300050493 Bacteria 5554
1530 nmdc:mga06z11_24273_c1 3300050494 Bacteria 2857
1531 nmdc:mga06z11_42332_c1 3300050494 Bacteria 2284
1532 nmdc:mga06z11_4487_c1 3300050494 Bacteria 5495
1533 nmdc:mga06z11_5359_c1 3300050494 Bacteria 5137
1534 nmdc:mga04h51_26532_c1 3300050495 Bacteria 1792
1535 nmdc:mga04h51_66563_c1 3300050495 Bacteria 1248
1536 nmdc:mga07m45_53962_c1 3300050496 Bacteria 2272
1537 nmdc:mga05p37_1104_c1 3300050507 Bacteria 31014
1538 nmdc:mga05p37_223327_c1 3300050507 Bacteria 2272
1539 nmdc:mga05p37_84450_c1 3300050507 Bacteria 3912
1540 nmdc:mga05p37_97634_c1 3300050507 Bacteria 3619
1541 nmdc:mga09592_1765_c1 3300050508 Bacteria 17372
1542 nmdc:mga0qj67_28_c1 3300050509 Bacteria 102760
1543 nmdc:mga0qj67_3718_c1 3300050509 Bacteria 11008
1544 nmdc:mga06r32_196680_c1 3300050510 Bacteria 2003
1545 nmdc:mga06r32_46542_c1 3300050510 Bacteria 4139
1546 nmdc:mga06r32_736_c1 3300050510 Bacteria 28719
1547 nmdc:mga08y16_143561_c1 3300050511 Bacteria 2482
1548 nmdc:mga08y16_167383_c1 3300050511 Bacteria 2283
1549 nmdc:mga08y16_1849_c1 3300050511 Bacteria 21493
1550 nmdc:mga08y16_21691_c1 3300050511 Bacteria 6780
1551 nmdc:mga08y16_383869_c1 3300050511 Bacteria 1440
1552 nmdc:mga08y16_469850_c1 3300050511 Bacteria 1281
1553 nmdc:mga08y16_74311_c1 3300050511 Bacteria 3542
1554 nmdc:mga0n895_13632_c1 3300050512 Bacteria 7346
1555 nmdc:mga0n895_190625_c1 3300050512 Bacteria 2081
1556 nmdc:mga0n895_1980_c1 3300050512 Bacteria 15715
1557 nmdc:mga0n895_2460_c1 3300050512 Bacteria 14479
1558 nmdc:mga0n895_26501_c1 3300050512 Bacteria 5491
1559 nmdc:mga0rr50_161853_c1 3300050513 Bacteria 1817
1560 nmdc:mga0rr50_2527_c1 3300050513 Bacteria 10358
1561 nmdc:mga0rr50_32494_c1 3300050513 Bacteria 2700
1562 nmdc:mga0rr50_72464_c1 3300050513 Bacteria 2631
1563 nmdc:mga08x19_149100_c1 3300050514 Bacteria 1583
1564 nmdc:mga08x19_21_c1 3300050514 Bacteria 302369
1565 nmdc:mga0a205_121822_c1 3300050515 Bacteria 2507
1566 nmdc:mga0a205_14901_c1 3300050515 Bacteria 7254
1567 nmdc:mga0a205_1718_c1 3300050515 Bacteria 18905
1568 nmdc:mga0a205_176242_c1 3300050515 Bacteria 2033
1569 nmdc:mga0a205_179715_c1 3300050515 Bacteria 2010
1570 nmdc:mga0a205_271378_c1 3300050515 Bacteria 1573
1571 nmdc:mga0a205_65966_c1 3300050515 Bacteria 3498
1572 nmdc:mga0a205_8485_c3 3300050515 Bacteria 5321
1573 Ga0495601_0000467 3300053077 Bacteria 21224
1574 Ga0495601_0008398 3300053077 Bacteria 6099
1575 Ga0495601_0046279 3300053077 Bacteria 2738
1576 Ga0495601_0190038 3300053077 Bacteria 1342
1577 Ga0495612_0000575 3300053078 Bacteria 14787
1578 Ga0495612_0004077 3300053078 Bacteria 6053
1579 Ga0495612_0009540 3300053078 Bacteria 3932
1580 Ga0495595_0005255 3300053084 Bacteria 5230
1581 Ga0495595_0015806 3300053084 Bacteria 3223
1582 Ga0495595_0020591 3300053084 Bacteria 2872
1583 Ga0495619_0000016 3300053085 Bacteria 231442
1584 Ga0495619_0000292 3300053085 Bacteria 35551
1585 Ga0495619_0000804 3300053085 Bacteria 20515
1586 Ga0495619_0002154 3300053085 Bacteria 13053
1587 Ga0495619_0003066 3300053085 Bacteria 10850
1588 Ga0495619_0004183 3300053085 Bacteria 9211
1589 Ga0495619_0009942 3300053085 Bacteria 5991
1590 Ga0495619_0033620 3300053085 Bacteria 3330
1591 Ga0495619_0040028 3300053085 Bacteria 3062
1592 Ga0495619_0136110 3300053085 Bacteria 1690
1593 Ga0500578_0135202 3300053086 Bacteria 1544
1594 Ga0500643_006080 3300053087 Bacteria 5101
1595 Ga0500644_0044863 3300053088 Bacteria 1486
1596 Ga0500651_0062888 3300053093 Bacteria 2317
1597 Ga0500566_0129026 3300053094 Bacteria 1355
1598 Ga0500641_0003644 3300053096 Bacteria 5437
1599 Ga0500641_0004560 3300053096 Bacteria 4896
1600 Ga0500595_000394 3300053119 Bacteria 28047
1601 Ga0500595_018802 3300053119 Bacteria 2520
1602 Ga0500642_0014969 3300053130 Bacteria 2901
1603 Ga0500642_0025906 3300053130 Bacteria 2388
1604 Ga0500652_004858 3300053131 Bacteria 4191
1605 Ga0500568_0013284 3300053139 Bacteria 3756
1606 Ga0500616_0000001 3300053153 Bacteria 1986011
1607 Ga0500616_0003621 3300053153 Bacteria 11644
1608 Ga0500627_0039875 3300053158 Bacteria 2013
1609 Ga0500645_000755 3300053730 Bacteria 19791
1610 Ga0501084_0029401 3300054114 Bacteria 4597
1611 Ga0501084_0112022 3300054114 Bacteria 2293
1612 Ga0501084_0251460 3300054114 Bacteria 1492
1613 Ga0587080_017340 3300059503 Bacteria 1146
1614 Ga0587067_014850 3300059640 Bacteria 1254
1615 Ga0501082_0000555 3300060353 Bacteria 33188
1616 Ga0501082_0015451 3300060353 Bacteria 6571
1617 Ga0501082_0019338 3300060353 Bacteria 5870
1618 Ga0501082_0042186 3300060353 Bacteria 3933
1619 Ga0501082_0119888 3300060353 Bacteria 2280
1620 Ga0501082_0167224 3300060353 Bacteria 1911
1621 Ga0501082_0195000 3300060353 Bacteria 1762
1622 Ga0501082_0234740 3300060353 Bacteria 1596
1623 Ga0501082_0238986 3300060353 Bacteria 1581
1624 Ga0466962_0021598 3300061719 Bacteria 3090

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009094 Ga0111539_10242837 Ga0111539_102428372 314
2 3300048906 Ga0496103_0092876 Ga0496103_0092876_380_1417 315
3 3300048907 Ga0496104_0128547 Ga0496104_0128547_754_1791 315
4 3300048915 Ga0496112_0076113 Ga0496112_0076113_1802_2839 315
5 3300003751 Ga0055538_1000013 Ga0055538_1000013235 317
6 3300003752 Ga0055539_1000018 Ga0055539_1000018235 317
7 3300003756 Ga0055533_1000022 Ga0055533_1000022235 317
8 3300003759 Ga0055525_1000024 Ga0055525_1000024235 317
9 3300003841 Ga0055541_1000013 Ga0055541_1000013235 317
10 3300025224 Ga0209784_100005 Ga0209784_100005493 317
11 3300025225 Ga0209566_100005 Ga0209566_100005493 317
12 3300025226 Ga0209674_100009 Ga0209674_100009493 317
13 3300025230 Ga0209563_100012 Ga0209563_100012493 317
14 3300025253 Ga0209677_100006 Ga0209677_100006493 317
15 3300005563 Ga0068855_100000899 Ga0068855_10000089910 318
16 3300025949 Ga0207667_10000053 Ga0207667_1000005340 318
17 3300039447 Ga0436361_0372175 Ga0436361_0372175_5102_6151 318
18 3300054114 Ga0501084_0251460 Ga0501084_0251460_136_1128 321
19 iso_pu_bacteria 2839094727 2839094819 321
20 3300031344 Ga0265316_10077968 Ga0265316_100779682 322
21 3300038443 Ga0395901_0041730 Ga0395901_0041730_769_1803 324
22 3300035116 Ga0373945_0005146 Ga0373945_0005146_1320_2357 326
23 3300035695 Ga0373927_0004764 Ga0373927_0004764_2566_3603 326
24 3300036401 Ga0373937_0360643 Ga0373937_0360643_179_1216 326
25 3300037068 Ga0373925_0008898 Ga0373925_0008898_1609_2646 326
26 3300046455 Ga0495603_0000670 Ga0495603_0000670_13823_14860 326
27 3300046459 Ga0495629_0001375 Ga0495629_0001375_13882_14919 326
28 3300046461 Ga0495641_0025422 Ga0495641_0025422_1704_2741 326
29 3300046473 Ga0495582_0000779 Ga0495582_0000779_13540_14577 326
30 3300046475 Ga0495639_0009849 Ga0495639_0009849_1343_2380 326
31 3300046499 Ga0495594_0009696 Ga0495594_0009696_2350_3387 326
32 3300046557 Ga0495622_0002612 Ga0495622_0002612_3472_4509 326
33 3300046642 Ga0495634_0002031 Ga0495634_0002031_12811_13848 326
34 3300046674 Ga0495588_0001427 Ga0495588_0001427_4663_5700 326
35 3300046681 Ga0495647_0006768 Ga0495647_0006768_2365_3402 326
36 3300046683 Ga0495658_0005085 Ga0495658_0005085_642_1679 326
37 3300046689 Ga0495613_0000828 Ga0495613_0000828_8966_10003 326
38 3300047315 Ga0495581_0001264 Ga0495581_0001264_11035_12072 326
39 3300047321 Ga0495676_0006475 Ga0495676_0006475_331_1368 326
40 3300047673 Ga0495593_0007472 Ga0495593_0007472_4817_5854 326
41 3300048089 Ga0495614_0007782 Ga0495614_0007782_3316_4353 326
42 3300049573 Ga0501037_0214393 Ga0501037_0214393_136_1164 326
43 3300053084 Ga0495595_0015806 Ga0495595_0015806_1863_2900 326
44 3300053085 Ga0495619_0040028 Ga0495619_0040028_813_1850 326
45 3300014325 Ga0163163_10148670 Ga0163163_101486702 327
46 3300060353 Ga0501082_0234740 Ga0501082_0234740_12_1007 327
47 3300049744 Ga0501083_0004883 Ga0501083_0004883_8182_9246 328
48 3300050492 nmdc:mga0yw44_45934_c1 nmdc:mga0yw44_45934_c1_515_1531 328
49 3300050494 nmdc:mga06z11_4487_c1 nmdc:mga06z11_4487_c1_3220_4236 328
50 3300059503 Ga0587080_017340 Ga0587080_017340_37_1080 328
51 3300002705 JGI25156J39149_1002724 JGI25156J39149_10027245 330
52 3300002741 JGI25157J39369_1001000 JGI25157J39369_10010006 330
53 3300003214 JGI25165J46597_1001163 JGI25165J46597_10011636 330
54 3300025250 Ga0209026_1000041 Ga0209026_1000041158 330
55 3300025256 Ga0209759_1000823 Ga0209759_100082316 330
56 3300025261 Ga0209233_1000030 Ga0209233_1000030407 330
57 3300049571 Ga0501034_0004047 Ga0501034_0004047_2736_3782 330
58 3300049576 Ga0501040_0157384 Ga0501040_0157384_315_1358 330
59 3300049584 Ga0501068_0001787 Ga0501068_0001787_2297_3343 330
60 3300049742 Ga0501080_0347892 Ga0501080_0347892_56_1102 330
61 3300049823 Ga0501044_0284153 Ga0501044_0284153_416_1462 330
62 3300037418 Ga0395900_0172049 Ga0395900_0172049_14_1033 331
63 3300037471 Ga0395905_0068444 Ga0395905_0068444_970_1989 331
64 3300038443 Ga0395901_0109712 Ga0395901_0109712_1478_2497 331
65 3300048928 Ga0496125_0090083 Ga0496125_0090083_941_1960 331
66 3300049586 Ga0501070_0233141 Ga0501070_0233141_177_1196 331
67 3300059640 Ga0587067_014850 Ga0587067_014850_118_1176 331
68 3300060353 Ga0501082_0000555 Ga0501082_0000555_28451_29500 331
69 3300001979 JGI24740J21852_10003708 JGI24740J21852_100037087 332
70 3300005339 Ga0070660_100093896 Ga0070660_1000938962 332
71 3300005614 Ga0068856_100154628 Ga0068856_1001546282 332
72 3300006038 Ga0075365_10005892 Ga0075365_100058927 332
73 3300006042 Ga0075368_10035481 Ga0075368_100354811 332
74 3300006048 Ga0075363_100007241 Ga0075363_1000072412 332
75 3300006051 Ga0075364_10030197 Ga0075364_100301973 332
76 3300006178 Ga0075367_10024719 Ga0075367_100247192 332
77 3300006353 Ga0075370_10008027 Ga0075370_100080272 332
78 3300009174 Ga0105241_10120078 Ga0105241_101200782 332
79 3300013105 Ga0157369_10095863 Ga0157369_100958633 332
80 3300015265 Ga0182005_1041840 Ga0182005_10418401 332
81 3300025254 Ga0209148_1000165 Ga0209148_100016573 332
82 3300025272 Ga0209455_1000143 Ga0209455_100014373 332
83 3300025904 Ga0207647_10005612 Ga0207647_100056122 332
84 3300025920 Ga0207649_10146006 Ga0207649_101460062 332
85 3300026078 Ga0207702_10145308 Ga0207702_101453082 332
86 3300031249 Ga0265339_10062948 Ga0265339_100629481 332
87 3300037312 Ga0395899_0186938 Ga0395899_0186938_316_1341 332
88 3300046665 Ga0495661_0001616 Ga0495661_0001616_9438_10472 332
89 3300047443 Ga0495687_002811 Ga0495687_002811_2192_3226 332
90 3300048918 Ga0496115_0132013 Ga0496115_0132013_548_1603 332
91 3300050490 nmdc:mga03n38_42272_c1 nmdc:mga03n38_42272_c1_514_1569 332
92 3300050491 nmdc:mga00v17_56125_c1 nmdc:mga00v17_56125_c1_934_1989 332
93 3300050495 nmdc:mga04h51_26532_c1 nmdc:mga04h51_26532_c1_52_1107 332
94 3300050496 nmdc:mga07m45_53962_c1 nmdc:mga07m45_53962_c1_14_1069 332
95 3300053153 Ga0500616_0003621 Ga0500616_0003621_3889_4914 332
96 3300005331 Ga0070670_100076571 Ga0070670_1000765713 333
97 3300005335 Ga0070666_10051877 Ga0070666_100518772 333
98 3300005340 Ga0070689_100031553 Ga0070689_1000315532 333
99 3300005344 Ga0070661_100054000 Ga0070661_1000540002 333
100 3300005347 Ga0070668_100129203 Ga0070668_1001292031 333
101 3300005355 Ga0070671_100170379 Ga0070671_1001703792 333
102 3300005365 Ga0070688_100048065 Ga0070688_1000480652 333
103 3300005367 Ga0070667_100084453 Ga0070667_1000844532 333
104 3300005406 Ga0070703_10005029 Ga0070703_100050294 333
105 3300005434 Ga0070709_10012359 Ga0070709_100123592 333
106 3300005436 Ga0070713_100000386 Ga0070713_1000003866 333
107 3300005438 Ga0070701_10090486 Ga0070701_100904861 333
108 3300005440 Ga0070705_100000435 Ga0070705_10000043521 333
109 3300005444 Ga0070694_100001961 Ga0070694_10000196110 333
110 3300005445 Ga0070708_100157380 Ga0070708_1001573802 333
111 3300005455 Ga0070663_100043766 Ga0070663_1000437662 333
112 3300005466 Ga0070685_10049384 Ga0070685_100493842 333
113 3300005468 Ga0070707_100125319 Ga0070707_1001253192 333
114 3300005518 Ga0070699_100003034 Ga0070699_1000030341 333
115 3300005544 Ga0070686_100004208 Ga0070686_1000042084 333
116 3300005545 Ga0070695_100021946 Ga0070695_1000219461 333
117 3300005546 Ga0070696_100000223 Ga0070696_1000002237 333
118 3300005548 Ga0070665_100274845 Ga0070665_1002748452 333
119 3300005564 Ga0070664_100032140 Ga0070664_1000321404 333
120 3300005577 Ga0068857_100016636 Ga0068857_1000166362 333
121 3300005577 Ga0068857_100070302 Ga0068857_1000703022 333
122 3300005617 Ga0068859_100004306 Ga0068859_10000430617 333
123 3300005617 Ga0068859_100127127 Ga0068859_1001271272 333
124 3300005618 Ga0068864_100022809 Ga0068864_1000228094 333
125 3300005618 Ga0068864_100240374 Ga0068864_1002403741 333
126 3300005841 Ga0068863_100094817 Ga0068863_1000948173 333
127 3300005842 Ga0068858_100172578 Ga0068858_1001725782 333
128 3300005843 Ga0068860_100006221 Ga0068860_10000622114 333
129 3300005844 Ga0068862_100030924 Ga0068862_1000309245 333
130 3300006173 Ga0070716_100000521 Ga0070716_1000005217 333
131 3300006175 Ga0070712_100052271 Ga0070712_1000522713 333
132 3300006237 Ga0097621_100026110 Ga0097621_1000261103 333
133 3300006358 Ga0068871_100017854 Ga0068871_1000178542 333
134 3300006358 Ga0068871_100240854 Ga0068871_1002408543 333
135 3300006931 Ga0097620_100004306 Ga0097620_1000043062 333
136 3300006931 Ga0097620_100127127 Ga0097620_1001271272 333
137 3300007076 Ga0075435_100039937 Ga0075435_1000399373 333
138 3300009011 Ga0105251_10016129 Ga0105251_100161293 333
139 3300009094 Ga0111539_10053404 Ga0111539_100534044 333
140 3300009094 Ga0111539_10112285 Ga0111539_101122853 333
141 3300009098 Ga0105245_10482679 Ga0105245_104826791 333
142 3300009101 Ga0105247_10035475 Ga0105247_100354752 333
143 3300009147 Ga0114129_10164133 Ga0114129_101641332 333
144 3300009176 Ga0105242_10018520 Ga0105242_100185202 333
145 3300009177 Ga0105248_10241410 Ga0105248_102414102 333
146 3300009545 Ga0105237_10082473 Ga0105237_100824732 333
147 3300009553 Ga0105249_10007611 Ga0105249_100076118 333
148 3300009553 Ga0105249_10109986 Ga0105249_101099862 333
149 3300009553 Ga0105249_10117597 Ga0105249_101175972 333
150 3300010375 Ga0105239_10089074 Ga0105239_100890742 333
151 3300012507 Ga0157342_1001578 Ga0157342_10015781 333
152 3300013102 Ga0157371_10101753 Ga0157371_101017532 333
153 3300013297 Ga0157378_10083826 Ga0157378_100838263 333
154 3300013306 Ga0163162_10448517 Ga0163162_104485171 333
155 3300014968 Ga0157379_10025886 Ga0157379_100258861 333
156 3300025885 Ga0207653_10001759 Ga0207653_100017597 333
157 3300025898 Ga0207692_10006606 Ga0207692_100066064 333
158 3300025904 Ga0207647_10066062 Ga0207647_100660621 333
159 3300025905 Ga0207685_10017035 Ga0207685_100170351 333
160 3300025906 Ga0207699_10140312 Ga0207699_101403122 333
161 3300025907 Ga0207645_10094800 Ga0207645_100948002 333
162 3300025911 Ga0207654_10236515 Ga0207654_102365151 333
163 3300025915 Ga0207693_10003902 Ga0207693_1000390215 333
164 3300025922 Ga0207646_10234315 Ga0207646_102343152 333
165 3300025924 Ga0207694_10059284 Ga0207694_100592842 333
166 3300025925 Ga0207650_10103672 Ga0207650_101036721 333
167 3300025927 Ga0207687_10012727 Ga0207687_100127272 333
168 3300025928 Ga0207700_10000516 Ga0207700_1000051618 333
169 3300025931 Ga0207644_10066275 Ga0207644_100662752 333
170 3300025935 Ga0207709_10055805 Ga0207709_100558051 333
171 3300025939 Ga0207665_10001387 Ga0207665_1000138715 333
172 3300025940 Ga0207691_10096678 Ga0207691_100966782 333
173 3300025941 Ga0207711_10003715 Ga0207711_1000371511 333
174 3300025942 Ga0207689_10037034 Ga0207689_100370344 333
175 3300025961 Ga0207712_10001313 Ga0207712_1000131313 333
176 3300026035 Ga0207703_10151577 Ga0207703_101515771 333
177 3300026067 Ga0207678_10113809 Ga0207678_101138092 333
178 3300026075 Ga0207708_10041554 Ga0207708_100415542 333
179 3300026078 Ga0207702_10258556 Ga0207702_102585562 333
180 3300026095 Ga0207676_10040193 Ga0207676_100401933 333
181 3300026095 Ga0207676_10044107 Ga0207676_100441073 333
182 3300026116 Ga0207674_10020898 Ga0207674_100208986 333
183 3300026116 Ga0207674_10107462 Ga0207674_101074622 333
184 3300026118 Ga0207675_100073676 Ga0207675_1000736763 333
185 3300028379 Ga0268266_10048222 Ga0268266_100482222 333
186 3300028380 Ga0268265_10044645 Ga0268265_100446452 333
187 3300028556 Ga0265337_1000071 Ga0265337_100007119 333
188 3300028556 Ga0265337_1000905 Ga0265337_100090521 333
189 3300028573 Ga0265334_10001642 Ga0265334_100016422 333
190 3300028577 Ga0265318_10008960 Ga0265318_100089602 333
191 3300031242 Ga0265329_10046785 Ga0265329_100467851 333
192 3300031247 Ga0265340_10004425 Ga0265340_100044259 333
193 3300031665 Ga0316575_10001860 Ga0316575_100018603 333
194 3300031711 Ga0265314_10026132 Ga0265314_100261321 333
195 3300031712 Ga0265342_10125768 Ga0265342_101257681 333
196 3300031901 Ga0307406_10210881 Ga0307406_102108811 333
197 3300034817 Ga0373948_0001422 Ga0373948_0001422_564_1613 333
198 3300034820 Ga0373959_0008925 Ga0373959_0008925_539_1588 333
199 3300034957 Ga0373938_0008045 Ga0373938_0008045_361_1410 333
200 3300035083 Ga0373926_0016522 Ga0373926_0016522_34_1083 333
201 3300035091 Ga0373951_0001516 Ga0373951_0001516_3796_4845 333
202 3300035114 Ga0373939_0025147 Ga0373939_0025147_592_1641 333
203 3300035115 Ga0373941_0004557 Ga0373941_0004557_373_1422 333
204 3300035121 Ga0373960_0042215 Ga0373960_0042215_260_1309 333
205 3300035241 Ga0373961_0021487 Ga0373961_0021487_20_1069 333
206 3300035691 Ga0373931_0067187 Ga0373931_0067187_681_1730 333
207 3300037068 Ga0373925_0002927 Ga0373925_0002927_2755_3804 333
208 3300039437 Ga0436365_0105297 Ga0436365_0105297_1434_2450 333
209 3300046459 Ga0495629_0000393 Ga0495629_0000393_4109_5158 333
210 3300046461 Ga0495641_0047353 Ga0495641_0047353_852_1901 333
211 3300046472 Ga0495580_0034851 Ga0495580_0034851_187_1236 333
212 3300046499 Ga0495594_0005668 Ga0495594_0005668_2352_3401 333
213 3300046681 Ga0495647_0003738 Ga0495647_0003738_266_1315 333
214 3300046683 Ga0495658_0009265 Ga0495658_0009265_3725_4774 333
215 3300046689 Ga0495613_0038239 Ga0495613_0038239_2381_3430 333
216 3300047321 Ga0495676_0007659 Ga0495676_0007659_873_1922 333
217 3300047322 Ga0495680_0014386 Ga0495680_0014386_300_1349 333
218 3300047673 Ga0495593_0001300 Ga0495593_0001300_9748_10797 333
219 3300048903 Ga0496100_0001803 Ga0496100_0001803_1536_2585 333
220 3300048904 Ga0496101_0005494 Ga0496101_0005494_2490_3539 333
221 3300048905 Ga0496102_0002383 Ga0496102_0002383_13625_14710 333
222 3300048906 Ga0496103_0120944 Ga0496103_0120944_359_1408 333
223 3300048908 Ga0496105_0078450 Ga0496105_0078450_93_1142 333
224 3300048908 Ga0496105_0248493 Ga0496105_0248493_362_1411 333
225 3300048909 Ga0496106_0006169 Ga0496106_0006169_6965_8050 333
226 3300048910 Ga0496107_0039598 Ga0496107_0039598_748_1797 333
227 3300048910 Ga0496107_0058907 Ga0496107_0058907_745_1761 333
228 3300048912 Ga0496109_0058311 Ga0496109_0058311_1127_2176 333
229 3300048913 Ga0496110_0039121 Ga0496110_0039121_3027_4076 333
230 3300048914 Ga0496111_0013771 Ga0496111_0013771_1496_2545 333
231 3300048918 Ga0496115_0094061 Ga0496115_0094061_260_1309 333
232 3300049569 Ga0501032_0129986 Ga0501032_0129986_179_1195 333
233 3300049571 Ga0501034_0161489 Ga0501034_0161489_799_1815 333
234 3300049574 Ga0501038_0118921 Ga0501038_0118921_957_1973 333
235 3300049575 Ga0501039_0288684 Ga0501039_0288684_142_1221 333
236 3300049577 Ga0501041_0073998 Ga0501041_0073998_855_1934 333
237 3300049587 Ga0501071_0244357 Ga0501071_0244357_139_1218 333
238 3300049824 Ga0501045_0026466 Ga0501045_0026466_3050_4129 333
239 3300050513 nmdc:mga0rr50_72464_c1 nmdc:mga0rr50_72464_c1_1370_2419 333
240 3300053085 Ga0495619_0000292 Ga0495619_0000292_33147_34196 333
241 3300054114 Ga0501084_0029401 Ga0501084_0029401_753_1832 333
242 3300060353 Ga0501082_0119888 Ga0501082_0119888_501_1580 333
243 3300021384 Ga0213876_10092539 Ga0213876_100925391 334
244 3300025924 Ga0207694_10310487 Ga0207694_103104871 334
245 3300036401 Ga0373937_0429426 Ga0373937_0429426_15_1034 334
246 3300039437 Ga0436365_1117139 Ga0436365_1117139_18194_19255 334
247 3300049581 Ga0501047_0152823 Ga0501047_0152823_254_1312 334
248 3300049585 Ga0501069_0034669 Ga0501069_0034669_832_1851 334
249 3300049586 Ga0501070_0000519 Ga0501070_0000519_29966_31024 334
250 3300049589 Ga0501073_0095525 Ga0501073_0095525_34_1092 334
251 3300049590 Ga0501074_0044865 Ga0501074_0044865_2105_3163 334
252 3300049742 Ga0501080_0023300 Ga0501080_0023300_4301_5359 334
253 3300049822 Ga0501035_0000646 Ga0501035_0000646_35984_37042 334
254 3300049823 Ga0501044_0006201 Ga0501044_0006201_10606_11664 334
255 iso_pu_bacteria 2808606386 2808983395 334
256 iso_pu_bacteria 2808606415 2809128623 334
257 iso_pu_bacteria 2808606419 2809148244 334
258 iso_pu_bacteria 2818991449 2819618658 334
259 iso_pu_bacteria 2852618963 2852620334 334
260 iso_pu_bacteria 2928130867 2928133394 334
261 3300005439 Ga0070711_100101069 Ga0070711_1001010691 335
262 3300009147 Ga0114129_10551892 Ga0114129_105518921 335
263 3300014968 Ga0157379_10261538 Ga0157379_102615382 335
264 3300031247 Ga0265340_10026353 Ga0265340_100263533 335
265 3300031595 Ga0265313_10000007 Ga0265313_10000007136 335
266 3300031595 Ga0265313_10040439 Ga0265313_100404392 335
267 3300032133 Ga0316583_10000114 Ga0316583_100001147 335
268 3300035695 Ga0373927_0257955 Ga0373927_0257955_16_1038 335
269 3300045051 Ga0451576_0013427 Ga0451576_0013427_1957_3003 335
270 3300049744 Ga0501083_0013908 Ga0501083_0013908_264_1328 335
271 3300053096 Ga0500641_0003644 Ga0500641_0003644_1429_2463 335
272 3300053119 Ga0500595_018802 Ga0500595_018802_842_1867 335
273 3300053131 Ga0500652_004858 Ga0500652_004858_889_1911 335
274 3300053730 Ga0500645_000755 Ga0500645_000755_5707_6729 335
275 iso_pu_bacteria 2765235838 2765568319 335
276 3300002737 JGI25162J39368_1006977 JGI25162J39368_10069772 336
277 3300005331 Ga0070670_100217389 Ga0070670_1002173892 336
278 3300005334 Ga0068869_100216213 Ga0068869_1002162131 336
279 3300005338 Ga0068868_100177126 Ga0068868_1001771262 336
280 3300005345 Ga0070692_10145410 Ga0070692_101454101 336
281 3300005353 Ga0070669_100055900 Ga0070669_1000559002 336
282 3300005364 Ga0070673_100062830 Ga0070673_1000628303 336
283 3300005365 Ga0070688_100036157 Ga0070688_1000361572 336
284 3300005367 Ga0070667_100067331 Ga0070667_1000673312 336
285 3300005367 Ga0070667_100438524 Ga0070667_1004385241 336
286 3300005438 Ga0070701_10007667 Ga0070701_100076674 336
287 3300005441 Ga0070700_100247718 Ga0070700_1002477181 336
288 3300005456 Ga0070678_100359909 Ga0070678_1003599091 336
289 3300005458 Ga0070681_10045357 Ga0070681_100453574 336
290 3300005459 Ga0068867_100044695 Ga0068867_1000446952 336
291 3300005459 Ga0068867_100192542 Ga0068867_1001925422 336
292 3300005530 Ga0070679_100082575 Ga0070679_1000825753 336
293 3300005539 Ga0068853_100083538 Ga0068853_1000835382 336
294 3300005543 Ga0070672_100227059 Ga0070672_1002270592 336
295 3300005545 Ga0070695_100094242 Ga0070695_1000942421 336
296 3300005548 Ga0070665_100352391 Ga0070665_1003523911 336
297 3300005563 Ga0068855_100080155 Ga0068855_1000801552 336
298 3300005577 Ga0068857_100052140 Ga0068857_1000521403 336
299 3300005615 Ga0070702_100040401 Ga0070702_1000404012 336
300 3300005617 Ga0068859_100087393 Ga0068859_1000873932 336
301 3300005618 Ga0068864_100075952 Ga0068864_1000759522 336
302 3300005618 Ga0068864_100126771 Ga0068864_1001267712 336
303 3300005840 Ga0068870_10089933 Ga0068870_100899332 336
304 3300005841 Ga0068863_100068930 Ga0068863_1000689302 336
305 3300005842 Ga0068858_100068794 Ga0068858_1000687943 336
306 3300005844 Ga0068862_100074436 Ga0068862_1000744361 336
307 3300005844 Ga0068862_100123498 Ga0068862_1001234982 336
308 3300006038 Ga0075365_10067727 Ga0075365_100677272 336
309 3300006042 Ga0075368_10025068 Ga0075368_100250681 336
310 3300006048 Ga0075363_100006563 Ga0075363_1000065633 336
311 3300006178 Ga0075367_10003833 Ga0075367_100038332 336
312 3300006186 Ga0075369_10005732 Ga0075369_100057325 336
313 3300006237 Ga0097621_100118825 Ga0097621_1001188252 336
314 3300006931 Ga0097620_100087394 Ga0097620_1000873942 336
315 3300009036 Ga0105244_10060181 Ga0105244_100601812 336
316 3300009094 Ga0111539_10103752 Ga0111539_101037522 336
317 3300009098 Ga0105245_10034000 Ga0105245_100340004 336
318 3300009098 Ga0105245_10089875 Ga0105245_100898751 336
319 3300009148 Ga0105243_10124868 Ga0105243_101248681 336
320 3300009174 Ga0105241_10017686 Ga0105241_100176863 336
321 3300009174 Ga0105241_10042788 Ga0105241_100427883 336
322 3300009176 Ga0105242_10013092 Ga0105242_100130923 336
323 3300009177 Ga0105248_10208726 Ga0105248_102087262 336
324 3300009545 Ga0105237_10008546 Ga0105237_100085468 336
325 3300009545 Ga0105237_10011149 Ga0105237_100111494 336
326 3300009551 Ga0105238_10010402 Ga0105238_100104028 336
327 3300010375 Ga0105239_10205019 Ga0105239_102050192 336
328 3300011119 Ga0105246_10016595 Ga0105246_100165954 336
329 3300011119 Ga0105246_10318265 Ga0105246_103182651 336
330 3300013104 Ga0157370_10016367 Ga0157370_100163675 336
331 3300013296 Ga0157374_10090291 Ga0157374_100902912 336
332 3300013308 Ga0157375_10035534 Ga0157375_100355344 336
333 3300014968 Ga0157379_10057308 Ga0157379_100573082 336
334 3300014969 Ga0157376_10017349 Ga0157376_100173492 336
335 3300015262 Ga0182007_10001553 Ga0182007_1000155310 336
336 3300021361 Ga0213872_10032107 Ga0213872_100321072 336
337 3300025271 Ga0207666_1009299 Ga0207666_10092992 336
338 3300025315 Ga0207697_10014060 Ga0207697_100140603 336
339 3300025893 Ga0207682_10020561 Ga0207682_100205612 336
340 3300025907 Ga0207645_10087452 Ga0207645_100874522 336
341 3300025912 Ga0207707_10034736 Ga0207707_100347362 336
342 3300025914 Ga0207671_10012676 Ga0207671_100126764 336
343 3300025914 Ga0207671_10310726 Ga0207671_103107261 336
344 3300025918 Ga0207662_10003118 Ga0207662_100031183 336
345 3300025921 Ga0207652_10069429 Ga0207652_100694293 336
346 3300025925 Ga0207650_10013399 Ga0207650_100133995 336
347 3300025925 Ga0207650_10069440 Ga0207650_100694402 336
348 3300025926 Ga0207659_10010586 Ga0207659_100105866 336
349 3300025926 Ga0207659_10289166 Ga0207659_102891661 336
350 3300025936 Ga0207670_10069959 Ga0207670_100699592 336
351 3300025936 Ga0207670_10284853 Ga0207670_102848531 336
352 3300025938 Ga0207704_10068712 Ga0207704_100687122 336
353 3300025940 Ga0207691_10072104 Ga0207691_100721043 336
354 3300025942 Ga0207689_10251963 Ga0207689_102519631 336
355 3300025945 Ga0207679_10101637 Ga0207679_101016372 336
356 3300025949 Ga0207667_10062323 Ga0207667_100623232 336
357 3300025960 Ga0207651_10008936 Ga0207651_100089364 336
358 3300025961 Ga0207712_10225868 Ga0207712_102258682 336
359 3300025981 Ga0207640_10114872 Ga0207640_101148722 336
360 3300026041 Ga0207639_10096724 Ga0207639_100967242 336
361 3300026075 Ga0207708_10027764 Ga0207708_100277642 336
362 3300026088 Ga0207641_10067424 Ga0207641_100674243 336
363 3300026089 Ga0207648_10040413 Ga0207648_100404134 336
364 3300026095 Ga0207676_10014297 Ga0207676_100142976 336
365 3300026116 Ga0207674_10021107 Ga0207674_100211073 336
366 3300026118 Ga0207675_100017895 Ga0207675_1000178955 336
367 3300026118 Ga0207675_100195549 Ga0207675_1001955492 336
368 3300028380 Ga0268265_10275013 Ga0268265_102750132 336
369 3300028380 Ga0268265_10390677 Ga0268265_103906771 336
370 3300028381 Ga0268264_10080828 Ga0268264_100808282 336
371 3300031241 Ga0265325_10047121 Ga0265325_100471212 336
372 3300036647 Ga0316582_0000730 Ga0316582_0000730_9953_10990 336
373 3300036647 Ga0316582_0011650 Ga0316582_0011650_1651_2709 336
374 3300036712 Ga0316584_0013465 Ga0316584_0013465_4131_5168 336
375 3300037312 Ga0395899_0002076 Ga0395899_0002076_13323_14366 336
376 3300037418 Ga0395900_0071597 Ga0395900_0071597_1517_2560 336
377 3300037471 Ga0395905_0158266 Ga0395905_0158266_696_1775 336
378 3300039447 Ga0436361_0259398 Ga0436361_0259398_1646_2680 336
379 3300044684 Ga0466966_0037433 Ga0466966_0037433_212_1255 336
380 3300044693 Ga0466961_0170254 Ga0466961_0170254_155_1198 336
381 3300044842 Ga0466957_0025628 Ga0466957_0025628_157_1200 336
382 3300046529 Ga0495652_0026173 Ga0495652_0026173_3356_4399 336
383 3300046543 Ga0495645_0189828 Ga0495645_0189828_327_1370 336
384 3300047443 Ga0495687_029624 Ga0495687_029624_659_1738 336
385 3300048903 Ga0496100_0035057 Ga0496100_0035057_1081_2109 336
386 3300048905 Ga0496102_0002581 Ga0496102_0002581_8553_9581 336
387 3300048906 Ga0496103_0001467 Ga0496103_0001467_3470_4498 336
388 3300048907 Ga0496104_0003723 Ga0496104_0003723_8442_9473 336
389 3300048907 Ga0496104_0063858 Ga0496104_0063858_1059_2087 336
390 3300048907 Ga0496104_0074567 Ga0496104_0074567_588_1625 336
391 3300048908 Ga0496105_0015883 Ga0496105_0015883_1982_3010 336
392 3300048909 Ga0496106_0005139 Ga0496106_0005139_322_1350 336
393 3300048910 Ga0496107_0003075 Ga0496107_0003075_9458_10486 336
394 3300048910 Ga0496107_0011594 Ga0496107_0011594_1008_2033 336
395 3300048911 Ga0496108_0008567 Ga0496108_0008567_3595_4626 336
396 3300048912 Ga0496109_0020933 Ga0496109_0020933_1161_2192 336
397 3300048913 Ga0496110_0021179 Ga0496110_0021179_3033_4064 336
398 3300048913 Ga0496110_0261954 Ga0496110_0261954_402_1451 336
399 3300048914 Ga0496111_0009164 Ga0496111_0009164_1840_2871 336
400 3300048915 Ga0496112_0066084 Ga0496112_0066084_365_1396 336
401 3300048916 Ga0496113_0016856 Ga0496113_0016856_3693_4724 336
402 3300048918 Ga0496115_0001108 Ga0496115_0001108_13833_14861 336
403 3300049571 Ga0501034_0078952 Ga0501034_0078952_673_1716 336
404 3300049571 Ga0501034_0106109 Ga0501034_0106109_1159_2217 336
405 3300049572 Ga0501036_0255386 Ga0501036_0255386_376_1434 336
406 3300049575 Ga0501039_0079972 Ga0501039_0079972_139_1197 336
407 3300049579 Ga0501043_0146257 Ga0501043_0146257_763_1821 336
408 3300049582 Ga0501048_0194541 Ga0501048_0194541_140_1198 336
409 3300049583 Ga0501067_0060130 Ga0501067_0060130_226_1284 336
410 3300049585 Ga0501069_0131486 Ga0501069_0131486_226_1284 336
411 3300049589 Ga0501073_0070335 Ga0501073_0070335_131_1189 336
412 3300049742 Ga0501080_0282933 Ga0501080_0282933_405_1463 336
413 3300049823 Ga0501044_0231993 Ga0501044_0231993_268_1326 336
414 3300049824 Ga0501045_0133694 Ga0501045_0133694_321_1379 336
415 3300050490 nmdc:mga03n38_2293_c1 nmdc:mga03n38_2293_c1_3958_5004 336
416 3300050494 nmdc:mga06z11_5359_c1 nmdc:mga06z11_5359_c1_3457_4503 336
417 3300050511 nmdc:mga08y16_167383_c1 nmdc:mga08y16_167383_c1_931_1980 336
418 3300061719 Ga0466962_0021598 Ga0466962_0021598_1009_2052 336
419 iso_pu_bacteria 2503198000 2503199447 336
420 iso_pu_bacteria 2508501123 2509113463 336
421 iso_pu_bacteria 2509276022 2509394376 336
422 iso_pu_bacteria 2512875024 2512961212 336
423 iso_pu_bacteria 2513237164 2514035252 336
424 iso_pu_bacteria 2588253730 2588519210 336
425 iso_pu_bacteria 2756170246 2756674140 336
426 iso_pu_bacteria 2791355123 2792750560 336
427 iso_pu_bacteria 2844002411 2844009339 336
428 iso_pu_bacteria 2856320880 2856321559 336
429 iso_pu_bacteria 2869278585 2869285488 336
430 iso_pu_bacteria 2871466892 2871472122 336
431 iso_pu_bacteria 2874139085 2874146268 336
432 iso_pu_bacteria 2876363079 2876364602 336
433 iso_pu_bacteria 2878738818 2878741311 336
434 iso_pu_bacteria 2888337043 2888337807 336
435 iso_pu_bacteria 2903448605 2903454872 336
436 iso_pu_bacteria 2903521522 2903522662 336
437 iso_pu_bacteria 2903528002 2903529041 336
438 iso_pu_bacteria 2906378014 2906381191 336
439 iso_pu_bacteria 2924718760 2924723090 336
440 iso_pu_bacteria 2924776078 2924778993 336
441 iso_pu_bacteria 2937848649 2937853500 336
442 iso_pu_bacteria 2937877337 2937883346 336
443 iso_pu_bacteria 2937972304 2937979033 336
444 iso_pu_bacteria 2958034702 2958041193 336
445 iso_pu_bacteria 2958041894 2958057687 336
446 iso_pu_bacteria 2958064165 2958069928 336
447 iso_pu_bacteria 2958084443 2958090513 336
448 iso_pu_bacteria 2958092219 2958092609 336
449 iso_pu_bacteria 2958144490 2958151985 336
450 iso_pu_bacteria 2963644680 2963646058 336
451 iso_pu_bacteria 2968016561 2968022793 336
452 iso_pu_bacteria 2968083720 2968089570 336
453 iso_pu_bacteria 2970469710 2970475378 336
454 iso_pu_bacteria 2970593180 2970600104 336
455 iso_pu_bacteria 2977872689 2977876220 336
456 iso_pu_bacteria 2977922695 2977928708 336
457 iso_pu_bacteria 2977986579 2977992746 336
458 iso_pu_bacteria 2996348954 2996353198 336
459 iso_pu_bacteria 3004211236 3004211350 336
460 iso_pu_bacteria 3004218560 3004225101 336
461 iso_pu_bacteria 3004275668 3004279880 336
462 iso_pu_bacteria 3004334049 3004336364 336
463 iso_pu_bacteria 637000159 637076232 336
464 iso_pu_bacteria 8002060224 8002061154 336
465 iso_pu_bacteria 8004640170 8004645627 336
466 3300005327 Ga0070658_10009761 Ga0070658_100097617 337
467 3300005344 Ga0070661_100008310 Ga0070661_1000083105 337
468 3300005366 Ga0070659_100207364 Ga0070659_1002073642 337
469 3300005539 Ga0068853_100089534 Ga0068853_1000895341 337
470 3300005563 Ga0068855_100011187 Ga0068855_10001118712 337
471 3300005578 Ga0068854_100108048 Ga0068854_1001080482 337
472 3300005614 Ga0068856_100004841 Ga0068856_1000048415 337
473 3300005616 Ga0068852_100024277 Ga0068852_1000242772 337
474 3300005616 Ga0068852_100025918 Ga0068852_1000259185 337
475 3300006358 Ga0068871_100078866 Ga0068871_1000788661 337
476 3300009174 Ga0105241_10030825 Ga0105241_100308252 337
477 3300009551 Ga0105238_10032621 Ga0105238_100326214 337
478 3300013102 Ga0157371_10016708 Ga0157371_100167084 337
479 3300013104 Ga0157370_10059405 Ga0157370_100594054 337
480 3300013105 Ga0157369_10420709 Ga0157369_104207092 337
481 3300025909 Ga0207705_10074918 Ga0207705_100749182 337
482 3300025911 Ga0207654_10055426 Ga0207654_100554262 337
483 3300025919 Ga0207657_10009104 Ga0207657_100091048 337
484 3300025924 Ga0207694_10048354 Ga0207694_100483543 337
485 3300025932 Ga0207690_10144852 Ga0207690_101448522 337
486 3300025949 Ga0207667_10012666 Ga0207667_100126665 337
487 3300025981 Ga0207640_10048971 Ga0207640_100489712 337
488 3300026142 Ga0207698_10011844 Ga0207698_100118445 337
489 3300026142 Ga0207698_10030316 Ga0207698_100303163 337
490 3300031239 Ga0265328_10008652 Ga0265328_100086525 337
491 3300031250 Ga0265331_10000066 Ga0265331_1000006628 337
492 3300031616 Ga0307508_10042520 Ga0307508_100425204 337
493 3300049568 Ga0501031_0042937 Ga0501031_0042937_157_1212 337
494 3300049570 Ga0501033_0175263 Ga0501033_0175263_146_1186 337
495 3300049571 Ga0501034_0187870 Ga0501034_0187870_715_1770 337
496 3300049572 Ga0501036_0011259 Ga0501036_0011259_3981_5036 337
497 3300049574 Ga0501038_0222729 Ga0501038_0222729_196_1251 337
498 3300049579 Ga0501043_0041542 Ga0501043_0041542_1929_2984 337
499 3300049582 Ga0501048_0267366 Ga0501048_0267366_74_1129 337
500 3300049822 Ga0501035_0020702 Ga0501035_0020702_3799_4854 337
501 3300050495 nmdc:mga04h51_66563_c1 nmdc:mga04h51_66563_c1_24_1049 337
502 3300005262 Ga0065165_1001551 Ga0065165_100155118 338
503 3300005339 Ga0070660_100034495 Ga0070660_1000344952 338
504 3300005563 Ga0068855_100021137 Ga0068855_1000211378 338
505 3300006237 Ga0097621_100086354 Ga0097621_1000863541 338
506 3300013296 Ga0157374_10007740 Ga0157374_100077408 338
507 3300025909 Ga0207705_10014540 Ga0207705_100145404 338
508 3300025919 Ga0207657_10008168 Ga0207657_100081684 338
509 3300025921 Ga0207652_10186716 Ga0207652_101867162 338
510 3300025960 Ga0207651_10167102 Ga0207651_101671021 338
511 3300025986 Ga0207658_10274471 Ga0207658_102744712 338
512 3300031238 Ga0265332_10020847 Ga0265332_100208473 338
513 3300031250 Ga0265331_10040257 Ga0265331_100402571 338
514 3300044842 Ga0466957_0102590 Ga0466957_0102590_318_1361 338
515 3300046615 Ga0495656_0000318 Ga0495656_0000318_6624_7655 338
516 iso_pu_bacteria 2891088606 2891090052 338
517 3300005328 Ga0070676_10019390 Ga0070676_100193902 339
518 3300005456 Ga0070678_100101399 Ga0070678_1001013992 339
519 3300005457 Ga0070662_100080659 Ga0070662_1000806592 339
520 3300006881 Ga0068865_100099572 Ga0068865_1000995722 339
521 3300009148 Ga0105243_10367149 Ga0105243_103671491 339
522 3300009177 Ga0105248_10046280 Ga0105248_100462803 339
523 3300010375 Ga0105239_10077992 Ga0105239_100779922 339
524 3300011119 Ga0105246_10099889 Ga0105246_100998892 339
525 3300013104 Ga0157370_10209979 Ga0157370_102099791 339
526 3300013105 Ga0157369_10085321 Ga0157369_100853211 339
527 3300013308 Ga0157375_10001241 Ga0157375_100012416 339
528 3300014968 Ga0157379_10078527 Ga0157379_100785273 339
529 3300025907 Ga0207645_10013792 Ga0207645_100137923 339
530 3300025932 Ga0207690_10163203 Ga0207690_101632032 339
531 3300025938 Ga0207704_10009256 Ga0207704_100092562 339
532 3300025940 Ga0207691_10006204 Ga0207691_100062042 339
533 3300026121 Ga0207683_10015649 Ga0207683_100156492 339
534 3300027717 Ga0209998_10004196 Ga0209998_100041962 339
535 3300027876 Ga0209974_10005343 Ga0209974_100053432 339
536 3300035117 Ga0373953_0011810 Ga0373953_0011810_1780_2838 339
537 3300035119 Ga0373956_0006332 Ga0373956_0006332_3242_4300 339
538 3300035172 Ga0373955_0004688 Ga0373955_0004688_4579_5637 339
539 3300035692 Ga0373935_0090949 Ga0373935_0090949_505_1563 339
540 3300035724 Ga0373933_0012150 Ga0373933_0012150_3242_4300 339
541 3300036401 Ga0373937_0019345 Ga0373937_0019345_457_1515 339
542 3300037068 Ga0373925_0182452 Ga0373925_0182452_138_1196 339
543 3300042008 Ga0439450_007850 Ga0439450_007850_680_1729 339
544 3300046511 Ga0495608_0035043 Ga0495608_0035043_1923_2981 339
545 3300046514 Ga0495618_0108847 Ga0495618_0108847_30_1088 339
546 3300046517 Ga0495630_0029846 Ga0495630_0029846_457_1515 339
547 3300046535 Ga0495586_0017379 Ga0495586_0017379_445_1503 339
548 3300046536 Ga0495587_0078657 Ga0495587_0078657_252_1310 339
549 3300046559 Ga0495667_0007962 Ga0495667_0007962_3242_4300 339
550 3300046683 Ga0495658_0083082 Ga0495658_0083082_339_1397 339
551 3300047317 Ga0495604_0015527 Ga0495604_0015527_4579_5637 339
552 3300047322 Ga0495680_0087672 Ga0495680_0087672_876_1934 339
553 3300047471 Ga0495684_0026014 Ga0495684_0026014_3388_4446 339
554 3300048088 Ga0495602_0160353 Ga0495602_0160353_125_1159 339
555 3300048903 Ga0496100_0011212 Ga0496100_0011212_72_1106 339
556 3300048904 Ga0496101_0016075 Ga0496101_0016075_1427_2461 339
557 3300048905 Ga0496102_0014552 Ga0496102_0014552_5530_6564 339
558 3300048906 Ga0496103_0207986 Ga0496103_0207986_59_1093 339
559 3300048907 Ga0496104_0127335 Ga0496104_0127335_1346_2380 339
560 3300048912 Ga0496109_0008536 Ga0496109_0008536_3791_4825 339
561 3300048913 Ga0496110_0255543 Ga0496110_0255543_107_1141 339
562 3300048917 Ga0496114_0001691 Ga0496114_0001691_92_1126 339
563 3300049568 Ga0501031_0002979 Ga0501031_0002979_2673_3719 339
564 3300049570 Ga0501033_0053706 Ga0501033_0053706_822_1868 339
565 3300049572 Ga0501036_0020547 Ga0501036_0020547_2469_3515 339
566 3300049574 Ga0501038_0036503 Ga0501038_0036503_831_1877 339
567 3300049575 Ga0501039_0008139 Ga0501039_0008139_4141_5187 339
568 3300049581 Ga0501047_0271932 Ga0501047_0271932_73_1119 339
569 3300049583 Ga0501067_0034182 Ga0501067_0034182_677_1723 339
570 3300049586 Ga0501070_0030671 Ga0501070_0030671_1062_2108 339
571 3300049822 Ga0501035_0038854 Ga0501035_0038854_2768_3814 339
572 3300049822 Ga0501035_0051674 Ga0501035_0051674_132_1178 339
573 3300049823 Ga0501044_0222159 Ga0501044_0222159_645_1691 339
574 3300053077 Ga0495601_0190038 Ga0495601_0190038_114_1148 339
575 3300053085 Ga0495619_0004183 Ga0495619_0004183_4093_5127 339
576 iso_pu_bacteria 2738541317 2738947654 339
577 iso_pu_bacteria 2844533157 2844537003 339
578 iso_pu_bacteria 2913308742 2913311693 339
579 3300005336 Ga0070680_100037082 Ga0070680_1000370823 340
580 3300005336 Ga0070680_100048950 Ga0070680_1000489501 340
581 3300005339 Ga0070660_100005336 Ga0070660_1000053369 340
582 3300005344 Ga0070661_100080466 Ga0070661_1000804662 340
583 3300005435 Ga0070714_100033879 Ga0070714_1000338794 340
584 3300005437 Ga0070710_10003608 Ga0070710_100036084 340
585 3300005458 Ga0070681_10021669 Ga0070681_100216695 340
586 3300005530 Ga0070679_100057897 Ga0070679_1000578974 340
587 3300005530 Ga0070679_100137078 Ga0070679_1001370782 340
588 3300005530 Ga0070679_100433478 Ga0070679_1004334781 340
589 3300005563 Ga0068855_100053507 Ga0068855_1000535072 340
590 3300005563 Ga0068855_100060803 Ga0068855_1000608032 340
591 3300005563 Ga0068855_100090060 Ga0068855_1000900603 340
592 3300005578 Ga0068854_100156525 Ga0068854_1001565252 340
593 3300006048 Ga0075363_100098897 Ga0075363_1000988972 340
594 3300006353 Ga0075370_10034541 Ga0075370_100345412 340
595 3300009093 Ga0105240_10010579 Ga0105240_1001057910 340
596 3300013102 Ga0157371_10027373 Ga0157371_100273732 340
597 3300013104 Ga0157370_10041151 Ga0157370_100411513 340
598 3300013105 Ga0157369_10277423 Ga0157369_102774231 340
599 3300021377 Ga0213874_10018511 Ga0213874_100185112 340
600 3300021384 Ga0213876_10019646 Ga0213876_100196462 340
601 3300021388 Ga0213875_10001666 Ga0213875_100016668 340
602 3300025906 Ga0207699_10013430 Ga0207699_100134304 340
603 3300025909 Ga0207705_10044591 Ga0207705_100445913 340
604 3300025909 Ga0207705_10135035 Ga0207705_101350352 340
605 3300025912 Ga0207707_10024982 Ga0207707_100249823 340
606 3300025912 Ga0207707_10029968 Ga0207707_100299682 340
607 3300025913 Ga0207695_10024575 Ga0207695_100245754 340
608 3300025915 Ga0207693_10079502 Ga0207693_100795022 340
609 3300025915 Ga0207693_10161805 Ga0207693_101618052 340
610 3300025917 Ga0207660_10063518 Ga0207660_100635182 340
611 3300025919 Ga0207657_10015522 Ga0207657_100155225 340
612 3300025921 Ga0207652_10076662 Ga0207652_100766622 340
613 3300025921 Ga0207652_10130034 Ga0207652_101300341 340
614 3300025924 Ga0207694_10072111 Ga0207694_100721112 340
615 3300025928 Ga0207700_10215229 Ga0207700_102152292 340
616 3300025932 Ga0207690_10056690 Ga0207690_100566902 340
617 3300025949 Ga0207667_10007935 Ga0207667_1000793510 340
618 3300025949 Ga0207667_10051857 Ga0207667_100518571 340
619 3300025949 Ga0207667_10098252 Ga0207667_100982522 340
620 3300026116 Ga0207674_10289723 Ga0207674_102897232 340
621 3300028800 Ga0265338_10012346 Ga0265338_100123466 340
622 3300031239 Ga0265328_10004547 Ga0265328_100045472 340
623 3300031241 Ga0265325_10000119 Ga0265325_1000011928 340
624 3300031241 Ga0265325_10005776 Ga0265325_100057762 340
625 3300031241 Ga0265325_10040264 Ga0265325_100402641 340
626 3300031241 Ga0265325_10112471 Ga0265325_101124711 340
627 3300031247 Ga0265340_10021950 Ga0265340_100219503 340
628 3300031249 Ga0265339_10005156 Ga0265339_100051568 340
629 3300031344 Ga0265316_10158956 Ga0265316_101589562 340
630 3300031595 Ga0265313_10004012 Ga0265313_100040126 340
631 3300031595 Ga0265313_10009685 Ga0265313_100096857 340
632 3300031595 Ga0265313_10014650 Ga0265313_100146505 340
633 3300031595 Ga0265313_10015432 Ga0265313_100154322 340
634 3300031595 Ga0265313_10038559 Ga0265313_100385592 340
635 3300031595 Ga0265313_10086865 Ga0265313_100868651 340
636 3300031711 Ga0265314_10001283 Ga0265314_1000128327 340
637 3300031711 Ga0265314_10080024 Ga0265314_100800242 340
638 3300031712 Ga0265342_10000717 Ga0265342_100007177 340
639 3300031712 Ga0265342_10176858 Ga0265342_101768581 340
640 3300032168 Ga0316593_10069802 Ga0316593_100698021 340
641 3300035118 Ga0373954_0110839 Ga0373954_0110839_188_1225 340
642 3300035119 Ga0373956_0036257 Ga0373956_0036257_667_1704 340
643 3300035170 Ga0373943_0017856 Ga0373943_0017856_947_1984 340
644 3300035172 Ga0373955_0001661 Ga0373955_0001661_4555_5592 340
645 3300035410 Ga0373924_0021037 Ga0373924_0021037_719_1756 340
646 3300037068 Ga0373925_0037967 Ga0373925_0037967_644_1681 340
647 3300037312 Ga0395899_0006301 Ga0395899_0006301_58_1104 340
648 3300037418 Ga0395900_0068502 Ga0395900_0068502_132_1175 340
649 3300037466 Ga0395898_0088853 Ga0395898_0088853_180_1223 340
650 3300037853 Ga0436364_0036618 Ga0436364_0036618_1959_3014 340
651 3300038443 Ga0395901_0004832 Ga0395901_0004832_6325_7371 340
652 3300039437 Ga0436365_0459631 Ga0436365_0459631_18701_19756 340
653 3300039450 Ga0436363_0473328 Ga0436363_0473328_412_1467 340
654 3300039450 Ga0436363_1172772 Ga0436363_1172772_211_1266 340
655 3300039453 Ga0436362_1155470 Ga0436362_1155470_8130_9185 340
656 3300046516 Ga0495628_0010765 Ga0495628_0010765_5678_6715 340
657 3300046529 Ga0495652_0007383 Ga0495652_0007383_7006_8043 340
658 3300046533 Ga0495640_0024347 Ga0495640_0024347_276_1313 340
659 3300046536 Ga0495587_0040487 Ga0495587_0040487_1458_2495 340
660 3300046543 Ga0495645_0000411 Ga0495645_0000411_19076_20113 340
661 3300046559 Ga0495667_0001630 Ga0495667_0001630_5325_6362 340
662 3300046663 Ga0495635_0005256 Ga0495635_0005256_4648_5685 340
663 3300046675 Ga0495657_0045983 Ga0495657_0045983_1862_2899 340
664 3300046679 Ga0495623_0019658 Ga0495623_0019658_2362_3399 340
665 3300046809 Ga0495600_0023253 Ga0495600_0023253_2638_3675 340
666 3300047317 Ga0495604_0004303 Ga0495604_0004303_1532_2569 340
667 3300047444 Ga0495675_0060436 Ga0495675_0060436_826_1863 340
668 3300048088 Ga0495602_0000965 Ga0495602_0000965_12432_13469 340
669 3300048907 Ga0496104_0000140 Ga0496104_0000140_14410_15447 340
670 3300048908 Ga0496105_0000576 Ga0496105_0000576_21399_22436 340
671 3300048915 Ga0496112_0012548 Ga0496112_0012548_2888_3925 340
672 3300048918 Ga0496115_0047564 Ga0496115_0047564_2114_3151 340
673 3300048929 Ga0496126_0318472 Ga0496126_0318472_177_1220 340
674 3300049570 Ga0501033_0204422 Ga0501033_0204422_114_1157 340
675 3300049571 Ga0501034_0034216 Ga0501034_0034216_246_1283 340
676 3300049581 Ga0501047_0119127 Ga0501047_0119127_503_1540 340
677 3300049581 Ga0501047_0198354 Ga0501047_0198354_446_1483 340
678 3300049586 Ga0501070_0074797 Ga0501070_0074797_567_1604 340
679 3300049586 Ga0501070_0084019 Ga0501070_0084019_508_1554 340
680 3300049744 Ga0501083_0232747 Ga0501083_0232747_39_1085 340
681 3300049822 Ga0501035_0001203 Ga0501035_0001203_6800_7837 340
682 3300049823 Ga0501044_0162683 Ga0501044_0162683_625_1662 340
683 3300050512 nmdc:mga0n895_13632_c1 nmdc:mga0n895_13632_c1_1598_2647 340
684 3300050513 nmdc:mga0rr50_32494_c1 nmdc:mga0rr50_32494_c1_1098_2147 340
685 3300053077 Ga0495601_0000467 Ga0495601_0000467_10829_11866 340
686 3300053078 Ga0495612_0000575 Ga0495612_0000575_2439_3476 340
687 3300053085 Ga0495619_0000804 Ga0495619_0000804_19249_20286 340
688 3300053085 Ga0495619_0136110 Ga0495619_0136110_134_1291 340
689 3300060353 Ga0501082_0167224 Ga0501082_0167224_767_1816 340
690 iso_pu_bacteria 2643221555 2643795543 340
691 iso_pu_bacteria 2643221595 2643988706 340
692 iso_pu_bacteria 2643221627 2644155206 340
693 iso_pu_bacteria 2693429783 2694634142 340
694 iso_pu_bacteria 2693429784 2694638481 340
695 iso_pu_bacteria 2847686936 2847690624 340
696 iso_pu_bacteria 2856314179 2856317596 340
697 iso_pu_bacteria 2857349434 2857356716 340
698 iso_pu_bacteria 2869162929 2869163679 340
699 iso_pu_bacteria 2874102143 2874108041 340
700 iso_pu_bacteria 2876369609 2876373495 340
701 iso_pu_bacteria 2876377896 2876379011 340
702 iso_pu_bacteria 2876392853 2876396370 340
703 iso_pu_bacteria 2878035449 2878038654 340
704 iso_pu_bacteria 2878760144 2878762129 340
705 iso_pu_bacteria 2878767105 2878769096 340
706 iso_pu_bacteria 2881147464 2881149276 340
707 iso_pu_bacteria 2881161766 2881166099 340
708 iso_pu_bacteria 2885305155 2885307589 340
709 iso_pu_bacteria 2885326080 2885327411 340
710 iso_pu_bacteria 2885334103 2885336167 340
711 iso_pu_bacteria 2888350351 2888354351 340
712 iso_pu_bacteria 2889010040 2889016042 340
713 iso_pu_bacteria 2903540706 2903542705 340
714 iso_pu_bacteria 2904659560 2904663146 340
715 iso_pu_bacteria 2906328253 2906333394 340
716 iso_pu_bacteria 2906354277 2906356958 340
717 iso_pu_bacteria 2906414383 2906417661 340
718 iso_pu_bacteria 2922130491 2922131337 340
719 iso_pu_bacteria 2922158528 2922163722 340
720 iso_pu_bacteria 2922185730 2922193650 340
721 iso_pu_bacteria 2924726620 2924732453 340
722 iso_pu_bacteria 2937891427 2937898325 340
723 iso_pu_bacteria 2937994558 2937996557 340
724 iso_pu_bacteria 2938014810 2938015341 340
725 iso_pu_bacteria 2958100919 2958105346 340
726 iso_pu_bacteria 2958115193 2958116039 340
727 iso_pu_bacteria 2958165035 2958167028 340
728 iso_pu_bacteria 2958172287 2958176130 340
729 iso_pu_bacteria 2961114664 2961118173 340
730 iso_pu_bacteria 2961163497 2961165497 340
731 iso_pu_bacteria 2965018300 2965020320 340
732 iso_pu_bacteria 2965062239 2965067803 340
733 iso_pu_bacteria 2965119406 2965122112 340
734 iso_pu_bacteria 2968091066 2968091545 340
735 iso_pu_bacteria 2968097103 2968097470 340
736 iso_pu_bacteria 2968110612 2968114234 340
737 iso_pu_bacteria 2968117919 2968123357 340
738 iso_pu_bacteria 2968128360 2968133485 340
739 iso_pu_bacteria 2968171901 2968173899 340
740 iso_pu_bacteria 2970554993 2970556985 340
741 iso_pu_bacteria 2977858184 2977860408 340
742 iso_pu_bacteria 2977864932 2977871126 340
743 iso_pu_bacteria 2977942078 2977942958 340
744 iso_pu_bacteria 2977971508 2977980173 340
745 iso_pu_bacteria 2979710463 2979712805 340
746 iso_pu_bacteria 2979742915 2979745133 340
747 iso_pu_bacteria 2979779861 2979785436 340
748 iso_pu_bacteria 2987636660 2987643997 340
749 iso_pu_bacteria 2987652177 2987657775 340
750 iso_pu_bacteria 2987659509 2987661505 340
751 iso_pu_bacteria 2996341866 2996342573 340
752 iso_pu_bacteria 3004188549 3004190554 340
753 iso_pu_bacteria 3004203850 3004208146 340
754 iso_pu_bacteria 8004445564 8004450901 340
755 iso_pu_bacteria 8004703790 8004704404 340
756 3300005337 Ga0070682_100004957 Ga0070682_1000049576 341
757 3300005341 Ga0070691_10054484 Ga0070691_100544841 341
758 3300005366 Ga0070659_100010095 Ga0070659_1000100953 341
759 3300005444 Ga0070694_100047632 Ga0070694_1000476321 341
760 3300005455 Ga0070663_100003744 Ga0070663_1000037443 341
761 3300005458 Ga0070681_10166828 Ga0070681_101668281 341
762 3300005471 Ga0070698_100013388 Ga0070698_1000133885 341
763 3300005530 Ga0070679_100008124 Ga0070679_1000081245 341
764 3300005539 Ga0068853_100014654 Ga0068853_1000146545 341
765 3300005545 Ga0070695_100042543 Ga0070695_1000425431 341
766 3300005546 Ga0070696_100013073 Ga0070696_1000130732 341
767 3300005547 Ga0070693_100079910 Ga0070693_1000799102 341
768 3300005564 Ga0070664_100043313 Ga0070664_1000433133 341
769 3300005577 Ga0068857_100037380 Ga0068857_1000373805 341
770 3300005615 Ga0070702_100009688 Ga0070702_1000096884 341
771 3300005834 Ga0068851_10179234 Ga0068851_101792341 341
772 3300005843 Ga0068860_100142487 Ga0068860_1001424872 341
773 3300005985 Ga0081539_10005661 Ga0081539_100056612 341
774 3300007076 Ga0075435_100160471 Ga0075435_1001604712 341
775 3300009148 Ga0105243_10030511 Ga0105243_100305112 341
776 3300013297 Ga0157378_10039571 Ga0157378_100395714 341
777 3300021441 Ga0213871_10003648 Ga0213871_100036482 341
778 3300025321 Ga0207656_10131455 Ga0207656_101314551 341
779 3300025904 Ga0207647_10082384 Ga0207647_100823842 341
780 3300025912 Ga0207707_10027206 Ga0207707_100272066 341
781 3300025914 Ga0207671_10058235 Ga0207671_100582352 341
782 3300025921 Ga0207652_10026265 Ga0207652_100262653 341
783 3300025927 Ga0207687_10191540 Ga0207687_101915401 341
784 3300025935 Ga0207709_10069608 Ga0207709_100696082 341
785 3300025949 Ga0207667_10083772 Ga0207667_100837722 341
786 3300026041 Ga0207639_10304695 Ga0207639_103046951 341
787 3300026067 Ga0207678_10000869 Ga0207678_1000086919 341
788 3300026067 Ga0207678_10052562 Ga0207678_100525623 341
789 3300026116 Ga0207674_10025701 Ga0207674_100257011 341
790 3300026121 Ga0207683_10007446 Ga0207683_100074466 341
791 3300031665 Ga0316575_10011176 Ga0316575_100111762 341
792 3300031711 Ga0265314_10153779 Ga0265314_101537792 341
793 3300032168 Ga0316593_10001959 Ga0316593_100019595 341
794 3300032168 Ga0316593_10067672 Ga0316593_100676721 341
795 3300033529 Ga0316587_1011377 Ga0316587_10113773 341
796 3300033541 Ga0316596_1042051 Ga0316596_10420511 341
797 3300035398 Ga0316574_0009783 Ga0316574_0009783_2701_3750 341
798 3300036647 Ga0316582_0007218 Ga0316582_0007218_2979_4037 341
799 3300036647 Ga0316582_0023784 Ga0316582_0023784_1653_2702 341
800 3300039438 Ga0436360_0230815 Ga0436360_0230815_2297_3340 341
801 3300048916 Ga0496113_0090131 Ga0496113_0090131_408_1451 341
802 3300049569 Ga0501032_0023557 Ga0501032_0023557_848_1894 341
803 3300049569 Ga0501032_0038608 Ga0501032_0038608_483_1529 341
804 3300049569 Ga0501032_0140772 Ga0501032_0140772_360_1406 341
805 3300049570 Ga0501033_0000293 Ga0501033_0000293_9612_10664 341
806 3300049570 Ga0501033_0136525 Ga0501033_0136525_541_1587 341
807 3300049570 Ga0501033_0138876 Ga0501033_0138876_344_1390 341
808 3300049571 Ga0501034_0000933 Ga0501034_0000933_9797_10843 341
809 3300049571 Ga0501034_0022347 Ga0501034_0022347_1329_2441 341
810 3300049571 Ga0501034_0026343 Ga0501034_0026343_841_1887 341
811 3300049571 Ga0501034_0073445 Ga0501034_0073445_1957_3003 341
812 3300049572 Ga0501036_0016088 Ga0501036_0016088_2348_3394 341
813 3300049572 Ga0501036_0019692 Ga0501036_0019692_1763_2809 341
814 3300049572 Ga0501036_0146710 Ga0501036_0146710_199_1245 341
815 3300049572 Ga0501036_0167829 Ga0501036_0167829_93_1139 341
816 3300049572 Ga0501036_0308220 Ga0501036_0308220_224_1264 341
817 3300049572 Ga0501036_0374447 Ga0501036_0374447_50_1096 341
818 3300049573 Ga0501037_0000007 Ga0501037_0000007_49386_50438 341
819 3300049573 Ga0501037_0064865 Ga0501037_0064865_1468_2514 341
820 3300049573 Ga0501037_0108630 Ga0501037_0108630_859_1899 341
821 3300049574 Ga0501038_0090297 Ga0501038_0090297_46_1101 341
822 3300049574 Ga0501038_0128188 Ga0501038_0128188_900_1940 341
823 3300049574 Ga0501038_0202252 Ga0501038_0202252_180_1226 341
824 3300049575 Ga0501039_0016843 Ga0501039_0016843_2551_3597 341
825 3300049579 Ga0501043_0000034 Ga0501043_0000034_81201_82253 341
826 3300049579 Ga0501043_0006067 Ga0501043_0006067_1397_2443 341
827 3300049579 Ga0501043_0017750 Ga0501043_0017750_1568_2614 341
828 3300049579 Ga0501043_0189572 Ga0501043_0189572_50_1096 341
829 3300049580 Ga0501046_0079460 Ga0501046_0079460_949_1995 341
830 3300049581 Ga0501047_0000073 Ga0501047_0000073_79757_80803 341
831 3300049581 Ga0501047_0000774 Ga0501047_0000774_8550_9602 341
832 3300049581 Ga0501047_0409409 Ga0501047_0409409_93_1139 341
833 3300049581 Ga0501047_0409420 Ga0501047_0409420_50_1096 341
834 3300049582 Ga0501048_0000014 Ga0501048_0000014_12620_13666 341
835 3300049582 Ga0501048_0079945 Ga0501048_0079945_841_1887 341
836 3300049582 Ga0501048_0239835 Ga0501048_0239835_50_1096 341
837 3300049584 Ga0501068_0031102 Ga0501068_0031102_1531_2577 341
838 3300049584 Ga0501068_0054503 Ga0501068_0054503_309_1355 341
839 3300049585 Ga0501069_0000017 Ga0501069_0000017_137166_138218 341
840 3300049585 Ga0501069_0033135 Ga0501069_0033135_717_1769 341
841 3300049586 Ga0501070_0000541 Ga0501070_0000541_15593_16645 341
842 3300049586 Ga0501070_0002868 Ga0501070_0002868_2980_4026 341
843 3300049586 Ga0501070_0003489 Ga0501070_0003489_1551_2663 341
844 3300049586 Ga0501070_0005928 Ga0501070_0005928_6405_7457 341
845 3300049586 Ga0501070_0012906 Ga0501070_0012906_373_1419 341
846 3300049586 Ga0501070_0027817 Ga0501070_0027817_2841_3893 341
847 3300049586 Ga0501070_0142245 Ga0501070_0142245_649_1701 341
848 3300049586 Ga0501070_0166002 Ga0501070_0166002_147_1193 341
849 3300049587 Ga0501071_0128264 Ga0501071_0128264_676_1728 341
850 3300049588 Ga0501072_0136528 Ga0501072_0136528_680_1726 341
851 3300049589 Ga0501073_0036994 Ga0501073_0036994_312_1352 341
852 3300049589 Ga0501073_0039844 Ga0501073_0039844_472_1518 341
853 3300049589 Ga0501073_0040675 Ga0501073_0040675_466_1518 341
854 3300049589 Ga0501073_0057598 Ga0501073_0057598_49_1095 341
855 3300049589 Ga0501073_0136002 Ga0501073_0136002_241_1287 341
856 3300049590 Ga0501074_0000060 Ga0501074_0000060_43520_44572 341
857 3300049590 Ga0501074_0001948 Ga0501074_0001948_7700_8746 341
858 3300049590 Ga0501074_0018695 Ga0501074_0018695_3854_4900 341
859 3300049590 Ga0501074_0102239 Ga0501074_0102239_790_1842 341
860 3300049590 Ga0501074_0121566 Ga0501074_0121566_211_1257 341
861 3300049590 Ga0501074_0159199 Ga0501074_0159199_79_1125 341
862 3300049592 Ga0501076_0083499 Ga0501076_0083499_300_1346 341
863 3300049741 Ga0501079_0014973 Ga0501079_0014973_3594_4640 341
864 3300049741 Ga0501079_0106535 Ga0501079_0106535_169_1215 341
865 3300049741 Ga0501079_0125506 Ga0501079_0125506_229_1269 341
866 3300049742 Ga0501080_0004582 Ga0501080_0004582_10801_11853 341
867 3300049742 Ga0501080_0006500 Ga0501080_0006500_6345_7391 341
868 3300049742 Ga0501080_0006919 Ga0501080_0006919_721_1767 341
869 3300049742 Ga0501080_0045860 Ga0501080_0045860_1953_3005 341
870 3300049742 Ga0501080_0075568 Ga0501080_0075568_2019_3065 341
871 3300049742 Ga0501080_0104034 Ga0501080_0104034_1016_2128 341
872 3300049743 Ga0501081_0119398 Ga0501081_0119398_460_1506 341
873 3300049744 Ga0501083_0000901 Ga0501083_0000901_10516_11562 341
874 3300049744 Ga0501083_0047539 Ga0501083_0047539_1705_2817 341
875 3300049744 Ga0501083_0085333 Ga0501083_0085333_284_1324 341
876 3300049744 Ga0501083_0092153 Ga0501083_0092153_516_1562 341
877 3300049744 Ga0501083_0112212 Ga0501083_0112212_516_1562 341
878 3300049744 Ga0501083_0115820 Ga0501083_0115820_201_1253 341
879 3300049744 Ga0501083_0140556 Ga0501083_0140556_396_1442 341
880 3300049822 Ga0501035_0000159 Ga0501035_0000159_71474_72526 341
881 3300049822 Ga0501035_0000600 Ga0501035_0000600_17575_18627 341
882 3300049822 Ga0501035_0002346 Ga0501035_0002346_2946_3998 341
883 3300049822 Ga0501035_0019888 Ga0501035_0019888_5086_6132 341
884 3300049822 Ga0501035_0032064 Ga0501035_0032064_3436_4482 341
885 3300049822 Ga0501035_0037929 Ga0501035_0037929_1869_2921 341
886 3300049822 Ga0501035_0212306 Ga0501035_0212306_93_1139 341
887 3300049822 Ga0501035_0300110 Ga0501035_0300110_93_1139 341
888 3300049823 Ga0501044_0000010 Ga0501044_0000010_51472_52524 341
889 3300049823 Ga0501044_0003755 Ga0501044_0003755_769_1815 341
890 3300049823 Ga0501044_0004404 Ga0501044_0004404_2249_3301 341
891 3300049823 Ga0501044_0068227 Ga0501044_0068227_1712_2758 341
892 3300049823 Ga0501044_0086293 Ga0501044_0086293_1773_2825 341
893 3300049823 Ga0501044_0093675 Ga0501044_0093675_1712_2758 341
894 3300049823 Ga0501044_0251416 Ga0501044_0251416_266_1318 341
895 3300050492 nmdc:mga0yw44_85251_c1 nmdc:mga0yw44_85251_c1_268_1308 341
896 3300050513 nmdc:mga0rr50_161853_c1 nmdc:mga0rr50_161853_c1_541_1590 341
897 3300050515 nmdc:mga0a205_271378_c1 nmdc:mga0a205_271378_c1_40_1161 341
898 3300053087 Ga0500643_006080 Ga0500643_006080_3891_4931 341
899 3300053093 Ga0500651_0062888 Ga0500651_0062888_27_1067 341
900 3300053094 Ga0500566_0129026 Ga0500566_0129026_258_1298 341
901 3300053119 Ga0500595_000394 Ga0500595_000394_22351_23391 341
902 3300053153 Ga0500616_0000001 Ga0500616_0000001_529108_530148 341
903 3300060353 Ga0501082_0015451 Ga0501082_0015451_2496_3548 341
904 3300060353 Ga0501082_0019338 Ga0501082_0019338_2462_3502 341
905 3300060353 Ga0501082_0042186 Ga0501082_0042186_893_1939 341
906 3300060353 Ga0501082_0195000 Ga0501082_0195000_342_1388 341
907 3300060353 Ga0501082_0238986 Ga0501082_0238986_78_1130 341
908 3300001990 JGI24737J22298_10014252 JGI24737J22298_100142522 342
909 3300002067 JGI24735J21928_10036479 JGI24735J21928_100364791 342
910 3300005327 Ga0070658_10001834 Ga0070658_100018348 342
911 3300005329 Ga0070683_100250422 Ga0070683_1002504221 342
912 3300005330 Ga0070690_100028137 Ga0070690_1000281371 342
913 3300005330 Ga0070690_100065207 Ga0070690_1000652073 342
914 3300005331 Ga0070670_100007178 Ga0070670_1000071788 342
915 3300005334 Ga0068869_100022382 Ga0068869_1000223823 342
916 3300005335 Ga0070666_10117387 Ga0070666_101173871 342
917 3300005336 Ga0070680_100006747 Ga0070680_1000067474 342
918 3300005336 Ga0070680_100037705 Ga0070680_1000377054 342
919 3300005337 Ga0070682_100001743 Ga0070682_1000017434 342
920 3300005339 Ga0070660_100001439 Ga0070660_1000014393 342
921 3300005340 Ga0070689_100022920 Ga0070689_1000229202 342
922 3300005341 Ga0070691_10022648 Ga0070691_100226482 342
923 3300005341 Ga0070691_10038763 Ga0070691_100387632 342
924 3300005344 Ga0070661_100003067 Ga0070661_10000306710 342
925 3300005345 Ga0070692_10000143 Ga0070692_1000014311 342
926 3300005347 Ga0070668_100009504 Ga0070668_1000095048 342
927 3300005353 Ga0070669_100001661 Ga0070669_10000166119 342
928 3300005354 Ga0070675_100223164 Ga0070675_1002231641 342
929 3300005355 Ga0070671_100061481 Ga0070671_1000614813 342
930 3300005364 Ga0070673_100002974 Ga0070673_1000029742 342
931 3300005365 Ga0070688_100001875 Ga0070688_1000018752 342
932 3300005366 Ga0070659_100001512 Ga0070659_1000015124 342
933 3300005367 Ga0070667_100002378 Ga0070667_1000023784 342
934 3300005435 Ga0070714_100103416 Ga0070714_1001034162 342
935 3300005435 Ga0070714_100226559 Ga0070714_1002265592 342
936 3300005436 Ga0070713_100043416 Ga0070713_1000434162 342
937 3300005438 Ga0070701_10006855 Ga0070701_100068553 342
938 3300005439 Ga0070711_100008865 Ga0070711_1000088654 342
939 3300005440 Ga0070705_100001613 Ga0070705_1000016132 342
940 3300005441 Ga0070700_100007519 Ga0070700_1000075193 342
941 3300005444 Ga0070694_100000368 Ga0070694_10000036811 342
942 3300005455 Ga0070663_100033747 Ga0070663_1000337474 342
943 3300005456 Ga0070678_100008297 Ga0070678_1000082974 342
944 3300005457 Ga0070662_100007732 Ga0070662_1000077324 342
945 3300005458 Ga0070681_10010068 Ga0070681_100100683 342
946 3300005459 Ga0068867_100286889 Ga0068867_1002868891 342
947 3300005466 Ga0070685_10036947 Ga0070685_100369472 342
948 3300005530 Ga0070679_100043337 Ga0070679_1000433372 342
949 3300005536 Ga0070697_100069495 Ga0070697_1000694953 342
950 3300005539 Ga0068853_100000648 Ga0068853_10000064810 342
951 3300005544 Ga0070686_100003905 Ga0070686_1000039053 342
952 3300005545 Ga0070695_100003941 Ga0070695_1000039411 342
953 3300005546 Ga0070696_100058339 Ga0070696_1000583393 342
954 3300005547 Ga0070693_100001308 Ga0070693_1000013083 342
955 3300005547 Ga0070693_100144298 Ga0070693_1001442981 342
956 3300005548 Ga0070665_100256158 Ga0070665_1002561582 342
957 3300005549 Ga0070704_100018448 Ga0070704_1000184483 342
958 3300005563 Ga0068855_100004004 Ga0068855_10000400410 342
959 3300005563 Ga0068855_100009214 Ga0068855_10000921411 342
960 3300005564 Ga0070664_100017145 Ga0070664_1000171453 342
961 3300005577 Ga0068857_100000410 Ga0068857_10000041017 342
962 3300005577 Ga0068857_100057062 Ga0068857_1000570622 342
963 3300005578 Ga0068854_100002119 Ga0068854_1000021192 342
964 3300005614 Ga0068856_100001929 Ga0068856_10000192910 342
965 3300005615 Ga0070702_100002188 Ga0070702_1000021883 342
966 3300005615 Ga0070702_100053891 Ga0070702_1000538911 342
967 3300005616 Ga0068852_100039982 Ga0068852_1000399824 342
968 3300005617 Ga0068859_100005293 Ga0068859_1000052932 342
969 3300005718 Ga0068866_10077661 Ga0068866_100776612 342
970 3300005719 Ga0068861_100024530 Ga0068861_1000245304 342
971 3300005841 Ga0068863_100029050 Ga0068863_1000290504 342
972 3300005841 Ga0068863_100105499 Ga0068863_1001054992 342
973 3300005841 Ga0068863_100142159 Ga0068863_1001421592 342
974 3300005843 Ga0068860_100012678 Ga0068860_1000126787 342
975 3300005843 Ga0068860_100362834 Ga0068860_1003628341 342
976 3300005844 Ga0068862_100002625 Ga0068862_10000262518 342
977 3300005937 Ga0081455_10016037 Ga0081455_100160375 342
978 3300005937 Ga0081455_10039469 Ga0081455_100394694 342
979 3300005937 Ga0081455_10045499 Ga0081455_100454993 342
980 3300005983 Ga0081540_1028965 Ga0081540_10289653 342
981 3300006163 Ga0070715_10000372 Ga0070715_1000037211 342
982 3300006173 Ga0070716_100035807 Ga0070716_1000358071 342
983 3300006175 Ga0070712_100053437 Ga0070712_1000534371 342
984 3300006852 Ga0075433_10111249 Ga0075433_101112491 342
985 3300006881 Ga0068865_100001438 Ga0068865_1000014384 342
986 3300006931 Ga0097620_100005293 Ga0097620_1000052932 342
987 3300009093 Ga0105240_10014906 Ga0105240_100149069 342
988 3300009093 Ga0105240_10050958 Ga0105240_100509583 342
989 3300009098 Ga0105245_10001240 Ga0105245_100012409 342
990 3300009101 Ga0105247_10002403 Ga0105247_100024033 342
991 3300009147 Ga0114129_10114122 Ga0114129_101141221 342
992 3300009147 Ga0114129_10620922 Ga0114129_106209222 342
993 3300009148 Ga0105243_10004647 Ga0105243_1000464710 342
994 3300009174 Ga0105241_10011629 Ga0105241_100116299 342
995 3300009176 Ga0105242_10025798 Ga0105242_100257984 342
996 3300009177 Ga0105248_10001221 Ga0105248_1000122117 342
997 3300009545 Ga0105237_10027358 Ga0105237_100273586 342
998 3300009545 Ga0105237_10220060 Ga0105237_102200602 342
999 3300009551 Ga0105238_10007560 Ga0105238_100075608 342
1000 3300009551 Ga0105238_10010426 Ga0105238_100104269 342
1001 3300009553 Ga0105249_10002352 Ga0105249_100023523 342
1002 3300010375 Ga0105239_10115602 Ga0105239_101156021 342
1003 3300011119 Ga0105246_10005008 Ga0105246_100050088 342
1004 3300013100 Ga0157373_10014274 Ga0157373_100142747 342
1005 3300013102 Ga0157371_10014946 Ga0157371_100149463 342
1006 3300013105 Ga0157369_10175656 Ga0157369_101756561 342
1007 3300013296 Ga0157374_10039970 Ga0157374_100399703 342
1008 3300013297 Ga0157378_10037264 Ga0157378_100372642 342
1009 3300013306 Ga0163162_10017661 Ga0163162_100176616 342
1010 3300013307 Ga0157372_10007136 Ga0157372_100071364 342
1011 3300013308 Ga0157375_10134002 Ga0157375_101340021 342
1012 3300014325 Ga0163163_10089265 Ga0163163_100892651 342
1013 3300014326 Ga0157380_10008714 Ga0157380_100087148 342
1014 3300014968 Ga0157379_10002254 Ga0157379_100022548 342
1015 3300014968 Ga0157379_10116499 Ga0157379_101164991 342
1016 3300014969 Ga0157376_10001084 Ga0157376_1000108420 342
1017 3300014969 Ga0157376_10239744 Ga0157376_102397442 342
1018 3300017792 Ga0163161_10023248 Ga0163161_100232484 342
1019 3300025302 Ga0207426_1010418 Ga0207426_10104182 342
1020 3300025898 Ga0207692_10016030 Ga0207692_100160302 342
1021 3300025900 Ga0207710_10001201 Ga0207710_1000120110 342
1022 3300025901 Ga0207688_10027021 Ga0207688_100270213 342
1023 3300025903 Ga0207680_10019207 Ga0207680_100192073 342
1024 3300025904 Ga0207647_10022521 Ga0207647_100225213 342
1025 3300025905 Ga0207685_10001213 Ga0207685_100012132 342
1026 3300025906 Ga0207699_10000314 Ga0207699_1000031419 342
1027 3300025909 Ga0207705_10017922 Ga0207705_100179223 342
1028 3300025911 Ga0207654_10182538 Ga0207654_101825381 342
1029 3300025913 Ga0207695_10064850 Ga0207695_100648502 342
1030 3300025914 Ga0207671_10027636 Ga0207671_100276362 342
1031 3300025914 Ga0207671_10205306 Ga0207671_102053061 342
1032 3300025915 Ga0207693_10000893 Ga0207693_100008935 342
1033 3300025916 Ga0207663_10022472 Ga0207663_100224722 342
1034 3300025917 Ga0207660_10024283 Ga0207660_100242831 342
1035 3300025917 Ga0207660_10024958 Ga0207660_100249581 342
1036 3300025919 Ga0207657_10000527 Ga0207657_1000052720 342
1037 3300025920 Ga0207649_10012523 Ga0207649_100125233 342
1038 3300025923 Ga0207681_10003402 Ga0207681_1000340210 342
1039 3300025925 Ga0207650_10008626 Ga0207650_100086268 342
1040 3300025927 Ga0207687_10009189 Ga0207687_100091894 342
1041 3300025928 Ga0207700_10275507 Ga0207700_102755071 342
1042 3300025929 Ga0207664_10025720 Ga0207664_100257203 342
1043 3300025929 Ga0207664_10165523 Ga0207664_101655232 342
1044 3300025932 Ga0207690_10003081 Ga0207690_1000308110 342
1045 3300025933 Ga0207706_10000724 Ga0207706_1000072419 342
1046 3300025934 Ga0207686_10014950 Ga0207686_100149502 342
1047 3300025936 Ga0207670_10002721 Ga0207670_100027212 342
1048 3300025936 Ga0207670_10015281 Ga0207670_100152812 342
1049 3300025936 Ga0207670_10089913 Ga0207670_100899132 342
1050 3300025938 Ga0207704_10288429 Ga0207704_102884291 342
1051 3300025939 Ga0207665_10001119 Ga0207665_1000111920 342
1052 3300025940 Ga0207691_10012408 Ga0207691_100124083 342
1053 3300025941 Ga0207711_10007782 Ga0207711_100077828 342
1054 3300025941 Ga0207711_10286774 Ga0207711_102867742 342
1055 3300025942 Ga0207689_10014379 Ga0207689_100143797 342
1056 3300025945 Ga0207679_10021305 Ga0207679_100213053 342
1057 3300025949 Ga0207667_10011550 Ga0207667_1001155010 342
1058 3300025949 Ga0207667_10017718 Ga0207667_100177183 342
1059 3300025960 Ga0207651_10014831 Ga0207651_100148313 342
1060 3300025961 Ga0207712_10002613 Ga0207712_100026138 342
1061 3300025972 Ga0207668_10043061 Ga0207668_100430613 342
1062 3300025981 Ga0207640_10004814 Ga0207640_100048143 342
1063 3300025986 Ga0207658_10290847 Ga0207658_102908471 342
1064 3300026023 Ga0207677_10035790 Ga0207677_100357903 342
1065 3300026067 Ga0207678_10002381 Ga0207678_1000238118 342
1066 3300026075 Ga0207708_10000596 Ga0207708_1000059618 342
1067 3300026078 Ga0207702_10040353 Ga0207702_100403534 342
1068 3300026078 Ga0207702_10048402 Ga0207702_100484024 342
1069 3300026088 Ga0207641_10007032 Ga0207641_100070328 342
1070 3300026089 Ga0207648_10327238 Ga0207648_103272382 342
1071 3300026116 Ga0207674_10001458 Ga0207674_1000145819 342
1072 3300026116 Ga0207674_10013187 Ga0207674_100131873 342
1073 3300026116 Ga0207674_10257860 Ga0207674_102578602 342
1074 3300026118 Ga0207675_100002798 Ga0207675_1000027982 342
1075 3300026121 Ga0207683_10000778 Ga0207683_1000077818 342
1076 3300026121 Ga0207683_10180815 Ga0207683_101808152 342
1077 3300027907 Ga0207428_10007120 Ga0207428_100071202 342
1078 3300028380 Ga0268265_10108231 Ga0268265_101082311 342
1079 3300028381 Ga0268264_10017823 Ga0268264_100178233 342
1080 3300028381 Ga0268264_10432270 Ga0268264_104322701 342
1081 3300028381 Ga0268264_10441663 Ga0268264_104416631 342
1082 3300028573 Ga0265334_10002089 Ga0265334_100020892 342
1083 3300031247 Ga0265340_10010607 Ga0265340_100106076 342
1084 3300031691 Ga0316579_10001617 Ga0316579_100016174 342
1085 3300031733 Ga0316577_10014000 Ga0316577_100140004 342
1086 3300033524 Ga0316592_1031727 Ga0316592_10317271 342
1087 3300035084 Ga0373928_0025506 Ga0373928_0025506_191_1237 342
1088 3300035112 Ga0373932_0031209 Ga0373932_0031209_236_1282 342
1089 3300035113 Ga0373936_0072021 Ga0373936_0072021_122_1162 342
1090 3300035691 Ga0373931_0008963 Ga0373931_0008963_1934_2977 342
1091 3300035695 Ga0373927_0064957 Ga0373927_0064957_1129_2184 342
1092 3300035695 Ga0373927_0245578 Ga0373927_0245578_21_1067 342
1093 3300035724 Ga0373933_0055552 Ga0373933_0055552_778_1851 342
1094 3300039450 Ga0436363_0450541 Ga0436363_0450541_261_1313 342
1095 3300048903 Ga0496100_0009831 Ga0496100_0009831_1107_2150 342
1096 3300048904 Ga0496101_0010712 Ga0496101_0010712_3912_4955 342
1097 3300048905 Ga0496102_0027670 Ga0496102_0027670_3912_4955 342
1098 3300048905 Ga0496102_0226202 Ga0496102_0226202_24_1079 342
1099 3300048906 Ga0496103_0044861 Ga0496103_0044861_1172_2215 342
1100 3300048907 Ga0496104_0002385 Ga0496104_0002385_1053_2108 342
1101 3300048907 Ga0496104_0070545 Ga0496104_0070545_1107_2150 342
1102 3300048908 Ga0496105_0011644 Ga0496105_0011644_4974_6029 342
1103 3300048908 Ga0496105_0046617 Ga0496105_0046617_1235_2278 342
1104 3300048909 Ga0496106_0088672 Ga0496106_0088672_739_1782 342
1105 3300048909 Ga0496106_0172924 Ga0496106_0172924_570_1625 342
1106 3300048910 Ga0496107_0031611 Ga0496107_0031611_639_1682 342
1107 3300048911 Ga0496108_0015479 Ga0496108_0015479_2370_3413 342
1108 3300048912 Ga0496109_0032254 Ga0496109_0032254_967_2022 342
1109 3300048912 Ga0496109_0127659 Ga0496109_0127659_1107_2150 342
1110 3300048913 Ga0496110_0018836 Ga0496110_0018836_1807_2850 342
1111 3300048913 Ga0496110_0073283 Ga0496110_0073283_420_1475 342
1112 3300048914 Ga0496111_0008508 Ga0496111_0008508_4647_5690 342
1113 3300048914 Ga0496111_0012862 Ga0496111_0012862_1860_2915 342
1114 3300048915 Ga0496112_0013917 Ga0496112_0013917_4647_5690 342
1115 3300048916 Ga0496113_0007014 Ga0496113_0007014_1107_2150 342
1116 3300048916 Ga0496113_0276990 Ga0496113_0276990_82_1137 342
1117 3300048917 Ga0496114_0021688 Ga0496114_0021688_2949_3992 342
1118 3300048918 Ga0496115_0030806 Ga0496115_0030806_1495_2550 342
1119 3300048918 Ga0496115_0035840 Ga0496115_0035840_1360_2403 342
1120 3300048929 Ga0496126_0283871 Ga0496126_0283871_64_1110 342
1121 3300049571 Ga0501034_0000673 Ga0501034_0000673_12980_14053 342
1122 3300049571 Ga0501034_0005512 Ga0501034_0005512_5822_6886 342
1123 3300049579 Ga0501043_0063709 Ga0501043_0063709_722_1771 342
1124 3300049823 Ga0501044_0283961 Ga0501044_0283961_521_1576 342
1125 3300050507 nmdc:mga05p37_97634_c1 nmdc:mga05p37_97634_c1_2454_3497 342
1126 3300050511 nmdc:mga08y16_383869_c1 nmdc:mga08y16_383869_c1_200_1372 342
1127 3300050511 nmdc:mga08y16_74311_c1 nmdc:mga08y16_74311_c1_2177_3220 342
1128 3300050512 nmdc:mga0n895_190625_c1 nmdc:mga0n895_190625_c1_917_1972 342
1129 3300050515 nmdc:mga0a205_14901_c1 nmdc:mga0a205_14901_c1_5755_6927 342
1130 3300050515 nmdc:mga0a205_179715_c1 nmdc:mga0a205_179715_c1_798_1841 342
1131 3300053088 Ga0500644_0044863 Ga0500644_0044863_241_1287 342
1132 3300053130 Ga0500642_0014969 Ga0500642_0014969_1127_2185 342
1133 3300002987 JGI25159J45721_1017140 JGI25159J45721_10171401 343
1134 3300003187 JGI25151J46595_10000212 JGI25151J46595_1000021242 343
1135 3300003354 JGI25160J50197_1003644 JGI25160J50197_10036448 343
1136 3300005434 Ga0070709_10235677 Ga0070709_102356772 343
1137 3300005549 Ga0070704_100119912 Ga0070704_1001199121 343
1138 3300005983 Ga0081540_1001455 Ga0081540_100145517 343
1139 3300006048 Ga0075363_100053502 Ga0075363_1000535022 343
1140 3300006175 Ga0070712_100008526 Ga0070712_1000085262 343
1141 3300006871 Ga0075434_100032299 Ga0075434_1000322994 343
1142 3300007076 Ga0075435_100219108 Ga0075435_1002191081 343
1143 3300025284 Ga0209130_1000804 Ga0209130_100080423 343
1144 3300025294 Ga0209025_1000779 Ga0209025_10007799 343
1145 3300025297 Ga0209758_1007126 Ga0209758_10071264 343
1146 3300025302 Ga0207426_1000066 Ga0207426_1000066161 343
1147 3300025914 Ga0207671_10219942 Ga0207671_102199422 343
1148 3300025915 Ga0207693_10027451 Ga0207693_100274512 343
1149 3300025921 Ga0207652_10184106 Ga0207652_101841062 343
1150 3300025929 Ga0207664_10106602 Ga0207664_101066025 343
1151 3300031247 Ga0265340_10065786 Ga0265340_100657862 343
1152 3300031344 Ga0265316_10049686 Ga0265316_100496863 343
1153 3300031728 Ga0316578_10005806 Ga0316578_100058064 343
1154 3300032133 Ga0316583_10051704 Ga0316583_100517041 343
1155 3300035088 Ga0373940_0002009 Ga0373940_0002009_2530_3588 343
1156 3300035112 Ga0373932_0008232 Ga0373932_0008232_1328_2386 343
1157 3300035113 Ga0373936_0105241 Ga0373936_0105241_76_1119 343
1158 3300035114 Ga0373939_0014509 Ga0373939_0014509_484_1542 343
1159 3300035172 Ga0373955_0031456 Ga0373955_0031456_806_1852 343
1160 3300035398 Ga0316574_0000319 Ga0316574_0000319_15892_16938 343
1161 3300035691 Ga0373931_0019902 Ga0373931_0019902_1642_2700 343
1162 3300036712 Ga0316584_0027897 Ga0316584_0027897_33_1079 343
1163 3300037312 Ga0395899_0062305 Ga0395899_0062305_198_1259 343
1164 3300037418 Ga0395900_0001933 Ga0395900_0001933_17175_18236 343
1165 3300037466 Ga0395898_0011487 Ga0395898_0011487_306_1367 343
1166 3300038443 Ga0395901_0016566 Ga0395901_0016566_5639_6700 343
1167 3300038443 Ga0395901_0133484 Ga0395901_0133484_86_1201 343
1168 3300039437 Ga0436365_0692767 Ga0436365_0692767_154_1251 343
1169 3300044694 Ga0466963_0005297 Ga0466963_0005297_1629_2687 343
1170 3300044694 Ga0466963_0015991 Ga0466963_0015991_3443_4501 343
1171 3300044694 Ga0466963_0098823 Ga0466963_0098823_771_1829 343
1172 3300044842 Ga0466957_0046875 Ga0466957_0046875_1401_2459 343
1173 3300044842 Ga0466957_0155382 Ga0466957_0155382_298_1398 343
1174 3300045836 Ga0466958_0010304 Ga0466958_0010304_1445_2503 343
1175 3300045836 Ga0466958_0267711 Ga0466958_0267711_14_1060 343
1176 3300045976 Ga0466967_0002811 Ga0466967_0002811_7996_9054 343
1177 3300045976 Ga0466967_0030503 Ga0466967_0030503_29_1087 343
1178 3300045976 Ga0466967_0091017 Ga0466967_0091017_280_1338 343
1179 3300045976 Ga0466967_0432787 Ga0466967_0432787_108_1166 343
1180 3300045976 Ga0466967_0442481 Ga0466967_0442481_193_1251 343
1181 3300046459 Ga0495629_0207898 Ga0495629_0207898_109_1155 343
1182 3300046473 Ga0495582_0001937 Ga0495582_0001937_10475_11521 343
1183 3300046512 Ga0495610_0022275 Ga0495610_0022275_1823_2917 343
1184 3300046529 Ga0495652_0216386 Ga0495652_0216386_108_1154 343
1185 3300046642 Ga0495634_0174407 Ga0495634_0174407_129_1175 343
1186 3300046660 Ga0495625_0152320 Ga0495625_0152320_50_1108 343
1187 3300046663 Ga0495635_0011792 Ga0495635_0011792_1481_2527 343
1188 3300046683 Ga0495658_0025773 Ga0495658_0025773_140_1186 343
1189 3300047317 Ga0495604_0088587 Ga0495604_0088587_863_1909 343
1190 3300048903 Ga0496100_0009382 Ga0496100_0009382_2241_3287 343
1191 3300048904 Ga0496101_0092387 Ga0496101_0092387_290_1336 343
1192 3300048911 Ga0496108_0001916 Ga0496108_0001916_7151_8209 343
1193 3300048912 Ga0496109_0002403 Ga0496109_0002403_9840_10898 343
1194 3300048913 Ga0496110_0001138 Ga0496110_0001138_5250_6308 343
1195 3300048914 Ga0496111_0000953 Ga0496111_0000953_12789_13847 343
1196 3300048915 Ga0496112_0002442 Ga0496112_0002442_5208_6266 343
1197 3300048916 Ga0496113_0008248 Ga0496113_0008248_4488_5546 343
1198 3300049571 Ga0501034_0017759 Ga0501034_0017759_3458_4513 343
1199 3300049572 Ga0501036_0304425 Ga0501036_0304425_124_1182 343
1200 3300049584 Ga0501068_0108677 Ga0501068_0108677_213_1277 343
1201 3300049586 Ga0501070_0097175 Ga0501070_0097175_822_1886 343
1202 3300049589 Ga0501073_0003588 Ga0501073_0003588_7561_8625 343
1203 3300049742 Ga0501080_0071138 Ga0501080_0071138_1466_2530 343
1204 3300049822 Ga0501035_0066697 Ga0501035_0066697_774_1838 343
1205 3300049823 Ga0501044_0051021 Ga0501044_0051021_949_2007 343
1206 3300050515 nmdc:mga0a205_121822_c1 nmdc:mga0a205_121822_c1_1108_2148 343
1207 3300053084 Ga0495595_0020591 Ga0495595_0020591_860_1906 343
1208 3300053085 Ga0495619_0000016 Ga0495619_0000016_214119_215165 343
1209 3300053085 Ga0495619_0009942 Ga0495619_0009942_549_1595 343
1210 3300053158 Ga0500627_0039875 Ga0500627_0039875_626_1672 343
1211 3300054114 Ga0501084_0112022 Ga0501084_0112022_1073_2137 343
1212 2209111006 2214745216 2213754887 344
1213 3300000043 ARcpr5yngRDRAFT_c000295 ARcpr5yngRDRAFT_0002957 344
1214 3300000044 ARSoilOldRDRAFT_c000016 ARSoilOldRDRAFT_00001627 344
1215 3300000652 ARCol0yngRDRAFT_1000324 ARCol0yngRDRAFT_10003242 344
1216 3300001915 JGI24741J21665_1010360 JGI24741J21665_10103602 344
1217 3300001977 JGI24746J21847_1000674 JGI24746J21847_10006745 344
1218 3300001990 JGI24737J22298_10005956 JGI24737J22298_100059562 344
1219 3300001990 JGI24737J22298_10019789 JGI24737J22298_100197892 344
1220 3300002070 JGI24750J21931_1000863 JGI24750J21931_10008633 344
1221 3300002075 JGI24738J21930_10011175 JGI24738J21930_100111752 344
1222 3300002076 JGI24749J21850_1000794 JGI24749J21850_10007944 344
1223 3300002155 JGI24033J26618_1001038 JGI24033J26618_10010382 344
1224 3300002239 JGI24034J26672_10000405 JGI24034J26672_100004055 344
1225 3300002244 JGI24742J22300_10000245 JGI24742J22300_100002453 344
1226 3300002459 JGI24751J29686_10024238 JGI24751J29686_100242381 344
1227 3300003203 JGI25406J46586_10035163 JGI25406J46586_100351631 344
1228 3300005290 Ga0065712_10001131 Ga0065712_100011317 344
1229 3300005290 Ga0065712_10074595 Ga0065712_100745952 344
1230 3300005293 Ga0065715_10000410 Ga0065715_1000041012 344
1231 3300005293 Ga0065715_10100594 Ga0065715_101005942 344
1232 3300005328 Ga0070676_10000464 Ga0070676_1000046415 344
1233 3300005329 Ga0070683_100000585 Ga0070683_1000005856 344
1234 3300005330 Ga0070690_100004127 Ga0070690_1000041277 344
1235 3300005330 Ga0070690_100009515 Ga0070690_1000095153 344
1236 3300005330 Ga0070690_100039896 Ga0070690_1000398962 344
1237 3300005331 Ga0070670_100056455 Ga0070670_1000564552 344
1238 3300005333 Ga0070677_10000046 Ga0070677_1000004625 344
1239 3300005334 Ga0068869_100021357 Ga0068869_1000213572 344
1240 3300005335 Ga0070666_10012206 Ga0070666_100122063 344
1241 3300005335 Ga0070666_10072158 Ga0070666_100721582 344
1242 3300005335 Ga0070666_10139618 Ga0070666_101396181 344
1243 3300005336 Ga0070680_100031728 Ga0070680_1000317282 344
1244 3300005337 Ga0070682_100001270 Ga0070682_10000127015 344
1245 3300005338 Ga0068868_100002324 Ga0068868_10000232412 344
1246 3300005339 Ga0070660_100001207 Ga0070660_10000120716 344
1247 3300005339 Ga0070660_100092923 Ga0070660_1000929231 344
1248 3300005340 Ga0070689_100005142 Ga0070689_1000051428 344
1249 3300005340 Ga0070689_100027162 Ga0070689_1000271623 344
1250 3300005340 Ga0070689_100029436 Ga0070689_1000294362 344
1251 3300005341 Ga0070691_10003924 Ga0070691_100039245 344
1252 3300005343 Ga0070687_100010425 Ga0070687_1000104252 344
1253 3300005345 Ga0070692_10000212 Ga0070692_1000021215 344
1254 3300005345 Ga0070692_10019851 Ga0070692_100198512 344
1255 3300005347 Ga0070668_100033083 Ga0070668_1000330834 344
1256 3300005354 Ga0070675_100041716 Ga0070675_1000417163 344
1257 3300005355 Ga0070671_100008864 Ga0070671_1000088647 344
1258 3300005355 Ga0070671_100107968 Ga0070671_1001079681 344
1259 3300005364 Ga0070673_100000632 Ga0070673_10000063217 344
1260 3300005365 Ga0070688_100004634 Ga0070688_1000046348 344
1261 3300005366 Ga0070659_100001860 Ga0070659_1000018603 344
1262 3300005366 Ga0070659_100002503 Ga0070659_10000250314 344
1263 3300005367 Ga0070667_100007002 Ga0070667_1000070025 344
1264 3300005367 Ga0070667_100104480 Ga0070667_1001044801 344
1265 3300005406 Ga0070703_10003660 Ga0070703_100036603 344
1266 3300005406 Ga0070703_10020423 Ga0070703_100204232 344
1267 3300005434 Ga0070709_10003370 Ga0070709_100033701 344
1268 3300005434 Ga0070709_10040424 Ga0070709_100404242 344
1269 3300005436 Ga0070713_100030406 Ga0070713_1000304062 344
1270 3300005436 Ga0070713_100171755 Ga0070713_1001717553 344
1271 3300005437 Ga0070710_10035957 Ga0070710_100359572 344
1272 3300005437 Ga0070710_10042117 Ga0070710_100421172 344
1273 3300005438 Ga0070701_10000116 Ga0070701_1000011623 344
1274 3300005439 Ga0070711_100017123 Ga0070711_1000171234 344
1275 3300005439 Ga0070711_100096113 Ga0070711_1000961132 344
1276 3300005440 Ga0070705_100006545 Ga0070705_1000065453 344
1277 3300005441 Ga0070700_100004259 Ga0070700_1000042596 344
1278 3300005444 Ga0070694_100003022 Ga0070694_1000030225 344
1279 3300005445 Ga0070708_100065234 Ga0070708_1000652342 344
1280 3300005455 Ga0070663_100011775 Ga0070663_1000117753 344
1281 3300005455 Ga0070663_100191582 Ga0070663_1001915822 344
1282 3300005457 Ga0070662_100018718 Ga0070662_1000187184 344
1283 3300005457 Ga0070662_100027626 Ga0070662_1000276263 344
1284 3300005457 Ga0070662_100197186 Ga0070662_1001971861 344
1285 3300005457 Ga0070662_100275103 Ga0070662_1002751031 344
1286 3300005458 Ga0070681_10004628 Ga0070681_100046281 344
1287 3300005458 Ga0070681_10118690 Ga0070681_101186902 344
1288 3300005459 Ga0068867_100000619 Ga0068867_1000006193 344
1289 3300005466 Ga0070685_10085586 Ga0070685_100855862 344
1290 3300005467 Ga0070706_100105127 Ga0070706_1001051275 344
1291 3300005530 Ga0070679_100110921 Ga0070679_1001109212 344
1292 3300005530 Ga0070679_100211017 Ga0070679_1002110172 344
1293 3300005535 Ga0070684_100006410 Ga0070684_1000064108 344
1294 3300005535 Ga0070684_100007789 Ga0070684_1000077894 344
1295 3300005535 Ga0070684_100028223 Ga0070684_1000282232 344
1296 3300005536 Ga0070697_100052206 Ga0070697_1000522061 344
1297 3300005539 Ga0068853_100001956 Ga0068853_10000195614 344
1298 3300005539 Ga0068853_100011111 Ga0068853_1000111112 344
1299 3300005543 Ga0070672_100026958 Ga0070672_1000269582 344
1300 3300005543 Ga0070672_100052367 Ga0070672_1000523673 344
1301 3300005545 Ga0070695_100004414 Ga0070695_1000044147 344
1302 3300005545 Ga0070695_100007956 Ga0070695_1000079563 344
1303 3300005545 Ga0070695_100014292 Ga0070695_1000142921 344
1304 3300005545 Ga0070695_100049811 Ga0070695_1000498112 344
1305 3300005546 Ga0070696_100021646 Ga0070696_1000216463 344
1306 3300005546 Ga0070696_100038171 Ga0070696_1000381713 344
1307 3300005546 Ga0070696_100264393 Ga0070696_1002643931 344
1308 3300005547 Ga0070693_100001925 Ga0070693_1000019257 344
1309 3300005549 Ga0070704_100000828 Ga0070704_10000082815 344
1310 3300005549 Ga0070704_100060594 Ga0070704_1000605942 344
1311 3300005549 Ga0070704_100079940 Ga0070704_1000799402 344
1312 3300005563 Ga0068855_100004638 Ga0068855_1000046382 344
1313 3300005578 Ga0068854_100007930 Ga0068854_1000079305 344
1314 3300005614 Ga0068856_100267164 Ga0068856_1002671642 344
1315 3300005614 Ga0068856_100331220 Ga0068856_1003312202 344
1316 3300005615 Ga0070702_100028826 Ga0070702_1000288263 344
1317 3300005616 Ga0068852_100005642 Ga0068852_1000056423 344
1318 3300005617 Ga0068859_100011499 Ga0068859_1000114994 344
1319 3300005617 Ga0068859_100037056 Ga0068859_1000370563 344
1320 3300005618 Ga0068864_100000501 Ga0068864_10000050138 344
1321 3300005718 Ga0068866_10004992 Ga0068866_100049924 344
1322 3300005719 Ga0068861_100028822 Ga0068861_1000288222 344
1323 3300005840 Ga0068870_10000104 Ga0068870_100001042 344
1324 3300005841 Ga0068863_100112033 Ga0068863_1001120332 344
1325 3300005842 Ga0068858_100033292 Ga0068858_1000332924 344
1326 3300005842 Ga0068858_100057367 Ga0068858_1000573673 344
1327 3300005843 Ga0068860_100011137 Ga0068860_1000111378 344
1328 3300005843 Ga0068860_100155082 Ga0068860_1001550823 344
1329 3300005844 Ga0068862_100002741 Ga0068862_1000027411 344
1330 3300005844 Ga0068862_100040405 Ga0068862_1000404052 344
1331 3300005937 Ga0081455_10000058 Ga0081455_1000005869 344
1332 3300005937 Ga0081455_10000313 Ga0081455_100003132 344
1333 3300005937 Ga0081455_10003030 Ga0081455_1000303010 344
1334 3300005937 Ga0081455_10019695 Ga0081455_100196953 344
1335 3300005937 Ga0081455_10056050 Ga0081455_100560502 344
1336 3300005937 Ga0081455_10070225 Ga0081455_100702252 344
1337 3300005937 Ga0081455_10073457 Ga0081455_100734572 344
1338 3300005983 Ga0081540_1000040 Ga0081540_100004032 344
1339 3300005983 Ga0081540_1001972 Ga0081540_10019729 344
1340 3300005985 Ga0081539_10001588 Ga0081539_1000158826 344
1341 3300006028 Ga0070717_10004117 Ga0070717_100041175 344
1342 3300006038 Ga0075365_10039103 Ga0075365_100391032 344
1343 3300006038 Ga0075365_10111229 Ga0075365_101112291 344
1344 3300006038 Ga0075365_10139243 Ga0075365_101392431 344
1345 3300006051 Ga0075364_10030667 Ga0075364_100306672 344
1346 3300006058 Ga0075432_10010658 Ga0075432_100106583 344
1347 3300006175 Ga0070712_100110385 Ga0070712_1001103851 344
1348 3300006175 Ga0070712_100293572 Ga0070712_1002935721 344
1349 3300006178 Ga0075367_10029139 Ga0075367_100291392 344
1350 3300006178 Ga0075367_10065902 Ga0075367_100659022 344
1351 3300006195 Ga0075366_10152162 Ga0075366_101521621 344
1352 3300006237 Ga0097621_100000435 Ga0097621_10000043519 344
1353 3300006353 Ga0075370_10042670 Ga0075370_100426702 344
1354 3300006358 Ga0068871_100000485 Ga0068871_1000004856 344
1355 3300006358 Ga0068871_100064053 Ga0068871_1000640531 344
1356 3300006844 Ga0075428_100003602 Ga0075428_1000036024 344
1357 3300006844 Ga0075428_100093373 Ga0075428_1000933732 344
1358 3300006844 Ga0075428_100373095 Ga0075428_1003730951 344
1359 3300006846 Ga0075430_100000367 Ga0075430_10000036722 344
1360 3300006846 Ga0075430_100001911 Ga0075430_10000191116 344
1361 3300006847 Ga0075431_100007593 Ga0075431_1000075934 344
1362 3300006852 Ga0075433_10000501 Ga0075433_1000050115 344
1363 3300006852 Ga0075433_10009783 Ga0075433_100097835 344
1364 3300006852 Ga0075433_10033635 Ga0075433_100336353 344
1365 3300006871 Ga0075434_100005781 Ga0075434_10000578110 344
1366 3300006871 Ga0075434_100015803 Ga0075434_1000158032 344
1367 3300006880 Ga0075429_100001022 Ga0075429_1000010224 344
1368 3300006881 Ga0068865_100020005 Ga0068865_1000200051 344
1369 3300006881 Ga0068865_100063742 Ga0068865_1000637422 344
1370 3300006881 Ga0068865_100173433 Ga0068865_1001734332 344
1371 3300006914 Ga0075436_100003601 Ga0075436_1000036014 344
1372 3300006914 Ga0075436_100136239 Ga0075436_1001362392 344
1373 3300006914 Ga0075436_100166490 Ga0075436_1001664901 344
1374 3300006931 Ga0097620_100011499 Ga0097620_1000114994 344
1375 3300006931 Ga0097620_100037053 Ga0097620_1000370533 344
1376 3300009036 Ga0105244_10089489 Ga0105244_100894891 344
1377 3300009093 Ga0105240_10169492 Ga0105240_101694921 344
1378 3300009094 Ga0111539_10002680 Ga0111539_100026802 344
1379 3300009094 Ga0111539_10003452 Ga0111539_1000345214 344
1380 3300009094 Ga0111539_10004667 Ga0111539_100046673 344
1381 3300009094 Ga0111539_10394337 Ga0111539_103943372 344
1382 3300009098 Ga0105245_10004478 Ga0105245_1000447811 344
1383 3300009098 Ga0105245_10026459 Ga0105245_100264593 344
1384 3300009098 Ga0105245_10106286 Ga0105245_101062862 344
1385 3300009147 Ga0114129_10005976 Ga0114129_100059769 344
1386 3300009147 Ga0114129_10090836 Ga0114129_100908363 344
1387 3300009148 Ga0105243_10007567 Ga0105243_100075674 344
1388 3300009148 Ga0105243_10013397 Ga0105243_100133972 344
1389 3300009148 Ga0105243_10243265 Ga0105243_102432651 344
1390 3300009174 Ga0105241_10000805 Ga0105241_100008054 344
1391 3300009176 Ga0105242_10006128 Ga0105242_100061283 344
1392 3300009177 Ga0105248_10002578 Ga0105248_1000257816 344
1393 3300009177 Ga0105248_10031967 Ga0105248_100319672 344
1394 3300009545 Ga0105237_10050562 Ga0105237_100505623 344
1395 3300009545 Ga0105237_10068994 Ga0105237_100689942 344
1396 3300009551 Ga0105238_10024153 Ga0105238_100241532 344
1397 3300009551 Ga0105238_10050151 Ga0105238_100501512 344
1398 3300009553 Ga0105249_10017076 Ga0105249_100170764 344
1399 3300009553 Ga0105249_10213350 Ga0105249_102133501 344
1400 3300010375 Ga0105239_10031376 Ga0105239_100313764 344
1401 3300010375 Ga0105239_10052250 Ga0105239_100522502 344
1402 3300011119 Ga0105246_10001159 Ga0105246_1000115915 344
1403 3300013100 Ga0157373_10056793 Ga0157373_100567931 344
1404 3300013102 Ga0157371_10011034 Ga0157371_100110348 344
1405 3300013296 Ga0157374_10025598 Ga0157374_100255985 344
1406 3300013297 Ga0157378_10295418 Ga0157378_102954182 344
1407 3300013306 Ga0163162_10022100 Ga0163162_100221004 344
1408 3300013306 Ga0163162_10058241 Ga0163162_100582412 344
1409 3300013307 Ga0157372_10516025 Ga0157372_105160252 344
1410 3300013308 Ga0157375_10008574 Ga0157375_100085744 344
1411 3300013308 Ga0157375_10063050 Ga0157375_100630503 344
1412 3300013308 Ga0157375_10126028 Ga0157375_101260282 344
1413 3300014325 Ga0163163_10009906 Ga0163163_100099067 344
1414 3300014325 Ga0163163_10017983 Ga0163163_100179835 344
1415 3300014325 Ga0163163_10159958 Ga0163163_101599582 344
1416 3300014326 Ga0157380_10001249 Ga0157380_1000124915 344
1417 3300014326 Ga0157380_10168704 Ga0157380_101687042 344
1418 3300014497 Ga0182008_10139299 Ga0182008_101392992 344
1419 3300014968 Ga0157379_10054471 Ga0157379_100544712 344
1420 3300014969 Ga0157376_10000696 Ga0157376_100006966 344
1421 3300014969 Ga0157376_10152226 Ga0157376_101522262 344
1422 3300017792 Ga0163161_10005280 Ga0163161_100052804 344
1423 3300025271 Ga0207666_1000085 Ga0207666_10000853 344
1424 3300025271 Ga0207666_1007172 Ga0207666_10071722 344
1425 3300025315 Ga0207697_10002998 Ga0207697_100029987 344
1426 3300025885 Ga0207653_10016842 Ga0207653_100168423 344
1427 3300025898 Ga0207692_10027201 Ga0207692_100272012 344
1428 3300025900 Ga0207710_10002518 Ga0207710_100025184 344
1429 3300025900 Ga0207710_10022129 Ga0207710_100221292 344
1430 3300025901 Ga0207688_10000088 Ga0207688_1000008815 344
1431 3300025903 Ga0207680_10008516 Ga0207680_100085165 344
1432 3300025904 Ga0207647_10008915 Ga0207647_100089152 344
1433 3300025904 Ga0207647_10011501 Ga0207647_100115014 344
1434 3300025907 Ga0207645_10000668 Ga0207645_100006686 344
1435 3300025908 Ga0207643_10000085 Ga0207643_1000008537 344
1436 3300025911 Ga0207654_10000373 Ga0207654_1000037322 344
1437 3300025912 Ga0207707_10017090 Ga0207707_100170902 344
1438 3300025914 Ga0207671_10038319 Ga0207671_100383192 344
1439 3300025915 Ga0207693_10137852 Ga0207693_101378522 344
1440 3300025915 Ga0207693_10138590 Ga0207693_101385902 344
1441 3300025916 Ga0207663_10056550 Ga0207663_100565502 344
1442 3300025917 Ga0207660_10000370 Ga0207660_1000037025 344
1443 3300025917 Ga0207660_10217157 Ga0207660_102171571 344
1444 3300025918 Ga0207662_10003085 Ga0207662_100030857 344
1445 3300025918 Ga0207662_10041330 Ga0207662_100413302 344
1446 3300025919 Ga0207657_10011290 Ga0207657_100112907 344
1447 3300025920 Ga0207649_10004450 Ga0207649_100044505 344
1448 3300025921 Ga0207652_10040106 Ga0207652_100401062 344
1449 3300025921 Ga0207652_10083382 Ga0207652_100833823 344
1450 3300025921 Ga0207652_10109553 Ga0207652_101095532 344
1451 3300025921 Ga0207652_10127941 Ga0207652_101279412 344
1452 3300025923 Ga0207681_10023297 Ga0207681_100232971 344
1453 3300025923 Ga0207681_10080013 Ga0207681_100800132 344
1454 3300025924 Ga0207694_10035398 Ga0207694_100353981 344
1455 3300025924 Ga0207694_10190274 Ga0207694_101902741 344
1456 3300025926 Ga0207659_10000200 Ga0207659_1000020016 344
1457 3300025926 Ga0207659_10025147 Ga0207659_100251473 344
1458 3300025927 Ga0207687_10012599 Ga0207687_100125994 344
1459 3300025927 Ga0207687_10314645 Ga0207687_103146451 344
1460 3300025928 Ga0207700_10026232 Ga0207700_100262322 344
1461 3300025932 Ga0207690_10007237 Ga0207690_100072376 344
1462 3300025932 Ga0207690_10040734 Ga0207690_100407341 344
1463 3300025933 Ga0207706_10010392 Ga0207706_100103927 344
1464 3300025933 Ga0207706_10048288 Ga0207706_100482882 344
1465 3300025933 Ga0207706_10164137 Ga0207706_101641372 344
1466 3300025935 Ga0207709_10024665 Ga0207709_100246654 344
1467 3300025935 Ga0207709_10152221 Ga0207709_101522212 344
1468 3300025936 Ga0207670_10010668 Ga0207670_100106683 344
1469 3300025936 Ga0207670_10145489 Ga0207670_101454892 344
1470 3300025937 Ga0207669_10000129 Ga0207669_1000012916 344
1471 3300025938 Ga0207704_10248310 Ga0207704_102483101 344
1472 3300025939 Ga0207665_10021523 Ga0207665_100215233 344
1473 3300025940 Ga0207691_10006943 Ga0207691_100069436 344
1474 3300025940 Ga0207691_10076919 Ga0207691_100769192 344
1475 3300025941 Ga0207711_10002466 Ga0207711_1000246617 344
1476 3300025941 Ga0207711_10092833 Ga0207711_100928332 344
1477 3300025942 Ga0207689_10000547 Ga0207689_1000054728 344
1478 3300025944 Ga0207661_10000373 Ga0207661_1000037324 344
1479 3300025945 Ga0207679_10000558 Ga0207679_100005588 344
1480 3300025949 Ga0207667_10064488 Ga0207667_100644884 344
1481 3300025960 Ga0207651_10000709 Ga0207651_100007092 344
1482 3300025961 Ga0207712_10065985 Ga0207712_100659852 344
1483 3300025981 Ga0207640_10039433 Ga0207640_100394332 344
1484 3300025981 Ga0207640_10231133 Ga0207640_102311331 344
1485 3300025986 Ga0207658_10021810 Ga0207658_100218104 344
1486 3300026023 Ga0207677_10004798 Ga0207677_100047984 344
1487 3300026035 Ga0207703_10000644 Ga0207703_1000064438 344
1488 3300026035 Ga0207703_10013473 Ga0207703_100134732 344
1489 3300026041 Ga0207639_10016724 Ga0207639_100167245 344
1490 3300026041 Ga0207639_10025582 Ga0207639_100255822 344
1491 3300026067 Ga0207678_10005937 Ga0207678_100059377 344
1492 3300026075 Ga0207708_10008554 Ga0207708_100085547 344
1493 3300026075 Ga0207708_10019753 Ga0207708_100197534 344
1494 3300026078 Ga0207702_10108689 Ga0207702_101086892 344
1495 3300026078 Ga0207702_10370650 Ga0207702_103706501 344
1496 3300026088 Ga0207641_10019914 Ga0207641_100199143 344
1497 3300026089 Ga0207648_10006768 Ga0207648_100067687 344
1498 3300026089 Ga0207648_10045391 Ga0207648_100453912 344
1499 3300026095 Ga0207676_10113411 Ga0207676_101134112 344
1500 3300026116 Ga0207674_10005267 Ga0207674_100052673 344
1501 3300026118 Ga0207675_100011076 Ga0207675_1000110767 344
1502 3300026118 Ga0207675_100068558 Ga0207675_1000685582 344
1503 3300026121 Ga0207683_10001220 Ga0207683_100012203 344
1504 3300026121 Ga0207683_10044386 Ga0207683_100443862 344
1505 3300026142 Ga0207698_10036394 Ga0207698_100363943 344
1506 3300027614 Ga0209970_1008087 Ga0209970_10080872 344
1507 3300027695 Ga0209966_1000401 Ga0209966_100040113 344
1508 3300027717 Ga0209998_10003905 Ga0209998_100039052 344
1509 3300027876 Ga0209974_10003102 Ga0209974_100031026 344
1510 3300027876 Ga0209974_10023552 Ga0209974_100235522 344
1511 3300027907 Ga0207428_10000141 Ga0207428_1000014139 344
1512 3300027907 Ga0207428_10000664 Ga0207428_100006647 344
1513 3300027907 Ga0207428_10000896 Ga0207428_100008963 344
1514 3300028380 Ga0268265_10008023 Ga0268265_100080232 344
1515 3300028380 Ga0268265_10025201 Ga0268265_100252013 344
1516 3300028380 Ga0268265_10348892 Ga0268265_103488921 344
1517 3300028381 Ga0268264_10001202 Ga0268264_100012023 344
1518 3300028381 Ga0268264_10017561 Ga0268264_100175613 344
1519 3300031247 Ga0265340_10012517 Ga0265340_100125173 344
1520 3300031344 Ga0265316_10140445 Ga0265316_101404452 344
1521 3300031456 Ga0307513_10279610 Ga0307513_102796101 344
1522 3300031691 Ga0316579_10041051 Ga0316579_100410512 344
1523 3300033541 Ga0316596_1045316 Ga0316596_10453161 344
1524 3300034816 Ga0373930_0016934 Ga0373930_0016934_114_1163 344
1525 3300034817 Ga0373948_0000055 Ga0373948_0000055_9801_10853 344
1526 3300034817 Ga0373948_0000864 Ga0373948_0000864_954_2003 344
1527 3300034818 Ga0373950_0000535 Ga0373950_0000535_1356_2408 344
1528 3300034819 Ga0373958_0000216 Ga0373958_0000216_5461_6513 344
1529 3300034957 Ga0373938_0000124 Ga0373938_0000124_6257_7309 344
1530 3300034957 Ga0373938_0000788 Ga0373938_0000788_1104_2153 344
1531 3300035084 Ga0373928_0000110 Ga0373928_0000110_10507_11559 344
1532 3300035084 Ga0373928_0002179 Ga0373928_0002179_2710_3759 344
1533 3300035085 Ga0373929_0001063 Ga0373929_0001063_328_1380 344
1534 3300035086 Ga0373934_0001670 Ga0373934_0001670_1779_2828 344
1535 3300035089 Ga0373944_0003628 Ga0373944_0003628_2836_3885 344
1536 3300035089 Ga0373944_0058131 Ga0373944_0058131_94_1143 344
1537 3300035090 Ga0373949_0000761 Ga0373949_0000761_3242_4294 344
1538 3300035090 Ga0373949_0001658 Ga0373949_0001658_4257_5306 344
1539 3300035091 Ga0373951_0000329 Ga0373951_0000329_10675_11727 344
1540 3300035092 Ga0373952_0000070 Ga0373952_0000070_86_1138 344
1541 3300035111 Ga0373923_0005698 Ga0373923_0005698_2692_3741 344
1542 3300035112 Ga0373932_0000433 Ga0373932_0000433_603_1655 344
1543 3300035112 Ga0373932_0000963 Ga0373932_0000963_1608_2657 344
1544 3300035113 Ga0373936_0004576 Ga0373936_0004576_1147_2196 344
1545 3300035114 Ga0373939_0000855 Ga0373939_0000855_5875_6927 344
1546 3300035114 Ga0373939_0001546 Ga0373939_0001546_1840_2889 344
1547 3300035114 Ga0373939_0003350 Ga0373939_0003350_308_1357 344
1548 3300035115 Ga0373941_0000305 Ga0373941_0000305_3242_4294 344
1549 3300035118 Ga0373954_0045399 Ga0373954_0045399_406_1455 344
1550 3300035119 Ga0373956_0005026 Ga0373956_0005026_807_1856 344
1551 3300035119 Ga0373956_0010100 Ga0373956_0010100_442_1491 344
1552 3300035119 Ga0373956_0125173 Ga0373956_0125173_29_1078 344
1553 3300035120 Ga0373957_0000983 Ga0373957_0000983_4633_5682 344
1554 3300035121 Ga0373960_0000546 Ga0373960_0000546_604_1656 344
1555 3300035171 Ga0373946_0031747 Ga0373946_0031747_885_1934 344
1556 3300035172 Ga0373955_0045719 Ga0373955_0045719_691_1740 344
1557 3300035207 Ga0373942_0001944 Ga0373942_0001944_1325_2377 344
1558 3300035241 Ga0373961_0001228 Ga0373961_0001228_5384_6436 344
1559 3300035242 Ga0373962_0000078 Ga0373962_0000078_10093_11145 344
1560 3300035410 Ga0373924_0001379 Ga0373924_0001379_2658_3896 344
1561 3300035691 Ga0373931_0006061 Ga0373931_0006061_4557_5609 344
1562 3300035691 Ga0373931_0013241 Ga0373931_0013241_2553_3602 344
1563 3300035691 Ga0373931_0032688 Ga0373931_0032688_592_1644 344
1564 3300035695 Ga0373927_0222576 Ga0373927_0222576_71_1120 344
1565 3300035724 Ga0373933_0007273 Ga0373933_0007273_522_1571 344
1566 3300035725 Ga0373947_0056337 Ga0373947_0056337_774_2012 344
1567 3300035725 Ga0373947_0081181 Ga0373947_0081181_823_1872 344
1568 3300036401 Ga0373937_0004370 Ga0373937_0004370_6027_7076 344
1569 3300036401 Ga0373937_0027569 Ga0373937_0027569_235_1404 344
1570 3300036647 Ga0316582_0002562 Ga0316582_0002562_3132_4208 344
1571 3300037068 Ga0373925_0186013 Ga0373925_0186013_529_1578 344
1572 3300037418 Ga0395900_0239598 Ga0395900_0239598_333_1394 344
1573 3300037466 Ga0395898_0212239 Ga0395898_0212239_75_1136 344
1574 3300037471 Ga0395905_0129877 Ga0395905_0129877_1294_2343 344
1575 3300037853 Ga0436364_0857514 Ga0436364_0857514_1050_2099 344
1576 3300039437 Ga0436365_1201344 Ga0436365_1201344_353_1402 344
1577 3300039437 Ga0436365_1240810 Ga0436365_1240810_593_1642 344
1578 3300039438 Ga0436360_0883006 Ga0436360_0883006_145_1194 344
1579 3300039447 Ga0436361_0200318 Ga0436361_0200318_3005_4057 344
1580 3300044842 Ga0466957_0035271 Ga0466957_0035271_1334_2383 344
1581 3300045836 Ga0466958_0132747 Ga0466958_0132747_95_1144 344
1582 3300045976 Ga0466967_0368073 Ga0466967_0368073_189_1238 344
1583 3300046454 Ga0495592_0001529 Ga0495592_0001529_6276_7325 344
1584 3300046459 Ga0495629_0012826 Ga0495629_0012826_573_1622 344
1585 3300046459 Ga0495629_0080038 Ga0495629_0080038_294_1343 344
1586 3300046461 Ga0495641_0033775 Ga0495641_0033775_1352_2401 344
1587 3300046462 Ga0495651_0006087 Ga0495651_0006087_5804_6853 344
1588 3300046462 Ga0495651_0008573 Ga0495651_0008573_1912_2961 344
1589 3300046463 Ga0495653_0002726 Ga0495653_0002726_10111_11160 344
1590 3300046463 Ga0495653_0004466 Ga0495653_0004466_8704_9753 344
1591 3300046473 Ga0495582_0008531 Ga0495582_0008531_645_1694 344
1592 3300046475 Ga0495639_0036987 Ga0495639_0036987_319_1368 344
1593 3300046476 Ga0495662_0016674 Ga0495662_0016674_2122_3360 344
1594 3300046477 Ga0495664_0061378 Ga0495664_0061378_749_1798 344
1595 3300046477 Ga0495664_0068131 Ga0495664_0068131_560_1609 344
1596 3300046491 Ga0495584_0019743 Ga0495584_0019743_75_1124 344
1597 3300046491 Ga0495584_0022014 Ga0495584_0022014_2105_3154 344
1598 3300046492 Ga0495585_0001185 Ga0495585_0001185_3353_4402 344
1599 3300046501 Ga0495607_0005231 Ga0495607_0005231_7921_8970 344
1600 3300046511 Ga0495608_0000910 Ga0495608_0000910_8039_9088 344
1601 3300046511 Ga0495608_0159942 Ga0495608_0159942_226_1275 344
1602 3300046514 Ga0495618_0007318 Ga0495618_0007318_3508_4557 344
1603 3300046516 Ga0495628_0005038 Ga0495628_0005038_6027_7076 344
1604 3300046516 Ga0495628_0012779 Ga0495628_0012779_494_1543 344
1605 3300046517 Ga0495630_0088181 Ga0495630_0088181_221_1270 344
1606 3300046523 Ga0495644_0000958 Ga0495644_0000958_4636_5685 344
1607 3300046529 Ga0495652_0007044 Ga0495652_0007044_8778_9827 344
1608 3300046529 Ga0495652_0312341 Ga0495652_0312341_79_1128 344
1609 3300046531 Ga0495665_0091900 Ga0495665_0091900_420_1469 344
1610 3300046533 Ga0495640_0015973 Ga0495640_0015973_3981_5030 344
1611 3300046535 Ga0495586_0015728 Ga0495586_0015728_1317_2366 344
1612 3300046536 Ga0495587_0005121 Ga0495587_0005121_1619_2668 344
1613 3300046538 Ga0495609_0008204 Ga0495609_0008204_564_1613 344
1614 3300046543 Ga0495645_0043834 Ga0495645_0043834_564_1613 344
1615 3300046558 Ga0495633_0001515 Ga0495633_0001515_15731_16780 344
1616 3300046559 Ga0495667_0010461 Ga0495667_0010461_564_1613 344
1617 3300046642 Ga0495634_0036809 Ga0495634_0036809_2152_3201 344
1618 3300046642 Ga0495634_0060188 Ga0495634_0060188_63_1112 344
1619 3300046642 Ga0495634_0122527 Ga0495634_0122527_55_1104 344
1620 3300046648 Ga0495611_0074564 Ga0495611_0074564_139_1188 344
1621 3300046663 Ga0495635_0001031 Ga0495635_0001031_7932_8981 344
1622 3300046663 Ga0495635_0012085 Ga0495635_0012085_3647_4696 344
1623 3300046663 Ga0495635_0062737 Ga0495635_0062737_43_1092 344
1624 3300046665 Ga0495661_0095256 Ga0495661_0095256_161_1210 344
1625 3300046674 Ga0495588_0129404 Ga0495588_0129404_214_1263 344
1626 3300046675 Ga0495657_0001810 Ga0495657_0001810_1946_2995 344
1627 3300046678 Ga0495599_0003947 Ga0495599_0003947_5896_6945 344
1628 3300046679 Ga0495623_0015056 Ga0495623_0015056_993_2042 344
1629 3300046680 Ga0495646_0001814 Ga0495646_0001814_6276_7325 344
1630 3300046689 Ga0495613_0099705 Ga0495613_0099705_692_1741 344
1631 3300046690 Ga0495624_0012537 Ga0495624_0012537_3815_4864 344
1632 3300046691 Ga0495670_0000124 Ga0495670_0000124_8088_9137 344
1633 3300047315 Ga0495581_0053539 Ga0495581_0053539_688_1737 344
1634 3300047315 Ga0495581_0149215 Ga0495581_0149215_26_1075 344
1635 3300047317 Ga0495604_0002346 Ga0495604_0002346_8228_9277 344
1636 3300047319 Ga0495674_0026260 Ga0495674_0026260_3813_4862 344
1637 3300047319 Ga0495674_0074287 Ga0495674_0074287_469_1518 344
1638 3300047320 Ga0495672_0109837 Ga0495672_0109837_386_1432 344
1639 3300047322 Ga0495680_0004228 Ga0495680_0004228_6713_7762 344
1640 3300047322 Ga0495680_0013913 Ga0495680_0013913_2250_3299 344
1641 3300047444 Ga0495675_0001356 Ga0495675_0001356_8739_9788 344
1642 3300047471 Ga0495684_0026180 Ga0495684_0026180_1030_2079 344
1643 3300048088 Ga0495602_0016070 Ga0495602_0016070_5005_6054 344
1644 3300048089 Ga0495614_0013377 Ga0495614_0013377_2049_3287 344
1645 3300048903 Ga0496100_0006007 Ga0496100_0006007_1533_2582 344
1646 3300048904 Ga0496101_0012308 Ga0496101_0012308_2274_3323 344
1647 3300048905 Ga0496102_0057895 Ga0496102_0057895_1906_2955 344
1648 3300048905 Ga0496102_0165086 Ga0496102_0165086_29_1078 344
1649 3300048906 Ga0496103_0048265 Ga0496103_0048265_913_1962 344
1650 3300048907 Ga0496104_0001380 Ga0496104_0001380_18571_19620 344
1651 3300048907 Ga0496104_0011140 Ga0496104_0011140_179_1228 344
1652 3300048907 Ga0496104_0023064 Ga0496104_0023064_4330_5379 344
1653 3300048908 Ga0496105_0037931 Ga0496105_0037931_1132_2181 344
1654 3300048908 Ga0496105_0118052 Ga0496105_0118052_161_1210 344
1655 3300048908 Ga0496105_0291550 Ga0496105_0291550_13_1062 344
1656 3300048910 Ga0496107_0007600 Ga0496107_0007600_806_1855 344
1657 3300048910 Ga0496107_0055432 Ga0496107_0055432_1285_2334 344
1658 3300048910 Ga0496107_0065927 Ga0496107_0065927_423_1475 344
1659 3300048911 Ga0496108_0001956 Ga0496108_0001956_5423_6472 344
1660 3300048911 Ga0496108_0033980 Ga0496108_0033980_2910_3959 344
1661 3300048911 Ga0496108_0167849 Ga0496108_0167849_724_1773 344
1662 3300048911 Ga0496108_0189295 Ga0496108_0189295_513_1562 344
1663 3300048912 Ga0496109_0003867 Ga0496109_0003867_9910_10959 344
1664 3300048912 Ga0496109_0016699 Ga0496109_0016699_1299_2348 344
1665 3300048912 Ga0496109_0070470 Ga0496109_0070470_1183_2232 344
1666 3300048912 Ga0496109_0114739 Ga0496109_0114739_1404_2453 344
1667 3300048913 Ga0496110_0020613 Ga0496110_0020613_2389_3438 344
1668 3300048913 Ga0496110_0101020 Ga0496110_0101020_41_1090 344
1669 3300048913 Ga0496110_0260936 Ga0496110_0260936_491_1540 344
1670 3300048914 Ga0496111_0056098 Ga0496111_0056098_1742_2794 344
1671 3300048914 Ga0496111_0164006 Ga0496111_0164006_352_1401 344
1672 3300048914 Ga0496111_0241353 Ga0496111_0241353_241_1290 344
1673 3300048915 Ga0496112_0011458 Ga0496112_0011458_1212_2261 344
1674 3300048916 Ga0496113_0000507 Ga0496113_0000507_12317_13366 344
1675 3300048917 Ga0496114_0060291 Ga0496114_0060291_1712_2761 344
1676 3300048917 Ga0496114_0451102 Ga0496114_0451102_21_1070 344
1677 3300048918 Ga0496115_0022877 Ga0496115_0022877_2702_3751 344
1678 3300048918 Ga0496115_0087821 Ga0496115_0087821_398_1447 344
1679 3300048918 Ga0496115_0115263 Ga0496115_0115263_237_1286 344
1680 3300048929 Ga0496126_0147504 Ga0496126_0147504_754_1800 344
1681 3300049569 Ga0501032_0033838 Ga0501032_0033838_653_1708 344
1682 3300049569 Ga0501032_0041098 Ga0501032_0041098_637_1698 344
1683 3300049571 Ga0501034_0060934 Ga0501034_0060934_488_1543 344
1684 3300049571 Ga0501034_0079168 Ga0501034_0079168_712_1773 344
1685 3300049571 Ga0501034_0143476 Ga0501034_0143476_276_1442 344
1686 3300049572 Ga0501036_0006497 Ga0501036_0006497_68_1123 344
1687 3300049572 Ga0501036_0029776 Ga0501036_0029776_1396_2562 344
1688 3300049573 Ga0501037_0132829 Ga0501037_0132829_259_1320 344
1689 3300049574 Ga0501038_0005137 Ga0501038_0005137_8755_9921 344
1690 3300049574 Ga0501038_0012390 Ga0501038_0012390_1655_2710 344
1691 3300049574 Ga0501038_0143883 Ga0501038_0143883_536_1597 344
1692 3300049575 Ga0501039_0031185 Ga0501039_0031185_2812_3978 344
1693 3300049579 Ga0501043_0060758 Ga0501043_0060758_1229_2290 344
1694 3300049581 Ga0501047_0030634 Ga0501047_0030634_441_1490 344
1695 3300049581 Ga0501047_0038907 Ga0501047_0038907_1416_2471 344
1696 3300049581 Ga0501047_0177234 Ga0501047_0177234_622_1683 344
1697 3300049584 Ga0501068_0031777 Ga0501068_0031777_1635_2690 344
1698 3300049586 Ga0501070_0011719 Ga0501070_0011719_4874_5923 344
1699 3300049586 Ga0501070_0058049 Ga0501070_0058049_893_1954 344
1700 3300049587 Ga0501071_0080632 Ga0501071_0080632_449_1504 344
1701 3300049589 Ga0501073_0021568 Ga0501073_0021568_3437_4483 344
1702 3300049590 Ga0501074_0050782 Ga0501074_0050782_724_1770 344
1703 3300049593 Ga0501077_0015722 Ga0501077_0015722_1554_2603 344
1704 3300049593 Ga0501077_0098888 Ga0501077_0098888_495_1544 344
1705 3300049742 Ga0501080_0047871 Ga0501080_0047871_2797_3852 344
1706 3300049823 Ga0501044_0024781 Ga0501044_0024781_341_1396 344
1707 3300049823 Ga0501044_0030118 Ga0501044_0030118_3464_4513 344
1708 3300049823 Ga0501044_0095572 Ga0501044_0095572_1748_2842 344
1709 3300049823 Ga0501044_0101567 Ga0501044_0101567_856_1917 344
1710 3300049823 Ga0501044_0108024 Ga0501044_0108024_151_1200 344
1711 3300050491 nmdc:mga00v17_39835_c1 nmdc:mga00v17_39835_c1_1180_2265 344
1712 3300050493 nmdc:mga0k408_8357_c1 nmdc:mga0k408_8357_c1_1293_2339 344
1713 3300050494 nmdc:mga06z11_24273_c1 nmdc:mga06z11_24273_c1_1762_2811 344
1714 3300050494 nmdc:mga06z11_42332_c1 nmdc:mga06z11_42332_c1_979_2034 344
1715 3300050507 nmdc:mga05p37_1104_c1 nmdc:mga05p37_1104_c1_19234_20283 344
1716 3300050507 nmdc:mga05p37_223327_c1 nmdc:mga05p37_223327_c1_24_1073 344
1717 3300050507 nmdc:mga05p37_84450_c1 nmdc:mga05p37_84450_c1_2565_3614 344
1718 3300050508 nmdc:mga09592_1765_c1 nmdc:mga09592_1765_c1_11290_12339 344
1719 3300050509 nmdc:mga0qj67_28_c1 nmdc:mga0qj67_28_c1_94879_95925 344
1720 3300050509 nmdc:mga0qj67_3718_c1 nmdc:mga0qj67_3718_c1_7282_8331 344
1721 3300050510 nmdc:mga06r32_196680_c1 nmdc:mga06r32_196680_c1_151_1272 344
1722 3300050510 nmdc:mga06r32_46542_c1 nmdc:mga06r32_46542_c1_2736_3821 344
1723 3300050510 nmdc:mga06r32_736_c1 nmdc:mga06r32_736_c1_11284_12333 344
1724 3300050511 nmdc:mga08y16_143561_c1 nmdc:mga08y16_143561_c1_628_1677 344
1725 3300050511 nmdc:mga08y16_1849_c1 nmdc:mga08y16_1849_c1_11290_12339 344
1726 3300050511 nmdc:mga08y16_21691_c1 nmdc:mga08y16_21691_c1_328_1380 344
1727 3300050511 nmdc:mga08y16_469850_c1 nmdc:mga08y16_469850_c1_193_1254 344
1728 3300050512 nmdc:mga0n895_1980_c1 nmdc:mga0n895_1980_c1_10652_11701 344
1729 3300050512 nmdc:mga0n895_2460_c1 nmdc:mga0n895_2460_c1_4182_5231 344
1730 3300050512 nmdc:mga0n895_26501_c1 nmdc:mga0n895_26501_c1_1532_2581 344
1731 3300050513 nmdc:mga0rr50_2527_c1 nmdc:mga0rr50_2527_c1_6769_7818 344
1732 3300050514 nmdc:mga08x19_149100_c1 nmdc:mga08x19_149100_c1_154_1203 344
1733 3300050514 nmdc:mga08x19_21_c1 nmdc:mga08x19_21_c1_226470_227525 344
1734 3300050515 nmdc:mga0a205_1718_c1 nmdc:mga0a205_1718_c1_6609_7658 344
1735 3300050515 nmdc:mga0a205_176242_c1 nmdc:mga0a205_176242_c1_364_1413 344
1736 3300050515 nmdc:mga0a205_65966_c1 nmdc:mga0a205_65966_c1_2152_3204 344
1737 3300050515 nmdc:mga0a205_8485_c3 nmdc:mga0a205_8485_c3_2281_3330 344
1738 3300053077 Ga0495601_0008398 Ga0495601_0008398_4536_5585 344
1739 3300053077 Ga0495601_0046279 Ga0495601_0046279_1226_2275 344
1740 3300053078 Ga0495612_0004077 Ga0495612_0004077_4536_5585 344
1741 3300053078 Ga0495612_0009540 Ga0495612_0009540_2415_3464 344
1742 3300053084 Ga0495595_0005255 Ga0495595_0005255_3374_4423 344
1743 3300053085 Ga0495619_0002154 Ga0495619_0002154_6515_7564 344
1744 3300053085 Ga0495619_0003066 Ga0495619_0003066_4609_5658 344
1745 3300053085 Ga0495619_0033620 Ga0495619_0033620_926_1975 344
1746 3300053086 Ga0500578_0135202 Ga0500578_0135202_430_1479 344
1747 3300053096 Ga0500641_0004560 Ga0500641_0004560_312_1358 344
1748 3300053130 Ga0500642_0025906 Ga0500642_0025906_835_1884 344
1749 3300053139 Ga0500568_0013284 Ga0500568_0013284_1762_2808 344

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12849

PBP_like_2

PBP superfamily domain

78

370

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1pbp-assembly1.cif.gz_A fine tuning of the specificity of the periplasmic phosphate transport receptor: site-directed mutagenesis, ligand binding, and crystallographic studies 0.9921 19 340
1quj-assembly1.cif.gz_A phosphate-binding protein mutant with asp 137 replaced by gly complex with chlorine and phosphate 0.9912 19 340
1ixi-assembly1.cif.gz_A phosphate-binding protein mutant with asp 56 replaced by asn complex with monobasic phosphate ion 0.9905 19 340
5i84-assembly5.cif.gz_E structure of the xanthomonas citri phosphate-binding protein phox 0.9904 20 332
1a55-assembly1.cif.gz_A phosphate-binding protein mutant a197c 0.9901 19 340
ID Description Score Start End Superfamily
af_P0AG82_103_278_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9627 95 271 3.40.190.10
af_P0AG82_103_278_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9519 95 271 3.40.190.10
5i84A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9475 20 332 3.40.190.10
1pc3B02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9414 96 271 3.40.190.10
af_Q58421_135_323_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9395 97 270 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A379T2E0-F1-model_v4 Phosphate-binding protein PstS 0.9948 34 227 GO:0035435
GO:0042301
GO:0043190
AF-A0A2G8T783-F1-model_v4 Phosphate-binding protein PstS 0.9948 72 250 GO:0035435
GO:0042301
GO:0043190
AF-A0A3M5TDI5-F1-model_v4 Phosphate-binding protein PstS 0.9938 93 332 GO:0035435
GO:0042301
GO:0043190
AF-A0A4S1FX25-F1-model_v4 Phosphate ABC transporter substrate-binding protein PstS 0.9938 108 213
AF-A0A6D0EMP2-F1-model_v4 deleted 0.9934 44 204

Feature Viewer

pLDDT pTM Quality
93.2 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map