F495463

General Info

Members Datasets Scaffolds Average Seq Length
1719 594 1575 373

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100114106|Ga0068869_1001141062
Length 429
Sequence MNKENFEEKTSPLPKESLGQPLSDGEGTNLLEIPNIEEKSLNLNPPSRDSGLRVLFIDRDGTIIKEAPPTYQLDAFTKLEFYPHMFEFLTKIVKELDYELVMVTNQDGLGSQSFPEDSFWPIQHFILRALENEGIVFSEIFIDRTFAHENKLTRKPGTGMLTEYLGTDRYDLKNSFVIGDRITDVKLAENLGCRALWLNNHDELGAGELSVSAKELSSVIAVETQKWEDIYEFLKRPPRKIIHSRNTNETKIEINLNLDGGGISQIETGLGFFDHMLEQLSKHSGMNLGIICKGDLHIDEHHTIEDVALALGEAMLTALGDKRGIERYGFLLPMDDCLAQVGIDFGGRSWLVWNAEFKREKIGEVPTEMFYHFFKSFSDAAKCNLSIKAEGDNEHHKIESIFKAFAKSIKMAIKRDPMNNSLPTTKGLL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
3 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
4 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
5 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
6 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
7 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
8 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
9 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
10 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
11 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
12 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
13 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
14 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
15 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
16 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
17 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
18 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
19 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
20 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
21 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
22 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
23 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
24 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
25 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
26 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
27 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
28 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
29 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
30 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
31 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
32 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
33 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
34 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
35 2734482264 Dyella sp. AD052 Isolate Unclassified
36 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
37 2738541278 Niastella sp. CF465 Isolate Unclassified
38 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
39 2738541283 Pedobacter sp. OK701 Isolate Unclassified
40 2738541284 Pedobacter sp. YR016 Isolate Unclassified
41 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
42 2738541302 Pedobacter sp. CF074 Isolate Unclassified
43 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
44 2738543009 Luteibacter sp. OK325 Isolate Unclassified
45 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
46 2738543023 Pedobacter sp. OK628 Isolate Unclassified
47 2739367651 Pedobacter sp. OK291 Isolate Unclassified
48 2739367656 Pedobacter sp. CF523 Isolate Unclassified
49 2739367663 Pedobacter sp. YR510 Isolate Unclassified
50 2739367700 Dyella sp. YR388 Isolate Unclassified
51 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
52 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
53 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
54 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
55 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
56 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
57 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
58 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
59 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
60 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
61 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
62 2818991437 Pedobacter terrae 518 Isolate Unclassified
63 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
64 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
65 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
66 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
67 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
68 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
69 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
70 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
71 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
72 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
73 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
74 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
75 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
76 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
77 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
78 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
79 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
80 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
81 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
82 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
83 2884411467 Dyella sp. AD56 Isolate Rhizosphere
84 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
85 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
86 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
87 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
88 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
89 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
90 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
91 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
92 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
93 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
94 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
95 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
96 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
97 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
98 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
99 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
100 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
101 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
102 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
103 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
104 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
105 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
106 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
107 2914759650 Rhizosphaericola mali Isolate Rhizosphere
108 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
109 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
110 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
111 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
112 2919404418 Luteibacter sp. 3190 Isolate Unclassified
113 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
114 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
115 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
116 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
117 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
118 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
119 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
120 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
121 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
122 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
123 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
124 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
125 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
126 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
127 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
128 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
129 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
130 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
131 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
132 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
133 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
134 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
135 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
136 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
137 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
138 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
139 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
140 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
141 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
142 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
143 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
144 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
145 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
146 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
147 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
148 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
149 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
150 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
151 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
152 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
153 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
154 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
155 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
156 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
157 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
158 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
159 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
160 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
161 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
162 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
163 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
164 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
165 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
166 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
167 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
168 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
169 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
170 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
171 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
172 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
173 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
174 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
175 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
176 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
177 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
178 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
179 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
180 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
181 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
182 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
183 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
184 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
185 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
186 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
187 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
188 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
189 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
190 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
191 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
192 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
193 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
194 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
195 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
196 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
197 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
198 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
199 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
200 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
201 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
202 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
203 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
204 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
205 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
206 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
207 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
208 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
209 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
210 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
211 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
212 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
213 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
214 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
215 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
216 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
217 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
218 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
219 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
220 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
221 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
222 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
223 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
224 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
225 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
226 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
227 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
228 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
229 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
230 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
231 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
232 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
233 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
234 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
235 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
236 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
237 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
238 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
239 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
240 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
241 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
242 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
243 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
244 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
245 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
246 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
247 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
248 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
249 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
250 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
251 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
252 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
253 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
254 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
255 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
256 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
257 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
258 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
259 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
260 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
261 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
262 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
263 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
264 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
265 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
266 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
267 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
268 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
269 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
270 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
271 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
272 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
273 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
274 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
275 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
276 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
277 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
278 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
279 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
280 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
281 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
282 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
283 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
284 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
285 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
286 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
287 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
288 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
289 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
290 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
291 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
292 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
293 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
294 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
295 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
296 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
297 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
298 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
299 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
300 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
301 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
302 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
303 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
304 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
305 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
306 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
307 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
308 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
354 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
355 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
356 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
358 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
359 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
360 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
361 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
362 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
363 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
365 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
366 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
367 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
368 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
369 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
370 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
371 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
373 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
374 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
375 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
376 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
377 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
378 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
379 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
380 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
381 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
382 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
383 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
384 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
385 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
386 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
387 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
388 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
389 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
390 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
391 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
392 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
393 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
394 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
395 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
396 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
397 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
398 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
399 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
400 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
401 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
402 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
403 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
404 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
405 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
406 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
407 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
408 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
409 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
410 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
411 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
412 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
413 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
414 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
415 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
416 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
417 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
418 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
419 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
420 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
421 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
422 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
423 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
424 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
425 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
426 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
427 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
428 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
429 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
430 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
431 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
432 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
433 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
434 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
435 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
436 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
437 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
438 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
439 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
440 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
441 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
442 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
443 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
444 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
445 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
446 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
447 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
448 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
449 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
450 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
451 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
452 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
453 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
454 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
455 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
456 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
457 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
458 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
459 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
460 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
461 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
462 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
463 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
464 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
465 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
466 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
467 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
468 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
469 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
470 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
471 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
472 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
473 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
474 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
475 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
476 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
477 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
478 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
479 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
480 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
481 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
482 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
483 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
484 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
485 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
486 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
487 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
488 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
489 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
490 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
491 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
492 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
493 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
494 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
495 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
496 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
497 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
498 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
499 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
500 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
501 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
502 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
503 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
504 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
505 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
506 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
507 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
508 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
509 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
510 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
511 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
512 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
513 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
514 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
515 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
516 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
517 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
518 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
519 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
520 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
521 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
522 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
523 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
524 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
525 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
526 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
527 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
528 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
529 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
530 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
531 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
532 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
533 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
534 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
535 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
536 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
537 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
538 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
539 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
540 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
541 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
542 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
543 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
544 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
545 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
546 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
547 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
548 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
549 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
550 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
551 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
552 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
553 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
554 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
555 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
556 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
557 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
558 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
559 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
560 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
561 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
562 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
563 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
564 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
565 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
566 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
567 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
568 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
569 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
570 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
571 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
572 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
573 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
574 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
575 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
576 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
577 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
578 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
579 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
580 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
581 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
582 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
583 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
584 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
585 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
586 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
587 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
588 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
589 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
590 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
591 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
592 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere
593 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
594 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.33
Metatranscriptomes 0.23
Isolates 8.44

Biome Distribution

Category Percentage (%)
Aerial Root 0.12
Bulb 0
Endosphere 8.14
Nodule 0.12
Rhizoplane 0.52
Rhizosphere 81.5
Stem 0
Stem Tuber 0
Unclassified 9.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2106057 2162886007 Bacteria 1249
2 SwRhRL2b_contig_787417 2162886007 Bacteria 8367
3 SwRhRL2b_contig_995218 2162886007 Bacteria 2934
4 JGI24740J21852_10011978 3300001979 Bacteria 3283
5 JGI24739J22299_10005607 3300001989 Bacteria 4759
6 JGI24739J22299_10018320 3300001989 Bacteria 2517
7 JGI24737J22298_10007120 3300001990 Bacteria 3790
8 JGI24737J22298_10007166 3300001990 Bacteria 3774
9 JGI24735J21928_10000004 3300002067 Bacteria 381713
10 JGI24735J21928_10000733 3300002067 Bacteria 11666
11 JGI24738J21930_10007886 3300002075 Bacteria 2436
12 JGI25156J39149_1010714 3300002705 Bacteria 2134
13 JGI25156J39149_1011938 3300002705 Bacteria 1941
14 JGI25162J39368_1000011 3300002737 Bacteria 379156
15 JGI25162J39368_1000395 3300002737 Bacteria 36803
16 JGI25162J39368_1000614 3300002737 Bacteria 25616
17 JGI25154J39366_1000040 3300002738 Bacteria 147410
18 JGI25157J39369_1004284 3300002741 Bacteria 2638
19 JGI25164J39214_1000338 3300002772 Bacteria 29675
20 JGI25164J39214_1000416 3300002772 Bacteria 24162
21 JGI25150J39212_1000001 3300002774 Bacteria 1318726
22 JGI25159J45721_1013514 3300002987 Bacteria 1884
23 JGI25151J46595_10000001 3300003187 Bacteria 887211
24 JGI25151J46595_10012241 3300003187 Bacteria 3909
25 JGI25165J46597_1000513 3300003214 Bacteria 36803
26 JGI25165J46597_1000985 3300003214 Bacteria 19074
27 JGI25153J46596_10000001 3300003215 Bacteria 748985
28 JGI25153J46596_10003346 3300003215 Bacteria 9003
29 rootH1_10005810 3300003316 Bacteria 3544
30 rootH1_10024829 3300003316 Bacteria 25564
31 rootH1_10091502 3300003316 Bacteria 1806
32 rootH2_10001891 3300003320 Bacteria 464318
33 rootH2_10006905 3300003320 Bacteria 21755
34 rootH2_10013742 3300003320 Bacteria 11980
35 rootH2_10026728 3300003320 Bacteria 23571
36 rootH2_10070248 3300003320 Bacteria 1869
37 rootH2_10090920 3300003320 Bacteria 6366
38 rootL2_10009890 3300003322 Bacteria 1938
39 rootL2_10030202 3300003322 Bacteria 2816
40 rootL2_10058669 3300003322 Bacteria 5201
41 rootL2_10102542 3300003322 Bacteria 3154
42 rootL2_10115167 3300003322 Bacteria 2189
43 rootL2_10124282 3300003322 Bacteria 2909
44 rootH1_10000019 3300003316 Bacteria 18606
45 rootH1_10000019 3300003323 Bacteria 34919
46 rootH1_10008801 3300003323 Bacteria 13652
47 rootH1_10014558 3300003323 Bacteria 13059
48 rootH1_10035284 3300003323 Bacteria 47456
49 rootH1_10162681 3300003323 Bacteria 3348
50 rootH1_10178453 3300003323 Bacteria 2808
51 rootH1_10196299 3300003323 Bacteria 1821
52 rootH1_10230245 3300003323 Bacteria 1263
53 JGI25160J50197_1000719 3300003354 Bacteria 18158
54 JGI25160J50197_1005718 3300003354 Bacteria 5138
55 JGI25160J50197_1006644 3300003354 Bacteria 4654
56 JGI25160J50197_1012160 3300003354 Bacteria 3008
57 Ga0006562J51391_1077937 3300003578 Bacteria 7790
58 Ga0055533_1000705 3300003756 Bacteria 10941
59 Ga0055535_1004072 3300003761 Bacteria 3753
60 Ga0055542_1002114 3300003762 Bacteria 7298
61 Ga0055526_1020598 3300003771 Bacteria 2336
62 Ga0055526_1021512 3300003771 Bacteria 2240
63 Ga0055524_1008450 3300003775 Bacteria 4278
64 Ga0055536_1000001 3300003781 Bacteria 630663
65 Ga0055536_1002653 3300003781 Bacteria 9935
66 Ga0055536_1005846 3300003781 Bacteria 5909
67 Ga0055534_1003989 3300003784 Bacteria 4435
68 Ga0055528_1001650 3300003790 Bacteria 13115
69 Ga0055530_10000387 3300003791 Bacteria 39558
70 Ga0055530_10002797 3300003791 Bacteria 10738
71 Ga0055530_10004772 3300003791 Bacteria 6816
72 Ga0055531_10000087 3300003794 Bacteria 101553
73 Ga0055531_10000131 3300003794 Bacteria 85257
74 Ga0055531_10003712 3300003794 Bacteria 9601
75 Ga0055531_10017858 3300003794 Bacteria 2966
76 Ga0055531_10022988 3300003794 Bacteria 2356
77 Ga0065165_1000102 3300005262 Bacteria 140917
78 Ga0065165_1000396 3300005262 Bacteria 70676
79 Ga0065165_1002869 3300005262 Bacteria 13297
80 Ga0065165_1011677 3300005262 Bacteria 3633
81 Ga0065714_10003545 3300005288 Bacteria 7328
82 Ga0065714_10004089 3300005288 Bacteria 9774
83 Ga0065714_10010706 3300005288 Bacteria 2645
84 Ga0065714_10027838 3300005288 Bacteria 1420
85 Ga0065714_10064750 3300005288 Bacteria 20200
86 Ga0065714_10064863 3300005288 Bacteria 16719
87 Ga0065714_10067358 3300005288 Bacteria 5607
88 Ga0065714_10084036 3300005288 Bacteria 2219
89 Ga0065714_10091768 3300005288 Bacteria 1886
90 Ga0065714_10095177 3300005288 Bacteria 1757
91 Ga0065704_10000210 3300005289 Bacteria 93612
92 Ga0065704_10002415 3300005289 Bacteria 5278
93 Ga0065704_10005410 3300005289 Bacteria 3301
94 Ga0065704_10070975 3300005289 Bacteria 14132
95 Ga0065704_10077961 3300005289 Bacteria 4569
96 Ga0065704_10090743 3300005289 Bacteria 2766
97 Ga0065704_10113887 3300005289 Bacteria 1902
98 Ga0065712_10088970 3300005290 Bacteria 2491
99 Ga0065715_10133536 3300005293 Bacteria 1971
100 Ga0070658_10000049 3300005327 Bacteria 119985
101 Ga0070658_10013707 3300005327 Bacteria 6505
102 Ga0070658_10025309 3300005327 Bacteria 4759
103 Ga0070658_10054233 3300005327 Bacteria 3255
104 Ga0070676_10000336 3300005328 Bacteria 21357
105 Ga0070676_10026339 3300005328 Bacteria 3292
106 Ga0070676_10030128 3300005328 Bacteria 3092
107 Ga0070683_100249876 3300005329 Bacteria 1687
108 Ga0070690_100039757 3300005330 Bacteria 2972
109 Ga0070690_100101551 3300005330 Bacteria 1908
110 Ga0070690_100121968 3300005330 Bacteria 1750
111 Ga0070670_100022394 3300005331 Bacteria 5439
112 Ga0070670_100033933 3300005331 Bacteria 4393
113 Ga0070670_100045698 3300005331 Bacteria 3765
114 Ga0070670_100095525 3300005331 Bacteria 2557
115 Ga0070670_100096661 3300005331 Bacteria 2541
116 Ga0070670_100169959 3300005331 Bacteria 1891
117 Ga0070677_10030505 3300005333 Bacteria 2053
118 Ga0070677_10032555 3300005333 Bacteria 2001
119 Ga0068869_100003156 3300005334 Bacteria 10060
120 Ga0068869_100025054 3300005334 Bacteria 4139
121 Ga0068869_100039400 3300005334 Bacteria 3373
122 Ga0068869_100071316 3300005334 Bacteria 2572
123 Ga0068869_100092872 3300005334 Bacteria 2272
124 Ga0068869_100114106 3300005334 Bacteria 2059
125 Ga0068869_100126876 3300005334 Bacteria 1957
126 Ga0068869_100129295 3300005334 Bacteria 1940
127 Ga0068869_100145294 3300005334 Bacteria 1835
128 Ga0068869_100149394 3300005334 Bacteria 1811
129 Ga0068869_100200348 3300005334 Bacteria 1574
130 Ga0070666_10000003 3300005335 Bacteria 463666
131 Ga0070666_10000051 3300005335 Bacteria 99740
132 Ga0070666_10035424 3300005335 Bacteria 3310
133 Ga0070666_10038936 3300005335 Bacteria 3165
134 Ga0070666_10055085 3300005335 Bacteria 2684
135 Ga0070680_100014158 3300005336 Bacteria 6230
136 Ga0070680_100014310 3300005336 Bacteria 6197
137 Ga0070680_100045802 3300005336 Unclassified 3557
138 Ga0070682_100000153 3300005337 Bacteria 53159
139 Ga0070682_100001275 3300005337 Bacteria 14290
140 Ga0070682_100023945 3300005337 Bacteria 3629
141 Ga0068868_100008530 3300005338 Bacteria 7338
142 Ga0068868_100015143 3300005338 Bacteria 5698
143 Ga0068868_100016530 3300005338 Bacteria 5482
144 Ga0068868_100020344 3300005338 Bacteria 4985
145 Ga0068868_100026273 3300005338 Bacteria 4435
146 Ga0068868_100181732 3300005338 Bacteria 1745
147 Ga0070660_100021175 3300005339 Bacteria 4791
148 Ga0070660_100027944 3300005339 Bacteria 4216
149 Ga0070660_100045939 3300005339 Bacteria 3346
150 Ga0070660_100202184 3300005339 Bacteria 1611
151 Ga0070689_100012964 3300005340 Bacteria 6020
152 Ga0070689_100020120 3300005340 Bacteria 4948
153 Ga0070689_100027105 3300005340 Bacteria 4318
154 Ga0070689_100064306 3300005340 Bacteria 2855
155 Ga0070691_10004326 3300005341 Bacteria 6456
156 Ga0070691_10007180 3300005341 Bacteria 5101
157 Ga0070687_100026921 3300005343 Bacteria 2773
158 Ga0070661_100003020 3300005344 Bacteria 11579
159 Ga0070661_100017264 3300005344 Bacteria 5118
160 Ga0070661_100023944 3300005344 Bacteria 4380
161 Ga0070661_100034512 3300005344 Bacteria 3668
162 Ga0070661_100047201 3300005344 Bacteria 3151
163 Ga0070692_10044215 3300005345 Bacteria 2293
164 Ga0070668_100077511 3300005347 Bacteria 2598
165 Ga0070668_100159218 3300005347 Bacteria 1831
166 Ga0070668_100265475 3300005347 Bacteria 1429
167 Ga0070669_100004024 3300005353 Bacteria 10630
168 Ga0070669_100237792 3300005353 Bacteria 1446
169 Ga0070675_100015326 3300005354 Bacteria 6059
170 Ga0070675_100016332 3300005354 Bacteria 5890
171 Ga0070675_100027340 3300005354 Bacteria 4582
172 Ga0070675_100096546 3300005354 Unclassified 2483
173 Ga0070671_100005548 3300005355 Bacteria 10050
174 Ga0070671_100038509 3300005355 Bacteria 3969
175 Ga0070671_100103058 3300005355 Bacteria 2394
176 Ga0070671_100311131 3300005355 Bacteria 1342
177 Ga0070674_100002364 3300005356 Bacteria 10411
178 Ga0070674_100111721 3300005356 Bacteria 2007
179 Ga0070673_100001990 3300005364 Bacteria 12324
180 Ga0070673_100026479 3300005364 Bacteria 4283
181 Ga0070673_100047585 3300005364 Bacteria 3338
182 Ga0070673_100078015 3300005364 Bacteria 2678
183 Ga0070673_100079941 3300005364 Bacteria 2648
184 Ga0070673_100212742 3300005364 Bacteria 1670
185 Ga0070673_100386908 3300005364 Bacteria 1248
186 Ga0070688_100001700 3300005365 Bacteria 10987
187 Ga0070659_100004255 3300005366 Bacteria 10213
188 Ga0070659_100005797 3300005366 Bacteria 8894
189 Ga0070659_100006368 3300005366 Bacteria 8525
190 Ga0070659_100006699 3300005366 Bacteria 8329
191 Ga0070659_100011612 3300005366 Bacteria 6519
192 Ga0070659_100052714 3300005366 Bacteria 3200
193 Ga0070659_100086606 3300005366 Bacteria 2507
194 Ga0070667_100000492 3300005367 Bacteria 40164
195 Ga0070667_100001349 3300005367 Bacteria 22023
196 Ga0070667_100044097 3300005367 Bacteria 3744
197 Ga0070667_100069793 3300005367 Bacteria 2991
198 Ga0070667_100121925 3300005367 Bacteria 2268
199 Ga0070714_100116833 3300005435 Bacteria 2368
200 Ga0070713_100006097 3300005436 Bacteria 8314
201 Ga0070710_10058995 3300005437 Bacteria 2178
202 Ga0070663_100001195 3300005455 Bacteria 14271
203 Ga0070663_100195511 3300005455 Bacteria 1576
204 Ga0070678_100001813 3300005456 Bacteria 11512
205 Ga0070678_100024345 3300005456 Bacteria 4052
206 Ga0070678_100189828 3300005456 Bacteria 1689
207 Ga0070662_100000045 3300005457 Bacteria 67900
208 Ga0070662_100004086 3300005457 Bacteria 9167
209 Ga0070662_100049317 3300005457 Bacteria 3036
210 Ga0070662_100121832 3300005457 Bacteria 2000
211 Ga0070681_10003864 3300005458 Bacteria 14101
212 Ga0070681_10022395 3300005458 Bacteria 6345
213 Ga0070681_10053268 3300005458 Bacteria 4032
214 Ga0070681_10222079 3300005458 Bacteria 1804
215 Ga0068867_100004573 3300005459 Bacteria 9730
216 Ga0068867_100062000 3300005459 Bacteria 2778
217 Ga0068867_100075744 3300005459 Bacteria 2525
218 Ga0068867_100188557 3300005459 Bacteria 1644
219 Ga0070685_10002206 3300005466 Bacteria 10050
220 Ga0070698_100043739 3300005471 Bacteria 4591
221 Ga0070679_100000634 3300005530 Bacteria 29900
222 Ga0070679_100004536 3300005530 Bacteria 12825
223 Ga0070679_100006277 3300005530 Bacteria 11066
224 Ga0070679_100007656 3300005530 Bacteria 10111
225 Ga0070679_100019902 3300005530 Bacteria 6535
226 Ga0070679_100200590 3300005530 Bacteria 1961
227 Ga0070679_100251163 3300005530 Bacteria 1725
228 Ga0070679_100304594 3300005530 Bacteria 1544
229 Ga0070684_100000495 3300005535 Bacteria 27122
230 Ga0070684_100005089 3300005535 Bacteria 10043
231 Ga0070684_100035368 3300005535 Bacteria 4275
232 Ga0070684_100261462 3300005535 Bacteria 1583
233 Ga0068853_100000221 3300005539 Bacteria 40294
234 Ga0068853_100008065 3300005539 Bacteria 8446
235 Ga0068853_100009733 3300005539 Bacteria 7754
236 Ga0068853_100013393 3300005539 Bacteria 6695
237 Ga0068853_100016539 3300005539 Bacteria 6074
238 Ga0068853_100046538 3300005539 Bacteria 3720
239 Ga0068853_100057348 3300005539 Bacteria 3361
240 Ga0068853_100070430 3300005539 Bacteria 3044
241 Ga0068853_100098422 3300005539 Unclassified 2583
242 Ga0068853_100134731 3300005539 Bacteria 2213
243 Ga0068853_100252364 3300005539 Bacteria 1619
244 Ga0068853_100265163 3300005539 Bacteria 1580
245 Ga0070672_100001489 3300005543 Bacteria 14544
246 Ga0070672_100065616 3300005543 Bacteria 2872
247 Ga0070672_100068525 3300005543 Bacteria 2814
248 Ga0070686_100022221 3300005544 Bacteria 3775
249 Ga0070686_100149017 3300005544 Bacteria 1637
250 Ga0070696_100005210 3300005546 Bacteria 8690
251 Ga0070693_100003483 3300005547 Bacteria 7347
252 Ga0070693_100065349 3300005547 Bacteria 2126
253 Ga0070665_100000020 3300005548 Bacteria 389687
254 Ga0070665_100016967 3300005548 Bacteria 7300
255 Ga0070665_100043231 3300005548 Bacteria 4528
256 Ga0070665_100079883 3300005548 Bacteria 3276
257 Ga0070665_100113957 3300005548 Bacteria 2706
258 Ga0068855_100000089 3300005563 Bacteria 110845
259 Ga0068855_100000240 3300005563 Bacteria 69408
260 Ga0068855_100000346 3300005563 Bacteria 57719
261 Ga0068855_100005837 3300005563 Bacteria 15028
262 Ga0068855_100008169 3300005563 Bacteria 12653
263 Ga0068855_100020597 3300005563 Bacteria 7909
264 Ga0068855_100024825 3300005563 Bacteria 7170
265 Ga0068855_100026080 3300005563 Bacteria 6991
266 Ga0068855_100030585 3300005563 Bacteria 6437
267 Ga0068855_100047040 3300005563 Bacteria 5098
268 Ga0068855_100053363 3300005563 Bacteria 4756
269 Ga0068855_100062842 3300005563 Bacteria 4334
270 Ga0068855_100107211 3300005563 Bacteria 3210
271 Ga0068855_100136803 3300005563 Bacteria 2794
272 Ga0068855_100139053 3300005563 Bacteria 2770
273 Ga0068855_100234343 3300005563 Bacteria 2053
274 Ga0068855_100257335 3300005563 Bacteria 1945
275 Ga0068855_100264801 3300005563 Bacteria 1913
276 Ga0070664_100007478 3300005564 Bacteria 8823
277 Ga0070664_100014454 3300005564 Bacteria 6435
278 Ga0070664_100015583 3300005564 Bacteria 6220
279 Ga0070664_100039376 3300005564 Bacteria 3983
280 Ga0070664_100044954 3300005564 Bacteria 3729
281 Ga0070664_100161976 3300005564 Bacteria 1980
282 Ga0070664_100255598 3300005564 Bacteria 1576
283 Ga0068857_100007822 3300005577 Bacteria 9217
284 Ga0068857_100008143 3300005577 Bacteria 9051
285 Ga0068857_100008503 3300005577 Bacteria 8872
286 Ga0068857_100019055 3300005577 Bacteria 6022
287 Ga0068857_100036860 3300005577 Bacteria 4332
288 Ga0068857_100039954 3300005577 Unclassified 4159
289 Ga0068857_100042446 3300005577 Bacteria 4035
290 Ga0068857_100139189 3300005577 Bacteria 2193
291 Ga0068857_100237126 3300005577 Bacteria 1669
292 Ga0068857_100251550 3300005577 Bacteria 1620
293 Ga0068854_100014860 3300005578 Bacteria 5141
294 Ga0068854_100036209 3300005578 Bacteria 3459
295 Ga0068854_100044551 3300005578 Bacteria 3150
296 Ga0068854_100051761 3300005578 Bacteria 2943
297 Ga0068854_100315201 3300005578 Bacteria 1269
298 Ga0068856_100000835 3300005614 Bacteria 33215
299 Ga0068856_100006910 3300005614 Bacteria 11099
300 Ga0068856_100007967 3300005614 Bacteria 10348
301 Ga0068856_100010959 3300005614 Bacteria 8800
302 Ga0068856_100017673 3300005614 Bacteria 6914
303 Ga0068856_100021537 3300005614 Bacteria 6265
304 Ga0068856_100022699 3300005614 Bacteria 6101
305 Ga0068856_100074762 3300005614 Bacteria 3355
306 Ga0068856_100093470 3300005614 Bacteria 2993
307 Ga0068856_100132644 3300005614 Bacteria 2496
308 Ga0068856_100464115 3300005614 Bacteria 1287
309 Ga0068852_100001345 3300005616 Bacteria 16491
310 Ga0068852_100002446 3300005616 Bacteria 12784
311 Ga0068852_100002479 3300005616 Bacteria 12715
312 Ga0068852_100003445 3300005616 Bacteria 11058
313 Ga0068852_100021932 3300005616 Bacteria 5111
314 Ga0068852_100049232 3300005616 Bacteria 3604
315 Ga0068852_100187804 3300005616 Bacteria 1947
316 Ga0068859_100000037 3300005617 Bacteria 165480
317 Ga0068859_100002554 3300005617 Bacteria 18479
318 Ga0068859_100009853 3300005617 Bacteria 9646
319 Ga0068859_100014329 3300005617 Bacteria 7953
320 Ga0068859_100014701 3300005617 Bacteria 7865
321 Ga0068859_100019039 3300005617 Bacteria 6894
322 Ga0068859_100081931 3300005617 Bacteria 3269
323 Ga0068859_100112184 3300005617 Bacteria 2789
324 Ga0068859_100156882 3300005617 Bacteria 2354
325 Ga0068859_100211719 3300005617 Bacteria 2025
326 Ga0068859_100222053 3300005617 Bacteria 1977
327 Ga0068859_100259099 3300005617 Bacteria 1830
328 Ga0068859_100343093 3300005617 Bacteria 1588
329 Ga0068859_100466366 3300005617 Bacteria 1359
330 Ga0068864_100005800 3300005618 Bacteria 10131
331 Ga0068864_100046544 3300005618 Bacteria 3722
332 Ga0068864_100047161 3300005618 Bacteria 3700
333 Ga0068864_100071407 3300005618 Bacteria 3023
334 Ga0068864_100081890 3300005618 Bacteria 2831
335 Ga0068864_100291107 3300005618 Bacteria 1527
336 Ga0068861_100072756 3300005719 Bacteria 2668
337 Ga0068861_100076439 3300005719 Bacteria 2609
338 Ga0068861_100109468 3300005719 Bacteria 2211
339 Ga0068851_10011215 3300005834 Bacteria 4198
340 Ga0068851_10017429 3300005834 Bacteria 3449
341 Ga0068870_10028107 3300005840 Bacteria 2820
342 Ga0068863_100000412 3300005841 Bacteria 43521
343 Ga0068863_100001812 3300005841 Bacteria 21216
344 Ga0068863_100015360 3300005841 Bacteria 7359
345 Ga0068863_100026107 3300005841 Bacteria 5573
346 Ga0068863_100038028 3300005841 Bacteria 4579
347 Ga0068863_100041343 3300005841 Bacteria 4383
348 Ga0068863_100102832 3300005841 Bacteria 2717
349 Ga0068858_100019340 3300005842 Bacteria 6368
350 Ga0068858_100038430 3300005842 Bacteria 4439
351 Ga0068858_100068957 3300005842 Bacteria 3277
352 Ga0068858_100074780 3300005842 Bacteria 3146
353 Ga0068858_100113886 3300005842 Bacteria 2526
354 Ga0068858_100405101 3300005842 Bacteria 1311
355 Ga0068860_100000916 3300005843 Bacteria 32698
356 Ga0068860_100001316 3300005843 Bacteria 26971
357 Ga0068860_100003283 3300005843 Bacteria 16648
358 Ga0068860_100011274 3300005843 Bacteria 8808
359 Ga0068860_100011999 3300005843 Bacteria 8534
360 Ga0068860_100022244 3300005843 Bacteria 6137
361 Ga0068860_100079593 3300005843 Bacteria 3116
362 Ga0068860_100081707 3300005843 Bacteria 3073
363 Ga0068860_100173481 3300005843 Bacteria 2083
364 Ga0068860_100191982 3300005843 Bacteria 1977
365 Ga0068862_100010385 3300005844 Bacteria 7684
366 Ga0068862_100025020 3300005844 Bacteria 5011
367 Ga0068862_100041877 3300005844 Bacteria 3898
368 Ga0068862_100045273 3300005844 Bacteria 3754
369 Ga0068862_100079303 3300005844 Bacteria 2846
370 Ga0068862_100100522 3300005844 Bacteria 2529
371 Ga0068862_100169907 3300005844 Bacteria 1952
372 Ga0068862_100297749 3300005844 Bacteria 1483
373 Ga0081539_10000531 3300005985 Bacteria 79191
374 Ga0081539_10049494 3300005985 Bacteria 2384
375 Ga0070712_100072125 3300006175 Bacteria 2473
376 Ga0075366_10005218 3300006195 Bacteria 7031
377 Ga0075366_10020069 3300006195 Bacteria 3875
378 Ga0075366_10061158 3300006195 Bacteria 2238
379 Ga0097621_100000818 3300006237 Bacteria 21982
380 Ga0097621_100002086 3300006237 Bacteria 13691
381 Ga0097621_100018421 3300006237 Bacteria 5333
382 Ga0097621_100021360 3300006237 Bacteria 5006
383 Ga0097621_100022179 3300006237 Bacteria 4926
384 Ga0097621_100037338 3300006237 Bacteria 3892
385 Ga0097621_100093623 3300006237 Bacteria 2518
386 Ga0068871_100000027 3300006358 Bacteria 78588
387 Ga0068871_100000100 3300006358 Bacteria 51253
388 Ga0068871_100000354 3300006358 Bacteria 31915
389 Ga0068871_100010400 3300006358 Bacteria 6788
390 Ga0068871_100032169 3300006358 Unclassified 4141
391 Ga0068871_100056018 3300006358 Bacteria 3203
392 Ga0075428_100017721 3300006844 Bacteria 7870
393 Ga0075428_100050469 3300006844 Bacteria 4562
394 Ga0075428_100219642 3300006844 Bacteria 2052
395 Ga0075428_100285890 3300006844 Bacteria 1774
396 Ga0075430_100009529 3300006846 Bacteria 8210
397 Ga0075431_100065731 3300006847 Bacteria 3745
398 Ga0075429_100018092 3300006880 Bacteria 6097
399 Ga0075429_100032161 3300006880 Bacteria 4560
400 Ga0075429_100122899 3300006880 Bacteria 2269
401 Ga0068865_100000174 3300006881 Bacteria 35630
402 Ga0068865_100023102 3300006881 Bacteria 4068
403 Ga0068865_100028117 3300006881 Bacteria 3721
404 Ga0068865_100260016 3300006881 Bacteria 1374
405 Ga0097620_100000037 3300006931 Bacteria 165480
406 Ga0097620_100002554 3300006931 Bacteria 18479
407 Ga0097620_100009853 3300006931 Bacteria 9646
408 Ga0097620_100014329 3300006931 Bacteria 7953
409 Ga0097620_100014701 3300006931 Bacteria 7865
410 Ga0097620_100019038 3300006931 Bacteria 6894
411 Ga0097620_100081931 3300006931 Bacteria 3269
412 Ga0097620_100112184 3300006931 Bacteria 2789
413 Ga0097620_100156891 3300006931 Bacteria 2354
414 Ga0097620_100211717 3300006931 Bacteria 2025
415 Ga0097620_100222053 3300006931 Bacteria 1977
416 Ga0097620_100259079 3300006931 Bacteria 1830
417 Ga0097620_100343100 3300006931 Bacteria 1588
418 Ga0097620_100466346 3300006931 Bacteria 1359
419 Ga0105244_10000063 3300009036 Bacteria 122746
420 Ga0105244_10000261 3300009036 Bacteria 53251
421 Ga0105240_10000074 3300009093 Bacteria 199611
422 Ga0105240_10000176 3300009093 Bacteria 130109
423 Ga0105240_10000237 3300009093 Bacteria 109895
424 Ga0105240_10000598 3300009093 Bacteria 67006
425 Ga0105240_10000626 3300009093 Bacteria 65179
426 Ga0105240_10001351 3300009093 Bacteria 42091
427 Ga0105240_10001595 3300009093 Bacteria 38516
428 Ga0105240_10002663 3300009093 Bacteria 28411
429 Ga0105240_10007062 3300009093 Bacteria 16373
430 Ga0105240_10008151 3300009093 Bacteria 15026
431 Ga0105240_10020015 3300009093 Bacteria 8934
432 Ga0105240_10022028 3300009093 Bacteria 8460
433 Ga0105240_10066229 3300009093 Bacteria 4482
434 Ga0105240_10070852 3300009093 Unclassified 4312
435 Ga0105240_10085848 3300009093 Bacteria 3856
436 Ga0105240_10108377 3300009093 Bacteria 3365
437 Ga0105240_10287009 3300009093 Bacteria 1888
438 Ga0105240_10305713 3300009093 Bacteria 1818
439 Ga0105240_10326021 3300009093 Bacteria 1749
440 Ga0105240_10351421 3300009093 Bacteria 1672
441 Ga0105240_10404120 3300009093 Bacteria 1538
442 Ga0111539_10005620 3300009094 Bacteria 16217
443 Ga0111539_10008695 3300009094 Bacteria 12887
444 Ga0111539_10067948 3300009094 Bacteria 4207
445 Ga0105245_10178928 3300009098 Bacteria 2025
446 Ga0105247_10005412 3300009101 Bacteria 8044
447 Ga0105247_10010386 3300009101 Bacteria 5633
448 Ga0105247_10012510 3300009101 Bacteria 5098
449 Ga0105247_10018230 3300009101 Bacteria 4211
450 Ga0114129_10033962 3300009147 Bacteria 7205
451 Ga0114129_10095953 3300009147 Bacteria 4106
452 Ga0105243_10000043 3300009148 Bacteria 158809
453 Ga0105243_10002194 3300009148 Bacteria 16455
454 Ga0105243_10062549 3300009148 Bacteria 2980
455 Ga0105241_10000086 3300009174 Bacteria 69935
456 Ga0105241_10000659 3300009174 Bacteria 25872
457 Ga0105241_10000881 3300009174 Bacteria 22671
458 Ga0105241_10003116 3300009174 Bacteria 12343
459 Ga0105241_10021858 3300009174 Unclassified 4735
460 Ga0105241_10057228 3300009174 Bacteria 2990
461 Ga0105241_10098806 3300009174 Bacteria 2317
462 Ga0105241_10119203 3300009174 Bacteria 2123
463 Ga0105241_10432439 3300009174 Bacteria 1161
464 Ga0105242_10009407 3300009176 Bacteria 7494
465 Ga0105242_10013463 3300009176 Bacteria 6324
466 Ga0105242_10015906 3300009176 Bacteria 5846
467 Ga0105242_10034951 3300009176 Bacteria 4030
468 Ga0105242_10124504 3300009176 Bacteria 2217
469 Ga0105242_10211747 3300009176 Bacteria 1728
470 Ga0105248_10391891 3300009177 Bacteria 1564
471 Ga0105237_10000224 3300009545 Bacteria 79854
472 Ga0105237_10000595 3300009545 Bacteria 50470
473 Ga0105237_10001565 3300009545 Bacteria 29826
474 Ga0105237_10003647 3300009545 Bacteria 18154
475 Ga0105237_10003651 3300009545 Bacteria 18149
476 Ga0105237_10004072 3300009545 Bacteria 17045
477 Ga0105237_10009395 3300009545 Bacteria 10472
478 Ga0105237_10013977 3300009545 Bacteria 8401
479 Ga0105237_10028286 3300009545 Bacteria 5712
480 Ga0105237_10036976 3300009545 Bacteria 4937
481 Ga0105237_10049654 3300009545 Bacteria 4216
482 Ga0105237_10064255 3300009545 Bacteria 3666
483 Ga0105237_10067260 3300009545 Bacteria 3577
484 Ga0105237_10078883 3300009545 Bacteria 3282
485 Ga0105237_10135454 3300009545 Bacteria 2457
486 Ga0105237_10148072 3300009545 Unclassified 2343
487 Ga0105237_10213852 3300009545 Bacteria 1928
488 Ga0105237_10279271 3300009545 Bacteria 1673
489 Ga0105238_10001132 3300009551 Bacteria 26885
490 Ga0105238_10005720 3300009551 Bacteria 12290
491 Ga0105238_10006640 3300009551 Bacteria 11534
492 Ga0105238_10077802 3300009551 Bacteria 3308
493 Ga0105238_10097865 3300009551 Bacteria 2919
494 Ga0105238_10106237 3300009551 Bacteria 2789
495 Ga0105238_10192735 3300009551 Bacteria 2014
496 Ga0105238_10268543 3300009551 Bacteria 1686
497 Ga0105238_10380094 3300009551 Bacteria 1404
498 Ga0105249_10002281 3300009553 Bacteria 16658
499 Ga0105249_10005103 3300009553 Bacteria 11318
500 Ga0105249_10005252 3300009553 Bacteria 11181
501 Ga0105249_10008737 3300009553 Bacteria 8837
502 Ga0105249_10012834 3300009553 Bacteria 7392
503 Ga0105249_10035965 3300009553 Bacteria 4493
504 Ga0105249_10046215 3300009553 Bacteria 3962
505 Ga0105249_10107176 3300009553 Bacteria 2637
506 Ga0105249_10107814 3300009553 Unclassified 2629
507 Ga0105249_10335863 3300009553 Bacteria 1526
508 Ga0105239_10000048 3300010375 Bacteria 177855
509 Ga0105239_10000616 3300010375 Bacteria 50645
510 Ga0105239_10000758 3300010375 Bacteria 45640
511 Ga0105239_10001789 3300010375 Bacteria 28284
512 Ga0105239_10001948 3300010375 Bacteria 26930
513 Ga0105239_10002090 3300010375 Bacteria 25893
514 Ga0105239_10002752 3300010375 Bacteria 22079
515 Ga0105239_10005094 3300010375 Bacteria 15518
516 Ga0105239_10006841 3300010375 Bacteria 13158
517 Ga0105239_10008918 3300010375 Bacteria 11347
518 Ga0105239_10024710 3300010375 Bacteria 6618
519 Ga0105239_10038370 3300010375 Bacteria 5249
520 Ga0105239_10042529 3300010375 Bacteria 4979
521 Ga0105239_10078397 3300010375 Bacteria 3635
522 Ga0105239_10130417 3300010375 Bacteria 2796
523 Ga0105239_10131149 3300010375 Bacteria 2788
524 Ga0105239_10137595 3300010375 Bacteria 2719
525 Ga0105246_10013371 3300011119 Bacteria 5144
526 Ga0105246_10053815 3300011119 Bacteria 2771
527 Ga0157373_10000002 3300013100 Bacteria 750094
528 Ga0157373_10000036 3300013100 Bacteria 122723
529 Ga0157373_10000821 3300013100 Bacteria 24074
530 Ga0157373_10004709 3300013100 Bacteria 10259
531 Ga0157373_10004786 3300013100 Bacteria 10190
532 Ga0157373_10007995 3300013100 Bacteria 7864
533 Ga0157373_10013034 3300013100 Bacteria 6101
534 Ga0157373_10019401 3300013100 Bacteria 4948
535 Ga0157373_10026029 3300013100 Bacteria 4228
536 Ga0157373_10027400 3300013100 Bacteria 4110
537 Ga0157373_10118640 3300013100 Bacteria 1859
538 Ga0157373_10221355 3300013100 Bacteria 1335
539 Ga0157371_10000016 3300013102 Bacteria 330495
540 Ga0157371_10000036 3300013102 Bacteria 215191
541 Ga0157371_10000135 3300013102 Bacteria 107607
542 Ga0157371_10000563 3300013102 Bacteria 43940
543 Ga0157371_10001161 3300013102 Bacteria 28350
544 Ga0157371_10001915 3300013102 Bacteria 20795
545 Ga0157371_10003112 3300013102 Bacteria 15343
546 Ga0157371_10003683 3300013102 Bacteria 13759
547 Ga0157371_10005312 3300013102 Bacteria 10902
548 Ga0157371_10024187 3300013102 Bacteria 4437
549 Ga0157371_10024298 3300013102 Bacteria 4427
550 Ga0157371_10028632 3300013102 Bacteria 4032
551 Ga0157371_10034813 3300013102 Bacteria 3611
552 Ga0157371_10035822 3300013102 Bacteria 3555
553 Ga0157371_10042442 3300013102 Bacteria 3242
554 Ga0157371_10068485 3300013102 Bacteria 2512
555 Ga0157371_10070988 3300013102 Bacteria 2465
556 Ga0157371_10077958 3300013102 Bacteria 2347
557 Ga0157371_10078589 3300013102 Bacteria 2337
558 Ga0157371_10103195 3300013102 Bacteria 2023
559 Ga0157371_10130738 3300013102 Bacteria 1786
560 Ga0157371_10155734 3300013102 Bacteria 1630
561 Ga0157370_10000500 3300013104 Bacteria 48866
562 Ga0157370_10001022 3300013104 Bacteria 35238
563 Ga0157370_10001166 3300013104 Bacteria 32718
564 Ga0157370_10002014 3300013104 Bacteria 24962
565 Ga0157370_10004754 3300013104 Bacteria 15460
566 Ga0157370_10009476 3300013104 Bacteria 10395
567 Ga0157370_10010727 3300013104 Bacteria 9634
568 Ga0157370_10014206 3300013104 Bacteria 8159
569 Ga0157370_10014665 3300013104 Bacteria 8007
570 Ga0157370_10017596 3300013104 Bacteria 7210
571 Ga0157370_10031451 3300013104 Bacteria 5191
572 Ga0157370_10031722 3300013104 Bacteria 5166
573 Ga0157370_10036146 3300013104 Bacteria 4795
574 Ga0157370_10036413 3300013104 Bacteria 4774
575 Ga0157370_10039822 3300013104 Bacteria 4539
576 Ga0157370_10060009 3300013104 Bacteria 3612
577 Ga0157370_10142304 3300013104 Bacteria 2235
578 Ga0157370_10147217 3300013104 Unclassified 2192
579 Ga0157370_10180805 3300013104 Bacteria 1960
580 Ga0157369_10000129 3300013105 Bacteria 108473
581 Ga0157369_10000475 3300013105 Bacteria 53219
582 Ga0157369_10001138 3300013105 Bacteria 33208
583 Ga0157369_10001311 3300013105 Bacteria 30914
584 Ga0157369_10046098 3300013105 Bacteria 4739
585 Ga0157369_10051032 3300013105 Bacteria 4478
586 Ga0157369_10078779 3300013105 Bacteria 3530
587 Ga0157369_10103039 3300013105 Unclassified 3040
588 Ga0157369_10104015 3300013105 Bacteria 3025
589 Ga0157369_10123106 3300013105 Bacteria 2751
590 Ga0157369_10145737 3300013105 Bacteria 2504
591 Ga0157374_10000001 3300013296 Bacteria 1077351
592 Ga0157374_10000128 3300013296 Bacteria 69753
593 Ga0157374_10000202 3300013296 Bacteria 54739
594 Ga0157374_10058779 3300013296 Bacteria 3594
595 Ga0157374_10094451 3300013296 Bacteria 2858
596 Ga0157374_10095724 3300013296 Bacteria 2839
597 Ga0157374_10142797 3300013296 Bacteria 2324
598 Ga0157374_10185874 3300013296 Bacteria 2031
599 Ga0157374_10249613 3300013296 Bacteria 1746
600 Ga0157374_10420002 3300013296 Bacteria 1336
601 Ga0157378_10005717 3300013297 Bacteria 10884
602 Ga0157378_10005849 3300013297 Bacteria 10778
603 Ga0157378_10010586 3300013297 Bacteria 8059
604 Ga0157378_10031758 3300013297 Bacteria 4664
605 Ga0157378_10038652 3300013297 Bacteria 4230
606 Ga0157378_10049204 3300013297 Bacteria 3750
607 Ga0157378_10060809 3300013297 Bacteria 3370
608 Ga0157378_10100527 3300013297 Bacteria 2640
609 Ga0157378_10301761 3300013297 Bacteria 1550
610 Ga0157378_10362527 3300013297 Bacteria 1419
611 Ga0157378_10426561 3300013297 Bacteria 1312
612 Ga0163162_10000032 3300013306 Bacteria 156609
613 Ga0163162_10000152 3300013306 Bacteria 64273
614 Ga0163162_10000236 3300013306 Bacteria 50620
615 Ga0163162_10000331 3300013306 Bacteria 43319
616 Ga0163162_10000967 3300013306 Bacteria 26666
617 Ga0163162_10009046 3300013306 Bacteria 9683
618 Ga0163162_10010809 3300013306 Bacteria 8878
619 Ga0163162_10011763 3300013306 Bacteria 8536
620 Ga0163162_10013133 3300013306 Bacteria 8087
621 Ga0163162_10016026 3300013306 Bacteria 7325
622 Ga0163162_10026171 3300013306 Bacteria 5766
623 Ga0163162_10029333 3300013306 Bacteria 5444
624 Ga0163162_10031876 3300013306 Bacteria 5230
625 Ga0163162_10052634 3300013306 Bacteria 4089
626 Ga0163162_10052936 3300013306 Bacteria 4079
627 Ga0163162_10055013 3300013306 Bacteria 4005
628 Ga0163162_10067516 3300013306 Bacteria 3626
629 Ga0163162_10086163 3300013306 Bacteria 3219
630 Ga0163162_10114892 3300013306 Bacteria 2791
631 Ga0163162_10117466 3300013306 Bacteria 2761
632 Ga0163162_10128129 3300013306 Bacteria 2646
633 Ga0163162_10381208 3300013306 Bacteria 1543
634 Ga0163162_10393182 3300013306 Bacteria 1519
635 Ga0163162_10403773 3300013306 Bacteria 1499
636 Ga0163162_10432294 3300013306 Bacteria 1448
637 Ga0157372_10000017 3300013307 Bacteria 219543
638 Ga0157372_10000061 3300013307 Bacteria 119814
639 Ga0157372_10000921 3300013307 Bacteria 32008
640 Ga0157372_10018588 3300013307 Bacteria 7477
641 Ga0157372_10034779 3300013307 Bacteria 5543
642 Ga0157372_10042883 3300013307 Bacteria 5007
643 Ga0157372_10052962 3300013307 Bacteria 4521
644 Ga0157372_10092410 3300013307 Bacteria 3442
645 Ga0157372_10093593 3300013307 Bacteria 3420
646 Ga0157372_10098360 3300013307 Bacteria 3338
647 Ga0157372_10115846 3300013307 Bacteria 3073
648 Ga0157372_10120930 3300013307 Bacteria 3007
649 Ga0157372_10130498 3300013307 Bacteria 2891
650 Ga0157372_10146950 3300013307 Bacteria 2718
651 Ga0157372_10151239 3300013307 Bacteria 2679
652 Ga0157372_10155057 3300013307 Bacteria 2645
653 Ga0157372_10234220 3300013307 Bacteria 2129
654 Ga0157372_10259321 3300013307 Bacteria 2019
655 Ga0157372_10426779 3300013307 Bacteria 1545
656 Ga0157372_10434537 3300013307 Bacteria 1530
657 Ga0157372_10453975 3300013307 Bacteria 1493
658 Ga0157372_10467762 3300013307 Bacteria 1470
659 Ga0157372_10500769 3300013307 Bacteria 1417
660 Ga0157375_10000229 3300013308 Bacteria 52257
661 Ga0157375_10000910 3300013308 Bacteria 25705
662 Ga0157375_10003117 3300013308 Bacteria 14392
663 Ga0157375_10011803 3300013308 Bacteria 7723
664 Ga0157375_10033928 3300013308 Bacteria 4856
665 Ga0157375_10040512 3300013308 Bacteria 4490
666 Ga0157375_10046217 3300013308 Bacteria 4243
667 Ga0157375_10052220 3300013308 Bacteria 4018
668 Ga0157375_10144618 3300013308 Bacteria 2508
669 Ga0157375_10365735 3300013308 Bacteria 1608
670 Ga0163163_10000477 3300014325 Bacteria 36351
671 Ga0163163_10000653 3300014325 Bacteria 29691
672 Ga0163163_10048819 3300014325 Bacteria 4163
673 Ga0163163_10052489 3300014325 Bacteria 4022
674 Ga0163163_10098082 3300014325 Bacteria 2952
675 Ga0163163_10260990 3300014325 Bacteria 1783
676 Ga0163163_10313114 3300014325 Bacteria 1623
677 Ga0163163_10341979 3300014325 Bacteria 1552
678 Ga0157380_10010112 3300014326 Bacteria 6777
679 Ga0157380_10019234 3300014326 Bacteria 5088
680 Ga0157380_10022125 3300014326 Bacteria 4779
681 Ga0157380_10076848 3300014326 Bacteria 2719
682 Ga0157380_10095552 3300014326 Bacteria 2462
683 Ga0157380_10269005 3300014326 Bacteria 1552
684 Ga0182008_10000006 3300014497 Bacteria 378521
685 Ga0182008_10000011 3300014497 Bacteria 297770
686 Ga0182008_10000818 3300014497 Bacteria 21712
687 Ga0182008_10001192 3300014497 Bacteria 17914
688 Ga0182008_10052173 3300014497 Bacteria 2028
689 Ga0182008_10060873 3300014497 Bacteria 1861
690 Ga0182008_10085277 3300014497 Bacteria 1556
691 Ga0182008_10088475 3300014497 Bacteria 1526
692 Ga0182008_10090629 3300014497 Bacteria 1507
693 Ga0157377_10004205 3300014745 Bacteria 6587
694 Ga0157377_10007108 3300014745 Bacteria 5384
695 Ga0157377_10055979 3300014745 Bacteria 2238
696 Ga0157379_10001640 3300014968 Bacteria 18479
697 Ga0157379_10002723 3300014968 Bacteria 14918
698 Ga0157379_10032061 3300014968 Bacteria 4682
699 Ga0157379_10043311 3300014968 Bacteria 4019
700 Ga0157379_10112740 3300014968 Bacteria 2444
701 Ga0157379_10262260 3300014968 Bacteria 1570
702 Ga0157376_10000721 3300014969 Bacteria 21396
703 Ga0157376_10001279 3300014969 Bacteria 16546
704 Ga0157376_10002407 3300014969 Bacteria 12640
705 Ga0157376_10004414 3300014969 Bacteria 9794
706 Ga0157376_10008360 3300014969 Bacteria 7464
707 Ga0157376_10062287 3300014969 Bacteria 3138
708 Ga0157376_10153139 3300014969 Bacteria 2081
709 Ga0157376_10173014 3300014969 Bacteria 1968
710 Ga0157376_10211479 3300014969 Bacteria 1791
711 Ga0182006_1000011 3300015261 Bacteria 408647
712 Ga0182006_1000068 3300015261 Bacteria 144823
713 Ga0182006_1000869 3300015261 Bacteria 20275
714 Ga0182006_1001629 3300015261 Bacteria 13261
715 Ga0182006_1002952 3300015261 Bacteria 8994
716 Ga0182006_1003367 3300015261 Bacteria 8215
717 Ga0182006_1029738 3300015261 Bacteria 2212
718 Ga0182006_1030063 3300015261 Bacteria 2198
719 Ga0182007_10000003 3300015262 Bacteria 548244
720 Ga0182007_10013574 3300015262 Bacteria 3101
721 Ga0182007_10017113 3300015262 Bacteria 2656
722 Ga0183373_1001 3300015682 Bacteria 1410374
723 Ga0163161_10000012 3300017792 Bacteria 264639
724 Ga0163161_10000074 3300017792 Bacteria 101784
725 Ga0163161_10002988 3300017792 Bacteria 11965
726 Ga0163161_10004613 3300017792 Bacteria 9590
727 Ga0163161_10005307 3300017792 Bacteria 8969
728 Ga0163161_10006285 3300017792 Bacteria 8224
729 Ga0163161_10015370 3300017792 Bacteria 5336
730 Ga0163161_10016813 3300017792 Bacteria 5115
731 Ga0163161_10024699 3300017792 Bacteria 4248
732 Ga0163161_10030157 3300017792 Bacteria 3857
733 Ga0163161_10033399 3300017792 Bacteria 3677
734 Ga0163161_10033761 3300017792 Bacteria 3656
735 Ga0163161_10044131 3300017792 Bacteria 3211
736 Ga0163161_10148063 3300017792 Bacteria 1782
737 Ga0197907_11483478 3300020069 Bacteria 1402
738 Ga0206353_11137735 3300020082 Bacteria 5000
739 Ga0206353_12030687 3300020082 Bacteria 1326
740 Ga0213872_10009314 3300021361 Bacteria 4715
741 Ga0213876_10001528 3300021384 Bacteria 14327
742 Ga0209674_100378 3300025226 Bacteria 23853
743 Ga0207427_100103 3300025231 Bacteria 119618
744 Ga0207427_100115 3300025231 Bacteria 104282
745 Ga0207427_100130 3300025231 Bacteria 94510
746 Ga0209437_100017 3300025233 Bacteria 694471
747 Ga0209437_100020 3300025233 Bacteria 656374
748 Ga0209437_100079 3300025233 Bacteria 275948
749 Ga0209437_100101 3300025233 Bacteria 226668
750 Ga0209258_100151 3300025242 Bacteria 160444
751 Ga0207425_1000002 3300025245 Bacteria 1362590
752 Ga0209646_1000002 3300025246 Bacteria 1425781
753 Ga0209646_1000745 3300025246 Bacteria 11381
754 Ga0209646_1001409 3300025246 Bacteria 6528
755 Ga0209026_1000105 3300025250 Bacteria 150738
756 Ga0209026_1000162 3300025250 Bacteria 102867
757 Ga0209026_1000434 3300025250 Bacteria 34861
758 Ga0209026_1007075 3300025250 Bacteria 2608
759 Ga0209148_1000154 3300025254 Bacteria 145214
760 Ga0209759_1004885 3300025256 Bacteria 4852
761 Ga0209759_1004887 3300025256 Bacteria 4852
762 Ga0209759_1009298 3300025256 Bacteria 2979
763 Ga0209129_1000002 3300025258 Bacteria 1359086
764 Ga0209129_1002458 3300025258 Bacteria 9072
765 Ga0209233_1000020 3300025261 Bacteria 798224
766 Ga0209233_1000121 3300025261 Bacteria 233309
767 Ga0209233_1000124 3300025261 Bacteria 226743
768 Ga0209455_1000560 3300025272 Bacteria 25084
769 Ga0209673_1000208 3300025273 Bacteria 117755
770 Ga0209673_1042251 3300025273 Bacteria 1284
771 Ga0209130_1005416 3300025284 Bacteria 4431
772 Ga0209675_1000033 3300025291 Bacteria 271576
773 Ga0209675_1003459 3300025291 Bacteria 7489
774 Ga0209676_1000008 3300025292 Bacteria 991778
775 Ga0209676_1000390 3300025292 Bacteria 80030
776 Ga0209676_1001110 3300025292 Bacteria 29893
777 Ga0209676_1002036 3300025292 Bacteria 15843
778 Ga0209676_1004629 3300025292 Bacteria 7572
779 Ga0209676_1007535 3300025292 Bacteria 5078
780 Ga0209025_1000004 3300025294 Bacteria 1361782
781 Ga0209025_1009272 3300025294 Bacteria 6891
782 Ga0209564_1006739 3300025295 Bacteria 6100
783 Ga0209564_1014033 3300025295 Bacteria 3359
784 Ga0209564_1014047 3300025295 Bacteria 3357
785 Ga0209758_1000006 3300025297 Bacteria 1359562
786 Ga0209758_1003065 3300025297 Bacteria 15894
787 Ga0209758_1020284 3300025297 Bacteria 3153
788 Ga0209050_1000045 3300025298 Bacteria 388022
789 Ga0209050_1000134 3300025298 Bacteria 184417
790 Ga0209256_1003208 3300025299 Bacteria 11815
791 Ga0209256_1028734 3300025299 Bacteria 1563
792 Ga0207426_1000002 3300025302 Bacteria 1249660
793 Ga0207426_1000051 3300025302 Bacteria 391700
794 Ga0207426_1000497 3300025302 Bacteria 58506
795 Ga0207426_1001981 3300025302 Bacteria 14539
796 Ga0207426_1006084 3300025302 Bacteria 5323
797 Ga0209257_1000001 3300025304 Bacteria 2274655
798 Ga0209257_1000006 3300025304 Bacteria 1570111
799 Ga0209257_1001605 3300025304 Bacteria 25882
800 Ga0209257_1003878 3300025304 Bacteria 12208
801 Ga0209257_1008310 3300025304 Bacteria 5948
802 Ga0207656_10007257 3300025321 Bacteria 4026
803 Ga0207656_10107870 3300025321 Bacteria 1284
804 Ga0207655_1000008 3300025728 Bacteria 734289
805 Ga0207655_1005122 3300025728 Bacteria 9034
806 Ga0207682_10010357 3300025893 Bacteria 3654
807 Ga0207682_10033618 3300025893 Bacteria 2065
808 Ga0207692_10028338 3300025898 Bacteria 2648
809 Ga0207642_10142856 3300025899 Bacteria 1264
810 Ga0207710_10002439 3300025900 Bacteria 8644
811 Ga0207710_10002748 3300025900 Bacteria 8047
812 Ga0207710_10008558 3300025900 Bacteria 4313
813 Ga0207688_10130719 3300025901 Bacteria 1472
814 Ga0207680_10000006 3300025903 Bacteria 635950
815 Ga0207680_10000162 3300025903 Bacteria 32782
816 Ga0207680_10023544 3300025903 Bacteria 3365
817 Ga0207680_10028103 3300025903 Bacteria 3142
818 Ga0207680_10039495 3300025903 Bacteria 2739
819 Ga0207680_10052159 3300025903 Bacteria 2449
820 Ga0207680_10208101 3300025903 Bacteria 1336
821 Ga0207647_10000105 3300025904 Bacteria 65502
822 Ga0207647_10000511 3300025904 Bacteria 30935
823 Ga0207647_10011313 3300025904 Bacteria 6265
824 Ga0207647_10018195 3300025904 Bacteria 4761
825 Ga0207647_10025074 3300025904 Bacteria 3925
826 Ga0207647_10027673 3300025904 Bacteria 3693
827 Ga0207647_10041070 3300025904 Bacteria 2910
828 Ga0207647_10080460 3300025904 Bacteria 1954
829 Ga0207645_10000622 3300025907 Bacteria 29378
830 Ga0207645_10001210 3300025907 Bacteria 21312
831 Ga0207645_10003591 3300025907 Bacteria 11736
832 Ga0207645_10004714 3300025907 Bacteria 10031
833 Ga0207643_10023368 3300025908 Bacteria 3408
834 Ga0207643_10104056 3300025908 Bacteria 1667
835 Ga0207643_10130808 3300025908 Bacteria 1493
836 Ga0207705_10000079 3300025909 Bacteria 119999
837 Ga0207705_10061750 3300025909 Bacteria 2707
838 Ga0207705_10090827 3300025909 Bacteria 2236
839 Ga0207705_10093493 3300025909 Bacteria 2204
840 Ga0207705_10125830 3300025909 Bacteria 1905
841 Ga0207654_10003772 3300025911 Bacteria 7635
842 Ga0207654_10005580 3300025911 Bacteria 6363
843 Ga0207654_10016294 3300025911 Bacteria 3868
844 Ga0207707_10000051 3300025912 Bacteria 117204
845 Ga0207707_10003389 3300025912 Bacteria 14147
846 Ga0207707_10038834 3300025912 Bacteria 4161
847 Ga0207707_10170685 3300025912 Bacteria 1901
848 Ga0207707_10283405 3300025912 Bacteria 1435
849 Ga0207695_10000013 3300025913 Bacteria 821265
850 Ga0207695_10000071 3300025913 Bacteria 315568
851 Ga0207695_10000084 3300025913 Bacteria 282392
852 Ga0207695_10000102 3300025913 Bacteria 257838
853 Ga0207695_10000323 3300025913 Bacteria 114265
854 Ga0207695_10001232 3300025913 Bacteria 43800
855 Ga0207695_10004447 3300025913 Bacteria 19105
856 Ga0207695_10004602 3300025913 Bacteria 18731
857 Ga0207695_10009118 3300025913 Bacteria 12316
858 Ga0207695_10015643 3300025913 Bacteria 8923
859 Ga0207695_10023061 3300025913 Bacteria 7045
860 Ga0207695_10026849 3300025913 Bacteria 6420
861 Ga0207695_10040999 3300025913 Bacteria 4957
862 Ga0207695_10047480 3300025913 Bacteria 4544
863 Ga0207695_10084921 3300025913 Bacteria 3195
864 Ga0207695_10094245 3300025913 Bacteria 3002
865 Ga0207695_10276714 3300025913 Unclassified 1573
866 Ga0207671_10000036 3300025914 Bacteria 236133
867 Ga0207671_10000272 3300025914 Bacteria 77080
868 Ga0207671_10000726 3300025914 Bacteria 41902
869 Ga0207671_10001497 3300025914 Bacteria 26937
870 Ga0207671_10002907 3300025914 Bacteria 17690
871 Ga0207671_10005889 3300025914 Bacteria 11125
872 Ga0207671_10008744 3300025914 Bacteria 8532
873 Ga0207671_10014622 3300025914 Bacteria 6192
874 Ga0207671_10021459 3300025914 Bacteria 4901
875 Ga0207671_10042678 3300025914 Bacteria 3356
876 Ga0207671_10119462 3300025914 Bacteria 2013
877 Ga0207671_10119489 3300025914 Bacteria 2013
878 Ga0207660_10044410 3300025917 Bacteria 3126
879 Ga0207660_10055888 3300025917 Bacteria 2823
880 Ga0207660_10249322 3300025917 Bacteria 1401
881 Ga0207662_10004762 3300025918 Bacteria 7171
882 Ga0207662_10016297 3300025918 Bacteria 4192
883 Ga0207657_10021748 3300025919 Bacteria 6027
884 Ga0207657_10031993 3300025919 Bacteria 4758
885 Ga0207657_10049273 3300025919 Bacteria 3672
886 Ga0207657_10049826 3300025919 Bacteria 3647
887 Ga0207657_10110330 3300025919 Bacteria 2272
888 Ga0207649_10023770 3300025920 Bacteria 3553
889 Ga0207649_10150443 3300025920 Bacteria 1603
890 Ga0207652_10000384 3300025921 Bacteria 46082
891 Ga0207652_10001696 3300025921 Bacteria 19285
892 Ga0207652_10061632 3300025921 Bacteria 3239
893 Ga0207681_10037670 3300025923 Bacteria 3198
894 Ga0207694_10003086 3300025924 Bacteria 13334
895 Ga0207694_10006130 3300025924 Bacteria 9187
896 Ga0207694_10007231 3300025924 Bacteria 8426
897 Ga0207694_10092271 3300025924 Bacteria 2390
898 Ga0207694_10097905 3300025924 Bacteria 2321
899 Ga0207650_10019073 3300025925 Bacteria 4820
900 Ga0207650_10042343 3300025925 Bacteria 3341
901 Ga0207650_10062339 3300025925 Bacteria 2786
902 Ga0207650_10066978 3300025925 Bacteria 2694
903 Ga0207650_10084184 3300025925 Bacteria 2417
904 Ga0207650_10173709 3300025925 Bacteria 1714
905 Ga0207659_10008155 3300025926 Bacteria 6484
906 Ga0207659_10053334 3300025926 Bacteria 2884
907 Ga0207687_10196626 3300025927 Bacteria 1573
908 Ga0207700_10003865 3300025928 Bacteria 8752
909 Ga0207664_10022981 3300025929 Bacteria 4666
910 Ga0207644_10002938 3300025931 Bacteria 10975
911 Ga0207644_10041897 3300025931 Bacteria 3241
912 Ga0207644_10075688 3300025931 Bacteria 2474
913 Ga0207690_10000314 3300025932 Bacteria 32801
914 Ga0207690_10000318 3300025932 Bacteria 32496
915 Ga0207690_10000797 3300025932 Bacteria 20327
916 Ga0207690_10008204 3300025932 Bacteria 6196
917 Ga0207690_10023288 3300025932 Bacteria 3864
918 Ga0207690_10052218 3300025932 Bacteria 2737
919 Ga0207690_10058473 3300025932 Bacteria 2608
920 Ga0207690_10076849 3300025932 Bacteria 2320
921 Ga0207690_10103318 3300025932 Bacteria 2039
922 Ga0207706_10000120 3300025933 Bacteria 84222
923 Ga0207706_10027522 3300025933 Bacteria 5083
924 Ga0207706_10029817 3300025933 Bacteria 4869
925 Ga0207706_10064116 3300025933 Bacteria 3235
926 Ga0207706_10083306 3300025933 Bacteria 2811
927 Ga0207706_10153267 3300025933 Bacteria 2027
928 Ga0207686_10000546 3300025934 Bacteria 24296
929 Ga0207686_10024502 3300025934 Bacteria 3498
930 Ga0207686_10093300 3300025934 Bacteria 1993
931 Ga0207686_10103114 3300025934 Unclassified 1908
932 Ga0207709_10000021 3300025935 Bacteria 386722
933 Ga0207709_10001686 3300025935 Bacteria 14848
934 Ga0207670_10080132 3300025936 Bacteria 2281
935 Ga0207704_10000099 3300025938 Bacteria 48088
936 Ga0207691_10002527 3300025940 Bacteria 17886
937 Ga0207691_10004310 3300025940 Bacteria 13818
938 Ga0207691_10027226 3300025940 Bacteria 5363
939 Ga0207691_10172503 3300025940 Bacteria 1893
940 Ga0207691_10230027 3300025940 Bacteria 1606
941 Ga0207689_10008841 3300025942 Bacteria 8746
942 Ga0207689_10009849 3300025942 Bacteria 8237
943 Ga0207689_10017703 3300025942 Bacteria 6022
944 Ga0207689_10022258 3300025942 Bacteria 5329
945 Ga0207689_10025477 3300025942 Bacteria 4956
946 Ga0207689_10066990 3300025942 Bacteria 2951
947 Ga0207689_10085796 3300025942 Bacteria 2588
948 Ga0207689_10100672 3300025942 Bacteria 2374
949 Ga0207689_10169592 3300025942 Bacteria 1799
950 Ga0207661_10027722 3300025944 Bacteria 4330
951 Ga0207679_10007258 3300025945 Bacteria 7021
952 Ga0207679_10011633 3300025945 Bacteria 5711
953 Ga0207679_10025004 3300025945 Bacteria 4102
954 Ga0207679_10036528 3300025945 Bacteria 3485
955 Ga0207679_10070427 3300025945 Bacteria 2635
956 Ga0207667_10000037 3300025949 Bacteria 297252
957 Ga0207667_10000177 3300025949 Bacteria 92852
958 Ga0207667_10007957 3300025949 Bacteria 12648
959 Ga0207667_10011669 3300025949 Bacteria 10195
960 Ga0207667_10015290 3300025949 Bacteria 8725
961 Ga0207667_10017914 3300025949 Bacteria 7961
962 Ga0207667_10028059 3300025949 Bacteria 6116
963 Ga0207667_10028127 3300025949 Bacteria 6107
964 Ga0207667_10038231 3300025949 Bacteria 5127
965 Ga0207667_10048612 3300025949 Bacteria 4485
966 Ga0207667_10064211 3300025949 Bacteria 3834
967 Ga0207667_10066061 3300025949 Bacteria 3771
968 Ga0207667_10144396 3300025949 Bacteria 2450
969 Ga0207667_10195765 3300025949 Bacteria 2074
970 Ga0207667_10223392 3300025949 Bacteria 1930
971 Ga0207667_10224780 3300025949 Bacteria 1923
972 Ga0207651_10001099 3300025960 Bacteria 12009
973 Ga0207651_10005116 3300025960 Bacteria 6696
974 Ga0207651_10021365 3300025960 Bacteria 3933
975 Ga0207651_10037220 3300025960 Bacteria 3186
976 Ga0207712_10002040 3300025961 Bacteria 13248
977 Ga0207712_10002656 3300025961 Bacteria 11439
978 Ga0207712_10004495 3300025961 Bacteria 8810
979 Ga0207712_10005109 3300025961 Bacteria 8305
980 Ga0207712_10007103 3300025961 Bacteria 7062
981 Ga0207712_10016647 3300025961 Bacteria 4766
982 Ga0207712_10037202 3300025961 Bacteria 3319
983 Ga0207668_10135219 3300025972 Bacteria 1888
984 Ga0207668_10165388 3300025972 Bacteria 1729
985 Ga0207640_10014412 3300025981 Bacteria 4553
986 Ga0207640_10043616 3300025981 Bacteria 2868
987 Ga0207640_10088672 3300025981 Bacteria 2136
988 Ga0207640_10300155 3300025981 Bacteria 1270
989 Ga0207658_10007260 3300025986 Bacteria 7555
990 Ga0207658_10024494 3300025986 Bacteria 4224
991 Ga0207658_10079172 3300025986 Bacteria 2513
992 Ga0207658_10105398 3300025986 Bacteria 2217
993 Ga0207658_10156711 3300025986 Bacteria 1862
994 Ga0207658_10249189 3300025986 Bacteria 1508
995 Ga0207658_10327430 3300025986 Bacteria 1328
996 Ga0207677_10014691 3300026023 Bacteria 4581
997 Ga0207677_10085142 3300026023 Bacteria 2281
998 Ga0207677_10159092 3300026023 Bacteria 1753
999 Ga0207703_10004370 3300026035 Bacteria 11617
1000 Ga0207703_10102381 3300026035 Bacteria 2430
1001 Ga0207703_10158557 3300026035 Bacteria 1980
1002 Ga0207639_10001126 3300026041 Bacteria 18166
1003 Ga0207639_10015924 3300026041 Bacteria 5309
1004 Ga0207639_10022108 3300026041 Bacteria 4578
1005 Ga0207639_10047659 3300026041 Bacteria 3240
1006 Ga0207639_10065475 3300026041 Bacteria 2821
1007 Ga0207639_10151182 3300026041 Bacteria 1944
1008 Ga0207639_10242079 3300026041 Bacteria 1569
1009 Ga0207639_10292829 3300026041 Bacteria 1436
1010 Ga0207678_10009382 3300026067 Bacteria 8612
1011 Ga0207678_10038074 3300026067 Bacteria 4181
1012 Ga0207678_10124809 3300026067 Bacteria 2196
1013 Ga0207702_10000196 3300026078 Bacteria 71703
1014 Ga0207702_10005976 3300026078 Bacteria 10568
1015 Ga0207702_10009327 3300026078 Bacteria 8244
1016 Ga0207702_10032297 3300026078 Bacteria 4368
1017 Ga0207702_10042660 3300026078 Bacteria 3806
1018 Ga0207702_10057179 3300026078 Bacteria 3315
1019 Ga0207702_10105221 3300026078 Bacteria 2499
1020 Ga0207702_10107011 3300026078 Bacteria 2479
1021 Ga0207702_10206373 3300026078 Bacteria 1824
1022 Ga0207702_10251550 3300026078 Bacteria 1660
1023 Ga0207641_10000226 3300026088 Bacteria 72539
1024 Ga0207641_10000253 3300026088 Bacteria 67848
1025 Ga0207641_10043904 3300026088 Bacteria 3757
1026 Ga0207641_10196855 3300026088 Bacteria 1855
1027 Ga0207648_10002506 3300026089 Bacteria 19710
1028 Ga0207648_10003327 3300026089 Bacteria 16884
1029 Ga0207648_10004019 3300026089 Bacteria 15269
1030 Ga0207648_10018210 3300026089 Bacteria 6362
1031 Ga0207648_10021796 3300026089 Bacteria 5756
1032 Ga0207648_10034323 3300026089 Bacteria 4472
1033 Ga0207648_10060760 3300026089 Bacteria 3295
1034 Ga0207648_10104599 3300026089 Bacteria 2483
1035 Ga0207676_10009837 3300026095 Bacteria 6802
1036 Ga0207676_10045351 3300026095 Bacteria 3396
1037 Ga0207676_10063266 3300026095 Bacteria 2938
1038 Ga0207676_10120226 3300026095 Bacteria 2214
1039 Ga0207676_10159764 3300026095 Bacteria 1951
1040 Ga0207676_10224103 3300026095 Unclassified 1676
1041 Ga0207674_10000672 3300026116 Bacteria 44419
1042 Ga0207674_10006740 3300026116 Bacteria 13484
1043 Ga0207674_10017537 3300026116 Bacteria 7811
1044 Ga0207674_10021327 3300026116 Bacteria 6980
1045 Ga0207674_10047238 3300026116 Bacteria 4415
1046 Ga0207674_10048707 3300026116 Bacteria 4336
1047 Ga0207674_10054469 3300026116 Bacteria 4072
1048 Ga0207674_10054880 3300026116 Bacteria 4054
1049 Ga0207674_10084731 3300026116 Bacteria 3166
1050 Ga0207674_10103679 3300026116 Bacteria 2823
1051 Ga0207674_10106119 3300026116 Bacteria 2787
1052 Ga0207674_10110348 3300026116 Bacteria 2726
1053 Ga0207674_10136063 3300026116 Unclassified 2419
1054 Ga0207674_10264485 3300026116 Bacteria 1668
1055 Ga0207675_100000304 3300026118 Bacteria 47181
1056 Ga0207675_100014435 3300026118 Bacteria 7364
1057 Ga0207675_100048449 3300026118 Bacteria 3966
1058 Ga0207675_100080172 3300026118 Bacteria 3060
1059 Ga0207675_100083807 3300026118 Bacteria 2990
1060 Ga0207683_10003712 3300026121 Bacteria 13255
1061 Ga0207683_10005010 3300026121 Bacteria 11378
1062 Ga0207683_10250288 3300026121 Bacteria 1617
1063 Ga0207698_10001082 3300026142 Bacteria 15843
1064 Ga0207698_10002060 3300026142 Bacteria 11858
1065 Ga0207698_10004520 3300026142 Bacteria 8484
1066 Ga0207698_10056964 3300026142 Bacteria 3020
1067 Ga0207698_10174689 3300026142 Bacteria 1896
1068 Ga0209281_1000094 3300027111 Bacteria 238155
1069 Ga0209995_1001337 3300027471 Bacteria 3795
1070 Ga0209968_1002355 3300027526 Bacteria 2857
1071 Ga0210002_1001420 3300027617 Bacteria 3370
1072 Ga0209974_10017789 3300027876 Bacteria 2356
1073 Ga0207428_10179661 3300027907 Bacteria 1599
1074 Ga0268266_10000018 3300028379 Bacteria 569141
1075 Ga0268266_10000021 3300028379 Bacteria 522453
1076 Ga0268266_10000049 3300028379 Bacteria 307763
1077 Ga0268266_10071433 3300028379 Bacteria 3008
1078 Ga0268265_10014622 3300028380 Bacteria 5351
1079 Ga0268265_10019901 3300028380 Bacteria 4675
1080 Ga0268265_10138654 3300028380 Bacteria 2033
1081 Ga0268265_10235540 3300028380 Bacteria 1612
1082 Ga0268264_10000041 3300028381 Bacteria 372501
1083 Ga0268264_10001720 3300028381 Bacteria 20153
1084 Ga0268264_10003107 3300028381 Bacteria 14381
1085 Ga0268264_10003860 3300028381 Bacteria 12861
1086 Ga0268264_10009362 3300028381 Bacteria 8107
1087 Ga0268264_10011235 3300028381 Bacteria 7398
1088 Ga0268264_10014882 3300028381 Bacteria 6389
1089 Ga0268264_10022519 3300028381 Bacteria 5143
1090 Ga0268264_10054823 3300028381 Bacteria 3330
1091 Ga0268264_10066048 3300028381 Bacteria 3050
1092 Ga0268264_10166098 3300028381 Bacteria 1992
1093 Ga0268264_10274850 3300028381 Bacteria 1575
1094 Ga0265334_10005205 3300028573 Bacteria 5701
1095 Ga0265323_10000381 3300028653 Bacteria 25539
1096 Ga0307517_10002048 3300028786 Bacteria 32795
1097 Ga0307517_10004683 3300028786 Bacteria 20955
1098 Ga0307515_10000001 3300028794 Bacteria 4259510
1099 Ga0307515_10001752 3300028794 Bacteria 48338
1100 Ga0307515_10002910 3300028794 Bacteria 36374
1101 Ga0307515_10014453 3300028794 Bacteria 14631
1102 Ga0307515_10086237 3300028794 Bacteria 4005
1103 Ga0265338_10000471 3300028800 Bacteria 71881
1104 Ga0265338_10138998 3300028800 Bacteria 1905
1105 Ga0307511_10000042 3300030521 Bacteria 102114
1106 Ga0316177_1198244 3300030731 Bacteria 7343
1107 Ga0316176_1050137 3300030732 Bacteria 14004
1108 Ga0314311_1025340 3300030733 Bacteria 9144
1109 Ga0316183_1065995 3300030742 Bacteria 27909
1110 Ga0316181_1148726 3300030744 Bacteria 7875
1111 Ga0265327_10000010 3300031251 Bacteria 566817
1112 Ga0265327_10000192 3300031251 Bacteria 129439
1113 Ga0265327_10000653 3300031251 Bacteria 55957
1114 Ga0265327_10000972 3300031251 Bacteria 40973
1115 Ga0265316_10000618 3300031344 Bacteria 39590
1116 Ga0265316_10028488 3300031344 Bacteria 4608
1117 Ga0307509_10026381 3300031507 Bacteria 6479
1118 Ga0307509_10105279 3300031507 Bacteria 2843
1119 Ga0307408_100000121 3300031548 Bacteria 85849
1120 Ga0307408_100000611 3300031548 Bacteria 30550
1121 Ga0307408_100000660 3300031548 Bacteria 28737
1122 Ga0307408_100001373 3300031548 Bacteria 18154
1123 Ga0307408_100002250 3300031548 Bacteria 13771
1124 Ga0307408_100129664 3300031548 Unclassified 1966
1125 Ga0307408_100160155 3300031548 Bacteria 1787
1126 Ga0307508_10002100 3300031616 Bacteria 21430
1127 Ga0316575_10070219 3300031665 Bacteria 1407
1128 Ga0265342_10123102 3300031712 Bacteria 1459
1129 Ga0316576_10008094 3300031727 Bacteria 6672
1130 Ga0316576_10075969 3300031727 Bacteria 2485
1131 Ga0316578_10044042 3300031728 Unclassified 2594
1132 Ga0316578_10162598 3300031728 Bacteria 1346
1133 Ga0307516_10003117 3300031730 Bacteria 21573
1134 Ga0307405_10000003 3300031731 Bacteria 569064
1135 Ga0307405_10156175 3300031731 Bacteria 1610
1136 Ga0316577_10004430 3300031733 Bacteria 7246
1137 Ga0316577_10026440 3300031733 Bacteria 3233
1138 Ga0307413_10001112 3300031824 Bacteria 9834
1139 Ga0307413_10185404 3300031824 Bacteria 1488
1140 Ga0307410_10000067 3300031852 Bacteria 37092
1141 Ga0307410_10001320 3300031852 Bacteria 11079
1142 Ga0307410_10003139 3300031852 Bacteria 8213
1143 Ga0307406_10000035 3300031901 Bacteria 82953
1144 Ga0307406_10008639 3300031901 Bacteria 5692
1145 Ga0307406_10083253 3300031901 Bacteria 2133
1146 Ga0307406_10147620 3300031901 Bacteria 1673
1147 Ga0307407_10000008 3300031903 Bacteria 191228
1148 Ga0307407_10004708 3300031903 Bacteria 5831
1149 Ga0307407_10048190 3300031903 Bacteria 2423
1150 Ga0307412_10000012 3300031911 Bacteria 404180
1151 Ga0307412_10000427 3300031911 Bacteria 25500
1152 Ga0307412_10001456 3300031911 Bacteria 13169
1153 Ga0307412_10031631 3300031911 Bacteria 3344
1154 Ga0307409_100006323 3300031995 Bacteria 6943
1155 Ga0307409_100008566 3300031995 Bacteria 6218
1156 Ga0307409_100063317 3300031995 Bacteria 2900
1157 Ga0307416_100000009 3300032002 Bacteria 374271
1158 Ga0307416_100000010 3300032002 Bacteria 320243
1159 Ga0307416_100000639 3300032002 Bacteria 18075
1160 Ga0307416_100063210 3300032002 Bacteria 3030
1161 Ga0307414_10000009 3300032004 Bacteria 359782
1162 Ga0307414_10000038 3300032004 Bacteria 150774
1163 Ga0307414_10000063 3300032004 Bacteria 107710
1164 Ga0307414_10002879 3300032004 Bacteria 9086
1165 Ga0307414_10004631 3300032004 Bacteria 7486
1166 Ga0307414_10008231 3300032004 Bacteria 5899
1167 Ga0307414_10010064 3300032004 Bacteria 5464
1168 Ga0307414_10014324 3300032004 Bacteria 4751
1169 Ga0307414_10033966 3300032004 Bacteria 3376
1170 Ga0307414_10086212 3300032004 Bacteria 2316
1171 Ga0307414_10131628 3300032004 Bacteria 1943
1172 Ga0307414_10207829 3300032004 Bacteria 1597
1173 Ga0307411_10000001 3300032005 Bacteria 931810
1174 Ga0307411_10003236 3300032005 Bacteria 7504
1175 Ga0307411_10108067 3300032005 Bacteria 1984
1176 Ga0307415_100012792 3300032126 Bacteria 4868
1177 Ga0307415_100050534 3300032126 Unclassified 2818
1178 Ga0316580_10014554 3300032139 Bacteria 2402
1179 Ga0307507_10000064 3300033179 Bacteria 161226
1180 Ga0307507_10110315 3300033179 Bacteria 2252
1181 Ga0307510_10002860 3300033180 Bacteria 19841
1182 Ga0307510_10006943 3300033180 Bacteria 13500
1183 Ga0307510_10041880 3300033180 Bacteria 4999
1184 Ga0373941_0013117 3300035115 Bacteria 2184
1185 Ga0316574_0101490 3300035398 Bacteria 1842
1186 Ga0373927_0005849 3300035695 Bacteria 8433
1187 Ga0373947_0056584 3300035725 Bacteria 2371
1188 Ga0373937_0078419 3300036401 Bacteria 3053
1189 Ga0373937_0287874 3300036401 Bacteria 1552
1190 Ga0316582_0015711 3300036647 Bacteria 4340
1191 Ga0316582_0120513 3300036647 Unclassified 1755
1192 Ga0316584_0004574 3300036712 Bacteria 9170
1193 Ga0316584_0004745 3300036712 Bacteria 9012
1194 Ga0316584_0294557 3300036712 Unclassified 1176
1195 Ga0395899_0000025 3300037312 Bacteria 350927
1196 Ga0395899_0000033 3300037312 Bacteria 306589
1197 Ga0395899_0000493 3300037312 Bacteria 44066
1198 Ga0395899_0000629 3300037312 Bacteria 36706
1199 Ga0395899_0001884 3300037312 Bacteria 17312
1200 Ga0395899_0029186 3300037312 Bacteria 4149
1201 Ga0395899_0041383 3300037312 Bacteria 3443
1202 Ga0395899_0066951 3300037312 Bacteria 2636
1203 Ga0395899_0126590 3300037312 Bacteria 1826
1204 Ga0395900_0000480 3300037418 Bacteria 56578
1205 Ga0395900_0000506 3300037418 Bacteria 54890
1206 Ga0395900_0006601 3300037418 Bacteria 12073
1207 Ga0395900_0009920 3300037418 Bacteria 9750
1208 Ga0395900_0012177 3300037418 Bacteria 8793
1209 Ga0395900_0108003 3300037418 Bacteria 2859
1210 Ga0395900_0194491 3300037418 Bacteria 2055
1211 Ga0395898_0001651 3300037466 Bacteria 30118
1212 Ga0395898_0006652 3300037466 Bacteria 12328
1213 Ga0395898_0021259 3300037466 Bacteria 6581
1214 Ga0395898_0031717 3300037466 Bacteria 5277
1215 Ga0395898_0032624 3300037466 Bacteria 5199
1216 Ga0395898_0056108 3300037466 Bacteria 3841
1217 Ga0395898_0058562 3300037466 Bacteria 3750
1218 Ga0395898_0095872 3300037466 Bacteria 2850
1219 Ga0395898_0097172 3300037466 Bacteria 2829
1220 Ga0395905_0000254 3300037471 Bacteria 79953
1221 Ga0395905_0000738 3300037471 Bacteria 43061
1222 Ga0395905_0001166 3300037471 Bacteria 32800
1223 Ga0395905_0006569 3300037471 Bacteria 11683
1224 Ga0395905_0064234 3300037471 Bacteria 3435
1225 Ga0395901_0000853 3300038443 Bacteria 33521
1226 Ga0395901_0004350 3300038443 Bacteria 14289
1227 Ga0395901_0010578 3300038443 Bacteria 9348
1228 Ga0395901_0013263 3300038443 Bacteria 8369
1229 Ga0395901_0041573 3300038443 Bacteria 4765
1230 Ga0395901_0059253 3300038443 Bacteria 3983
1231 Ga0395901_0119295 3300038443 Bacteria 2772
1232 Ga0395901_0293579 3300038443 Bacteria 1686
1233 Ga0400491_13685 3300038727 Bacteria 1556
1234 Ga0400488_26420 3300038741 Bacteria 1348
1235 Ga0400483_075612 3300039062 Bacteria 31325
1236 Ga0400483_151915 3300039062 Bacteria 21081
1237 Ga0436365_0688175 3300039437 Bacteria 1274
1238 Ga0436365_1079918 3300039437 Bacteria 37760
1239 Ga0436361_0021149 3300039447 Bacteria 8615
1240 Ga0439436_0033356 3300041404 Bacteria 1491
1241 Ga0439439_0011270 3300041406 Bacteria 2150
1242 Ga0439466_0001850 3300041411 Bacteria 8310
1243 Ga0439431_0010163 3300041997 Bacteria 2133
1244 Ga0439442_001916 3300042002 Bacteria 4086
1245 Ga0439445_0005056 3300042004 Bacteria 2995
1246 Ga0439449_0047197 3300042007 Bacteria 1595
1247 Ga0439457_003825 3300042014 Bacteria 4037
1248 Ga0439462_0005205 3300042015 Bacteria 3198
1249 Ga0450898_003860 3300042134 Bacteria 2180
1250 Ga0439459_0002997 3300042438 Bacteria 2649
1251 Ga0451577_0001046 3300042876 Bacteria 40002
1252 Ga0451577_0002168 3300042876 Bacteria 23990
1253 Ga0451577_0005746 3300042876 Bacteria 12578
1254 Ga0451577_0044094 3300042876 Bacteria 3993
1255 Ga0451577_0092006 3300042876 Bacteria 2708
1256 Ga0451577_0119738 3300042876 Bacteria 2358
1257 Ga0451577_0173668 3300042876 Bacteria 1942
1258 Ga0466969_0000912 3300044656 Bacteria 15928
1259 Ga0466972_0000002 3300044658 Bacteria 408005
1260 Ga0466972_0000013 3300044658 Bacteria 229345
1261 Ga0466972_0036255 3300044658 Bacteria 2413
1262 Ga0466982_0000020 3300044672 Bacteria 99164
1263 Ga0453683_0000594 3300044673 Bacteria 40002
1264 Ga0453683_0001699 3300044673 Bacteria 18345
1265 Ga0453683_0048234 3300044673 Bacteria 2671
1266 Ga0466965_0031585 3300044683 Bacteria 2583
1267 Ga0466966_0000045 3300044684 Bacteria 92504
1268 Ga0466966_0008999 3300044684 Bacteria 6617
1269 Ga0466966_0053935 3300044684 Bacteria 2549
1270 Ga0466961_0033719 3300044693 Bacteria 3289
1271 Ga0466964_0060823 3300044706 Bacteria 1571
1272 Ga0453684_0000165 3300044712 Bacteria 294572
1273 Ga0453684_0000432 3300044712 Bacteria 170746
1274 Ga0453684_0000889 3300044712 Bacteria 99678
1275 Ga0453684_0001834 3300044712 Bacteria 55525
1276 Ga0453684_0002066 3300044712 Bacteria 51033
1277 Ga0453684_0002932 3300044712 Bacteria 40002
1278 Ga0453684_0003998 3300044712 Bacteria 32179
1279 Ga0453684_0004204 3300044712 Bacteria 30947
1280 Ga0453684_0006105 3300044712 Bacteria 23232
1281 Ga0453684_0007145 3300044712 Bacteria 20778
1282 Ga0453684_0009766 3300044712 Bacteria 16663
1283 Ga0453684_0017983 3300044712 Bacteria 10888
1284 Ga0453684_0027844 3300044712 Bacteria 8087
1285 Ga0453684_0027912 3300044712 Bacteria 8075
1286 Ga0453684_0032909 3300044712 Bacteria 7239
1287 Ga0453684_0048440 3300044712 Bacteria 5620
1288 Ga0453684_0071008 3300044712 Bacteria 4405
1289 Ga0453684_0097891 3300044712 Bacteria 3599
1290 Ga0453684_0110447 3300044712 Bacteria 3342
1291 Ga0453684_0114624 3300044712 Bacteria 3267
1292 Ga0453684_0354844 3300044712 Bacteria 1652
1293 Ga0453684_0508637 3300044712 Bacteria 1332
1294 Ga0466971_0011181 3300044719 Bacteria 3932
1295 Ga0466968_0012998 3300044735 Bacteria 3267
1296 Ga0466968_0016306 3300044735 Bacteria 2956
1297 Ga0466968_0038964 3300044735 Bacteria 1999
1298 Ga0466970_0000765 3300044765 Bacteria 15584
1299 Ga0466970_0024226 3300044765 Bacteria 3173
1300 Ga0466970_0045474 3300044765 Bacteria 2338
1301 Ga0466970_0057555 3300044765 Bacteria 2079
1302 Ga0466957_0000070 3300044842 Bacteria 39824
1303 Ga0466957_0003333 3300044842 Bacteria 8805
1304 Ga0466959_0000023 3300045049 Bacteria 124545
1305 Ga0466959_0004264 3300045049 Bacteria 9538
1306 Ga0466959_0099272 3300045049 Bacteria 2085
1307 Ga0466959_0216616 3300045049 Bacteria 1329
1308 Ga0451576_0000003 3300045051 Bacteria 1550573
1309 Ga0451576_0000113 3300045051 Bacteria 208644
1310 Ga0451576_0001464 3300045051 Bacteria 40002
1311 Ga0451576_0007020 3300045051 Bacteria 13616
1312 Ga0451576_0007064 3300045051 Bacteria 13567
1313 Ga0451576_0010902 3300045051 Bacteria 10390
1314 Ga0451576_0023244 3300045051 Bacteria 6714
1315 Ga0451576_0085698 3300045051 Bacteria 3277
1316 Ga0451576_0100688 3300045051 Bacteria 3005
1317 Ga0451576_0182787 3300045051 Bacteria 2189
1318 Ga0451576_0384349 3300045051 Bacteria 1471
1319 Ga0466958_0016632 3300045836 Bacteria 4239
1320 Ga0495627_000003 3300046453 Bacteria 704557
1321 Ga0495590_0003121 3300046457 Bacteria 6775
1322 Ga0495638_0020976 3300046460 Bacteria 4313
1323 Ga0495653_0134127 3300046463 Bacteria 1749
1324 Ga0495650_0000087 3300046471 Bacteria 234870
1325 Ga0495650_0001052 3300046471 Bacteria 30673
1326 Ga0495650_0012544 3300046471 Bacteria 4552
1327 Ga0495580_0176230 3300046472 Bacteria 1477
1328 Ga0495585_0000286 3300046492 Bacteria 50524
1329 Ga0495585_0001651 3300046492 Bacteria 17060
1330 Ga0495596_0000878 3300046500 Bacteria 18129
1331 Ga0495607_0040258 3300046501 Bacteria 2784
1332 Ga0495606_0000052 3300046507 Bacteria 201529
1333 Ga0495606_0002637 3300046507 Bacteria 20464
1334 Ga0495606_0014847 3300046507 Bacteria 6048
1335 Ga0495606_0053437 3300046507 Bacteria 2621
1336 Ga0495606_0131942 3300046507 Bacteria 1484
1337 Ga0495608_0247946 3300046511 Bacteria 1111
1338 Ga0495610_0000001 3300046512 Bacteria 1620061
1339 Ga0495610_0000903 3300046512 Bacteria 27607
1340 Ga0495610_0006770 3300046512 Bacteria 7778
1341 Ga0495610_0010020 3300046512 Bacteria 5922
1342 Ga0495616_0005196 3300046513 Bacteria 8053
1343 Ga0495616_0045190 3300046513 Bacteria 2231
1344 Ga0495628_0046274 3300046516 Bacteria 3456
1345 Ga0495630_0023979 3300046517 Bacteria 4512
1346 Ga0495631_0061416 3300046518 Bacteria 1630
1347 Ga0495632_0000032 3300046519 Bacteria 164561
1348 Ga0495643_0049195 3300046522 Bacteria 2275
1349 Ga0495648_0003874 3300046524 Bacteria 12979
1350 Ga0495648_0009989 3300046524 Bacteria 7280
1351 Ga0495652_0150381 3300046529 Bacteria 1820
1352 Ga0495652_0183721 3300046529 Bacteria 1602
1353 Ga0495654_0000001 3300046530 Bacteria 1513197
1354 Ga0495587_0011934 3300046536 Bacteria 5492
1355 Ga0495609_0000134 3300046538 Bacteria 79757
1356 Ga0495609_0012533 3300046538 Bacteria 4022
1357 Ga0495621_0020509 3300046539 Bacteria 2170
1358 Ga0495633_0000008 3300046558 Bacteria 301830
1359 Ga0495633_0000080 3300046558 Bacteria 127703
1360 Ga0495633_0000081 3300046558 Bacteria 125903
1361 Ga0495633_0004351 3300046558 Bacteria 9044
1362 Ga0495656_0039957 3300046615 Bacteria 1952
1363 Ga0495668_0000012 3300046616 Bacteria 458817
1364 Ga0495668_0000292 3300046616 Bacteria 68757
1365 Ga0495668_0000592 3300046616 Bacteria 44008
1366 Ga0495668_0000751 3300046616 Bacteria 38311
1367 Ga0495611_0001116 3300046648 Bacteria 14130
1368 Ga0495625_0000036 3300046660 Bacteria 221680
1369 Ga0495625_0000781 3300046660 Bacteria 44239
1370 Ga0495625_0002289 3300046660 Bacteria 20991
1371 Ga0495625_0010136 3300046660 Bacteria 7829
1372 Ga0495625_0014574 3300046660 Bacteria 6267
1373 Ga0495625_0115965 3300046660 Bacteria 1827
1374 Ga0495661_0003611 3300046665 Bacteria 11391
1375 Ga0495661_0015900 3300046665 Bacteria 5009
1376 Ga0495661_0054910 3300046665 Bacteria 2390
1377 Ga0495657_0093194 3300046675 Bacteria 1929
1378 Ga0495658_0027377 3300046683 Bacteria 3067
1379 Ga0495658_0068601 3300046683 Bacteria 2054
1380 Ga0495670_0033633 3300046691 Bacteria 2551
1381 Ga0495670_0091140 3300046691 Bacteria 1560
1382 Ga0495649_0000017 3300046694 Bacteria 221685
1383 Ga0495649_0014914 3300046694 Bacteria 4441
1384 Ga0495649_0135922 3300046694 Bacteria 1296
1385 Ga0495660_0013731 3300046810 Bacteria 4694
1386 Ga0495636_0014693 3300047318 Bacteria 3115
1387 Ga0495674_0225205 3300047319 Bacteria 1549
1388 Ga0495672_0002824 3300047320 Bacteria 15467
1389 Ga0495672_0012654 3300047320 Bacteria 5872
1390 Ga0495672_0030914 3300047320 Bacteria 3350
1391 Ga0495687_000001 3300047443 Bacteria 1215582
1392 Ga0495687_001156 3300047443 Bacteria 25557
1393 Ga0495687_004759 3300047443 Bacteria 8973
1394 Ga0495673_0000010 3300047469 Bacteria 709599
1395 Ga0495684_0059523 3300047471 Bacteria 2909
1396 Ga0495686_0000004 3300047472 Bacteria 869019
1397 Ga0495686_0000118 3300047472 Bacteria 165897
1398 Ga0495686_0000582 3300047472 Bacteria 51799
1399 Ga0495686_0000884 3300047472 Bacteria 38050
1400 Ga0495686_0020028 3300047472 Bacteria 4464
1401 Ga0495686_0028549 3300047472 Bacteria 3633
1402 Ga0495686_0079786 3300047472 Bacteria 2001
1403 Ga0495614_0015805 3300048089 Bacteria 3287
1404 Ga0496100_0035115 3300048903 Bacteria 3152
1405 Ga0496102_0049516 3300048905 Bacteria 3823
1406 Ga0496104_0317799 3300048907 Bacteria 1470
1407 Ga0496108_0142405 3300048911 Bacteria 2066
1408 Ga0496109_0165330 3300048912 Bacteria 2074
1409 Ga0496114_0000594 3300048917 Bacteria 26726
1410 Ga0496114_0091226 3300048917 Bacteria 2588
1411 Ga0496115_0045415 3300048918 Bacteria 3507
1412 Ga0496116_0000053 3300048919 Bacteria 291837
1413 Ga0496116_0001728 3300048919 Bacteria 23852
1414 Ga0496117_0000050 3300048920 Bacteria 292727
1415 Ga0496117_0003269 3300048920 Bacteria 19047
1416 Ga0496118_0000044 3300048921 Bacteria 283524
1417 Ga0496118_0065557 3300048921 Bacteria 2657
1418 Ga0496119_0000002 3300048922 Bacteria 738385
1419 Ga0496121_0000030 3300048924 Bacteria 412079
1420 Ga0496121_0021002 3300048924 Bacteria 6424
1421 Ga0496121_0150208 3300048924 Bacteria 1715
1422 Ga0496122_0000188 3300048925 Bacteria 143808
1423 Ga0496122_0000191 3300048925 Bacteria 140173
1424 Ga0496122_0000538 3300048925 Bacteria 78492
1425 Ga0496122_0000769 3300048925 Bacteria 61918
1426 Ga0496122_0001208 3300048925 Bacteria 43998
1427 Ga0496122_0006115 3300048925 Bacteria 14014
1428 Ga0496123_0000636 3300048926 Bacteria 58636
1429 Ga0496123_0003634 3300048926 Bacteria 17066
1430 Ga0496123_0003787 3300048926 Bacteria 16562
1431 Ga0496123_0005816 3300048926 Bacteria 12234
1432 Ga0496123_0008537 3300048926 Bacteria 9392
1433 Ga0496124_0001056 3300048927 Bacteria 43505
1434 Ga0496124_0096704 3300048927 Bacteria 2398
1435 Ga0496124_0099531 3300048927 Bacteria 2358
1436 Ga0496124_0112931 3300048927 Bacteria 2184
1437 Ga0496125_0000059 3300048928 Bacteria 264149
1438 Ga0496125_0000310 3300048928 Bacteria 95700
1439 Ga0496125_0000623 3300048928 Bacteria 59478
1440 Ga0496125_0007782 3300048928 Bacteria 11336
1441 Ga0496125_0008192 3300048928 Bacteria 10999
1442 Ga0496125_0036412 3300048928 Bacteria 4298
1443 Ga0496125_0043748 3300048928 Bacteria 3796
1444 Ga0496126_0000660 3300048929 Bacteria 63892
1445 Ga0496126_0008790 3300048929 Bacteria 10843
1446 Ga0496126_0022457 3300048929 Bacteria 6139
1447 Ga0501031_0003605 3300049568 Bacteria 9955
1448 Ga0501032_0030825 3300049569 Bacteria 3679
1449 Ga0501033_0001868 3300049570 Bacteria 18315
1450 Ga0501033_0010675 3300049570 Bacteria 7038
1451 Ga0501034_0000083 3300049571 Bacteria 169656
1452 Ga0501034_0004012 3300049571 Bacteria 16517
1453 Ga0501034_0016530 3300049571 Bacteria 7567
1454 Ga0501034_0018957 3300049571 Bacteria 7050
1455 Ga0501034_0027052 3300049571 Bacteria 5835
1456 Ga0501034_0054770 3300049571 Bacteria 4015
1457 Ga0501034_0110395 3300049571 Bacteria 2741
1458 Ga0501034_0151692 3300049571 Bacteria 2293
1459 Ga0501034_0167744 3300049571 Bacteria 2163
1460 Ga0501034_0225484 3300049571 Bacteria 1825
1461 Ga0501036_0029789 3300049572 Bacteria 4612
1462 Ga0501036_0111278 3300049572 Bacteria 2314
1463 Ga0501036_0205073 3300049572 Bacteria 1658
1464 Ga0501037_0046526 3300049573 Bacteria 3182
1465 Ga0501037_0046561 3300049573 Bacteria 3180
1466 Ga0501038_0012291 3300049574 Bacteria 7820
1467 Ga0501038_0060482 3300049574 Bacteria 3242
1468 Ga0501038_0162179 3300049574 Bacteria 1816
1469 Ga0501039_0212900 3300049575 Bacteria 1519
1470 Ga0501043_0016678 3300049579 Bacteria 5755
1471 Ga0501043_0024314 3300049579 Bacteria 4754
1472 Ga0501046_0045170 3300049580 Bacteria 3501
1473 Ga0501047_0021075 3300049581 Bacteria 6258
1474 Ga0501047_0027231 3300049581 Bacteria 5506
1475 Ga0501047_0072959 3300049581 Bacteria 3304
1476 Ga0501047_0180380 3300049581 Bacteria 1978
1477 Ga0501048_0043141 3300049582 Bacteria 3229
1478 Ga0501073_0019693 3300049589 Bacteria 4870
1479 Ga0501074_0036497 3300049590 Bacteria 3560
1480 Ga0501199_008572 3300049650 Bacteria 1073
1481 Ga0501207_007577 3300049654 Bacteria 1549
1482 Ga0501223_002893 3300049663 Bacteria 3764
1483 Ga0501233_003872 3300049668 Bacteria 2711
1484 Ga0501233_018303 3300049668 Bacteria 1472
1485 Ga0501235_003383 3300049669 Bacteria 3450
1486 Ga0501238_002082 3300049671 Bacteria 2358
1487 Ga0501238_006011 3300049671 Bacteria 1555
1488 Ga0501249_000037 3300049679 Bacteria 63492
1489 Ga0501249_009400 3300049679 Bacteria 2034
1490 Ga0501252_001366 3300049682 Bacteria 2233
1491 Ga0501257_004852 3300049686 Bacteria 2945
1492 Ga0501259_001042 3300049688 Bacteria 4623
1493 Ga0501221_000044 3300049704 Bacteria 12905
1494 Ga0501225_0010824 3300049705 Bacteria 2576
1495 Ga0501225_0026170 3300049705 Bacteria 1605
1496 Ga0501234_012219 3300049707 Bacteria 1344
1497 Ga0501080_0083979 3300049742 Bacteria 2959
1498 Ga0501083_0056426 3300049744 Bacteria 2631
1499 Ga0501241_000031 3300049758 Bacteria 52001
1500 Ga0501241_013916 3300049758 Bacteria 1461
1501 Ga0501264_003224 3300049761 Bacteria 1488
1502 Ga0501266_000011 3300049763 Bacteria 197280
1503 Ga0501266_001616 3300049763 Bacteria 2875
1504 Ga0501270_000445 3300049767 Bacteria 3533
1505 Ga0501275_000447 3300049772 Bacteria 4640
1506 Ga0501280_005944 3300049776 Bacteria 1733
1507 Ga0501280_006796 3300049776 Bacteria 1608
1508 Ga0501035_0015438 3300049822 Bacteria 7045
1509 Ga0501035_0017043 3300049822 Bacteria 6694
1510 Ga0501035_0023420 3300049822 Bacteria 5664
1511 Ga0501035_0048319 3300049822 Bacteria 3816
1512 Ga0501035_0082433 3300049822 Bacteria 2838
1513 Ga0501044_0017840 3300049823 Bacteria 7614
1514 Ga0501044_0021863 3300049823 Bacteria 6820
1515 Ga0501044_0037569 3300049823 Bacteria 5061
1516 Ga0501044_0042471 3300049823 Bacteria 4728
1517 Ga0501044_0054836 3300049823 Bacteria 4095
1518 Ga0501044_0058135 3300049823 Bacteria 3967
1519 Ga0501284_00029 3300050005 Bacteria 74818
1520 nmdc:mga0k408_124405_c1 3300050493 Bacteria 1529
1521 nmdc:mga0k408_127396_c1 3300050493 Bacteria 1510
1522 nmdc:mga0k408_3518_c1 3300050493 Bacteria 8279
1523 nmdc:mga0k408_749_c1 3300050493 Bacteria 17824
1524 nmdc:mga0k408_821_c1 3300050493 Bacteria 17147
1525 nmdc:mga05p37_60273_c1 3300050507 Bacteria 4673
1526 nmdc:mga09592_983_c1 3300050508 Bacteria 22557
1527 nmdc:mga0qj67_97741_c1 3300050509 Bacteria 2365
1528 nmdc:mga06r32_98089_c1 3300050510 Bacteria 2872
1529 nmdc:mga08y16_10414_c1 3300050511 Bacteria 9752
1530 nmdc:mga08y16_107284_c1 3300050511 Bacteria 2907
1531 nmdc:mga08y16_244111_c1 3300050511 Bacteria 1856
1532 Ga0500578_0004418 3300053086 Bacteria 9905
1533 Ga0500578_0137455 3300053086 Bacteria 1529
1534 Ga0500644_0000283 3300053088 Bacteria 28078
1535 Ga0500646_0001428 3300053090 Bacteria 6341
1536 Ga0500646_0004317 3300053090 Bacteria 3602
1537 Ga0500583_0000108 3300053092 Bacteria 41760
1538 Ga0500583_0004742 3300053092 Bacteria 4474
1539 Ga0500651_0000084 3300053093 Bacteria 60127
1540 Ga0500641_0000017 3300053096 Bacteria 132678
1541 Ga0500641_0002621 3300053096 Bacteria 6345
1542 Ga0500556_0003239 3300053104 Bacteria 4841
1543 Ga0500562_000050 3300053108 Bacteria 60058
1544 Ga0500572_020975 3300053111 Bacteria 1726
1545 Ga0500592_009044 3300053116 Bacteria 1582
1546 Ga0500607_043640 3300053121 Bacteria 2415
1547 Ga0500608_004098 3300053122 Bacteria 5585
1548 Ga0500608_016279 3300053122 Bacteria 3356
1549 Ga0500614_006386 3300053123 Bacteria 2478
1550 Ga0500618_000002 3300053125 Bacteria 370822
1551 Ga0500652_072800 3300053131 Bacteria 1426
1552 Ga0500658_0000003 3300053134 Bacteria 512506
1553 Ga0500658_0006060 3300053134 Bacteria 4494
1554 Ga0500564_024121 3300053138 Bacteria 2791
1555 Ga0500568_0001545 3300053139 Bacteria 14626
1556 Ga0500577_0002086 3300053142 Bacteria 5107
1557 Ga0500589_003337 3300053147 Bacteria 5739
1558 Ga0500604_0021565 3300053151 Bacteria 1822
1559 Ga0500616_0000082 3300053153 Bacteria 198665
1560 Ga0500616_0000849 3300053153 Bacteria 34031
1561 Ga0500616_0009033 3300053153 Bacteria 6104
1562 Ga0500616_0059069 3300053153 Bacteria 1993
1563 Ga0500622_0000003 3300053156 Bacteria 613483
1564 Ga0500622_0000008 3300053156 Bacteria 423636
1565 Ga0500622_0000777 3300053156 Bacteria 27709
1566 Ga0500622_0004378 3300053156 Bacteria 8905
1567 Ga0500622_0004557 3300053156 Bacteria 8641
1568 Ga0500622_0005633 3300053156 Bacteria 7461
1569 Ga0500627_0051765 3300053158 Bacteria 1792
1570 Ga0500633_0020452 3300053160 Bacteria 1997
1571 Ga0500637_0167162 3300053178 Bacteria 1266
1572 Ga0500611_000022 3300053727 Bacteria 102349
1573 Ga0500645_019667 3300053730 Bacteria 2099
1574 Ga0501082_0050376 3300060353 Bacteria 3591
1575 Ga0466962_0005611 3300061719 Bacteria 6028

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_0173668 Ga0451577_0173668_50_949 287
2 iso_pu_bacteria 2772190705 2772605418 290
3 3300045049 Ga0466959_0099272 Ga0466959_0099272_15_929 292
4 3300049650 Ga0501199_008572 Ga0501199_008572_43_1008 309
5 3300038741 Ga0400488_26420 Ga0400488_26420_27_998 311
6 3300046500 Ga0495596_0000878 Ga0495596_0000878_14479_15573 317
7 3300049823 Ga0501044_0058135 Ga0501044_0058135_32_1054 329
8 3300046511 Ga0495608_0247946 Ga0495608_0247946_35_1060 330
9 3300049679 Ga0501249_009400 Ga0501249_009400_13_1038 330
10 3300046522 Ga0495643_0049195 Ga0495643_0049195_905_1999 331
11 3300025908 Ga0207643_10130808 Ga0207643_101308082 332
12 3300035398 Ga0316574_0101490 Ga0316574_0101490_388_1521 332
13 3300009174 Ga0105241_10432439 Ga0105241_104324391 334
14 3300049763 Ga0501266_001616 Ga0501266_001616_15_1052 334
15 3300013308 Ga0157375_10000910 Ga0157375_1000091016 335
16 3300013308 Ga0157375_10046217 Ga0157375_100462174 335
17 3300025294 Ga0209025_1009272 Ga0209025_10092726 335
18 3300046460 Ga0495638_0020976 Ga0495638_0020976_2253_3335 335
19 3300009176 Ga0105242_10124504 Ga0105242_101245042 336
20 3300044712 Ga0453684_0007145 Ga0453684_0007145_1356_2423 336
21 3300048928 Ga0496125_0008192 Ga0496125_0008192_1516_2610 336
22 3300038727 Ga0400491_13685 Ga0400491_13685_287_1357 337
23 3300013104 Ga0157370_10036146 Ga0157370_100361465 338
24 3300046507 Ga0495606_0002637 Ga0495606_0002637_7875_8927 338
25 iso_pu_bacteria 2593339239 2595451676 338
26 iso_pu_bacteria 2718218334 2721028239 338
27 iso_pu_bacteria 2734482264 2735836266 338
28 iso_pu_bacteria 2738543009 2739227679 338
29 iso_pu_bacteria 2739367700 2739730759 338
30 iso_pu_bacteria 2818991440 2819563491 338
31 iso_pu_bacteria 2842914999 2842915361 338
32 iso_pu_bacteria 2884411467 2884414414 338
33 iso_pu_bacteria 2904463128 2904464199 338
34 iso_pu_bacteria 2919404418 2919404752 338
35 iso_pu_bacteria 2537561836 2538832432 339
36 iso_pu_bacteria 2643221562 2643830454 339
37 iso_pu_bacteria 2895395659 2895398771 339
38 iso_pu_bacteria 2939611941 2939612355 339
39 3300002705 JGI25156J39149_1011938 JGI25156J39149_10119382 340
40 3300002741 JGI25157J39369_1004284 JGI25157J39369_10042841 340
41 3300005366 Ga0070659_100052714 Ga0070659_1000527142 340
42 3300005547 Ga0070693_100065349 Ga0070693_1000653493 340
43 3300005563 Ga0068855_100020597 Ga0068855_1000205976 340
44 3300005578 Ga0068854_100036209 Ga0068854_1000362092 340
45 3300009093 Ga0105240_10020015 Ga0105240_100200154 340
46 3300009545 Ga0105237_10000595 Ga0105237_1000059511 340
47 3300013104 Ga0157370_10031722 Ga0157370_100317225 340
48 3300013307 Ga0157372_10426779 Ga0157372_104267791 340
49 3300020069 Ga0197907_11483478 Ga0197907_114834781 340
50 3300020082 Ga0206353_11137735 Ga0206353_111377352 340
51 3300025246 Ga0209646_1001409 Ga0209646_10014094 340
52 3300025250 Ga0209026_1000162 Ga0209026_100016211 340
53 3300025256 Ga0209759_1004885 Ga0209759_10048854 340
54 3300025256 Ga0209759_1004887 Ga0209759_10048874 340
55 3300025272 Ga0209455_1000560 Ga0209455_10005607 340
56 3300025904 Ga0207647_10080460 Ga0207647_100804602 340
57 3300025913 Ga0207695_10047480 Ga0207695_100474805 340
58 3300025914 Ga0207671_10000726 Ga0207671_1000072617 340
59 3300025949 Ga0207667_10064211 Ga0207667_100642113 340
60 3300025981 Ga0207640_10088672 Ga0207640_100886722 340
61 3300026067 Ga0207678_10009382 Ga0207678_100093829 340
62 3300037466 Ga0395898_0095872 Ga0395898_0095872_215_1282 340
63 3300038443 Ga0395901_0013263 Ga0395901_0013263_7043_8110 340
64 3300002067 JGI24735J21928_10000733 JGI24735J21928_100007335 341
65 3300002075 JGI24738J21930_10007886 JGI24738J21930_100078862 341
66 3300002705 JGI25156J39149_1010714 JGI25156J39149_10107142 341
67 3300002737 JGI25162J39368_1000395 JGI25162J39368_100039518 341
68 3300002772 JGI25164J39214_1000338 JGI25164J39214_100033812 341
69 3300002772 JGI25164J39214_1000416 JGI25164J39214_100041618 341
70 3300003214 JGI25165J46597_1000513 JGI25165J46597_100051324 341
71 3300003320 rootH2_10026728 rootH2_1002672818 341
72 3300003323 rootH1_10162681 rootH1_101626812 341
73 3300003578 Ga0006562J51391_1077937 Ga0006562J51391_10779376 341
74 3300003756 Ga0055533_1000705 Ga0055533_10007053 341
75 3300005262 Ga0065165_1002869 Ga0065165_100286910 341
76 3300005327 Ga0070658_10013707 Ga0070658_100137071 341
77 3300005335 Ga0070666_10000003 Ga0070666_10000003311 341
78 3300005337 Ga0070682_100023945 Ga0070682_1000239452 341
79 3300005339 Ga0070660_100021175 Ga0070660_1000211751 341
80 3300005344 Ga0070661_100003020 Ga0070661_10000302013 341
81 3300005344 Ga0070661_100034512 Ga0070661_1000345122 341
82 3300005345 Ga0070692_10044215 Ga0070692_100442152 341
83 3300005347 Ga0070668_100159218 Ga0070668_1001592182 341
84 3300005366 Ga0070659_100005797 Ga0070659_1000057972 341
85 3300005435 Ga0070714_100116833 Ga0070714_1001168333 341
86 3300005436 Ga0070713_100006097 Ga0070713_1000060978 341
87 3300005437 Ga0070710_10058995 Ga0070710_100589952 341
88 3300005458 Ga0070681_10022395 Ga0070681_100223956 341
89 3300005530 Ga0070679_100019902 Ga0070679_1000199026 341
90 3300005546 Ga0070696_100005210 Ga0070696_1000052107 341
91 3300005548 Ga0070665_100079883 Ga0070665_1000798832 341
92 3300005563 Ga0068855_100107211 Ga0068855_1001072113 341
93 3300005577 Ga0068857_100042446 Ga0068857_1000424464 341
94 3300006175 Ga0070712_100072125 Ga0070712_1000721252 341
95 3300009101 Ga0105247_10018230 Ga0105247_100182302 341
96 3300009174 Ga0105241_10098806 Ga0105241_100988062 341
97 3300009551 Ga0105238_10005720 Ga0105238_100057209 341
98 3300009551 Ga0105238_10006640 Ga0105238_1000664012 341
99 3300009551 Ga0105238_10106237 Ga0105238_101062373 341
100 3300009551 Ga0105238_10268543 Ga0105238_102685431 341
101 3300010375 Ga0105239_10038370 Ga0105239_100383703 341
102 3300010375 Ga0105239_10078397 Ga0105239_100783973 341
103 3300013100 Ga0157373_10027400 Ga0157373_100274002 341
104 3300013102 Ga0157371_10024187 Ga0157371_100241873 341
105 3300013102 Ga0157371_10155734 Ga0157371_101557342 341
106 3300013104 Ga0157370_10009476 Ga0157370_100094769 341
107 3300013104 Ga0157370_10060009 Ga0157370_100600094 341
108 3300013306 Ga0163162_10000236 Ga0163162_1000023634 341
109 3300013307 Ga0157372_10151239 Ga0157372_101512394 341
110 3300013307 Ga0157372_10234220 Ga0157372_102342202 341
111 3300013307 Ga0157372_10467762 Ga0157372_104677622 341
112 3300014497 Ga0182008_10060873 Ga0182008_100608732 341
113 3300014497 Ga0182008_10088475 Ga0182008_100884752 341
114 3300014497 Ga0182008_10090629 Ga0182008_100906291 341
115 3300015262 Ga0182007_10013574 Ga0182007_100135743 341
116 3300017792 Ga0163161_10006285 Ga0163161_100062852 341
117 3300020082 Ga0206353_12030687 Ga0206353_120306872 341
118 3300025226 Ga0209674_100378 Ga0209674_10037811 341
119 3300025231 Ga0207427_100115 Ga0207427_10011570 341
120 3300025231 Ga0207427_100130 Ga0207427_10013063 341
121 3300025233 Ga0209437_100020 Ga0209437_100020206 341
122 3300025233 Ga0209437_100079 Ga0209437_100079204 341
123 3300025250 Ga0209026_1000105 Ga0209026_100010587 341
124 3300025256 Ga0209759_1009298 Ga0209759_10092982 341
125 3300025258 Ga0209129_1002458 Ga0209129_10024587 341
126 3300025261 Ga0209233_1000020 Ga0209233_1000020419 341
127 3300025261 Ga0209233_1000121 Ga0209233_1000121161 341
128 3300025299 Ga0209256_1028734 Ga0209256_10287342 341
129 3300025898 Ga0207692_10028338 Ga0207692_100283382 341
130 3300025903 Ga0207680_10000006 Ga0207680_10000006458 341
131 3300025904 Ga0207647_10018195 Ga0207647_100181954 341
132 3300025909 Ga0207705_10090827 Ga0207705_100908272 341
133 3300025912 Ga0207707_10170685 Ga0207707_101706852 341
134 3300025913 Ga0207695_10023061 Ga0207695_100230617 341
135 3300025919 Ga0207657_10031993 Ga0207657_100319933 341
136 3300025924 Ga0207694_10003086 Ga0207694_100030865 341
137 3300025924 Ga0207694_10006130 Ga0207694_100061305 341
138 3300025924 Ga0207694_10092271 Ga0207694_100922713 341
139 3300025928 Ga0207700_10003865 Ga0207700_1000386511 341
140 3300025929 Ga0207664_10022981 Ga0207664_100229814 341
141 3300025932 Ga0207690_10000314 Ga0207690_1000031415 341
142 3300025932 Ga0207690_10000797 Ga0207690_1000079715 341
143 3300025932 Ga0207690_10008204 Ga0207690_100082043 341
144 3300025933 Ga0207706_10064116 Ga0207706_100641162 341
145 3300025972 Ga0207668_10135219 Ga0207668_101352192 341
146 3300026116 Ga0207674_10021327 Ga0207674_100213275 341
147 3300026116 Ga0207674_10047238 Ga0207674_100472382 341
148 3300028379 Ga0268266_10000021 Ga0268266_10000021359 341
149 3300033180 Ga0307510_10006943 Ga0307510_1000694310 341
150 3300037466 Ga0395898_0021259 Ga0395898_0021259_3352_4416 341
151 3300038443 Ga0395901_0041573 Ga0395901_0041573_1514_2578 341
152 3300038443 Ga0395901_0293579 Ga0395901_0293579_164_1234 341
153 3300042438 Ga0439459_0002997 Ga0439459_0002997_1433_2497 341
154 3300044658 Ga0466972_0036255 Ga0466972_0036255_942_2006 341
155 3300044672 Ga0466982_0000020 Ga0466982_0000020_27061_28125 341
156 3300044684 Ga0466966_0008999 Ga0466966_0008999_4623_5687 341
157 3300044706 Ga0466964_0060823 Ga0466964_0060823_241_1305 341
158 3300044735 Ga0466968_0016306 Ga0466968_0016306_1310_2374 341
159 3300044765 Ga0466970_0024226 Ga0466970_0024226_1620_2684 341
160 3300045836 Ga0466958_0016632 Ga0466958_0016632_1122_2186 341
161 3300046471 Ga0495650_0001052 Ga0495650_0001052_13177_14241 341
162 3300046519 Ga0495632_0000032 Ga0495632_0000032_142859_143923 341
163 3300046524 Ga0495648_0009989 Ga0495648_0009989_2652_3716 341
164 3300046660 Ga0495625_0115965 Ga0495625_0115965_480_1544 341
165 3300047469 Ga0495673_0000010 Ga0495673_0000010_163496_164560 341
166 3300048924 Ga0496121_0150208 Ga0496121_0150208_231_1295 341
167 3300048928 Ga0496125_0043748 Ga0496125_0043748_353_1417 341
168 3300049570 Ga0501033_0001868 Ga0501033_0001868_10566_11630 341
169 3300049572 Ga0501036_0111278 Ga0501036_0111278_787_1851 341
170 3300049574 Ga0501038_0162179 Ga0501038_0162179_552_1616 341
171 3300049822 Ga0501035_0017043 Ga0501035_0017043_181_1251 341
172 3300049822 Ga0501035_0023420 Ga0501035_0023420_960_2024 341
173 3300049823 Ga0501044_0037569 Ga0501044_0037569_261_1331 341
174 3300049823 Ga0501044_0042471 Ga0501044_0042471_1351_2415 341
175 3300003187 JGI25151J46595_10012241 JGI25151J46595_100122413 343
176 3300003771 Ga0055526_1020598 Ga0055526_10205981 343
177 3300003775 Ga0055524_1008450 Ga0055524_10084502 343
178 3300003781 Ga0055536_1002653 Ga0055536_10026534 343
179 3300003791 Ga0055530_10002797 Ga0055530_100027973 343
180 3300003794 Ga0055531_10003712 Ga0055531_100037127 343
181 3300003794 Ga0055531_10017858 Ga0055531_100178584 343
182 3300025273 Ga0209673_1042251 Ga0209673_10422511 343
183 3300025291 Ga0209675_1003459 Ga0209675_10034595 343
184 3300025292 Ga0209676_1001110 Ga0209676_10011109 343
185 3300025292 Ga0209676_1002036 Ga0209676_10020367 343
186 3300025292 Ga0209676_1004629 Ga0209676_10046292 343
187 3300025292 Ga0209676_1007535 Ga0209676_10075354 343
188 3300025295 Ga0209564_1006739 Ga0209564_10067395 343
189 3300025299 Ga0209256_1003208 Ga0209256_10032084 343
190 3300025304 Ga0209257_1003878 Ga0209257_10038785 343
191 3300025304 Ga0209257_1008310 Ga0209257_10083105 343
192 3300030733 Ga0314311_1025340 Ga0314311_10253404 343
193 3300031665 Ga0316575_10070219 Ga0316575_100702192 343
194 3300031727 Ga0316576_10008094 Ga0316576_100080945 343
195 3300031728 Ga0316578_10162598 Ga0316578_101625982 343
196 3300032004 Ga0307414_10131628 Ga0307414_101316282 343
197 3300046539 Ga0495621_0020509 Ga0495621_0020509_208_1284 343
198 3300046615 Ga0495656_0039957 Ga0495656_0039957_556_1644 343
199 3300047318 Ga0495636_0014693 Ga0495636_0014693_1847_2935 343
200 3300049571 Ga0501034_0000083 Ga0501034_0000083_30756_31829 343
201 3300049772 Ga0501275_000447 Ga0501275_000447_2122_3204 343
202 3300013102 Ga0157371_10001161 Ga0157371_100011618 344
203 3300013104 Ga0157370_10017596 Ga0157370_100175965 344
204 3300006844 Ga0075428_100285890 Ga0075428_1002858901 346
205 3300050511 nmdc:mga08y16_107284_c1 nmdc:mga08y16_107284_c1_327_1442 346
206 iso_pu_bacteria 2958512119 2958513294 346
207 3300046538 Ga0495609_0000134 Ga0495609_0000134_69630_70724 347
208 iso_pu_bacteria 2839989709 2839991350 347
209 iso_pu_bacteria 2910245624 2910247658 347
210 iso_pu_bacteria 2984572630 2984575975 347
211 iso_pu_bacteria 2984606641 2984609430 347
212 3300001989 JGI24739J22299_10005607 JGI24739J22299_100056073 348
213 3300003354 JGI25160J50197_1005718 JGI25160J50197_10057184 348
214 3300003771 Ga0055526_1021512 Ga0055526_10215122 348
215 3300003790 Ga0055528_1001650 Ga0055528_10016502 348
216 3300003791 Ga0055530_10000387 Ga0055530_1000038712 348
217 3300003794 Ga0055531_10022988 Ga0055531_100229882 348
218 3300005262 Ga0065165_1000102 Ga0065165_10001027 348
219 3300013102 Ga0157371_10078589 Ga0157371_100785892 348
220 3300017792 Ga0163161_10005307 Ga0163161_100053079 348
221 3300025273 Ga0209673_1000208 Ga0209673_10002086 348
222 3300025295 Ga0209564_1014033 Ga0209564_10140333 348
223 3300025295 Ga0209564_1014047 Ga0209564_10140473 348
224 3300025297 Ga0209758_1020284 Ga0209758_10202842 348
225 3300025298 Ga0209050_1000134 Ga0209050_1000134145 348
226 3300025302 Ga0207426_1001981 Ga0207426_100198111 348
227 3300025304 Ga0209257_1001605 Ga0209257_100160512 348
228 3300032004 Ga0307414_10000009 Ga0307414_10000009163 348
229 3300048925 Ga0496122_0000188 Ga0496122_0000188_19892_20986 348
230 3300048926 Ga0496123_0003634 Ga0496123_0003634_8378_9472 348
231 iso_pu_bacteria 2511231000 2511234749 348
232 iso_pu_bacteria 2523533629 2524004499 348
233 iso_pu_bacteria 2582581278 2585143470 348
234 iso_pu_bacteria 2582581281 2585158507 348
235 iso_pu_bacteria 2582581282 2585162855 348
236 iso_pu_bacteria 2582581873 2585424754 348
237 iso_pu_bacteria 2585428045 2587680655 348
238 iso_pu_bacteria 2585428060 2587747861 348
239 iso_pu_bacteria 2585428095 2587866777 348
240 iso_pu_bacteria 2585428115 2587942916 348
241 iso_pu_bacteria 2585428182 2588208243 348
242 iso_pu_bacteria 2585428183 2588213191 348
243 iso_pu_bacteria 2585428184 2588219807 348
244 iso_pu_bacteria 2585428185 2588223920 348
245 iso_pu_bacteria 2585428187 2588233479 348
246 iso_pu_bacteria 2588253712 2588446447 348
247 iso_pu_bacteria 2588254255 2590600845 348
248 iso_pu_bacteria 2588254257 2590611894 348
249 iso_pu_bacteria 2728369107 2729198586 348
250 iso_pu_bacteria 2739367874 2740057599 348
251 iso_pu_bacteria 2751185877 2753672695 348
252 iso_pu_bacteria 2765235839 2765572573 348
253 iso_pu_bacteria 2816332188 2816872924 348
254 iso_pu_bacteria 2842083920 2842084181 348
255 iso_pu_bacteria 2871720351 2871723726 348
256 iso_pu_bacteria 2884634485 2884635382 348
257 iso_pu_bacteria 2889290771 2889291699 348
258 iso_pu_bacteria 2905999023 2906000812 348
259 iso_pu_bacteria 2919399522 2919402895 348
260 iso_pu_bacteria 2919692658 2919695678 348
261 iso_pu_bacteria 2945924605 2945927284 348
262 iso_pu_bacteria 2946019816 2946021401 348
263 iso_pu_bacteria 2977243572 2977246214 348
264 iso_pu_bacteria 2993372514 2993373501 348
265 iso_pu_bacteria 2993480792 2993484184 348
266 3300003316 rootH1_10091502 rootH1_100915022 349
267 3300003322 rootL2_10058669 rootL2_100586693 349
268 3300003784 Ga0055534_1003989 Ga0055534_10039892 349
269 3300005288 Ga0065714_10064750 Ga0065714_100647505 349
270 3300009148 Ga0105243_10002194 Ga0105243_1000219415 349
271 3300013100 Ga0157373_10000036 Ga0157373_10000036110 349
272 3300013102 Ga0157371_10070988 Ga0157371_100709883 349
273 3300014497 Ga0182008_10000011 Ga0182008_1000001114 349
274 3300025291 Ga0209675_1000033 Ga0209675_100003314 349
275 3300025935 Ga0207709_10001686 Ga0207709_1000168610 349
276 3300048928 Ga0496125_0000623 Ga0496125_0000623_7400_8494 349
277 3300009093 Ga0105240_10000176 Ga0105240_1000017665 350
278 3300010375 Ga0105239_10000616 Ga0105239_100006167 350
279 3300025913 Ga0207695_10000102 Ga0207695_10000102178 350
280 3300031901 Ga0307406_10008639 Ga0307406_100086394 350
281 3300046501 Ga0495607_0040258 Ga0495607_0040258_603_1691 350
282 3300046513 Ga0495616_0045190 Ga0495616_0045190_1109_2197 350
283 3300048928 Ga0496125_0000310 Ga0496125_0000310_24402_25490 350
284 iso_pu_bacteria 2739367866 2740032875 350
285 3300003323 rootH1_10035284 rootH1_1003528415 351
286 3300005614 Ga0068856_100007967 Ga0068856_10000796710 351
287 3300005614 Ga0068856_100074762 Ga0068856_1000747623 351
288 3300026078 Ga0207702_10005976 Ga0207702_1000597611 351
289 3300026078 Ga0207702_10105221 Ga0207702_101052212 351
290 3300031251 Ga0265327_10000972 Ga0265327_1000097217 351
291 3300031344 Ga0265316_10028488 Ga0265316_100284883 351
292 3300031712 Ga0265342_10123102 Ga0265342_101231022 351
293 3300031728 Ga0316578_10044042 Ga0316578_100440422 351
294 3300032004 Ga0307414_10000038 Ga0307414_10000038107 351
295 3300032004 Ga0307414_10014324 Ga0307414_100143246 351
296 3300032004 Ga0307414_10033966 Ga0307414_100339662 351
297 3300032004 Ga0307414_10207829 Ga0307414_102078291 351
298 3300037471 Ga0395905_0000254 Ga0395905_0000254_1491_2588 351
299 3300042876 Ga0451577_0005746 Ga0451577_0005746_5853_6947 351
300 3300042876 Ga0451577_0044094 Ga0451577_0044094_384_1472 351
301 3300042876 Ga0451577_0092006 Ga0451577_0092006_1584_2675 351
302 3300042876 Ga0451577_0119738 Ga0451577_0119738_593_1681 351
303 3300044712 Ga0453684_0000889 Ga0453684_0000889_89004_90098 351
304 3300044712 Ga0453684_0001834 Ga0453684_0001834_16115_17215 351
305 3300044712 Ga0453684_0071008 Ga0453684_0071008_195_1283 351
306 3300045051 Ga0451576_0023244 Ga0451576_0023244_3929_5017 351
307 3300045051 Ga0451576_0182787 Ga0451576_0182787_398_1489 351
308 3300046616 Ga0495668_0000592 Ga0495668_0000592_23520_24614 351
309 3300047472 Ga0495686_0000884 Ga0495686_0000884_18437_19555 351
310 3300053104 Ga0500556_0003239 Ga0500556_0003239_2919_4013 351
311 3300053116 Ga0500592_009044 Ga0500592_009044_435_1526 351
312 3300053153 Ga0500616_0000849 Ga0500616_0000849_3553_4647 351
313 3300053158 Ga0500627_0051765 Ga0500627_0051765_193_1287 351
314 3300005337 Ga0070682_100000153 Ga0070682_10000015350 352
315 3300005455 Ga0070663_100195511 Ga0070663_1001955112 352
316 3300009036 Ga0105244_10000261 Ga0105244_1000026136 352
317 3300015261 Ga0182006_1000011 Ga0182006_1000011244 352
318 3300025728 Ga0207655_1005122 Ga0207655_10051226 352
319 3300031911 Ga0307412_10000012 Ga0307412_10000012195 352
320 3300032002 Ga0307416_100000010 Ga0307416_100000010167 352
321 3300036647 Ga0316582_0120513 Ga0316582_0120513_436_1533 352
322 3300036712 Ga0316584_0004574 Ga0316584_0004574_2578_3669 352
323 3300036712 Ga0316584_0294557 Ga0316584_0294557_61_1158 352
324 3300044712 Ga0453684_0003998 Ga0453684_0003998_802_1947 352
325 3300044712 Ga0453684_0097891 Ga0453684_0097891_2286_3398 352
326 3300046453 Ga0495627_000003 Ga0495627_000003_378113_379207 352
327 3300046512 Ga0495610_0000001 Ga0495610_0000001_1449467_1450561 352
328 3300046530 Ga0495654_0000001 Ga0495654_0000001_740887_741981 352
329 3300046558 Ga0495633_0000008 Ga0495633_0000008_171888_172982 352
330 3300046558 Ga0495633_0004351 Ga0495633_0004351_2337_3431 352
331 3300046660 Ga0495625_0000781 Ga0495625_0000781_35641_36735 352
332 3300047472 Ga0495686_0000118 Ga0495686_0000118_131852_132946 352
333 3300047472 Ga0495686_0028549 Ga0495686_0028549_2324_3418 352
334 3300048905 Ga0496102_0049516 Ga0496102_0049516_1926_3020 352
335 3300048919 Ga0496116_0000053 Ga0496116_0000053_158327_159421 352
336 3300048920 Ga0496117_0000050 Ga0496117_0000050_281218_282312 352
337 3300048921 Ga0496118_0000044 Ga0496118_0000044_10443_11537 352
338 3300048922 Ga0496119_0000002 Ga0496119_0000002_12621_13715 352
339 3300048925 Ga0496122_0000191 Ga0496122_0000191_10749_11843 352
340 3300048925 Ga0496122_0000538 Ga0496122_0000538_12454_13548 352
341 3300048925 Ga0496122_0000769 Ga0496122_0000769_53461_54555 352
342 3300048926 Ga0496123_0000636 Ga0496123_0000636_10435_11529 352
343 3300048926 Ga0496123_0005816 Ga0496123_0005816_2885_3979 352
344 3300048927 Ga0496124_0001056 Ga0496124_0001056_12982_14076 352
345 3300048927 Ga0496124_0099531 Ga0496124_0099531_465_1559 352
346 3300048928 Ga0496125_0007782 Ga0496125_0007782_4775_5869 352
347 3300048929 Ga0496126_0000660 Ga0496126_0000660_1705_2799 352
348 2162886007 SwRhRL2b_contig_995218 SwRhRL2b_0375.00004920 353
349 3300003323 rootH1_10178453 rootH1_101784531 353
350 3300005288 Ga0065714_10067358 Ga0065714_100673583 353
351 3300005289 Ga0065704_10090743 Ga0065704_100907432 353
352 3300005289 Ga0065704_10113887 Ga0065704_101138872 353
353 3300005331 Ga0070670_100045698 Ga0070670_1000456982 353
354 3300005334 Ga0068869_100025054 Ga0068869_1000250543 353
355 3300005354 Ga0070675_100096546 Ga0070675_1000965463 353
356 3300005367 Ga0070667_100069793 Ga0070667_1000697933 353
357 3300005539 Ga0068853_100009733 Ga0068853_1000097335 353
358 3300005563 Ga0068855_100136803 Ga0068855_1001368033 353
359 3300005617 Ga0068859_100014329 Ga0068859_1000143295 353
360 3300005617 Ga0068859_100014701 Ga0068859_1000147019 353
361 3300005618 Ga0068864_100046544 Ga0068864_1000465442 353
362 3300005841 Ga0068863_100015360 Ga0068863_1000153606 353
363 3300005842 Ga0068858_100038430 Ga0068858_1000384302 353
364 3300005843 Ga0068860_100011999 Ga0068860_1000119994 353
365 3300005844 Ga0068862_100010385 Ga0068862_1000103854 353
366 3300005844 Ga0068862_100297749 Ga0068862_1002977492 353
367 3300006237 Ga0097621_100021360 Ga0097621_1000213607 353
368 3300006931 Ga0097620_100014329 Ga0097620_1000143293 353
369 3300006931 Ga0097620_100014701 Ga0097620_1000147013 353
370 3300009093 Ga0105240_10108377 Ga0105240_101083772 353
371 3300009177 Ga0105248_10391891 Ga0105248_103918911 353
372 3300009553 Ga0105249_10107814 Ga0105249_101078143 353
373 3300013102 Ga0157371_10003683 Ga0157371_100036835 353
374 3300013102 Ga0157371_10077958 Ga0157371_100779583 353
375 3300013104 Ga0157370_10039822 Ga0157370_100398223 353
376 3300013306 Ga0163162_10013133 Ga0163162_100131336 353
377 3300013307 Ga0157372_10500769 Ga0157372_105007691 353
378 3300014325 Ga0163163_10098082 Ga0163163_100980823 353
379 3300014325 Ga0163163_10313114 Ga0163163_103131142 353
380 3300017792 Ga0163161_10033761 Ga0163161_100337613 353
381 3300025904 Ga0207647_10027673 Ga0207647_100276735 353
382 3300025919 Ga0207657_10049273 Ga0207657_100492732 353
383 3300025934 Ga0207686_10103114 Ga0207686_101031142 353
384 3300025942 Ga0207689_10066990 Ga0207689_100669903 353
385 3300025986 Ga0207658_10079172 Ga0207658_100791722 353
386 3300026095 Ga0207676_10224103 Ga0207676_102241032 353
387 3300028380 Ga0268265_10235540 Ga0268265_102355402 353
388 3300028381 Ga0268264_10274850 Ga0268264_102748502 353
389 3300031548 Ga0307408_100129664 Ga0307408_1001296641 353
390 3300031548 Ga0307408_100160155 Ga0307408_1001601551 353
391 3300031852 Ga0307410_10001320 Ga0307410_100013202 353
392 3300031901 Ga0307406_10083253 Ga0307406_100832532 353
393 3300031995 Ga0307409_100063317 Ga0307409_1000633173 353
394 3300032005 Ga0307411_10108067 Ga0307411_101080672 353
395 3300032126 Ga0307415_100050534 Ga0307415_1000505343 353
396 3300037312 Ga0395899_0041383 Ga0395899_0041383_192_1334 353
397 3300037466 Ga0395898_0032624 Ga0395898_0032624_2430_3572 353
398 3300038443 Ga0395901_0059253 Ga0395901_0059253_1734_2876 353
399 3300046616 Ga0495668_0000292 Ga0495668_0000292_22982_24085 353
400 3300047320 Ga0495672_0002824 Ga0495672_0002824_8162_9328 353
401 3300053093 Ga0500651_0000084 Ga0500651_0000084_58954_60087 353
402 3300001989 JGI24739J22299_10018320 JGI24739J22299_100183202 354
403 3300002738 JGI25154J39366_1000040 JGI25154J39366_100004021 354
404 3300003215 JGI25153J46596_10003346 JGI25153J46596_100033465 354
405 3300003354 JGI25160J50197_1012160 JGI25160J50197_10121602 354
406 3300005548 Ga0070665_100043231 Ga0070665_1000432313 354
407 3300005617 Ga0068859_100259099 Ga0068859_1002590992 354
408 3300006931 Ga0097620_100259079 Ga0097620_1002590792 354
409 3300009093 Ga0105240_10066229 Ga0105240_100662293 354
410 3300009101 Ga0105247_10010386 Ga0105247_100103864 354
411 3300009545 Ga0105237_10003651 Ga0105237_100036515 354
412 3300009545 Ga0105237_10078883 Ga0105237_100788834 354
413 3300009545 Ga0105237_10279271 Ga0105237_102792712 354
414 3300010375 Ga0105239_10137595 Ga0105239_101375953 354
415 3300025246 Ga0209646_1000002 Ga0209646_1000002516 354
416 3300025250 Ga0209026_1000434 Ga0209026_100043419 354
417 3300025297 Ga0209758_1003065 Ga0209758_10030656 354
418 3300025302 Ga0207426_1000497 Ga0207426_100049717 354
419 3300025913 Ga0207695_10015643 Ga0207695_100156433 354
420 3300025914 Ga0207671_10000036 Ga0207671_1000003693 354
421 3300025914 Ga0207671_10119462 Ga0207671_101194622 354
422 3300025940 Ga0207691_10230027 Ga0207691_102300272 354
423 3300028379 Ga0268266_10071433 Ga0268266_100714334 354
424 3300031251 Ga0265327_10000010 Ga0265327_10000010314 354
425 3300048917 Ga0496114_0000594 Ga0496114_0000594_1354_2463 354
426 3300048929 Ga0496126_0022457 Ga0496126_0022457_4054_5154 354
427 3300049671 Ga0501238_006011 Ga0501238_006011_252_1352 354
428 3300049758 Ga0501241_000031 Ga0501241_000031_21612_22712 354
429 3300005335 Ga0070666_10038936 Ga0070666_100389362 355
430 3300005336 Ga0070680_100045802 Ga0070680_1000458023 355
431 3300005338 Ga0068868_100181732 Ga0068868_1001817322 355
432 3300005344 Ga0070661_100047201 Ga0070661_1000472012 355
433 3300005355 Ga0070671_100103058 Ga0070671_1001030581 355
434 3300005367 Ga0070667_100044097 Ga0070667_1000440973 355
435 3300005457 Ga0070662_100121832 Ga0070662_1001218322 355
436 3300005458 Ga0070681_10003864 Ga0070681_100038643 355
437 3300005530 Ga0070679_100007656 Ga0070679_1000076565 355
438 3300005539 Ga0068853_100016539 Ga0068853_1000165394 355
439 3300005544 Ga0070686_100022221 Ga0070686_1000222214 355
440 3300005563 Ga0068855_100234343 Ga0068855_1002343432 355
441 3300005563 Ga0068855_100257335 Ga0068855_1002573352 355
442 3300005564 Ga0070664_100014454 Ga0070664_1000144542 355
443 3300005577 Ga0068857_100008503 Ga0068857_1000085039 355
444 3300005577 Ga0068857_100036860 Ga0068857_1000368602 355
445 3300005577 Ga0068857_100039954 Ga0068857_1000399543 355
446 3300005614 Ga0068856_100021537 Ga0068856_1000215374 355
447 3300005617 Ga0068859_100081931 Ga0068859_1000819313 355
448 3300005617 Ga0068859_100112184 Ga0068859_1001121843 355
449 3300005617 Ga0068859_100156882 Ga0068859_1001568823 355
450 3300005618 Ga0068864_100081890 Ga0068864_1000818903 355
451 3300005842 Ga0068858_100074780 Ga0068858_1000747803 355
452 3300005843 Ga0068860_100011274 Ga0068860_1000112747 355
453 3300005843 Ga0068860_100173481 Ga0068860_1001734812 355
454 3300005844 Ga0068862_100025020 Ga0068862_1000250203 355
455 3300005844 Ga0068862_100045273 Ga0068862_1000452733 355
456 3300005844 Ga0068862_100100522 Ga0068862_1001005222 355
457 3300006237 Ga0097621_100093623 Ga0097621_1000936232 355
458 3300006931 Ga0097620_100081931 Ga0097620_1000819312 355
459 3300006931 Ga0097620_100112184 Ga0097620_1001121843 355
460 3300006931 Ga0097620_100156891 Ga0097620_1001568911 355
461 3300009093 Ga0105240_10070852 Ga0105240_100708524 355
462 3300009101 Ga0105247_10012510 Ga0105247_100125104 355
463 3300009174 Ga0105241_10021858 Ga0105241_100218585 355
464 3300009176 Ga0105242_10034951 Ga0105242_100349512 355
465 3300009545 Ga0105237_10148072 Ga0105237_101480723 355
466 3300009553 Ga0105249_10035965 Ga0105249_100359653 355
467 3300009553 Ga0105249_10107176 Ga0105249_101071763 355
468 3300013104 Ga0157370_10147217 Ga0157370_101472172 355
469 3300013105 Ga0157369_10104015 Ga0157369_101040153 355
470 3300013105 Ga0157369_10123106 Ga0157369_101231063 355
471 3300013297 Ga0157378_10010586 Ga0157378_100105863 355
472 3300013297 Ga0157378_10060809 Ga0157378_100608093 355
473 3300013306 Ga0163162_10055013 Ga0163162_100550134 355
474 3300013306 Ga0163162_10067516 Ga0163162_100675163 355
475 3300013306 Ga0163162_10432294 Ga0163162_104322941 355
476 3300013307 Ga0157372_10092410 Ga0157372_100924103 355
477 3300013307 Ga0157372_10093593 Ga0157372_100935932 355
478 3300013307 Ga0157372_10120930 Ga0157372_101209302 355
479 3300013308 Ga0157375_10144618 Ga0157375_101446183 355
480 3300014325 Ga0163163_10048819 Ga0163163_100488191 355
481 3300014326 Ga0157380_10019234 Ga0157380_100192342 355
482 3300017792 Ga0163161_10004613 Ga0163161_100046139 355
483 3300025321 Ga0207656_10107870 Ga0207656_101078702 355
484 3300025900 Ga0207710_10002439 Ga0207710_100024394 355
485 3300025903 Ga0207680_10028103 Ga0207680_100281033 355
486 3300025912 Ga0207707_10003389 Ga0207707_100033892 355
487 3300025913 Ga0207695_10276714 Ga0207695_102767142 355
488 3300025919 Ga0207657_10021748 Ga0207657_100217483 355
489 3300025920 Ga0207649_10023770 Ga0207649_100237703 355
490 3300025931 Ga0207644_10041897 Ga0207644_100418973 355
491 3300025933 Ga0207706_10027522 Ga0207706_100275223 355
492 3300025934 Ga0207686_10093300 Ga0207686_100933002 355
493 3300025945 Ga0207679_10025004 Ga0207679_100250043 355
494 3300025949 Ga0207667_10066061 Ga0207667_100660612 355
495 3300025949 Ga0207667_10195765 Ga0207667_101957652 355
496 3300025961 Ga0207712_10002656 Ga0207712_100026563 355
497 3300025961 Ga0207712_10005109 Ga0207712_100051096 355
498 3300025986 Ga0207658_10105398 Ga0207658_101053982 355
499 3300026023 Ga0207677_10159092 Ga0207677_101590922 355
500 3300026078 Ga0207702_10107011 Ga0207702_101070111 355
501 3300026116 Ga0207674_10048707 Ga0207674_100487076 355
502 3300026116 Ga0207674_10136063 Ga0207674_101360633 355
503 3300028381 Ga0268264_10003107 Ga0268264_100031074 355
504 3300028573 Ga0265334_10005205 Ga0265334_100052055 355
505 3300031852 Ga0307410_10003139 Ga0307410_100031395 355
506 3300031901 Ga0307406_10147620 Ga0307406_101476201 355
507 3300031903 Ga0307407_10004708 Ga0307407_100047084 355
508 3300031911 Ga0307412_10031631 Ga0307412_100316314 355
509 3300031995 Ga0307409_100006323 Ga0307409_1000063235 355
510 3300032002 Ga0307416_100063210 Ga0307416_1000632102 355
511 3300032004 Ga0307414_10010064 Ga0307414_100100644 355
512 3300032005 Ga0307411_10003236 Ga0307411_100032364 355
513 3300032126 Ga0307415_100012792 Ga0307415_1000127923 355
514 3300037312 Ga0395899_0000025 Ga0395899_0000025_224563_225672 355
515 3300037418 Ga0395900_0108003 Ga0395900_0108003_312_1421 355
516 3300044712 Ga0453684_0000165 Ga0453684_0000165_112755_113864 355
517 3300044712 Ga0453684_0004204 Ga0453684_0004204_10471_11580 355
518 3300044712 Ga0453684_0048440 Ga0453684_0048440_2011_3120 355
519 3300045051 Ga0451576_0000003 Ga0451576_0000003_1192734_1193846 355
520 3300048907 Ga0496104_0317799 Ga0496104_0317799_304_1404 355
521 3300048912 Ga0496109_0165330 Ga0496109_0165330_489_1589 355
522 3300048917 Ga0496114_0091226 Ga0496114_0091226_504_1604 355
523 3300049705 Ga0501225_0010824 Ga0501225_0010824_56_1165 355
524 3300049767 Ga0501270_000445 Ga0501270_000445_745_1854 355
525 3300053142 Ga0500577_0002086 Ga0500577_0002086_3526_4635 355
526 3300005564 Ga0070664_100007478 Ga0070664_1000074789 356
527 3300014497 Ga0182008_10000006 Ga0182008_10000006321 356
528 3300025945 Ga0207679_10070427 Ga0207679_100704272 356
529 3300031616 Ga0307508_10002100 Ga0307508_1000210012 356
530 3300048918 Ga0496115_0045415 Ga0496115_0045415_67_1200 356
531 3300049758 Ga0501241_013916 Ga0501241_013916_36_1238 356
532 iso_pu_bacteria 2522125168 2522548015 356
533 iso_pu_bacteria 2911138879 2911143607 356
534 3300005563 Ga0068855_100026080 Ga0068855_1000260803 357
535 3300005617 Ga0068859_100222053 Ga0068859_1002220533 357
536 3300005844 Ga0068862_100079303 Ga0068862_1000793033 357
537 3300006931 Ga0097620_100222053 Ga0097620_1002220531 357
538 3300009545 Ga0105237_10067260 Ga0105237_100672603 357
539 3300013104 Ga0157370_10001022 Ga0157370_1000102220 357
540 3300013104 Ga0157370_10001166 Ga0157370_100011662 357
541 3300014497 Ga0182008_10001192 Ga0182008_100011926 357
542 3300015261 Ga0182006_1000869 Ga0182006_10008696 357
543 3300017792 Ga0163161_10002988 Ga0163161_100029889 357
544 3300025914 Ga0207671_10042678 Ga0207671_100426783 357
545 3300028380 Ga0268265_10138654 Ga0268265_101386543 357
546 3300045051 Ga0451576_0007020 Ga0451576_0007020_8127_9296 357
547 3300048925 Ga0496122_0001208 Ga0496122_0001208_12385_13518 357
548 3300048926 Ga0496123_0008537 Ga0496123_0008537_1458_2591 357
549 3300003316 rootH1_10005810 rootH1_100058105 358
550 3300003320 rootH2_10006905 rootH2_1000690518 358
551 3300003322 rootL2_10030202 rootL2_100302024 358
552 3300003323 rootH1_10014558 rootH1_1001455815 358
553 3300009093 Ga0105240_10404120 Ga0105240_104041201 358
554 3300009094 Ga0111539_10008695 Ga0111539_100086956 358
555 3300013104 Ga0157370_10142304 Ga0157370_101423042 358
556 3300014326 Ga0157380_10095552 Ga0157380_100955522 358
557 3300027907 Ga0207428_10179661 Ga0207428_101796612 358
558 3300035695 Ga0373927_0005849 Ga0373927_0005849_6020_7135 358
559 3300044712 Ga0453684_0027844 Ga0453684_0027844_1605_2720 358
560 3300049686 Ga0501257_004852 Ga0501257_004852_1199_2314 358
561 3300049688 Ga0501259_001042 Ga0501259_001042_723_1838 358
562 3300049705 Ga0501225_0026170 Ga0501225_0026170_215_1330 358
563 3300049761 Ga0501264_003224 Ga0501264_003224_217_1332 358
564 3300050511 nmdc:mga08y16_10414_c1 nmdc:mga08y16_10414_c1_2343_3458 358
565 3300053086 Ga0500578_0137455 Ga0500578_0137455_366_1481 358
566 3300053153 Ga0500616_0000082 Ga0500616_0000082_117584_118699 358
567 3300053156 Ga0500622_0000003 Ga0500622_0000003_210621_211736 358
568 3300053156 Ga0500622_0000008 Ga0500622_0000008_3239_4354 358
569 3300002737 JGI25162J39368_1000614 JGI25162J39368_10006144 359
570 3300003214 JGI25165J46597_1000985 JGI25165J46597_100098510 359
571 3300003323 rootH1_10008801 rootH1_100088018 359
572 3300005288 Ga0065714_10010706 Ga0065714_100107061 359
573 3300005366 Ga0070659_100011612 Ga0070659_1000116124 359
574 3300005530 Ga0070679_100304594 Ga0070679_1003045942 359
575 3300005539 Ga0068853_100265163 Ga0068853_1002651632 359
576 3300005564 Ga0070664_100015583 Ga0070664_1000155834 359
577 3300005616 Ga0068852_100002446 Ga0068852_10000244613 359
578 3300009093 Ga0105240_10287009 Ga0105240_102870092 359
579 3300009093 Ga0105240_10351421 Ga0105240_103514212 359
580 3300009545 Ga0105237_10004072 Ga0105237_1000407219 359
581 3300009545 Ga0105237_10049654 Ga0105237_100496544 359
582 3300010375 Ga0105239_10000758 Ga0105239_1000075826 359
583 3300013100 Ga0157373_10019401 Ga0157373_100194013 359
584 3300013296 Ga0157374_10420002 Ga0157374_104200022 359
585 3300014325 Ga0163163_10052489 Ga0163163_100524892 359
586 3300025231 Ga0207427_100103 Ga0207427_10010393 359
587 3300025233 Ga0209437_100101 Ga0209437_100101114 359
588 3300025261 Ga0209233_1000124 Ga0209233_1000124122 359
589 3300025904 Ga0207647_10011313 Ga0207647_100113134 359
590 3300025921 Ga0207652_10061632 Ga0207652_100616322 359
591 3300025932 Ga0207690_10103318 Ga0207690_101033182 359
592 3300025945 Ga0207679_10011633 Ga0207679_100116334 359
593 3300026041 Ga0207639_10292829 Ga0207639_102928292 359
594 3300026142 Ga0207698_10174689 Ga0207698_101746892 359
595 3300037471 Ga0395905_0064234 Ga0395905_0064234_243_1382 359
596 3300003781 Ga0055536_1005846 Ga0055536_10058464 360
597 3300005262 Ga0065165_1000396 Ga0065165_100039613 360
598 3300005288 Ga0065714_10003545 Ga0065714_100035455 360
599 3300014497 Ga0182008_10000818 Ga0182008_100008182 360
600 3300025292 Ga0209676_1000390 Ga0209676_100039042 360
601 3300031731 Ga0307405_10156175 Ga0307405_101561752 360
602 3300042876 Ga0451577_0001046 Ga0451577_0001046_18937_20058 360
603 3300042876 Ga0451577_0002168 Ga0451577_0002168_11170_12291 360
604 3300044673 Ga0453683_0000594 Ga0453683_0000594_19945_21066 360
605 3300044673 Ga0453683_0001699 Ga0453683_0001699_7050_8171 360
606 3300044673 Ga0453683_0048234 Ga0453683_0048234_615_1736 360
607 3300044712 Ga0453684_0000432 Ga0453684_0000432_134618_135739 360
608 3300044712 Ga0453684_0002066 Ga0453684_0002066_563_1684 360
609 3300044712 Ga0453684_0002932 Ga0453684_0002932_18937_20058 360
610 3300044712 Ga0453684_0009766 Ga0453684_0009766_3855_4976 360
611 3300044712 Ga0453684_0017983 Ga0453684_0017983_4376_5497 360
612 3300044712 Ga0453684_0027912 Ga0453684_0027912_3662_4783 360
613 3300044712 Ga0453684_0032909 Ga0453684_0032909_1454_2575 360
614 3300044712 Ga0453684_0110447 Ga0453684_0110447_615_1736 360
615 3300044712 Ga0453684_0114624 Ga0453684_0114624_1470_2591 360
616 3300045051 Ga0451576_0000113 Ga0451576_0000113_134864_135985 360
617 3300045051 Ga0451576_0001464 Ga0451576_0001464_19945_21066 360
618 3300045051 Ga0451576_0007064 Ga0451576_0007064_9962_11083 360
619 3300045051 Ga0451576_0010902 Ga0451576_0010902_1959_3080 360
620 3300045051 Ga0451576_0085698 Ga0451576_0085698_71_1192 360
621 3300045051 Ga0451576_0100688 Ga0451576_0100688_1115_2236 360
622 3300045051 Ga0451576_0384349 Ga0451576_0384349_137_1258 360
623 iso_pu_bacteria 2883068021 2883072582 360
624 iso_pu_bacteria 2896109856 2896112545 360
625 iso_pu_bacteria 2896317667 2896319310 360
626 iso_pu_bacteria 2898713307 2898716259 360
627 3300003794 Ga0055531_10000087 Ga0055531_1000008755 361
628 3300021384 Ga0213876_10001528 Ga0213876_100015289 361
629 3300025304 Ga0209257_1000006 Ga0209257_1000006380 361
630 3300028653 Ga0265323_10000381 Ga0265323_100003819 361
631 3300028800 Ga0265338_10000471 Ga0265338_1000047134 361
632 3300031344 Ga0265316_10000618 Ga0265316_1000061830 361
633 3300031727 Ga0316576_10075969 Ga0316576_100759693 361
634 3300031733 Ga0316577_10004430 Ga0316577_100044303 361
635 3300031733 Ga0316577_10026440 Ga0316577_100264402 361
636 3300032139 Ga0316580_10014554 Ga0316580_100145543 361
637 3300036647 Ga0316582_0015711 Ga0316582_0015711_2135_3259 361
638 3300036712 Ga0316584_0004745 Ga0316584_0004745_6317_7441 361
639 3300039062 Ga0400483_075612 Ga0400483_075612_22828_23952 361
640 3300039062 Ga0400483_151915 Ga0400483_151915_8562_9686 361
641 3300039437 Ga0436365_0688175 Ga0436365_0688175_67_1200 361
642 3300039437 Ga0436365_1079918 Ga0436365_1079918_29585_30718 361
643 3300041406 Ga0439439_0011270 Ga0439439_0011270_49_1269 361
644 3300041997 Ga0439431_0010163 Ga0439431_0010163_895_2028 361
645 3300042002 Ga0439442_001916 Ga0439442_001916_87_1289 361
646 3300042007 Ga0439449_0047197 Ga0439449_0047197_144_1346 361
647 3300042134 Ga0450898_003860 Ga0450898_003860_1022_2155 361
648 3300044712 Ga0453684_0006105 Ga0453684_0006105_10271_11398 361
649 3300049570 Ga0501033_0010675 Ga0501033_0010675_3941_5077 361
650 3300049571 Ga0501034_0027052 Ga0501034_0027052_4340_5476 361
651 3300049571 Ga0501034_0054770 Ga0501034_0054770_1278_2414 361
652 iso_pu_bacteria 2721755487 2722726342 361
653 iso_pu_bacteria 2842903701 2842908875 361
654 iso_pu_bacteria 2890737413 2890739568 361
655 iso_pu_bacteria 2896085136 2896087749 361
656 iso_pu_bacteria 2896344016 2896346134 361
657 iso_pu_bacteria 2904780799 2904783772 361
658 iso_pu_bacteria 2919177583 2919181978 361
659 iso_pu_bacteria 3003233435 3003237224 361
660 iso_pu_bacteria 8055588893 8055589910 361
661 3300026067 Ga0207678_10124809 Ga0207678_101248092 362
662 3300031731 Ga0307405_10000003 Ga0307405_1000000371 362
663 3300049668 Ga0501233_018303 Ga0501233_018303_122_1246 362
664 3300050005 Ga0501284_00029 Ga0501284_00029_17617_18756 362
665 iso_pu_bacteria 2585427687 2586210051 362
666 iso_pu_bacteria 2738541283 2738757064 362
667 iso_pu_bacteria 2738541284 2738760401 362
668 iso_pu_bacteria 2738541302 2738851782 362
669 iso_pu_bacteria 2738543023 2739302548 362
670 iso_pu_bacteria 2739367651 2739590672 362
671 iso_pu_bacteria 2739367656 2739617092 362
672 iso_pu_bacteria 2739367663 2739647397 362
673 iso_pu_bacteria 2775506987 2776612452 362
674 iso_pu_bacteria 2818991437 2819546346 362
675 iso_pu_bacteria 2818991442 2819573626 362
676 iso_pu_bacteria 2818991460 2819680874 362
677 iso_pu_bacteria 2821136567 2821136960 362
678 iso_pu_bacteria 2833640130 2833643624 362
679 iso_pu_bacteria 2842722452 2842725023 362
680 iso_pu_bacteria 2842909656 2842914187 362
681 iso_pu_bacteria 2849281842 2849286581 362
682 iso_pu_bacteria 2852627209 2852630367 362
683 iso_pu_bacteria 2857627736 2857630291 362
684 iso_pu_bacteria 2884791551 2884795631 362
685 iso_pu_bacteria 2895498888 2895503564 362
686 iso_pu_bacteria 2904445276 2904448667 362
687 iso_pu_bacteria 2904467357 2904468298 362
688 iso_pu_bacteria 2919186247 2919189654 362
689 iso_pu_bacteria 2929177148 2929178798 362
690 iso_pu_bacteria 2929239360 2929241239 362
691 iso_pu_bacteria 2929921140 2929923237 362
692 iso_pu_bacteria 2939664404 2939667880 362
693 iso_pu_bacteria 2945997725 2946001965 362
694 iso_pu_bacteria 2946013367 2946019398 362
695 iso_pu_bacteria 2954016120 2954018849 362
696 iso_pu_bacteria 8003151029 8003153680 362
697 3300005289 Ga0065704_10002415 Ga0065704_100024152 363
698 3300005614 Ga0068856_100022699 Ga0068856_1000226997 363
699 3300009148 Ga0105243_10000043 Ga0105243_1000004361 363
700 3300013102 Ga0157371_10000036 Ga0157371_10000036156 363
701 3300013102 Ga0157371_10034813 Ga0157371_100348132 363
702 3300013105 Ga0157369_10051032 Ga0157369_100510323 363
703 3300013307 Ga0157372_10259321 Ga0157372_102593212 363
704 3300025250 Ga0209026_1007075 Ga0209026_10070752 363
705 3300025909 Ga0207705_10093493 Ga0207705_100934932 363
706 3300025917 Ga0207660_10249322 Ga0207660_102493222 363
707 3300025932 Ga0207690_10052218 Ga0207690_100522183 363
708 3300025935 Ga0207709_10000021 Ga0207709_10000021250 363
709 3300025949 Ga0207667_10028127 Ga0207667_100281275 363
710 3300026078 Ga0207702_10057179 Ga0207702_100571793 363
711 3300030731 Ga0316177_1198244 Ga0316177_11982445 363
712 3300030732 Ga0316176_1050137 Ga0316176_10501377 363
713 3300030742 Ga0316183_1065995 Ga0316183_10659957 363
714 3300030744 Ga0316181_1148726 Ga0316181_11487266 363
715 3300031507 Ga0307509_10026381 Ga0307509_100263813 363
716 3300037418 Ga0395900_0194491 Ga0395900_0194491_801_1943 363
717 3300037466 Ga0395898_0056108 Ga0395898_0056108_848_1990 363
718 3300048919 Ga0496116_0001728 Ga0496116_0001728_7488_8627 363
719 3300048920 Ga0496117_0003269 Ga0496117_0003269_6454_7593 363
720 3300048925 Ga0496122_0006115 Ga0496122_0006115_8491_9630 363
721 3300048926 Ga0496123_0003787 Ga0496123_0003787_745_1884 363
722 3300048927 Ga0496124_0112931 Ga0496124_0112931_846_1985 363
723 3300048928 Ga0496125_0036412 Ga0496125_0036412_1788_2927 363
724 iso_pu_bacteria 2513020052 2513235061 363
725 iso_pu_bacteria 2519899754 2520879409 363
726 iso_pu_bacteria 2643221600 2644013060 363
727 iso_pu_bacteria 2643221667 2644372378 363
728 iso_pu_bacteria 2643221716 2644642606 363
729 iso_pu_bacteria 2643221725 2644684850 363
730 iso_pu_bacteria 2738541273 2738700679 363
731 iso_pu_bacteria 2738541278 2738726372 363
732 iso_pu_bacteria 2738541279 2738732464 363
733 iso_pu_bacteria 2738541285 2738765029 363
734 iso_pu_bacteria 2738543007 2739214044 363
735 iso_pu_bacteria 2738543014 2739254428 363
736 iso_pu_bacteria 2739367857 2740001324 363
737 iso_pu_bacteria 2739367858 2740006140 363
738 iso_pu_bacteria 2802428842 2802653772 363
739 iso_pu_bacteria 2816332280 2817416277 363
740 iso_pu_bacteria 2857613821 2857614955 363
741 iso_pu_bacteria 2857618242 2857618659 363
742 iso_pu_bacteria 2881359912 2881363108 363
743 iso_pu_bacteria 2903895155 2903896889 363
744 iso_pu_bacteria 2904419702 2904422794 363
745 iso_pu_bacteria 2904555929 2904557072 363
746 iso_pu_bacteria 2914759650 2914760592 363
747 iso_pu_bacteria 2919191525 2919195304 363
748 iso_pu_bacteria 2919683626 2919685974 363
749 iso_pu_bacteria 2929150217 2929153565 363
750 iso_pu_bacteria 2929154850 2929157423 363
751 iso_pu_bacteria 2958458903 2958461119 363
752 iso_pu_bacteria 2977268062 2977270229 363
753 iso_pu_bacteria 8054307821 8054310081 363
754 iso_pu_bacteria 8055419101 8055421936 363
755 iso_pu_bacteria 8055592153 8055593424 363
756 iso_pu_bacteria 8056440228 8056443838 363
757 3300005327 Ga0070658_10025309 Ga0070658_100253092 364
758 3300005530 Ga0070679_100006277 Ga0070679_1000062778 364
759 3300013104 Ga0157370_10014206 Ga0157370_100142064 364
760 3300025909 Ga0207705_10061750 Ga0207705_100617502 364
761 3300025912 Ga0207707_10038834 Ga0207707_100388342 364
762 3300025917 Ga0207660_10055888 Ga0207660_100558883 364
763 3300025921 Ga0207652_10001696 Ga0207652_1000169610 364
764 3300037312 Ga0395899_0029186 Ga0395899_0029186_87_1229 364
765 3300037418 Ga0395900_0006601 Ga0395900_0006601_7093_8235 364
766 3300037466 Ga0395898_0097172 Ga0395898_0097172_1038_2180 364
767 3300003323 rootH1_10230245 rootH1_102302451 365
768 3300005289 Ga0065704_10005410 Ga0065704_100054103 365
769 3300005289 Ga0065704_10077961 Ga0065704_100779612 365
770 3300009148 Ga0105243_10062549 Ga0105243_100625492 365
771 3300013102 Ga0157371_10130738 Ga0157371_101307382 365
772 3300013306 Ga0163162_10086163 Ga0163162_100861632 365
773 3300013307 Ga0157372_10434537 Ga0157372_104345372 365
774 3300026088 Ga0207641_10196855 Ga0207641_101968552 365
775 3300031548 Ga0307408_100000121 Ga0307408_10000012164 365
776 3300031548 Ga0307408_100000660 Ga0307408_1000006603 365
777 3300042004 Ga0439445_0005056 Ga0439445_0005056_445_1578 365
778 3300046457 Ga0495590_0003121 Ga0495590_0003121_559_1692 365
779 3300046471 Ga0495650_0012544 Ga0495650_0012544_2521_3660 365
780 3300049571 Ga0501034_0016530 Ga0501034_0016530_2687_3826 365
781 3300049579 Ga0501043_0024314 Ga0501043_0024314_2495_3634 365
782 3300049580 Ga0501046_0045170 Ga0501046_0045170_84_1223 365
783 3300049581 Ga0501047_0072959 Ga0501047_0072959_88_1227 365
784 3300049582 Ga0501048_0043141 Ga0501048_0043141_191_1330 365
785 3300049589 Ga0501073_0019693 Ga0501073_0019693_2559_3698 365
786 3300049590 Ga0501074_0036497 Ga0501074_0036497_2155_3294 365
787 3300049663 Ga0501223_002893 Ga0501223_002893_306_1442 365
788 3300049822 Ga0501035_0015438 Ga0501035_0015438_87_1226 365
789 iso_pu_bacteria 2599185184 2599478339 365
790 iso_pu_bacteria 2852623160 2852623163 365
791 iso_pu_bacteria 2884933994 2884937972 365
792 iso_pu_bacteria 2919437846 2919440791 365
793 iso_pu_bacteria 2928078545 2928080611 365
794 iso_pu_bacteria 2928147474 2928150836 365
795 iso_pu_bacteria 2932082852 2932083004 365
796 iso_pu_bacteria 2977232053 2977232529 365
797 2162886007 SwRhRL2b_contig_787417 SwRhRL2b_0404.00004110 366
798 3300001979 JGI24740J21852_10011978 JGI24740J21852_100119782 366
799 3300002774 JGI25150J39212_1000001 JGI25150J39212_1000001465 366
800 3300002987 JGI25159J45721_1013514 JGI25159J45721_10135141 366
801 3300003187 JGI25151J46595_10000001 JGI25151J46595_10000001337 366
802 3300003215 JGI25153J46596_10000001 JGI25153J46596_10000001226 366
803 3300003320 rootH2_10070248 rootH2_100702481 366
804 3300003322 rootL2_10009890 rootL2_100098902 366
805 3300003322 rootL2_10115167 rootL2_101151671 366
806 3300003354 JGI25160J50197_1006644 JGI25160J50197_10066442 366
807 3300003761 Ga0055535_1004072 Ga0055535_10040722 366
808 3300003762 Ga0055542_1002114 Ga0055542_10021143 366
809 3300003781 Ga0055536_1000001 Ga0055536_1000001273 366
810 3300003791 Ga0055530_10004772 Ga0055530_100047723 366
811 3300003794 Ga0055531_10000131 Ga0055531_1000013142 366
812 3300005262 Ga0065165_1011677 Ga0065165_10116771 366
813 3300005288 Ga0065714_10004089 Ga0065714_100040898 366
814 3300005288 Ga0065714_10027838 Ga0065714_100278381 366
815 3300005288 Ga0065714_10064863 Ga0065714_1006486314 366
816 3300005289 Ga0065704_10000210 Ga0065704_100002105 366
817 3300005618 Ga0068864_100071407 Ga0068864_1000714072 366
818 3300005843 Ga0068860_100081707 Ga0068860_1000817073 366
819 3300006881 Ga0068865_100260016 Ga0068865_1002600161 366
820 3300013100 Ga0157373_10000821 Ga0157373_1000082112 366
821 3300013100 Ga0157373_10004709 Ga0157373_100047096 366
822 3300013102 Ga0157371_10000016 Ga0157371_10000016138 366
823 3300013102 Ga0157371_10001915 Ga0157371_1000191517 366
824 3300013104 Ga0157370_10031451 Ga0157370_100314514 366
825 3300013104 Ga0157370_10036413 Ga0157370_100364134 366
826 3300013105 Ga0157369_10000129 Ga0157369_10000129105 366
827 3300013306 Ga0163162_10000152 Ga0163162_100001528 366
828 3300014497 Ga0182008_10052173 Ga0182008_100521732 366
829 3300014497 Ga0182008_10085277 Ga0182008_100852772 366
830 3300015261 Ga0182006_1000068 Ga0182006_10000684 366
831 3300015261 Ga0182006_1001629 Ga0182006_10016297 366
832 3300015261 Ga0182006_1002952 Ga0182006_100295211 366
833 3300015261 Ga0182006_1003367 Ga0182006_10033674 366
834 3300015262 Ga0182007_10000003 Ga0182007_10000003286 366
835 3300015262 Ga0182007_10017113 Ga0182007_100171132 366
836 3300015682 Ga0183373_1001 Ga0183373_1001679 366
837 3300017792 Ga0163161_10000074 Ga0163161_10000074112 366
838 3300017792 Ga0163161_10015370 Ga0163161_100153704 366
839 3300017792 Ga0163161_10016813 Ga0163161_100168134 366
840 3300017792 Ga0163161_10030157 Ga0163161_100301572 366
841 3300025242 Ga0209258_100151 Ga0209258_10015165 366
842 3300025245 Ga0207425_1000002 Ga0207425_1000002706 366
843 3300025254 Ga0209148_1000154 Ga0209148_100015437 366
844 3300025258 Ga0209129_1000002 Ga0209129_1000002706 366
845 3300025284 Ga0209130_1005416 Ga0209130_10054162 366
846 3300025292 Ga0209676_1000008 Ga0209676_1000008588 366
847 3300025294 Ga0209025_1000004 Ga0209025_1000004484 366
848 3300025297 Ga0209758_1000006 Ga0209758_1000006484 366
849 3300025298 Ga0209050_1000045 Ga0209050_1000045197 366
850 3300025302 Ga0207426_1000051 Ga0207426_1000051336 366
851 3300025302 Ga0207426_1006084 Ga0207426_10060842 366
852 3300025304 Ga0209257_1000001 Ga0209257_10000011449 366
853 3300025986 Ga0207658_10327430 Ga0207658_103274302 366
854 3300026095 Ga0207676_10063266 Ga0207676_100632662 366
855 3300026121 Ga0207683_10250288 Ga0207683_102502882 366
856 3300028381 Ga0268264_10014882 Ga0268264_100148827 366
857 3300028794 Ga0307515_10086237 Ga0307515_100862373 366
858 3300031903 Ga0307407_10000008 Ga0307407_1000000881 366
859 3300031911 Ga0307412_10000427 Ga0307412_100004276 366
860 3300031995 Ga0307409_100008566 Ga0307409_1000085667 366
861 3300032002 Ga0307416_100000009 Ga0307416_100000009229 366
862 3300032004 Ga0307414_10002879 Ga0307414_100028794 366
863 3300032004 Ga0307414_10004631 Ga0307414_100046315 366
864 3300046507 Ga0495606_0053437 Ga0495606_0053437_642_1781 366
865 3300046512 Ga0495610_0006770 Ga0495610_0006770_785_1918 366
866 3300046512 Ga0495610_0010020 Ga0495610_0010020_1840_2973 366
867 3300046558 Ga0495633_0000080 Ga0495633_0000080_5445_6581 366
868 3300046665 Ga0495661_0003611 Ga0495661_0003611_8955_10100 366
869 3300048924 Ga0496121_0000030 Ga0496121_0000030_105_1241 366
870 3300049581 Ga0501047_0027231 Ga0501047_0027231_1609_2745 366
871 3300053088 Ga0500644_0000283 Ga0500644_0000283_10818_11954 366
872 3300053092 Ga0500583_0004742 Ga0500583_0004742_2104_3240 366
873 3300053121 Ga0500607_043640 Ga0500607_043640_842_1978 366
874 3300053134 Ga0500658_0006060 Ga0500658_0006060_990_2126 366
875 3300053153 Ga0500616_0009033 Ga0500616_0009033_183_1319 366
876 3300053156 Ga0500622_0000777 Ga0500622_0000777_18309_19445 366
877 3300053160 Ga0500633_0020452 Ga0500633_0020452_796_1932 366
878 iso_pu_bacteria 2902048731 2902051527 366
879 2162886007 SwRhRL2b_contig_2106057 SwRhRL2b_0439.00005770 367
880 3300001990 JGI24737J22298_10007120 JGI24737J22298_100071202 367
881 3300001990 JGI24737J22298_10007166 JGI24737J22298_100071662 367
882 3300002067 JGI24735J21928_10000004 JGI24735J21928_1000000497 367
883 3300002737 JGI25162J39368_1000011 JGI25162J39368_1000011118 367
884 3300003316 rootH1_10024829 rootH1_1002482914 367
885 3300003320 rootH2_10001891 rootH2_10001891198 367
886 3300003320 rootH2_10013742 rootH2_100137425 367
887 3300003320 rootH2_10090920 rootH2_100909204 367
888 3300003322 rootL2_10102542 rootL2_101025422 367
889 3300003322 rootL2_10124282 rootL2_101242823 367
890 3300003323 rootH1_10000019 rootH1_100000196 367
891 3300003323 rootH1_10196299 rootH1_101962992 367
892 3300003354 JGI25160J50197_1000719 JGI25160J50197_10007199 367
893 3300005288 Ga0065714_10084036 Ga0065714_100840362 367
894 3300005288 Ga0065714_10091768 Ga0065714_100917682 367
895 3300005288 Ga0065714_10095177 Ga0065714_100951772 367
896 3300005289 Ga0065704_10070975 Ga0065704_100709754 367
897 3300005290 Ga0065712_10088970 Ga0065712_100889703 367
898 3300005293 Ga0065715_10133536 Ga0065715_101335362 367
899 3300005327 Ga0070658_10000049 Ga0070658_1000004923 367
900 3300005327 Ga0070658_10054233 Ga0070658_100542332 367
901 3300005328 Ga0070676_10000336 Ga0070676_100003367 367
902 3300005328 Ga0070676_10026339 Ga0070676_100263392 367
903 3300005328 Ga0070676_10030128 Ga0070676_100301282 367
904 3300005329 Ga0070683_100249876 Ga0070683_1002498762 367
905 3300005330 Ga0070690_100039757 Ga0070690_1000397573 367
906 3300005330 Ga0070690_100101551 Ga0070690_1001015512 367
907 3300005330 Ga0070690_100121968 Ga0070690_1001219681 367
908 3300005331 Ga0070670_100022394 Ga0070670_1000223944 367
909 3300005331 Ga0070670_100033933 Ga0070670_1000339333 367
910 3300005331 Ga0070670_100095525 Ga0070670_1000955253 367
911 3300005331 Ga0070670_100096661 Ga0070670_1000966612 367
912 3300005331 Ga0070670_100169959 Ga0070670_1001699591 367
913 3300005333 Ga0070677_10030505 Ga0070677_100305052 367
914 3300005333 Ga0070677_10032555 Ga0070677_100325552 367
915 3300005334 Ga0068869_100003156 Ga0068869_1000031562 367
916 3300005334 Ga0068869_100039400 Ga0068869_1000394002 367
917 3300005334 Ga0068869_100071316 Ga0068869_1000713163 367
918 3300005334 Ga0068869_100092872 Ga0068869_1000928722 367
919 3300005334 Ga0068869_100114106 Ga0068869_1001141062 367
920 3300005334 Ga0068869_100126876 Ga0068869_1001268762 367
921 3300005334 Ga0068869_100129295 Ga0068869_1001292952 367
922 3300005334 Ga0068869_100145294 Ga0068869_1001452943 367
923 3300005334 Ga0068869_100149394 Ga0068869_1001493942 367
924 3300005334 Ga0068869_100200348 Ga0068869_1002003482 367
925 3300005335 Ga0070666_10000051 Ga0070666_1000005115 367
926 3300005335 Ga0070666_10035424 Ga0070666_100354243 367
927 3300005335 Ga0070666_10055085 Ga0070666_100550852 367
928 3300005336 Ga0070680_100014158 Ga0070680_1000141582 367
929 3300005336 Ga0070680_100014310 Ga0070680_1000143102 367
930 3300005337 Ga0070682_100001275 Ga0070682_1000012757 367
931 3300005338 Ga0068868_100008530 Ga0068868_1000085301 367
932 3300005338 Ga0068868_100015143 Ga0068868_1000151434 367
933 3300005338 Ga0068868_100016530 Ga0068868_1000165302 367
934 3300005338 Ga0068868_100020344 Ga0068868_1000203443 367
935 3300005338 Ga0068868_100026273 Ga0068868_1000262734 367
936 3300005339 Ga0070660_100027944 Ga0070660_1000279443 367
937 3300005339 Ga0070660_100045939 Ga0070660_1000459393 367
938 3300005339 Ga0070660_100202184 Ga0070660_1002021841 367
939 3300005340 Ga0070689_100012964 Ga0070689_1000129645 367
940 3300005340 Ga0070689_100020120 Ga0070689_1000201206 367
941 3300005340 Ga0070689_100027105 Ga0070689_1000271052 367
942 3300005340 Ga0070689_100064306 Ga0070689_1000643063 367
943 3300005341 Ga0070691_10004326 Ga0070691_100043263 367
944 3300005341 Ga0070691_10007180 Ga0070691_100071804 367
945 3300005343 Ga0070687_100026921 Ga0070687_1000269213 367
946 3300005344 Ga0070661_100017264 Ga0070661_1000172642 367
947 3300005344 Ga0070661_100023944 Ga0070661_1000239441 367
948 3300005347 Ga0070668_100077511 Ga0070668_1000775112 367
949 3300005347 Ga0070668_100265475 Ga0070668_1002654752 367
950 3300005353 Ga0070669_100004024 Ga0070669_1000040249 367
951 3300005353 Ga0070669_100237792 Ga0070669_1002377921 367
952 3300005354 Ga0070675_100015326 Ga0070675_1000153263 367
953 3300005354 Ga0070675_100016332 Ga0070675_1000163324 367
954 3300005354 Ga0070675_100027340 Ga0070675_1000273404 367
955 3300005355 Ga0070671_100005548 Ga0070671_1000055489 367
956 3300005355 Ga0070671_100038509 Ga0070671_1000385093 367
957 3300005355 Ga0070671_100311131 Ga0070671_1003111312 367
958 3300005356 Ga0070674_100002364 Ga0070674_1000023644 367
959 3300005356 Ga0070674_100111721 Ga0070674_1001117212 367
960 3300005364 Ga0070673_100001990 Ga0070673_1000019902 367
961 3300005364 Ga0070673_100026479 Ga0070673_1000264793 367
962 3300005364 Ga0070673_100047585 Ga0070673_1000475851 367
963 3300005364 Ga0070673_100078015 Ga0070673_1000780153 367
964 3300005364 Ga0070673_100079941 Ga0070673_1000799411 367
965 3300005364 Ga0070673_100212742 Ga0070673_1002127422 367
966 3300005364 Ga0070673_100386908 Ga0070673_1003869081 367
967 3300005365 Ga0070688_100001700 Ga0070688_1000017004 367
968 3300005366 Ga0070659_100004255 Ga0070659_1000042559 367
969 3300005366 Ga0070659_100006368 Ga0070659_1000063686 367
970 3300005366 Ga0070659_100006699 Ga0070659_1000066995 367
971 3300005366 Ga0070659_100086606 Ga0070659_1000866062 367
972 3300005367 Ga0070667_100000492 Ga0070667_10000049225 367
973 3300005367 Ga0070667_100001349 Ga0070667_10000134919 367
974 3300005367 Ga0070667_100121925 Ga0070667_1001219252 367
975 3300005455 Ga0070663_100001195 Ga0070663_10000119512 367
976 3300005456 Ga0070678_100001813 Ga0070678_1000018134 367
977 3300005456 Ga0070678_100024345 Ga0070678_1000243453 367
978 3300005456 Ga0070678_100189828 Ga0070678_1001898282 367
979 3300005457 Ga0070662_100000045 Ga0070662_10000004524 367
980 3300005457 Ga0070662_100004086 Ga0070662_1000040862 367
981 3300005457 Ga0070662_100049317 Ga0070662_1000493172 367
982 3300005458 Ga0070681_10053268 Ga0070681_100532684 367
983 3300005458 Ga0070681_10222079 Ga0070681_102220792 367
984 3300005459 Ga0068867_100004573 Ga0068867_1000045733 367
985 3300005459 Ga0068867_100062000 Ga0068867_1000620002 367
986 3300005459 Ga0068867_100075744 Ga0068867_1000757443 367
987 3300005459 Ga0068867_100188557 Ga0068867_1001885572 367
988 3300005466 Ga0070685_10002206 Ga0070685_100022065 367
989 3300005471 Ga0070698_100043739 Ga0070698_1000437392 367
990 3300005530 Ga0070679_100000634 Ga0070679_1000006349 367
991 3300005530 Ga0070679_100004536 Ga0070679_1000045366 367
992 3300005530 Ga0070679_100200590 Ga0070679_1002005902 367
993 3300005530 Ga0070679_100251163 Ga0070679_1002511632 367
994 3300005535 Ga0070684_100000495 Ga0070684_10000049522 367
995 3300005535 Ga0070684_100005089 Ga0070684_1000050896 367
996 3300005535 Ga0070684_100035368 Ga0070684_1000353684 367
997 3300005535 Ga0070684_100261462 Ga0070684_1002614622 367
998 3300005539 Ga0068853_100000221 Ga0068853_10000022141 367
999 3300005539 Ga0068853_100008065 Ga0068853_1000080655 367
1000 3300005539 Ga0068853_100013393 Ga0068853_1000133936 367
1001 3300005539 Ga0068853_100046538 Ga0068853_1000465383 367
1002 3300005539 Ga0068853_100057348 Ga0068853_1000573483 367
1003 3300005539 Ga0068853_100070430 Ga0068853_1000704302 367
1004 3300005539 Ga0068853_100098422 Ga0068853_1000984222 367
1005 3300005539 Ga0068853_100134731 Ga0068853_1001347311 367
1006 3300005539 Ga0068853_100252364 Ga0068853_1002523642 367
1007 3300005543 Ga0070672_100001489 Ga0070672_1000014892 367
1008 3300005543 Ga0070672_100065616 Ga0070672_1000656162 367
1009 3300005543 Ga0070672_100068525 Ga0070672_1000685251 367
1010 3300005544 Ga0070686_100149017 Ga0070686_1001490172 367
1011 3300005547 Ga0070693_100003483 Ga0070693_1000034832 367
1012 3300005548 Ga0070665_100000020 Ga0070665_100000020207 367
1013 3300005548 Ga0070665_100016967 Ga0070665_1000169675 367
1014 3300005548 Ga0070665_100113957 Ga0070665_1001139572 367
1015 3300005563 Ga0068855_100000089 Ga0068855_1000000894 367
1016 3300005563 Ga0068855_100000240 Ga0068855_1000002403 367
1017 3300005563 Ga0068855_100000346 Ga0068855_10000034634 367
1018 3300005563 Ga0068855_100005837 Ga0068855_1000058377 367
1019 3300005563 Ga0068855_100008169 Ga0068855_1000081697 367
1020 3300005563 Ga0068855_100024825 Ga0068855_1000248255 367
1021 3300005563 Ga0068855_100030585 Ga0068855_1000305854 367
1022 3300005563 Ga0068855_100047040 Ga0068855_1000470404 367
1023 3300005563 Ga0068855_100053363 Ga0068855_1000533632 367
1024 3300005563 Ga0068855_100062842 Ga0068855_1000628423 367
1025 3300005563 Ga0068855_100139053 Ga0068855_1001390535 367
1026 3300005563 Ga0068855_100264801 Ga0068855_1002648012 367
1027 3300005564 Ga0070664_100039376 Ga0070664_1000393763 367
1028 3300005564 Ga0070664_100044954 Ga0070664_1000449543 367
1029 3300005564 Ga0070664_100161976 Ga0070664_1001619761 367
1030 3300005564 Ga0070664_100255598 Ga0070664_1002555982 367
1031 3300005577 Ga0068857_100007822 Ga0068857_1000078228 367
1032 3300005577 Ga0068857_100008143 Ga0068857_1000081436 367
1033 3300005577 Ga0068857_100019055 Ga0068857_1000190556 367
1034 3300005577 Ga0068857_100139189 Ga0068857_1001391892 367
1035 3300005577 Ga0068857_100237126 Ga0068857_1002371262 367
1036 3300005577 Ga0068857_100251550 Ga0068857_1002515502 367
1037 3300005578 Ga0068854_100014860 Ga0068854_1000148602 367
1038 3300005578 Ga0068854_100044551 Ga0068854_1000445513 367
1039 3300005578 Ga0068854_100051761 Ga0068854_1000517611 367
1040 3300005578 Ga0068854_100315201 Ga0068854_1003152011 367
1041 3300005614 Ga0068856_100000835 Ga0068856_10000083520 367
1042 3300005614 Ga0068856_100006910 Ga0068856_1000069103 367
1043 3300005614 Ga0068856_100010959 Ga0068856_1000109597 367
1044 3300005614 Ga0068856_100017673 Ga0068856_1000176731 367
1045 3300005614 Ga0068856_100093470 Ga0068856_1000934702 367
1046 3300005614 Ga0068856_100132644 Ga0068856_1001326442 367
1047 3300005614 Ga0068856_100464115 Ga0068856_1004641151 367
1048 3300005616 Ga0068852_100001345 Ga0068852_1000013452 367
1049 3300005616 Ga0068852_100002479 Ga0068852_1000024797 367
1050 3300005616 Ga0068852_100003445 Ga0068852_10000344511 367
1051 3300005616 Ga0068852_100021932 Ga0068852_1000219326 367
1052 3300005616 Ga0068852_100049232 Ga0068852_1000492322 367
1053 3300005616 Ga0068852_100187804 Ga0068852_1001878041 367
1054 3300005617 Ga0068859_100000037 Ga0068859_1000000375 367
1055 3300005617 Ga0068859_100002554 Ga0068859_10000255422 367
1056 3300005617 Ga0068859_100009853 Ga0068859_1000098536 367
1057 3300005617 Ga0068859_100019039 Ga0068859_1000190392 367
1058 3300005617 Ga0068859_100211719 Ga0068859_1002117192 367
1059 3300005617 Ga0068859_100343093 Ga0068859_1003430932 367
1060 3300005617 Ga0068859_100466366 Ga0068859_1004663661 367
1061 3300005618 Ga0068864_100005800 Ga0068864_1000058004 367
1062 3300005618 Ga0068864_100047161 Ga0068864_1000471612 367
1063 3300005618 Ga0068864_100291107 Ga0068864_1002911072 367
1064 3300005719 Ga0068861_100072756 Ga0068861_1000727562 367
1065 3300005719 Ga0068861_100076439 Ga0068861_1000764393 367
1066 3300005719 Ga0068861_100109468 Ga0068861_1001094682 367
1067 3300005834 Ga0068851_10011215 Ga0068851_100112152 367
1068 3300005834 Ga0068851_10017429 Ga0068851_100174293 367
1069 3300005840 Ga0068870_10028107 Ga0068870_100281072 367
1070 3300005841 Ga0068863_100000412 Ga0068863_10000041217 367
1071 3300005841 Ga0068863_100001812 Ga0068863_10000181229 367
1072 3300005841 Ga0068863_100026107 Ga0068863_1000261073 367
1073 3300005841 Ga0068863_100038028 Ga0068863_1000380284 367
1074 3300005841 Ga0068863_100041343 Ga0068863_1000413431 367
1075 3300005841 Ga0068863_100102832 Ga0068863_1001028323 367
1076 3300005842 Ga0068858_100019340 Ga0068858_1000193404 367
1077 3300005842 Ga0068858_100068957 Ga0068858_1000689572 367
1078 3300005842 Ga0068858_100113886 Ga0068858_1001138863 367
1079 3300005842 Ga0068858_100405101 Ga0068858_1004051012 367
1080 3300005843 Ga0068860_100000916 Ga0068860_10000091627 367
1081 3300005843 Ga0068860_100001316 Ga0068860_10000131613 367
1082 3300005843 Ga0068860_100003283 Ga0068860_10000328316 367
1083 3300005843 Ga0068860_100022244 Ga0068860_1000222444 367
1084 3300005843 Ga0068860_100079593 Ga0068860_1000795932 367
1085 3300005843 Ga0068860_100191982 Ga0068860_1001919822 367
1086 3300005844 Ga0068862_100041877 Ga0068862_1000418774 367
1087 3300005844 Ga0068862_100169907 Ga0068862_1001699072 367
1088 3300005985 Ga0081539_10000531 Ga0081539_1000053130 367
1089 3300005985 Ga0081539_10049494 Ga0081539_100494941 367
1090 3300006195 Ga0075366_10005218 Ga0075366_100052184 367
1091 3300006195 Ga0075366_10020069 Ga0075366_100200694 367
1092 3300006195 Ga0075366_10061158 Ga0075366_100611582 367
1093 3300006237 Ga0097621_100000818 Ga0097621_10000081820 367
1094 3300006237 Ga0097621_100002086 Ga0097621_1000020861 367
1095 3300006237 Ga0097621_100018421 Ga0097621_1000184212 367
1096 3300006237 Ga0097621_100022179 Ga0097621_1000221793 367
1097 3300006237 Ga0097621_100037338 Ga0097621_1000373382 367
1098 3300006358 Ga0068871_100000027 Ga0068871_10000002740 367
1099 3300006358 Ga0068871_100000100 Ga0068871_10000010021 367
1100 3300006358 Ga0068871_100000354 Ga0068871_1000003544 367
1101 3300006358 Ga0068871_100010400 Ga0068871_1000104005 367
1102 3300006358 Ga0068871_100032169 Ga0068871_1000321692 367
1103 3300006358 Ga0068871_100056018 Ga0068871_1000560182 367
1104 3300006844 Ga0075428_100017721 Ga0075428_1000177213 367
1105 3300006844 Ga0075428_100050469 Ga0075428_1000504693 367
1106 3300006844 Ga0075428_100219642 Ga0075428_1002196422 367
1107 3300006846 Ga0075430_100009529 Ga0075430_1000095292 367
1108 3300006847 Ga0075431_100065731 Ga0075431_1000657312 367
1109 3300006880 Ga0075429_100018092 Ga0075429_1000180925 367
1110 3300006880 Ga0075429_100032161 Ga0075429_1000321614 367
1111 3300006880 Ga0075429_100122899 Ga0075429_1001228992 367
1112 3300006881 Ga0068865_100000174 Ga0068865_1000001748 367
1113 3300006881 Ga0068865_100023102 Ga0068865_1000231024 367
1114 3300006881 Ga0068865_100028117 Ga0068865_1000281172 367
1115 3300006931 Ga0097620_100000037 Ga0097620_1000000375 367
1116 3300006931 Ga0097620_100002554 Ga0097620_10000255422 367
1117 3300006931 Ga0097620_100009853 Ga0097620_1000098536 367
1118 3300006931 Ga0097620_100019038 Ga0097620_1000190386 367
1119 3300006931 Ga0097620_100211717 Ga0097620_1002117172 367
1120 3300006931 Ga0097620_100343100 Ga0097620_1003431002 367
1121 3300006931 Ga0097620_100466346 Ga0097620_1004663461 367
1122 3300009036 Ga0105244_10000063 Ga0105244_1000006323 367
1123 3300009093 Ga0105240_10000074 Ga0105240_10000074129 367
1124 3300009093 Ga0105240_10000237 Ga0105240_1000023726 367
1125 3300009093 Ga0105240_10000598 Ga0105240_1000059841 367
1126 3300009093 Ga0105240_10000626 Ga0105240_1000062622 367
1127 3300009093 Ga0105240_10001351 Ga0105240_1000135121 367
1128 3300009093 Ga0105240_10001595 Ga0105240_100015959 367
1129 3300009093 Ga0105240_10002663 Ga0105240_1000266311 367
1130 3300009093 Ga0105240_10007062 Ga0105240_1000706212 367
1131 3300009093 Ga0105240_10008151 Ga0105240_100081514 367
1132 3300009093 Ga0105240_10022028 Ga0105240_100220287 367
1133 3300009093 Ga0105240_10085848 Ga0105240_100858481 367
1134 3300009093 Ga0105240_10305713 Ga0105240_103057132 367
1135 3300009093 Ga0105240_10326021 Ga0105240_103260212 367
1136 3300009094 Ga0111539_10005620 Ga0111539_100056209 367
1137 3300009094 Ga0111539_10067948 Ga0111539_100679482 367
1138 3300009098 Ga0105245_10178928 Ga0105245_101789282 367
1139 3300009101 Ga0105247_10005412 Ga0105247_100054123 367
1140 3300009147 Ga0114129_10033962 Ga0114129_100339625 367
1141 3300009147 Ga0114129_10095953 Ga0114129_100959532 367
1142 3300009174 Ga0105241_10000086 Ga0105241_1000008652 367
1143 3300009174 Ga0105241_10000659 Ga0105241_1000065921 367
1144 3300009174 Ga0105241_10000881 Ga0105241_100008814 367
1145 3300009174 Ga0105241_10003116 Ga0105241_1000311610 367
1146 3300009174 Ga0105241_10057228 Ga0105241_100572283 367
1147 3300009174 Ga0105241_10119203 Ga0105241_101192032 367
1148 3300009176 Ga0105242_10009407 Ga0105242_100094076 367
1149 3300009176 Ga0105242_10013463 Ga0105242_100134634 367
1150 3300009176 Ga0105242_10015906 Ga0105242_100159065 367
1151 3300009176 Ga0105242_10211747 Ga0105242_102117471 367
1152 3300009545 Ga0105237_10000224 Ga0105237_1000022453 367
1153 3300009545 Ga0105237_10001565 Ga0105237_1000156526 367
1154 3300009545 Ga0105237_10003647 Ga0105237_100036473 367
1155 3300009545 Ga0105237_10009395 Ga0105237_100093955 367
1156 3300009545 Ga0105237_10013977 Ga0105237_100139772 367
1157 3300009545 Ga0105237_10028286 Ga0105237_100282862 367
1158 3300009545 Ga0105237_10036976 Ga0105237_100369764 367
1159 3300009545 Ga0105237_10064255 Ga0105237_100642554 367
1160 3300009545 Ga0105237_10135454 Ga0105237_101354542 367
1161 3300009545 Ga0105237_10213852 Ga0105237_102138522 367
1162 3300009551 Ga0105238_10001132 Ga0105238_1000113221 367
1163 3300009551 Ga0105238_10077802 Ga0105238_100778021 367
1164 3300009551 Ga0105238_10097865 Ga0105238_100978653 367
1165 3300009551 Ga0105238_10192735 Ga0105238_101927353 367
1166 3300009551 Ga0105238_10380094 Ga0105238_103800941 367
1167 3300009553 Ga0105249_10002281 Ga0105249_1000228114 367
1168 3300009553 Ga0105249_10005103 Ga0105249_100051038 367
1169 3300009553 Ga0105249_10005252 Ga0105249_100052522 367
1170 3300009553 Ga0105249_10008737 Ga0105249_100087375 367
1171 3300009553 Ga0105249_10012834 Ga0105249_100128342 367
1172 3300009553 Ga0105249_10046215 Ga0105249_100462152 367
1173 3300009553 Ga0105249_10335863 Ga0105249_103358631 367
1174 3300010375 Ga0105239_10000048 Ga0105239_1000004879 367
1175 3300010375 Ga0105239_10001789 Ga0105239_1000178928 367
1176 3300010375 Ga0105239_10001948 Ga0105239_100019483 367
1177 3300010375 Ga0105239_10002090 Ga0105239_1000209019 367
1178 3300010375 Ga0105239_10002752 Ga0105239_100027524 367
1179 3300010375 Ga0105239_10005094 Ga0105239_1000509415 367
1180 3300010375 Ga0105239_10006841 Ga0105239_100068414 367
1181 3300010375 Ga0105239_10008918 Ga0105239_100089183 367
1182 3300010375 Ga0105239_10024710 Ga0105239_100247103 367
1183 3300010375 Ga0105239_10042529 Ga0105239_100425295 367
1184 3300010375 Ga0105239_10130417 Ga0105239_101304172 367
1185 3300010375 Ga0105239_10131149 Ga0105239_101311493 367
1186 3300011119 Ga0105246_10013371 Ga0105246_100133715 367
1187 3300011119 Ga0105246_10053815 Ga0105246_100538153 367
1188 3300013100 Ga0157373_10000002 Ga0157373_10000002529 367
1189 3300013100 Ga0157373_10004786 Ga0157373_100047868 367
1190 3300013100 Ga0157373_10007995 Ga0157373_100079958 367
1191 3300013100 Ga0157373_10013034 Ga0157373_100130346 367
1192 3300013100 Ga0157373_10026029 Ga0157373_100260295 367
1193 3300013100 Ga0157373_10118640 Ga0157373_101186401 367
1194 3300013100 Ga0157373_10221355 Ga0157373_102213551 367
1195 3300013102 Ga0157371_10000135 Ga0157371_1000013553 367
1196 3300013102 Ga0157371_10000563 Ga0157371_1000056326 367
1197 3300013102 Ga0157371_10003112 Ga0157371_100031128 367
1198 3300013102 Ga0157371_10005312 Ga0157371_100053129 367
1199 3300013102 Ga0157371_10024298 Ga0157371_100242981 367
1200 3300013102 Ga0157371_10028632 Ga0157371_100286322 367
1201 3300013102 Ga0157371_10035822 Ga0157371_100358223 367
1202 3300013102 Ga0157371_10042442 Ga0157371_100424423 367
1203 3300013102 Ga0157371_10068485 Ga0157371_100684852 367
1204 3300013102 Ga0157371_10103195 Ga0157371_101031952 367
1205 3300013104 Ga0157370_10000500 Ga0157370_100005007 367
1206 3300013104 Ga0157370_10002014 Ga0157370_100020143 367
1207 3300013104 Ga0157370_10004754 Ga0157370_1000475410 367
1208 3300013104 Ga0157370_10010727 Ga0157370_1001072710 367
1209 3300013104 Ga0157370_10014665 Ga0157370_100146654 367
1210 3300013104 Ga0157370_10180805 Ga0157370_101808052 367
1211 3300013105 Ga0157369_10000475 Ga0157369_100004756 367
1212 3300013105 Ga0157369_10001138 Ga0157369_1000113817 367
1213 3300013105 Ga0157369_10001311 Ga0157369_1000131129 367
1214 3300013105 Ga0157369_10046098 Ga0157369_100460983 367
1215 3300013105 Ga0157369_10078779 Ga0157369_100787793 367
1216 3300013105 Ga0157369_10103039 Ga0157369_101030392 367
1217 3300013105 Ga0157369_10145737 Ga0157369_101457371 367
1218 3300013296 Ga0157374_10000001 Ga0157374_10000001221 367
1219 3300013296 Ga0157374_10000128 Ga0157374_100001287 367
1220 3300013296 Ga0157374_10000202 Ga0157374_1000020216 367
1221 3300013296 Ga0157374_10058779 Ga0157374_100587792 367
1222 3300013296 Ga0157374_10094451 Ga0157374_100944512 367
1223 3300013296 Ga0157374_10095724 Ga0157374_100957243 367
1224 3300013296 Ga0157374_10142797 Ga0157374_101427972 367
1225 3300013296 Ga0157374_10185874 Ga0157374_101858742 367
1226 3300013296 Ga0157374_10249613 Ga0157374_102496132 367
1227 3300013297 Ga0157378_10005717 Ga0157378_100057176 367
1228 3300013297 Ga0157378_10005849 Ga0157378_100058493 367
1229 3300013297 Ga0157378_10031758 Ga0157378_100317583 367
1230 3300013297 Ga0157378_10038652 Ga0157378_100386525 367
1231 3300013297 Ga0157378_10049204 Ga0157378_100492042 367
1232 3300013297 Ga0157378_10100527 Ga0157378_101005272 367
1233 3300013297 Ga0157378_10301761 Ga0157378_103017612 367
1234 3300013297 Ga0157378_10362527 Ga0157378_103625271 367
1235 3300013297 Ga0157378_10426561 Ga0157378_104265612 367
1236 3300013306 Ga0163162_10000032 Ga0163162_1000003229 367
1237 3300013306 Ga0163162_10000331 Ga0163162_100003315 367
1238 3300013306 Ga0163162_10000967 Ga0163162_1000096733 367
1239 3300013306 Ga0163162_10009046 Ga0163162_100090463 367
1240 3300013306 Ga0163162_10010809 Ga0163162_100108094 367
1241 3300013306 Ga0163162_10011763 Ga0163162_100117635 367
1242 3300013306 Ga0163162_10016026 Ga0163162_100160266 367
1243 3300013306 Ga0163162_10026171 Ga0163162_100261712 367
1244 3300013306 Ga0163162_10029333 Ga0163162_100293334 367
1245 3300013306 Ga0163162_10031876 Ga0163162_100318763 367
1246 3300013306 Ga0163162_10052634 Ga0163162_100526343 367
1247 3300013306 Ga0163162_10052936 Ga0163162_100529363 367
1248 3300013306 Ga0163162_10114892 Ga0163162_101148922 367
1249 3300013306 Ga0163162_10117466 Ga0163162_101174663 367
1250 3300013306 Ga0163162_10128129 Ga0163162_101281292 367
1251 3300013306 Ga0163162_10381208 Ga0163162_103812082 367
1252 3300013306 Ga0163162_10393182 Ga0163162_103931822 367
1253 3300013306 Ga0163162_10403773 Ga0163162_104037731 367
1254 3300013307 Ga0157372_10000017 Ga0157372_10000017156 367
1255 3300013307 Ga0157372_10000061 Ga0157372_1000006142 367
1256 3300013307 Ga0157372_10000921 Ga0157372_1000092119 367
1257 3300013307 Ga0157372_10018588 Ga0157372_100185888 367
1258 3300013307 Ga0157372_10034779 Ga0157372_100347795 367
1259 3300013307 Ga0157372_10042883 Ga0157372_100428832 367
1260 3300013307 Ga0157372_10052962 Ga0157372_100529624 367
1261 3300013307 Ga0157372_10098360 Ga0157372_100983602 367
1262 3300013307 Ga0157372_10115846 Ga0157372_101158463 367
1263 3300013307 Ga0157372_10130498 Ga0157372_101304983 367
1264 3300013307 Ga0157372_10146950 Ga0157372_101469504 367
1265 3300013307 Ga0157372_10155057 Ga0157372_101550573 367
1266 3300013307 Ga0157372_10453975 Ga0157372_104539751 367
1267 3300013308 Ga0157375_10000229 Ga0157375_1000022941 367
1268 3300013308 Ga0157375_10003117 Ga0157375_1000311714 367
1269 3300013308 Ga0157375_10011803 Ga0157375_100118035 367
1270 3300013308 Ga0157375_10033928 Ga0157375_100339283 367
1271 3300013308 Ga0157375_10040512 Ga0157375_100405123 367
1272 3300013308 Ga0157375_10052220 Ga0157375_100522203 367
1273 3300013308 Ga0157375_10365735 Ga0157375_103657352 367
1274 3300014325 Ga0163163_10000477 Ga0163163_1000047730 367
1275 3300014325 Ga0163163_10000653 Ga0163163_100006537 367
1276 3300014325 Ga0163163_10260990 Ga0163163_102609902 367
1277 3300014325 Ga0163163_10341979 Ga0163163_103419791 367
1278 3300014326 Ga0157380_10010112 Ga0157380_100101127 367
1279 3300014326 Ga0157380_10022125 Ga0157380_100221252 367
1280 3300014326 Ga0157380_10076848 Ga0157380_100768481 367
1281 3300014326 Ga0157380_10269005 Ga0157380_102690052 367
1282 3300014745 Ga0157377_10004205 Ga0157377_100042052 367
1283 3300014745 Ga0157377_10007108 Ga0157377_100071081 367
1284 3300014745 Ga0157377_10055979 Ga0157377_100559792 367
1285 3300014968 Ga0157379_10001640 Ga0157379_1000164013 367
1286 3300014968 Ga0157379_10002723 Ga0157379_1000272317 367
1287 3300014968 Ga0157379_10032061 Ga0157379_100320614 367
1288 3300014968 Ga0157379_10043311 Ga0157379_100433113 367
1289 3300014968 Ga0157379_10112740 Ga0157379_101127402 367
1290 3300014968 Ga0157379_10262260 Ga0157379_102622602 367
1291 3300014969 Ga0157376_10000721 Ga0157376_100007216 367
1292 3300014969 Ga0157376_10001279 Ga0157376_100012792 367
1293 3300014969 Ga0157376_10002407 Ga0157376_100024072 367
1294 3300014969 Ga0157376_10004414 Ga0157376_100044144 367
1295 3300014969 Ga0157376_10008360 Ga0157376_100083602 367
1296 3300014969 Ga0157376_10062287 Ga0157376_100622872 367
1297 3300014969 Ga0157376_10153139 Ga0157376_101531392 367
1298 3300014969 Ga0157376_10173014 Ga0157376_101730143 367
1299 3300014969 Ga0157376_10211479 Ga0157376_102114792 367
1300 3300015261 Ga0182006_1029738 Ga0182006_10297382 367
1301 3300015261 Ga0182006_1030063 Ga0182006_10300632 367
1302 3300017792 Ga0163161_10000012 Ga0163161_1000001246 367
1303 3300017792 Ga0163161_10024699 Ga0163161_100246995 367
1304 3300017792 Ga0163161_10033399 Ga0163161_100333992 367
1305 3300017792 Ga0163161_10044131 Ga0163161_100441312 367
1306 3300017792 Ga0163161_10148063 Ga0163161_101480632 367
1307 3300021361 Ga0213872_10009314 Ga0213872_100093144 367
1308 3300025233 Ga0209437_100017 Ga0209437_100017280 367
1309 3300025246 Ga0209646_1000745 Ga0209646_10007454 367
1310 3300025302 Ga0207426_1000002 Ga0207426_1000002524 367
1311 3300025321 Ga0207656_10007257 Ga0207656_100072574 367
1312 3300025728 Ga0207655_1000008 Ga0207655_1000008610 367
1313 3300025893 Ga0207682_10010357 Ga0207682_100103572 367
1314 3300025893 Ga0207682_10033618 Ga0207682_100336182 367
1315 3300025899 Ga0207642_10142856 Ga0207642_101428562 367
1316 3300025900 Ga0207710_10002748 Ga0207710_100027489 367
1317 3300025900 Ga0207710_10008558 Ga0207710_100085583 367
1318 3300025901 Ga0207688_10130719 Ga0207688_101307192 367
1319 3300025903 Ga0207680_10000162 Ga0207680_1000016217 367
1320 3300025903 Ga0207680_10023544 Ga0207680_100235442 367
1321 3300025903 Ga0207680_10039495 Ga0207680_100394951 367
1322 3300025903 Ga0207680_10052159 Ga0207680_100521592 367
1323 3300025903 Ga0207680_10208101 Ga0207680_102081011 367
1324 3300025904 Ga0207647_10000105 Ga0207647_1000010528 367
1325 3300025904 Ga0207647_10000511 Ga0207647_1000051116 367
1326 3300025904 Ga0207647_10025074 Ga0207647_100250744 367
1327 3300025904 Ga0207647_10041070 Ga0207647_100410703 367
1328 3300025907 Ga0207645_10000622 Ga0207645_1000062223 367
1329 3300025907 Ga0207645_10001210 Ga0207645_1000121016 367
1330 3300025907 Ga0207645_10003591 Ga0207645_100035911 367
1331 3300025907 Ga0207645_10004714 Ga0207645_100047142 367
1332 3300025908 Ga0207643_10023368 Ga0207643_100233683 367
1333 3300025908 Ga0207643_10104056 Ga0207643_101040561 367
1334 3300025909 Ga0207705_10000079 Ga0207705_1000007977 367
1335 3300025909 Ga0207705_10125830 Ga0207705_101258303 367
1336 3300025911 Ga0207654_10003772 Ga0207654_100037722 367
1337 3300025911 Ga0207654_10005580 Ga0207654_100055804 367
1338 3300025911 Ga0207654_10016294 Ga0207654_100162943 367
1339 3300025912 Ga0207707_10000051 Ga0207707_1000005156 367
1340 3300025912 Ga0207707_10283405 Ga0207707_102834052 367
1341 3300025913 Ga0207695_10000013 Ga0207695_1000001327 367
1342 3300025913 Ga0207695_10000071 Ga0207695_10000071234 367
1343 3300025913 Ga0207695_10000084 Ga0207695_10000084213 367
1344 3300025913 Ga0207695_10000323 Ga0207695_1000032361 367
1345 3300025913 Ga0207695_10001232 Ga0207695_100012328 367
1346 3300025913 Ga0207695_10004447 Ga0207695_1000444715 367
1347 3300025913 Ga0207695_10004602 Ga0207695_1000460217 367
1348 3300025913 Ga0207695_10009118 Ga0207695_1000911811 367
1349 3300025913 Ga0207695_10026849 Ga0207695_100268492 367
1350 3300025913 Ga0207695_10040999 Ga0207695_100409995 367
1351 3300025913 Ga0207695_10084921 Ga0207695_100849212 367
1352 3300025913 Ga0207695_10094245 Ga0207695_100942452 367
1353 3300025914 Ga0207671_10000272 Ga0207671_100002725 367
1354 3300025914 Ga0207671_10001497 Ga0207671_100014973 367
1355 3300025914 Ga0207671_10002907 Ga0207671_100029078 367
1356 3300025914 Ga0207671_10005889 Ga0207671_100058899 367
1357 3300025914 Ga0207671_10008744 Ga0207671_100087445 367
1358 3300025914 Ga0207671_10014622 Ga0207671_100146223 367
1359 3300025914 Ga0207671_10021459 Ga0207671_100214594 367
1360 3300025914 Ga0207671_10119489 Ga0207671_101194893 367
1361 3300025917 Ga0207660_10044410 Ga0207660_100444103 367
1362 3300025918 Ga0207662_10004762 Ga0207662_100047624 367
1363 3300025918 Ga0207662_10016297 Ga0207662_100162973 367
1364 3300025919 Ga0207657_10049826 Ga0207657_100498263 367
1365 3300025919 Ga0207657_10110330 Ga0207657_101103302 367
1366 3300025920 Ga0207649_10150443 Ga0207649_101504431 367
1367 3300025921 Ga0207652_10000384 Ga0207652_1000038427 367
1368 3300025923 Ga0207681_10037670 Ga0207681_100376702 367
1369 3300025924 Ga0207694_10007231 Ga0207694_100072313 367
1370 3300025924 Ga0207694_10097905 Ga0207694_100979052 367
1371 3300025925 Ga0207650_10019073 Ga0207650_100190732 367
1372 3300025925 Ga0207650_10042343 Ga0207650_100423432 367
1373 3300025925 Ga0207650_10062339 Ga0207650_100623392 367
1374 3300025925 Ga0207650_10066978 Ga0207650_100669782 367
1375 3300025925 Ga0207650_10084184 Ga0207650_100841842 367
1376 3300025925 Ga0207650_10173709 Ga0207650_101737092 367
1377 3300025926 Ga0207659_10008155 Ga0207659_100081553 367
1378 3300025926 Ga0207659_10053334 Ga0207659_100533342 367
1379 3300025927 Ga0207687_10196626 Ga0207687_101966262 367
1380 3300025931 Ga0207644_10002938 Ga0207644_100029382 367
1381 3300025931 Ga0207644_10075688 Ga0207644_100756883 367
1382 3300025932 Ga0207690_10000318 Ga0207690_1000031830 367
1383 3300025932 Ga0207690_10023288 Ga0207690_100232884 367
1384 3300025932 Ga0207690_10058473 Ga0207690_100584732 367
1385 3300025932 Ga0207690_10076849 Ga0207690_100768492 367
1386 3300025933 Ga0207706_10000120 Ga0207706_1000012041 367
1387 3300025933 Ga0207706_10029817 Ga0207706_100298174 367
1388 3300025933 Ga0207706_10083306 Ga0207706_100833062 367
1389 3300025933 Ga0207706_10153267 Ga0207706_101532671 367
1390 3300025934 Ga0207686_10000546 Ga0207686_100005464 367
1391 3300025934 Ga0207686_10024502 Ga0207686_100245022 367
1392 3300025936 Ga0207670_10080132 Ga0207670_100801321 367
1393 3300025938 Ga0207704_10000099 Ga0207704_1000009914 367
1394 3300025940 Ga0207691_10002527 Ga0207691_100025275 367
1395 3300025940 Ga0207691_10004310 Ga0207691_100043102 367
1396 3300025940 Ga0207691_10027226 Ga0207691_100272263 367
1397 3300025940 Ga0207691_10172503 Ga0207691_101725032 367
1398 3300025942 Ga0207689_10008841 Ga0207689_100088413 367
1399 3300025942 Ga0207689_10009849 Ga0207689_100098497 367
1400 3300025942 Ga0207689_10017703 Ga0207689_100177032 367
1401 3300025942 Ga0207689_10022258 Ga0207689_100222584 367
1402 3300025942 Ga0207689_10025477 Ga0207689_100254773 367
1403 3300025942 Ga0207689_10085796 Ga0207689_100857962 367
1404 3300025942 Ga0207689_10100672 Ga0207689_101006722 367
1405 3300025942 Ga0207689_10169592 Ga0207689_101695921 367
1406 3300025944 Ga0207661_10027722 Ga0207661_100277224 367
1407 3300025945 Ga0207679_10007258 Ga0207679_100072585 367
1408 3300025945 Ga0207679_10036528 Ga0207679_100365281 367
1409 3300025949 Ga0207667_10000037 Ga0207667_10000037130 367
1410 3300025949 Ga0207667_10000177 Ga0207667_1000017719 367
1411 3300025949 Ga0207667_10007957 Ga0207667_100079576 367
1412 3300025949 Ga0207667_10011669 Ga0207667_100116693 367
1413 3300025949 Ga0207667_10015290 Ga0207667_100152901 367
1414 3300025949 Ga0207667_10017914 Ga0207667_100179147 367
1415 3300025949 Ga0207667_10028059 Ga0207667_100280593 367
1416 3300025949 Ga0207667_10038231 Ga0207667_100382314 367
1417 3300025949 Ga0207667_10048612 Ga0207667_100486122 367
1418 3300025949 Ga0207667_10144396 Ga0207667_101443962 367
1419 3300025949 Ga0207667_10223392 Ga0207667_102233922 367
1420 3300025949 Ga0207667_10224780 Ga0207667_102247801 367
1421 3300025960 Ga0207651_10001099 Ga0207651_100010992 367
1422 3300025960 Ga0207651_10005116 Ga0207651_100051164 367
1423 3300025960 Ga0207651_10021365 Ga0207651_100213653 367
1424 3300025960 Ga0207651_10037220 Ga0207651_100372203 367
1425 3300025961 Ga0207712_10002040 Ga0207712_1000204010 367
1426 3300025961 Ga0207712_10004495 Ga0207712_100044956 367
1427 3300025961 Ga0207712_10007103 Ga0207712_100071036 367
1428 3300025961 Ga0207712_10016647 Ga0207712_100166472 367
1429 3300025961 Ga0207712_10037202 Ga0207712_100372022 367
1430 3300025972 Ga0207668_10165388 Ga0207668_101653882 367
1431 3300025981 Ga0207640_10014412 Ga0207640_100144122 367
1432 3300025981 Ga0207640_10043616 Ga0207640_100436161 367
1433 3300025981 Ga0207640_10300155 Ga0207640_103001551 367
1434 3300025986 Ga0207658_10007260 Ga0207658_100072606 367
1435 3300025986 Ga0207658_10024494 Ga0207658_100244944 367
1436 3300025986 Ga0207658_10156711 Ga0207658_101567112 367
1437 3300025986 Ga0207658_10249189 Ga0207658_102491892 367
1438 3300026023 Ga0207677_10014691 Ga0207677_100146915 367
1439 3300026023 Ga0207677_10085142 Ga0207677_100851422 367
1440 3300026035 Ga0207703_10004370 Ga0207703_100043707 367
1441 3300026035 Ga0207703_10102381 Ga0207703_101023812 367
1442 3300026035 Ga0207703_10158557 Ga0207703_101585572 367
1443 3300026041 Ga0207639_10001126 Ga0207639_1000112619 367
1444 3300026041 Ga0207639_10015924 Ga0207639_100159244 367
1445 3300026041 Ga0207639_10022108 Ga0207639_100221084 367
1446 3300026041 Ga0207639_10047659 Ga0207639_100476594 367
1447 3300026041 Ga0207639_10065475 Ga0207639_100654753 367
1448 3300026041 Ga0207639_10151182 Ga0207639_101511822 367
1449 3300026041 Ga0207639_10242079 Ga0207639_102420792 367
1450 3300026067 Ga0207678_10038074 Ga0207678_100380742 367
1451 3300026078 Ga0207702_10000196 Ga0207702_1000019654 367
1452 3300026078 Ga0207702_10009327 Ga0207702_100093272 367
1453 3300026078 Ga0207702_10032297 Ga0207702_100322973 367
1454 3300026078 Ga0207702_10042660 Ga0207702_100426602 367
1455 3300026078 Ga0207702_10206373 Ga0207702_102063731 367
1456 3300026078 Ga0207702_10251550 Ga0207702_102515501 367
1457 3300026088 Ga0207641_10000226 Ga0207641_1000022645 367
1458 3300026088 Ga0207641_10000253 Ga0207641_1000025332 367
1459 3300026088 Ga0207641_10043904 Ga0207641_100439043 367
1460 3300026089 Ga0207648_10002506 Ga0207648_100025062 367
1461 3300026089 Ga0207648_10003327 Ga0207648_100033272 367
1462 3300026089 Ga0207648_10004019 Ga0207648_1000401913 367
1463 3300026089 Ga0207648_10018210 Ga0207648_100182104 367
1464 3300026089 Ga0207648_10021796 Ga0207648_100217963 367
1465 3300026089 Ga0207648_10034323 Ga0207648_100343233 367
1466 3300026089 Ga0207648_10060760 Ga0207648_100607602 367
1467 3300026089 Ga0207648_10104599 Ga0207648_101045993 367
1468 3300026095 Ga0207676_10009837 Ga0207676_100098377 367
1469 3300026095 Ga0207676_10045351 Ga0207676_100453512 367
1470 3300026095 Ga0207676_10120226 Ga0207676_101202261 367
1471 3300026095 Ga0207676_10159764 Ga0207676_101597642 367
1472 3300026116 Ga0207674_10000672 Ga0207674_1000067214 367
1473 3300026116 Ga0207674_10006740 Ga0207674_1000674014 367
1474 3300026116 Ga0207674_10017537 Ga0207674_100175376 367
1475 3300026116 Ga0207674_10054469 Ga0207674_100544694 367
1476 3300026116 Ga0207674_10054880 Ga0207674_100548805 367
1477 3300026116 Ga0207674_10084731 Ga0207674_100847314 367
1478 3300026116 Ga0207674_10103679 Ga0207674_101036792 367
1479 3300026116 Ga0207674_10106119 Ga0207674_101061193 367
1480 3300026116 Ga0207674_10110348 Ga0207674_101103484 367
1481 3300026116 Ga0207674_10264485 Ga0207674_102644852 367
1482 3300026118 Ga0207675_100000304 Ga0207675_1000003046 367
1483 3300026118 Ga0207675_100014435 Ga0207675_1000144353 367
1484 3300026118 Ga0207675_100048449 Ga0207675_1000484493 367
1485 3300026118 Ga0207675_100080172 Ga0207675_1000801722 367
1486 3300026118 Ga0207675_100083807 Ga0207675_1000838073 367
1487 3300026121 Ga0207683_10003712 Ga0207683_100037128 367
1488 3300026121 Ga0207683_10005010 Ga0207683_100050104 367
1489 3300026142 Ga0207698_10001082 Ga0207698_1000108213 367
1490 3300026142 Ga0207698_10002060 Ga0207698_100020607 367
1491 3300026142 Ga0207698_10004520 Ga0207698_100045203 367
1492 3300026142 Ga0207698_10056964 Ga0207698_100569642 367
1493 3300027111 Ga0209281_1000094 Ga0209281_10000949 367
1494 3300027471 Ga0209995_1001337 Ga0209995_10013373 367
1495 3300027526 Ga0209968_1002355 Ga0209968_10023552 367
1496 3300027617 Ga0210002_1001420 Ga0210002_10014203 367
1497 3300027876 Ga0209974_10017789 Ga0209974_100177893 367
1498 3300028379 Ga0268266_10000018 Ga0268266_10000018284 367
1499 3300028379 Ga0268266_10000049 Ga0268266_1000004971 367
1500 3300028380 Ga0268265_10014622 Ga0268265_100146223 367
1501 3300028380 Ga0268265_10019901 Ga0268265_100199012 367
1502 3300028381 Ga0268264_10000041 Ga0268264_10000041304 367
1503 3300028381 Ga0268264_10001720 Ga0268264_100017208 367
1504 3300028381 Ga0268264_10003860 Ga0268264_1000386011 367
1505 3300028381 Ga0268264_10009362 Ga0268264_100093626 367
1506 3300028381 Ga0268264_10011235 Ga0268264_100112358 367
1507 3300028381 Ga0268264_10022519 Ga0268264_100225194 367
1508 3300028381 Ga0268264_10054823 Ga0268264_100548234 367
1509 3300028381 Ga0268264_10066048 Ga0268264_100660483 367
1510 3300028381 Ga0268264_10166098 Ga0268264_101660982 367
1511 3300028786 Ga0307517_10002048 Ga0307517_100020485 367
1512 3300028786 Ga0307517_10004683 Ga0307517_1000468313 367
1513 3300028794 Ga0307515_10000001 Ga0307515_10000001944 367
1514 3300028794 Ga0307515_10001752 Ga0307515_1000175245 367
1515 3300028794 Ga0307515_10002910 Ga0307515_1000291033 367
1516 3300028794 Ga0307515_10014453 Ga0307515_100144539 367
1517 3300028800 Ga0265338_10138998 Ga0265338_101389982 367
1518 3300030521 Ga0307511_10000042 Ga0307511_1000004275 367
1519 3300031251 Ga0265327_10000192 Ga0265327_1000019266 367
1520 3300031251 Ga0265327_10000653 Ga0265327_1000065337 367
1521 3300031507 Ga0307509_10105279 Ga0307509_101052792 367
1522 3300031548 Ga0307408_100000611 Ga0307408_10000061112 367
1523 3300031548 Ga0307408_100001373 Ga0307408_10000137314 367
1524 3300031548 Ga0307408_100002250 Ga0307408_1000022508 367
1525 3300031730 Ga0307516_10003117 Ga0307516_100031177 367
1526 3300031824 Ga0307413_10001112 Ga0307413_100011122 367
1527 3300031824 Ga0307413_10185404 Ga0307413_101854042 367
1528 3300031852 Ga0307410_10000067 Ga0307410_100000676 367
1529 3300031901 Ga0307406_10000035 Ga0307406_1000003546 367
1530 3300031903 Ga0307407_10048190 Ga0307407_100481902 367
1531 3300031911 Ga0307412_10001456 Ga0307412_100014562 367
1532 3300032002 Ga0307416_100000639 Ga0307416_1000006395 367
1533 3300032004 Ga0307414_10000063 Ga0307414_1000006332 367
1534 3300032004 Ga0307414_10008231 Ga0307414_100082315 367
1535 3300032004 Ga0307414_10086212 Ga0307414_100862122 367
1536 3300032005 Ga0307411_10000001 Ga0307411_10000001448 367
1537 3300033179 Ga0307507_10000064 Ga0307507_1000006453 367
1538 3300033179 Ga0307507_10110315 Ga0307507_101103152 367
1539 3300033180 Ga0307510_10002860 Ga0307510_1000286015 367
1540 3300033180 Ga0307510_10041880 Ga0307510_100418804 367
1541 3300035115 Ga0373941_0013117 Ga0373941_0013117_77_1225 367
1542 3300035725 Ga0373947_0056584 Ga0373947_0056584_250_1452 367
1543 3300036401 Ga0373937_0078419 Ga0373937_0078419_625_1764 367
1544 3300036401 Ga0373937_0287874 Ga0373937_0287874_387_1526 367
1545 3300037312 Ga0395899_0000033 Ga0395899_0000033_31381_32532 367
1546 3300037312 Ga0395899_0000493 Ga0395899_0000493_27811_28959 367
1547 3300037312 Ga0395899_0000629 Ga0395899_0000629_16749_17897 367
1548 3300037312 Ga0395899_0001884 Ga0395899_0001884_4037_5179 367
1549 3300037312 Ga0395899_0066951 Ga0395899_0066951_391_1533 367
1550 3300037312 Ga0395899_0126590 Ga0395899_0126590_447_1589 367
1551 3300037418 Ga0395900_0000480 Ga0395900_0000480_31030_32178 367
1552 3300037418 Ga0395900_0000506 Ga0395900_0000506_29980_31128 367
1553 3300037418 Ga0395900_0009920 Ga0395900_0009920_4291_5439 367
1554 3300037418 Ga0395900_0012177 Ga0395900_0012177_2899_4041 367
1555 3300037466 Ga0395898_0001651 Ga0395898_0001651_22246_23388 367
1556 3300037466 Ga0395898_0006652 Ga0395898_0006652_10473_11621 367
1557 3300037466 Ga0395898_0031717 Ga0395898_0031717_923_2065 367
1558 3300037466 Ga0395898_0058562 Ga0395898_0058562_725_1873 367
1559 3300037471 Ga0395905_0000738 Ga0395905_0000738_10918_12066 367
1560 3300037471 Ga0395905_0001166 Ga0395905_0001166_28590_29738 367
1561 3300037471 Ga0395905_0006569 Ga0395905_0006569_5027_6169 367
1562 3300038443 Ga0395901_0000853 Ga0395901_0000853_8708_9856 367
1563 3300038443 Ga0395901_0004350 Ga0395901_0004350_1557_2699 367
1564 3300038443 Ga0395901_0010578 Ga0395901_0010578_4917_6059 367
1565 3300038443 Ga0395901_0119295 Ga0395901_0119295_1103_2245 367
1566 3300039447 Ga0436361_0021149 Ga0436361_0021149_5516_6664 367
1567 3300041404 Ga0439436_0033356 Ga0439436_0033356_148_1287 367
1568 3300041411 Ga0439466_0001850 Ga0439466_0001850_3121_4257 367
1569 3300042014 Ga0439457_003825 Ga0439457_003825_813_1952 367
1570 3300042015 Ga0439462_0005205 Ga0439462_0005205_21_1160 367
1571 3300044656 Ga0466969_0000912 Ga0466969_0000912_8694_9833 367
1572 3300044658 Ga0466972_0000002 Ga0466972_0000002_12668_13807 367
1573 3300044658 Ga0466972_0000013 Ga0466972_0000013_73866_75005 367
1574 3300044683 Ga0466965_0031585 Ga0466965_0031585_542_1681 367
1575 3300044684 Ga0466966_0000045 Ga0466966_0000045_85484_86623 367
1576 3300044684 Ga0466966_0053935 Ga0466966_0053935_266_1414 367
1577 3300044693 Ga0466961_0033719 Ga0466961_0033719_1933_3072 367
1578 3300044712 Ga0453684_0354844 Ga0453684_0354844_127_1266 367
1579 3300044712 Ga0453684_0508637 Ga0453684_0508637_176_1321 367
1580 3300044719 Ga0466971_0011181 Ga0466971_0011181_998_2137 367
1581 3300044735 Ga0466968_0012998 Ga0466968_0012998_812_1951 367
1582 3300044735 Ga0466968_0038964 Ga0466968_0038964_298_1437 367
1583 3300044765 Ga0466970_0000765 Ga0466970_0000765_12416_13555 367
1584 3300044765 Ga0466970_0045474 Ga0466970_0045474_752_1891 367
1585 3300044765 Ga0466970_0057555 Ga0466970_0057555_751_1890 367
1586 3300044842 Ga0466957_0000070 Ga0466957_0000070_23027_24166 367
1587 3300044842 Ga0466957_0003333 Ga0466957_0003333_1751_2890 367
1588 3300045049 Ga0466959_0000023 Ga0466959_0000023_91667_92806 367
1589 3300045049 Ga0466959_0004264 Ga0466959_0004264_7285_8424 367
1590 3300045049 Ga0466959_0216616 Ga0466959_0216616_48_1187 367
1591 3300046463 Ga0495653_0134127 Ga0495653_0134127_532_1722 367
1592 3300046471 Ga0495650_0000087 Ga0495650_0000087_14703_15842 367
1593 3300046472 Ga0495580_0176230 Ga0495580_0176230_144_1283 367
1594 3300046492 Ga0495585_0000286 Ga0495585_0000286_39308_40447 367
1595 3300046492 Ga0495585_0001651 Ga0495585_0001651_10798_11940 367
1596 3300046507 Ga0495606_0000052 Ga0495606_0000052_179088_180230 367
1597 3300046507 Ga0495606_0014847 Ga0495606_0014847_4480_5628 367
1598 3300046507 Ga0495606_0131942 Ga0495606_0131942_13_1155 367
1599 3300046512 Ga0495610_0000903 Ga0495610_0000903_8449_9591 367
1600 3300046513 Ga0495616_0005196 Ga0495616_0005196_2948_4090 367
1601 3300046516 Ga0495628_0046274 Ga0495628_0046274_2041_3180 367
1602 3300046517 Ga0495630_0023979 Ga0495630_0023979_2516_3655 367
1603 3300046518 Ga0495631_0061416 Ga0495631_0061416_54_1196 367
1604 3300046524 Ga0495648_0003874 Ga0495648_0003874_7844_8983 367
1605 3300046529 Ga0495652_0150381 Ga0495652_0150381_498_1640 367
1606 3300046529 Ga0495652_0183721 Ga0495652_0183721_19_1167 367
1607 3300046536 Ga0495587_0011934 Ga0495587_0011934_2012_3151 367
1608 3300046538 Ga0495609_0012533 Ga0495609_0012533_2001_3143 367
1609 3300046558 Ga0495633_0000081 Ga0495633_0000081_46781_47923 367
1610 3300046616 Ga0495668_0000012 Ga0495668_0000012_275320_276462 367
1611 3300046616 Ga0495668_0000751 Ga0495668_0000751_30472_31611 367
1612 3300046648 Ga0495611_0001116 Ga0495611_0001116_7521_8675 367
1613 3300046660 Ga0495625_0000036 Ga0495625_0000036_7828_8970 367
1614 3300046660 Ga0495625_0002289 Ga0495625_0002289_6651_7793 367
1615 3300046660 Ga0495625_0010136 Ga0495625_0010136_162_1304 367
1616 3300046660 Ga0495625_0014574 Ga0495625_0014574_2022_3164 367
1617 3300046665 Ga0495661_0015900 Ga0495661_0015900_3671_4810 367
1618 3300046665 Ga0495661_0054910 Ga0495661_0054910_493_1641 367
1619 3300046675 Ga0495657_0093194 Ga0495657_0093194_515_1654 367
1620 3300046683 Ga0495658_0027377 Ga0495658_0027377_737_1879 367
1621 3300046683 Ga0495658_0068601 Ga0495658_0068601_130_1269 367
1622 3300046691 Ga0495670_0033633 Ga0495670_0033633_1040_2182 367
1623 3300046691 Ga0495670_0091140 Ga0495670_0091140_249_1388 367
1624 3300046694 Ga0495649_0000017 Ga0495649_0000017_212741_213883 367
1625 3300046694 Ga0495649_0014914 Ga0495649_0014914_702_1841 367
1626 3300046694 Ga0495649_0135922 Ga0495649_0135922_91_1230 367
1627 3300046810 Ga0495660_0013731 Ga0495660_0013731_1336_2478 367
1628 3300047319 Ga0495674_0225205 Ga0495674_0225205_397_1536 367
1629 3300047320 Ga0495672_0012654 Ga0495672_0012654_2213_3355 367
1630 3300047320 Ga0495672_0030914 Ga0495672_0030914_1809_2948 367
1631 3300047443 Ga0495687_000001 Ga0495687_000001_349982_351121 367
1632 3300047443 Ga0495687_001156 Ga0495687_001156_23932_25080 367
1633 3300047443 Ga0495687_004759 Ga0495687_004759_7409_8548 367
1634 3300047471 Ga0495684_0059523 Ga0495684_0059523_76_1266 367
1635 3300047472 Ga0495686_0000004 Ga0495686_0000004_413380_414519 367
1636 3300047472 Ga0495686_0000582 Ga0495686_0000582_25062_26204 367
1637 3300047472 Ga0495686_0020028 Ga0495686_0020028_1829_2971 367
1638 3300047472 Ga0495686_0079786 Ga0495686_0079786_201_1403 367
1639 3300048089 Ga0495614_0015805 Ga0495614_0015805_2013_3155 367
1640 3300048903 Ga0496100_0035115 Ga0496100_0035115_32_1171 367
1641 3300048911 Ga0496108_0142405 Ga0496108_0142405_35_1174 367
1642 3300048921 Ga0496118_0065557 Ga0496118_0065557_550_1686 367
1643 3300048924 Ga0496121_0021002 Ga0496121_0021002_5250_6386 367
1644 3300048927 Ga0496124_0096704 Ga0496124_0096704_1211_2347 367
1645 3300048928 Ga0496125_0000059 Ga0496125_0000059_141828_142964 367
1646 3300048929 Ga0496126_0008790 Ga0496126_0008790_5941_7077 367
1647 3300049568 Ga0501031_0003605 Ga0501031_0003605_2839_3981 367
1648 3300049569 Ga0501032_0030825 Ga0501032_0030825_449_1588 367
1649 3300049571 Ga0501034_0004012 Ga0501034_0004012_8612_9751 367
1650 3300049571 Ga0501034_0018957 Ga0501034_0018957_3593_4735 367
1651 3300049571 Ga0501034_0110395 Ga0501034_0110395_12_1154 367
1652 3300049571 Ga0501034_0151692 Ga0501034_0151692_489_1631 367
1653 3300049571 Ga0501034_0167744 Ga0501034_0167744_962_2104 367
1654 3300049571 Ga0501034_0225484 Ga0501034_0225484_181_1320 367
1655 3300049572 Ga0501036_0029789 Ga0501036_0029789_3135_4277 367
1656 3300049572 Ga0501036_0205073 Ga0501036_0205073_458_1600 367
1657 3300049573 Ga0501037_0046526 Ga0501037_0046526_1301_2443 367
1658 3300049573 Ga0501037_0046561 Ga0501037_0046561_1957_3096 367
1659 3300049574 Ga0501038_0012291 Ga0501038_0012291_2971_4113 367
1660 3300049574 Ga0501038_0060482 Ga0501038_0060482_1758_2897 367
1661 3300049575 Ga0501039_0212900 Ga0501039_0212900_60_1202 367
1662 3300049579 Ga0501043_0016678 Ga0501043_0016678_3235_4377 367
1663 3300049581 Ga0501047_0021075 Ga0501047_0021075_5098_6237 367
1664 3300049581 Ga0501047_0180380 Ga0501047_0180380_658_1797 367
1665 3300049654 Ga0501207_007577 Ga0501207_007577_314_1453 367
1666 3300049668 Ga0501233_003872 Ga0501233_003872_819_1958 367
1667 3300049669 Ga0501235_003383 Ga0501235_003383_133_1272 367
1668 3300049671 Ga0501238_002082 Ga0501238_002082_286_1422 367
1669 3300049679 Ga0501249_000037 Ga0501249_000037_33575_34711 367
1670 3300049682 Ga0501252_001366 Ga0501252_001366_298_1437 367
1671 3300049704 Ga0501221_000044 Ga0501221_000044_7103_8242 367
1672 3300049707 Ga0501234_012219 Ga0501234_012219_175_1314 367
1673 3300049742 Ga0501080_0083979 Ga0501080_0083979_533_1675 367
1674 3300049744 Ga0501083_0056426 Ga0501083_0056426_110_1267 367
1675 3300049763 Ga0501266_000011 Ga0501266_000011_186936_188072 367
1676 3300049776 Ga0501280_005944 Ga0501280_005944_447_1583 367
1677 3300049776 Ga0501280_006796 Ga0501280_006796_436_1575 367
1678 3300049822 Ga0501035_0048319 Ga0501035_0048319_115_1257 367
1679 3300049822 Ga0501035_0082433 Ga0501035_0082433_509_1651 367
1680 3300049823 Ga0501044_0017840 Ga0501044_0017840_1767_2909 367
1681 3300049823 Ga0501044_0021863 Ga0501044_0021863_4598_5737 367
1682 3300049823 Ga0501044_0054836 Ga0501044_0054836_864_2003 367
1683 3300050493 nmdc:mga0k408_124405_c1 nmdc:mga0k408_124405_c1_377_1516 367
1684 3300050493 nmdc:mga0k408_127396_c1 nmdc:mga0k408_127396_c1_293_1432 367
1685 3300050493 nmdc:mga0k408_3518_c1 nmdc:mga0k408_3518_c1_5330_6469 367
1686 3300050493 nmdc:mga0k408_749_c1 nmdc:mga0k408_749_c1_15587_16738 367
1687 3300050493 nmdc:mga0k408_821_c1 nmdc:mga0k408_821_c1_6402_7544 367
1688 3300050507 nmdc:mga05p37_60273_c1 nmdc:mga05p37_60273_c1_1126_2313 367
1689 3300050508 nmdc:mga09592_983_c1 nmdc:mga09592_983_c1_19565_20716 367
1690 3300050509 nmdc:mga0qj67_97741_c1 nmdc:mga0qj67_97741_c1_1068_2210 367
1691 3300050510 nmdc:mga06r32_98089_c1 nmdc:mga06r32_98089_c1_718_1860 367
1692 3300050511 nmdc:mga08y16_244111_c1 nmdc:mga08y16_244111_c1_565_1707 367
1693 3300053086 Ga0500578_0004418 Ga0500578_0004418_4928_6067 367
1694 3300053090 Ga0500646_0001428 Ga0500646_0001428_3425_4564 367
1695 3300053090 Ga0500646_0004317 Ga0500646_0004317_1033_2169 367
1696 3300053092 Ga0500583_0000108 Ga0500583_0000108_23537_24676 367
1697 3300053096 Ga0500641_0000017 Ga0500641_0000017_114729_115865 367
1698 3300053096 Ga0500641_0002621 Ga0500641_0002621_1616_2752 367
1699 3300053108 Ga0500562_000050 Ga0500562_000050_39185_40333 367
1700 3300053111 Ga0500572_020975 Ga0500572_020975_501_1640 367
1701 3300053122 Ga0500608_004098 Ga0500608_004098_4273_5421 367
1702 3300053122 Ga0500608_016279 Ga0500608_016279_2160_3302 367
1703 3300053123 Ga0500614_006386 Ga0500614_006386_38_1180 367
1704 3300053125 Ga0500618_000002 Ga0500618_000002_52119_53303 367
1705 3300053131 Ga0500652_072800 Ga0500652_072800_98_1237 367
1706 3300053134 Ga0500658_0000003 Ga0500658_0000003_166729_167865 367
1707 3300053138 Ga0500564_024121 Ga0500564_024121_700_1842 367
1708 3300053139 Ga0500568_0001545 Ga0500568_0001545_4957_6096 367
1709 3300053147 Ga0500589_003337 Ga0500589_003337_958_2097 367
1710 3300053151 Ga0500604_0021565 Ga0500604_0021565_226_1365 367
1711 3300053153 Ga0500616_0059069 Ga0500616_0059069_697_1845 367
1712 3300053156 Ga0500622_0004378 Ga0500622_0004378_3062_4210 367
1713 3300053156 Ga0500622_0004557 Ga0500622_0004557_63_1214 367
1714 3300053156 Ga0500622_0005633 Ga0500622_0005633_6238_7377 367
1715 3300053178 Ga0500637_0167162 Ga0500637_0167162_69_1208 367
1716 3300053727 Ga0500611_000022 Ga0500611_000022_88803_89960 367
1717 3300053730 Ga0500645_019667 Ga0500645_019667_692_1831 367
1718 3300060353 Ga0501082_0050376 Ga0501082_0050376_737_1894 367
1719 3300061719 Ga0466962_0005611 Ga0466962_0005611_509_1648 367

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00475

IGPD

Imidazoleglycerol-phosphate dehydratase

268

409

0.99

PF13242

Hydrolase_like

HAD-hyrolase-like

152

203

0.94

PF08645

PNK3P

Polynucleotide kinase 3 phosphatase

53

194

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
7oj5-assembly1.cif.gz_A cryo-em structure of medicago truncatula hisn5 protein 0.9668 197 355
4mu3-assembly1.cif.gz_A the form a structure of an e21q catalytic mutant of a. thaliana igpd2 in complex with mn2+ and a mixture of its substrate, 2r3s-igp, and an inhibitor, 2s3s-igp, to 1.12 a resolution 0.9652 197 357
4mu4-assembly1.cif.gz_A the form b structure of an e21q catalytic mutant of a. thaliana igpd2 in complex with mn2+ and its substrate, 2r3s-igp, to 1.41 a resolution 0.9503 197 365
6fwh-assembly1.cif.gz_A acanthamoeba igpd in complex with r-c348 to 1.7a resolution 0.9418 197 367
4lom-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis hisb in complex with its substrate 0.9396 197 355
ID Description Score Start End Superfamily
2f1dA02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9679 264 355 3.30.230.40
1rhyA02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9634 264 353 3.30.230.40
1rhyA02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9431 264 353 3.30.230.40
2f1dA02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9381 264 355 3.30.230.40
af_Q58109_93_196_3.30.230.40 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9318 264 367 3.30.230.40
ID Description Score Start End GO Terms
AF-A0A354X489-F1-model_v4 Bifunctional histidinol-phosphatase/imidazoleglycerol-phosphate dehydratase (EC 3.1.3.15, EC 4.2.1.19) 0.9975 1 93 GO:0004401
GO:0004424
AF-A0A7X3D3U3-F1-model_v4 D,D-heptose 1,7-bisphosphate phosphatase 0.9941 2 143 GO:0000105
GO:0004401
GO:0004424
GO:0005737
GO:0005975
GO:0046872
AF-A0A838TSW8-F1-model_v4 D,D-heptose 1,7-bisphosphate phosphatase 0.9824 3 130 GO:0000105
GO:0004401
GO:0004424
GO:0005737
GO:0005975
GO:0046872
AF-A0A354X489-F1-model_v4 Bifunctional histidinol-phosphatase/imidazoleglycerol-phosphate dehydratase (EC 3.1.3.15, EC 4.2.1.19) 0.9765 1 93 GO:0004401
GO:0004424
AF-A0A7J4NV12-F1-model_v4 Imidazoleglycerol-phosphate dehydratase HisB 0.9749 197 342 GO:0000105
GO:0004424

Feature Viewer

pLDDT pTM Quality
88.12 0.53 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map