F495444

General Info

Members Datasets Scaffolds Average Seq Length
1714 607 3428 332

Family's Representative Sequence

Representative Sequence 3300026067|Ga0207678_10214638|Ga0207678_102146382
Length 375
Sequence MTAPILSVIIPVYNEEQTLPLLFGRLYPALDSLNVNYEVLFVSDGSRDRSPAVLREQFQRRPDVTRVILFSANFGQHMAIMAGFEYCRGARVVTLDADLQNPPEEIGNLLVAMDAGHDYVGTIRRNRQDTVFRRCASQAMNWLRERITKIRMTDQGCMLRAYDRQIVDAIKVSCEVNTFIPALAYTYASSPIEIEVAHEERAAGESKYSIYSLLRLNFDLVTGFSIVPLQVFSLLGMFVALVSAVVYIGIIIQRWIAADTMREGVLALWDRDVLQFFLTGLVLFGLGLLGEYVGRMYQQVRSRPRYVVQAVLESDVDSFAARDLSSGRPAHDAARLSRTAPRDIAGPRITRLPGASCTTSSSAMVSTMPSEAASR

Samples

Sample ID Description Type Environment
1 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
8 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
9 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
10 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
11 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
12 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
13 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
14 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
15 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
16 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
19 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
20 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
21 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
22 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
23 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
24 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
25 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
26 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
27 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
28 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
29 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
30 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
31 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
32 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
33 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
34 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
37 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
38 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
39 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
40 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
41 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
42 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
43 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
44 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
45 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
46 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
47 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
48 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
49 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
50 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
51 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
52 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
53 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
54 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
55 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
56 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
57 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
58 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
59 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
60 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
61 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
62 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
63 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
64 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
65 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
66 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
67 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
68 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
69 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
70 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
71 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
72 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
73 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
74 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
77 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
78 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
79 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
80 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
81 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
82 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
83 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
84 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
85 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
86 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
87 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
88 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
89 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
90 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
91 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
92 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
93 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
94 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
95 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
96 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
97 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
98 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
99 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
100 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
101 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
102 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
103 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
104 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
106 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
107 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
108 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
110 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
111 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
112 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
113 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
114 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
115 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
116 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
117 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
118 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
119 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
120 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
121 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
122 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
123 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
124 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
125 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
126 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
127 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
128 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
129 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
130 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
131 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
132 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
133 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
134 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
135 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
136 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
137 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
138 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
139 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
140 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
141 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
142 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
143 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
144 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
145 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
146 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
148 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
150 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
151 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
159 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
160 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
162 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
163 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
164 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
167 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
168 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
172 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
174 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
175 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
240 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
241 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
245 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
246 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
247 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
248 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
249 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
250 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
251 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
252 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
254 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
255 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
256 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
257 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
258 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
259 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
260 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
261 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
262 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
263 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
264 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
265 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
266 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
267 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
268 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
269 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
270 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
271 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
272 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
273 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
274 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
275 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
276 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
277 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
278 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
279 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
280 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
281 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
282 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
283 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
284 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
285 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
286 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
287 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
288 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
289 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
290 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
291 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
292 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
293 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
294 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
295 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
296 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
297 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
298 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
299 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
300 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
301 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
302 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
303 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
304 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
305 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
306 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
307 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
308 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
309 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
310 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
311 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
312 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
313 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
314 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
315 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
316 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
317 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
318 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
319 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
320 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
321 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
322 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
323 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
324 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
325 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
326 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
327 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
328 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
329 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
330 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
331 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
332 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
333 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
334 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
335 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
336 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
337 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
338 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
339 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
340 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
341 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
342 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
343 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
344 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
345 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
346 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
347 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
348 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
349 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
350 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
351 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
352 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
353 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
354 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
355 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
356 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
357 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
358 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
359 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
360 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
361 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
362 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
363 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
364 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
365 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
366 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
367 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
368 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
369 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
370 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
371 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
372 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
373 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
374 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
375 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
376 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
377 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
378 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
379 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
380 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
381 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
382 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
383 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
384 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
385 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
386 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
387 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
388 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
389 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
390 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
391 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
392 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
393 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
394 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
395 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
396 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
397 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
398 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
399 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
400 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
401 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
402 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
403 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
404 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
405 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
406 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
407 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
408 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
409 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
410 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
411 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
412 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
413 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
414 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
415 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
416 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
417 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
418 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
419 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
420 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
421 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
422 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
423 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
424 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
425 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
426 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
427 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
428 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
430 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
431 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
432 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
433 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
434 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
435 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
436 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
437 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
438 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
439 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
440 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
441 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
442 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
443 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
444 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
445 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
446 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
447 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
448 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
449 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
450 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
451 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
452 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
453 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
454 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
455 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
456 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
457 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
458 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
459 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
460 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
461 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
462 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
463 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
464 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
465 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
466 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
467 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
468 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
469 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
470 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
471 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
472 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
473 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
474 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
475 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
476 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
477 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
478 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
479 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
480 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
481 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
482 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
483 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
484 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
485 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
486 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
487 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
488 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
489 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
490 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
491 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
492 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
493 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
494 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
495 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
496 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
497 2519103095 Burkholderia sp. KJ006 Isolate Nodule
498 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
499 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
500 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
501 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
502 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
503 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
504 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
505 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
506 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
507 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
508 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
509 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
510 2643221556 Massilia sp. Root1485 Isolate Unclassified
511 2643221684 Massilia sp. Root133 Isolate Unclassified
512 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
513 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
514 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
515 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
516 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
517 2738541297 Duganella sp. GV083 Isolate Unclassified
518 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
519 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
520 2738541357 Duganella sp. GV053 Isolate Unclassified
521 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
522 2738543003 Duganella sp. GV066 Isolate Unclassified
523 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
524 2738543026 Duganella sp. GV089 Isolate Unclassified
525 2738543029 Duganella sp. GV039 Isolate Unclassified
526 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
527 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
528 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
529 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
530 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
531 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
532 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
533 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
534 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
535 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
536 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
537 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
538 2818991436 Collimonas arenae 515 Isolate Unclassified
539 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
540 2818991450 Burkholderia sp. 604 Isolate Unclassified
541 2818991452 Burkholderia cepacia 561 Isolate Unclassified
542 2821131069 Duganella sp. 1224 Isolate Unclassified
543 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
544 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
545 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
546 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
547 2842711865 Duganella sp. R-73148 Isolate Unclassified
548 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
549 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
550 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
551 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
552 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
553 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
554 2857558681 Duganella sp. R-74565 Isolate Unclassified
555 2857564685 Duganella sp. R-74599 Isolate Unclassified
556 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
557 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
558 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
559 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
560 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
561 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
562 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
563 2885266251 Ralstonia sp. SET104 Isolate Nodule
564 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
565 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
566 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
567 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
568 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
569 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
570 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
571 2904564687 Burkholderia sp. 571 Isolate Unclassified
572 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
573 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
574 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
575 2928058823 Ralstonia sp. 1138 Isolate Unclassified
576 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
577 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
578 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
579 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
580 2928163908 Burkholderia sp. 567 Isolate Unclassified
581 2928170801 Burkholderia sp. 572 Isolate Unclassified
582 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
583 2928536128 Burkholderia sola 565 Isolate Unclassified
584 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
585 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
586 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
587 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
588 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
589 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
590 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
591 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
592 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
593 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
594 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
595 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
596 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
597 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
598 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
599 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
600 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
601 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
602 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
603 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
604 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
605 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
606 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
607 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.42
Metatranscriptomes 0.76
Isolates 7.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.42
Nodule 1.63
Rhizoplane 4.2
Rhizosphere 78.88
Stem 0
Stem Tuber 0
Unclassified 0.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207678_10214638 3300026067 Bacteria 1646
2 JGI24741J21665_1000126 3300001915 Bacteria 20797
3 JGI24740J21852_10002156 3300001979 Bacteria 8994
4 JGI24740J21852_10002843 3300001979 Bacteria 7737
5 JGI24740J21852_10036406 3300001979 Bacteria 1529
6 JGI24739J22299_10003819 3300001989 Bacteria 5751
7 JGI24739J22299_10021874 3300001989 Bacteria 2272
8 JGI24735J21928_10000091 3300002067 Bacteria 34002
9 JGI24735J21928_10006360 3300002067 Bacteria 3897
10 JGI24735J21928_10007474 3300002067 Bacteria 3563
11 JGI24738J21930_10010650 3300002075 Bacteria 2041
12 JGI25155J39150_1000304 3300002704 Bacteria 16690
13 JGI25155J39150_1000311 3300002704 Bacteria 16587
14 JGI25156J39149_1000736 3300002705 Bacteria 17339
15 JGI25156J39149_1001156 3300002705 Bacteria 11814
16 JGI25156J39149_1001924 3300002705 Bacteria 8059
17 JGI25156J39149_1003390 3300002705 Bacteria 5242
18 JGI25156J39149_1011453 3300002705 Bacteria 2005
19 JGI25162J39368_1000142 3300002737 Bacteria 77413
20 JGI25154J39366_1000220 3300002738 Bacteria 39001
21 JGI25154J39366_1000628 3300002738 Bacteria 16690
22 JGI25154J39366_1000634 3300002738 Bacteria 16587
23 JGI25154J39366_1000718 3300002738 Bacteria 15018
24 JGI25157J39369_1000265 3300002741 Bacteria 38301
25 JGI25163J39215_1002551 3300002771 Bacteria 1815
26 JGI25164J39214_1004295 3300002772 Bacteria 1660
27 JGI25150J39212_1002698 3300002774 Bacteria 4324
28 JGI25151J46595_10019719 3300003187 Bacteria 2857
29 JGI25165J46597_1000064 3300003214 Bacteria 199878
30 JGI25165J46597_1001227 3300003214 Bacteria 15281
31 rootH2_10058489 3300003320 Bacteria 2855
32 JGI25160J50197_1000421 3300003354 Bacteria 26769
33 Ga0055538_1000031 3300003751 Bacteria 199878
34 Ga0055539_1000041 3300003752 Bacteria 199878
35 Ga0055539_1000123 3300003752 Bacteria 83036
36 Ga0055533_1000051 3300003756 Bacteria 199878
37 Ga0055533_1000217 3300003756 Bacteria 41969
38 Ga0055532_1000002 3300003758 Bacteria 576000
39 Ga0055532_1000015 3300003758 Bacteria 340197
40 Ga0055532_1000027 3300003758 Bacteria 234571
41 Ga0055532_1000029 3300003758 Bacteria 232900
42 Ga0055525_1000001 3300003759 Bacteria 1016948
43 Ga0055525_1000061 3300003759 Bacteria 199878
44 Ga0055525_1000571 3300003759 Bacteria 16338
45 Ga0055527_1000019 3300003760 Bacteria 234571
46 Ga0055527_1000533 3300003760 Bacteria 12814
47 Ga0055527_1002805 3300003760 Bacteria 2791
48 Ga0055535_1000021 3300003761 Bacteria 234571
49 Ga0055542_1000032 3300003762 Bacteria 234571
50 Ga0055542_1001163 3300003762 Bacteria 15269
51 Ga0055529_1000038 3300003763 Bacteria 234571
52 Ga0055529_1000060 3300003763 Bacteria 191230
53 Ga0055529_1000062 3300003763 Bacteria 183782
54 Ga0055526_1000066 3300003771 Bacteria 101329
55 Ga0055526_1000100 3300003771 Bacteria 76578
56 Ga0055541_1000028 3300003841 Bacteria 199878
57 Ga0055541_1000208 3300003841 Bacteria 24817
58 Ga0055541_1000811 3300003841 Bacteria 7712
59 Ga0055543_1004650 3300004625 Bacteria 3680
60 Ga0065165_1000281 3300005262 Bacteria 86863
61 Ga0065165_1000475 3300005262 Bacteria 62656
62 Ga0065165_1002621 3300005262 Bacteria 14658
63 Ga0065714_10098877 3300005288 Bacteria 1700
64 Ga0065715_10180223 3300005293 Bacteria 1482
65 Ga0065707_10000578 3300005295 Bacteria 20614
66 Ga0065707_10084248 3300005295 Bacteria 7459
67 Ga0070658_10003869 3300005327 Bacteria 12279
68 Ga0070658_10105944 3300005327 Bacteria 2326
69 Ga0070658_10148699 3300005327 Bacteria 1960
70 Ga0070676_10014576 3300005328 Bacteria 4323
71 Ga0070676_10018588 3300005328 Bacteria 3854
72 Ga0070683_100003358 3300005329 Bacteria 12961
73 Ga0070690_100000415 3300005330 Bacteria 21579
74 Ga0070690_100000970 3300005330 Bacteria 14592
75 Ga0070690_100260120 3300005330 Bacteria 1231
76 Ga0070670_100007422 3300005331 Bacteria 9311
77 Ga0070670_100026302 3300005331 Bacteria 5009
78 Ga0070670_100094973 3300005331 Bacteria 2564
79 Ga0070670_100158748 3300005331 Bacteria 1959
80 Ga0070677_10004523 3300005333 Bacteria 4540
81 Ga0070677_10005761 3300005333 Bacteria 4097
82 Ga0068869_100002853 3300005334 Bacteria 10477
83 Ga0068869_100004401 3300005334 Bacteria 8751
84 Ga0068869_100024754 3300005334 Bacteria 4160
85 Ga0070666_10002232 3300005335 Bacteria 11718
86 Ga0070666_10014823 3300005335 Bacteria 4967
87 Ga0070666_10016331 3300005335 Bacteria 4748
88 Ga0070666_10044770 3300005335 Bacteria 2966
89 Ga0070680_100061995 3300005336 Bacteria 3062
90 Ga0070682_100008747 3300005337 Bacteria 5713
91 Ga0068868_100002963 3300005338 Bacteria 11785
92 Ga0068868_100003118 3300005338 Bacteria 11539
93 Ga0068868_100159628 3300005338 Bacteria 1861
94 Ga0068868_100314403 3300005338 Bacteria 1333
95 Ga0070660_100000007 3300005339 Bacteria 162039
96 Ga0070660_100000221 3300005339 Bacteria 37678
97 Ga0070660_100009312 3300005339 Bacteria 6902
98 Ga0070660_100198388 3300005339 Bacteria 1627
99 Ga0070689_100001396 3300005340 Bacteria 15389
100 Ga0070691_10020767 3300005341 Bacteria 3035
101 Ga0070687_100018754 3300005343 Bacteria 3207
102 Ga0070661_100000077 3300005344 Bacteria 77659
103 Ga0070661_100010322 3300005344 Bacteria 6492
104 Ga0070661_100017351 3300005344 Bacteria 5107
105 Ga0070661_100199786 3300005344 Bacteria 1527
106 Ga0070692_10092334 3300005345 Bacteria 1647
107 Ga0070668_100002323 3300005347 Bacteria 13996
108 Ga0070668_100304008 3300005347 Bacteria 1338
109 Ga0070669_100020775 3300005353 Bacteria 4691
110 Ga0070669_100044728 3300005353 Bacteria 3226
111 Ga0070669_100051433 3300005353 Bacteria 3011
112 Ga0070675_100000340 3300005354 Bacteria 31670
113 Ga0070675_100003765 3300005354 Bacteria 11517
114 Ga0070675_100006646 3300005354 Bacteria 8891
115 Ga0070675_100007231 3300005354 Bacteria 8561
116 Ga0070675_100128187 3300005354 Bacteria 2160
117 Ga0070671_100002234 3300005355 Bacteria 14949
118 Ga0070671_100003372 3300005355 Bacteria 12462
119 Ga0070671_100035825 3300005355 Bacteria 4112
120 Ga0070671_100168090 3300005355 Bacteria 1854
121 Ga0070674_100009567 3300005356 Bacteria 5806
122 Ga0070674_100014411 3300005356 Bacteria 4916
123 Ga0070674_100018134 3300005356 Bacteria 4443
124 Ga0070674_100066505 3300005356 Bacteria 2533
125 Ga0070674_100133902 3300005356 Bacteria 1852
126 Ga0070673_100002105 3300005364 Bacteria 12029
127 Ga0070673_100029426 3300005364 Bacteria 4096
128 Ga0070673_100061468 3300005364 Bacteria 2980
129 Ga0070673_100062840 3300005364 Bacteria 2952
130 Ga0070673_100074616 3300005364 Bacteria 2734
131 Ga0070673_100192842 3300005364 Bacteria 1751
132 Ga0070688_100141301 3300005365 Bacteria 1636
133 Ga0070659_100000019 3300005366 Bacteria 156016
134 Ga0070659_100001051 3300005366 Bacteria 20160
135 Ga0070659_100003354 3300005366 Bacteria 11396
136 Ga0070659_100039263 3300005366 Bacteria 3695
137 Ga0070667_100002371 3300005367 Bacteria 16505
138 Ga0070667_100004918 3300005367 Bacteria 11200
139 Ga0070667_100044551 3300005367 Bacteria 3727
140 Ga0070714_100020500 3300005435 Bacteria 5399
141 Ga0070714_100208036 3300005435 Bacteria 1792
142 Ga0070701_10000844 3300005438 Bacteria 10986
143 Ga0070700_100000812 3300005441 Bacteria 15344
144 Ga0070700_100152900 3300005441 Bacteria 1580
145 Ga0070700_100171807 3300005441 Bacteria 1501
146 Ga0070694_100027033 3300005444 Bacteria 3723
147 Ga0070708_100204078 3300005445 Bacteria 1851
148 Ga0070663_100000011 3300005455 Bacteria 146097
149 Ga0070663_100001639 3300005455 Bacteria 12358
150 Ga0070663_100031877 3300005455 Bacteria 3627
151 Ga0070663_100131322 3300005455 Bacteria 1902
152 Ga0070663_100168417 3300005455 Bacteria 1691
153 Ga0070678_100001667 3300005456 Bacteria 11896
154 Ga0070678_100037495 3300005456 Bacteria 3405
155 Ga0070678_100064893 3300005456 Bacteria 2708
156 Ga0070678_100184777 3300005456 Bacteria 1710
157 Ga0070678_100285388 3300005456 Bacteria 1397
158 Ga0070662_100010536 3300005457 Bacteria 6072
159 Ga0070681_10092877 3300005458 Bacteria 2966
160 Ga0068867_100000579 3300005459 Bacteria 24267
161 Ga0068867_100008360 3300005459 Bacteria 7304
162 Ga0068867_100049630 3300005459 Bacteria 3090
163 Ga0068867_100071971 3300005459 Bacteria 2587
164 Ga0068867_100098608 3300005459 Bacteria 2228
165 Ga0068867_100106121 3300005459 Bacteria 2151
166 Ga0068867_100343060 3300005459 Bacteria 1244
167 Ga0070685_10057439 3300005466 Bacteria 2265
168 Ga0070685_10061169 3300005466 Bacteria 2204
169 Ga0070706_100053802 3300005467 Bacteria 3715
170 Ga0070707_100231307 3300005468 Bacteria 1799
171 Ga0070679_100009410 3300005530 Bacteria 9241
172 Ga0070679_100211019 3300005530 Bacteria 1906
173 Ga0068853_100038063 3300005539 Bacteria 4096
174 Ga0070672_100002630 3300005543 Bacteria 11484
175 Ga0070672_100006856 3300005543 Bacteria 7695
176 Ga0070672_100186632 3300005543 Bacteria 1730
177 Ga0070686_100000272 3300005544 Bacteria 35374
178 Ga0070695_100023988 3300005545 Bacteria 3755
179 Ga0070696_100001233 3300005546 Bacteria 16612
180 Ga0070696_100141265 3300005546 Bacteria 1760
181 Ga0070693_100023166 3300005547 Bacteria 3315
182 Ga0070693_100108794 3300005547 Bacteria 1701
183 Ga0070693_100152543 3300005547 Bacteria 1465
184 Ga0070665_100041154 3300005548 Bacteria 4644
185 Ga0070665_100160574 3300005548 Bacteria 2249
186 Ga0070665_100168686 3300005548 Bacteria 2191
187 Ga0070665_100308882 3300005548 Bacteria 1585
188 Ga0070704_100056358 3300005549 Bacteria 2790
189 Ga0068855_100000737 3300005563 Bacteria 40209
190 Ga0068855_100000815 3300005563 Bacteria 38516
191 Ga0068855_100001553 3300005563 Bacteria 28892
192 Ga0068855_100040158 3300005563 Bacteria 5555
193 Ga0068855_100095907 3300005563 Bacteria 3418
194 Ga0068855_100325935 3300005563 Bacteria 1696
195 Ga0068855_100476898 3300005563 Bacteria 1358
196 Ga0070664_100000008 3300005564 Bacteria 173734
197 Ga0070664_100003658 3300005564 Bacteria 12383
198 Ga0070664_100004893 3300005564 Bacteria 10730
199 Ga0070664_100161817 3300005564 Bacteria 1981
200 Ga0068857_100055062 3300005577 Bacteria 3530
201 Ga0068857_100318888 3300005577 Bacteria 1435
202 Ga0068854_100000052 3300005578 Bacteria 85499
203 Ga0068854_100008124 3300005578 Bacteria 6733
204 Ga0068856_100000009 3300005614 Bacteria 181448
205 Ga0068856_100149005 3300005614 Bacteria 2348
206 Ga0070702_100000407 3300005615 Bacteria 15267
207 Ga0070702_100004309 3300005615 Bacteria 6486
208 Ga0068852_100002640 3300005616 Bacteria 12381
209 Ga0068852_100160333 3300005616 Bacteria 2100
210 Ga0068852_100219161 3300005616 Bacteria 1809
211 Ga0068852_100389284 3300005616 Bacteria 1369
212 Ga0068852_100413954 3300005616 Bacteria 1328
213 Ga0068859_100008729 3300005617 Bacteria 10239
214 Ga0068859_100018133 3300005617 Bacteria 7074
215 Ga0068859_100032679 3300005617 Bacteria 5227
216 Ga0068859_100032776 3300005617 Bacteria 5218
217 Ga0068859_100098274 3300005617 Bacteria 2981
218 Ga0068859_100285290 3300005617 Bacteria 1744
219 Ga0068864_100000301 3300005618 Bacteria 43932
220 Ga0068864_100001408 3300005618 Bacteria 19888
221 Ga0068864_100001954 3300005618 Bacteria 16951
222 Ga0068864_100049249 3300005618 Bacteria 3625
223 Ga0068864_100066142 3300005618 Bacteria 3137
224 Ga0068864_100066178 3300005618 Bacteria 3136
225 Ga0068864_100128503 3300005618 Bacteria 2273
226 Ga0068866_10000770 3300005718 Bacteria 14409
227 Ga0068866_10013144 3300005718 Bacteria 3624
228 Ga0068866_10018051 3300005718 Bacteria 3185
229 Ga0068866_10137178 3300005718 Bacteria 1399
230 Ga0068861_100000996 3300005719 Bacteria 17286
231 Ga0068861_100030681 3300005719 Bacteria 3942
232 Ga0068861_100130472 3300005719 Bacteria 2039
233 Ga0068861_100244937 3300005719 Bacteria 1527
234 Ga0068851_10066176 3300005834 Bacteria 1862
235 Ga0068851_10073071 3300005834 Bacteria 1778
236 Ga0068870_10036270 3300005840 Bacteria 2536
237 Ga0068870_10046154 3300005840 Bacteria 2283
238 Ga0068863_100003618 3300005841 Bacteria 15258
239 Ga0068863_100010572 3300005841 Bacteria 8960
240 Ga0068863_100034955 3300005841 Bacteria 4787
241 Ga0068863_100035413 3300005841 Bacteria 4755
242 Ga0068863_100052718 3300005841 Bacteria 3855
243 Ga0068863_100141743 3300005841 Bacteria 2297
244 Ga0068858_100002585 3300005842 Bacteria 18229
245 Ga0068858_100004088 3300005842 Bacteria 14378
246 Ga0068858_100013329 3300005842 Bacteria 7754
247 Ga0068858_100134144 3300005842 Bacteria 2322
248 Ga0068858_100374660 3300005842 Bacteria 1365
249 Ga0068860_100003547 3300005843 Bacteria 16047
250 Ga0068860_100006642 3300005843 Bacteria 11617
251 Ga0068860_100029667 3300005843 Bacteria 5262
252 Ga0068860_100162999 3300005843 Bacteria 2150
253 Ga0068862_100016245 3300005844 Bacteria 6195
254 Ga0068862_100191503 3300005844 Bacteria 1840
255 Ga0068862_100341891 3300005844 Bacteria 1386
256 Ga0075363_100034013 3300006048 Bacteria 2659
257 Ga0075364_10118996 3300006051 Unclassified 1767
258 Ga0070712_100085781 3300006175 Bacteria 2293
259 Ga0070712_100332577 3300006175 Bacteria 1238
260 Ga0075366_10055199 3300006195 Bacteria 2360
261 Ga0075366_10178045 3300006195 Bacteria 1291
262 Ga0097621_100002183 3300006237 Bacteria 13390
263 Ga0097621_100003026 3300006237 Bacteria 11544
264 Ga0097621_100013211 3300006237 Bacteria 6144
265 Ga0097621_100053316 3300006237 Bacteria 3297
266 Ga0097621_100174544 3300006237 Bacteria 1854
267 Ga0097621_100229009 3300006237 Bacteria 1622
268 Ga0075370_10004770 3300006353 Bacteria 6634
269 Ga0068871_100001574 3300006358 Bacteria 15332
270 Ga0068871_100004804 3300006358 Bacteria 9450
271 Ga0068871_100011159 3300006358 Bacteria 6586
272 Ga0068871_100042062 3300006358 Bacteria 3666
273 Ga0068871_100061397 3300006358 Bacteria 3069
274 Ga0068871_100093508 3300006358 Bacteria 2509
275 Ga0068865_100008523 3300006881 Bacteria 6338
276 Ga0068865_100019794 3300006881 Bacteria 4358
277 Ga0068865_100023667 3300006881 Bacteria 4024
278 Ga0097620_100008729 3300006931 Bacteria 10239
279 Ga0097620_100018133 3300006931 Bacteria 7074
280 Ga0097620_100032680 3300006931 Bacteria 5227
281 Ga0097620_100032778 3300006931 Bacteria 5218
282 Ga0097620_100098272 3300006931 Bacteria 2981
283 Ga0097620_100285291 3300006931 Bacteria 1744
284 Ga0079104_1006336 3300006946 Bacteria 4502
285 Ga0099795_10000125 3300007788 Bacteria 12966
286 Ga0105251_10000134 3300009011 Bacteria 74820
287 Ga0105251_10005177 3300009011 Bacteria 8608
288 Ga0105251_10013971 3300009011 Bacteria 4461
289 Ga0105251_10022862 3300009011 Bacteria 3236
290 Ga0105244_10005315 3300009036 Bacteria 8575
291 Ga0105244_10013656 3300009036 Bacteria 4734
292 Ga0105244_10038044 3300009036 Bacteria 2511
293 Ga0105250_10000008 3300009092 Bacteria 343965
294 Ga0105240_10003806 3300009093 Bacteria 23315
295 Ga0105240_10005169 3300009093 Bacteria 19516
296 Ga0105240_10027418 3300009093 Bacteria 7455
297 Ga0105240_10089502 3300009093 Bacteria 3764
298 Ga0105240_10094157 3300009093 Bacteria 3655
299 Ga0105240_10097409 3300009093 Bacteria 3584
300 Ga0105245_10000811 3300009098 Bacteria 28425
301 Ga0105245_10028867 3300009098 Bacteria 4897
302 Ga0105245_10107064 3300009098 Bacteria 2595
303 Ga0105245_10160119 3300009098 Bacteria 2135
304 Ga0105245_10163390 3300009098 Bacteria 2114
305 Ga0105245_10267668 3300009098 Bacteria 1665
306 Ga0105245_10477174 3300009098 Bacteria 1260
307 Ga0105243_10004077 3300009148 Bacteria 11637
308 Ga0105243_10008031 3300009148 Bacteria 8102
309 Ga0105243_10016549 3300009148 Bacteria 5576
310 Ga0105243_10141916 3300009148 Bacteria 2050
311 Ga0105241_10027698 3300009174 Bacteria 4220
312 Ga0105241_10044354 3300009174 Bacteria 3369
313 Ga0105241_10084332 3300009174 Bacteria 2495
314 Ga0105242_10005513 3300009176 Bacteria 9764
315 Ga0105242_10017277 3300009176 Bacteria 5619
316 Ga0105242_10066139 3300009176 Bacteria 2984
317 Ga0105242_10128169 3300009176 Bacteria 2187
318 Ga0105242_10227497 3300009176 Bacteria 1670
319 Ga0105248_10001495 3300009177 Bacteria 26017
320 Ga0105248_10005155 3300009177 Bacteria 14406
321 Ga0105248_10009050 3300009177 Bacteria 10952
322 Ga0105248_10015971 3300009177 Bacteria 8267
323 Ga0105248_10089029 3300009177 Bacteria 3474
324 Ga0105248_10151138 3300009177 Bacteria 2620
325 Ga0105237_10000784 3300009545 Bacteria 43457
326 Ga0105237_10066264 3300009545 Bacteria 3606
327 Ga0105237_10107544 3300009545 Bacteria 2781
328 Ga0105238_10005552 3300009551 Bacteria 12457
329 Ga0105238_10071538 3300009551 Bacteria 3466
330 Ga0105249_10025378 3300009553 Bacteria 5334
331 Ga0105249_10045520 3300009553 Bacteria 3991
332 Ga0099796_10026691 3300010159 Bacteria 1837
333 Ga0105239_10008150 3300010375 Bacteria 11956
334 Ga0105239_10021748 3300010375 Bacteria 7071
335 Ga0105239_10059776 3300010375 Bacteria 4183
336 Ga0105239_10156668 3300010375 Bacteria 2544
337 Ga0105239_10201344 3300010375 Bacteria 2231
338 Ga0105246_10171772 3300011119 Bacteria 1661
339 Ga0157373_10001549 3300013100 Bacteria 17549
340 Ga0157373_10015465 3300013100 Bacteria 5579
341 Ga0157373_10020555 3300013100 Bacteria 4797
342 Ga0157371_10000068 3300013102 Bacteria 168110
343 Ga0157371_10015589 3300013102 Bacteria 5697
344 Ga0157370_10001130 3300013104 Bacteria 33346
345 Ga0157370_10002304 3300013104 Bacteria 23107
346 Ga0157370_10002933 3300013104 Bacteria 20306
347 Ga0157370_10165182 3300013104 Bacteria 2059
348 Ga0157369_10000724 3300013105 Bacteria 42487
349 Ga0157369_10001199 3300013105 Bacteria 32259
350 Ga0157369_10002274 3300013105 Bacteria 23109
351 Ga0157369_10008205 3300013105 Bacteria 11978
352 Ga0157369_10201089 3300013105 Bacteria 2091
353 Ga0157374_10000044 3300013296 Bacteria 144848
354 Ga0157374_10004186 3300013296 Bacteria 12121
355 Ga0157374_10303450 3300013296 Bacteria 1580
356 Ga0157374_10339350 3300013296 Bacteria 1491
357 Ga0157378_10000762 3300013297 Bacteria 30119
358 Ga0157378_10002340 3300013297 Bacteria 16832
359 Ga0157378_10009123 3300013297 Bacteria 8631
360 Ga0157378_10012649 3300013297 Bacteria 7385
361 Ga0157378_10129186 3300013297 Bacteria 2337
362 Ga0163162_10001049 3300013306 Bacteria 25667
363 Ga0163162_10002545 3300013306 Bacteria 17253
364 Ga0163162_10003910 3300013306 Bacteria 14311
365 Ga0163162_10018428 3300013306 Bacteria 6840
366 Ga0163162_10025300 3300013306 Bacteria 5865
367 Ga0163162_10030772 3300013306 Bacteria 5319
368 Ga0163162_10215707 3300013306 Bacteria 2049
369 Ga0163162_10336427 3300013306 Bacteria 1642
370 Ga0157372_10000271 3300013307 Bacteria 57411
371 Ga0157372_10001941 3300013307 Bacteria 22444
372 Ga0157375_10003567 3300013308 Bacteria 13509
373 Ga0157375_10003891 3300013308 Bacteria 12952
374 Ga0157375_10009927 3300013308 Bacteria 8374
375 Ga0157375_10014532 3300013308 Bacteria 7026
376 Ga0157375_10086658 3300013308 Bacteria 3183
377 Ga0157375_10124474 3300013308 Bacteria 2691
378 Ga0157375_10181589 3300013308 Bacteria 2256
379 Ga0163163_10002307 3300014325 Bacteria 16107
380 Ga0157380_10002831 3300014326 Bacteria 11794
381 Ga0182008_10003181 3300014497 Bacteria 10043
382 Ga0157379_10000072 3300014968 Bacteria 64603
383 Ga0157379_10001980 3300014968 Bacteria 16946
384 Ga0157379_10007685 3300014968 Bacteria 9334
385 Ga0157379_10092868 3300014968 Bacteria 2707
386 Ga0157376_10027762 3300014969 Bacteria 4491
387 Ga0157376_10124972 3300014969 Bacteria 2286
388 Ga0157376_10134964 3300014969 Bacteria 2207
389 Ga0157376_10196684 3300014969 Bacteria 1852
390 Ga0157376_10322571 3300014969 Bacteria 1469
391 Ga0182006_1000002 3300015261 Bacteria 887990
392 Ga0182006_1005807 3300015261 Bacteria 5816
393 Ga0182006_1037965 3300015261 Bacteria 1907
394 Ga0182007_10000090 3300015262 Bacteria 66706
395 Ga0182007_10002950 3300015262 Bacteria 8252
396 Ga0182007_10011396 3300015262 Bacteria 3463
397 Ga0182007_10020871 3300015262 Bacteria 2334
398 Ga0182005_1000070 3300015265 Bacteria 85687
399 Ga0182005_1000656 3300015265 Bacteria 16502
400 Ga0182005_1031815 3300015265 Bacteria 1437
401 Ga0183362_10005 3300015683 Bacteria 437616
402 Ga0183361_10013 3300016635 Bacteria 179680
403 Ga0163161_10012761 3300017792 Bacteria 5836
404 Ga0163161_10024519 3300017792 Bacteria 4262
405 Ga0163161_10031877 3300017792 Bacteria 3759
406 Ga0163161_10064501 3300017792 Bacteria 2672
407 Ga0163161_10172340 3300017792 Bacteria 1655
408 Ga0163161_10176084 3300017792 Bacteria 1638
409 Ga0206349_1385556 3300020075 Bacteria 1691
410 Ga0206351_10134375 3300020077 Bacteria 14013
411 Ga0154015_1636926 3300020610 Bacteria 26784
412 Ga0213872_10000769 3300021361 Bacteria 23505
413 Ga0213872_10001970 3300021361 Bacteria 12518
414 Ga0213872_10030368 3300021361 Bacteria 2476
415 Ga0213875_10125441 3300021388 Bacteria 1200
416 Ga0224712_10000142 3300022467 Bacteria 12013
417 Ga0209784_100003 3300025224 Bacteria 1379451
418 Ga0209784_100039 3300025224 Bacteria 232021
419 Ga0209784_100860 3300025224 Bacteria 6544
420 Ga0209566_100002 3300025225 Bacteria 2614868
421 Ga0209566_100023 3300025225 Bacteria 396571
422 Ga0209566_100545 3300025225 Bacteria 25433
423 Ga0209566_100699 3300025225 Bacteria 19356
424 Ga0209566_101882 3300025225 Bacteria 4693
425 Ga0209674_100005 3300025226 Bacteria 1708125
426 Ga0209674_100008 3300025226 Bacteria 1076909
427 Ga0209674_100040 3300025226 Bacteria 396571
428 Ga0209674_100103 3300025226 Bacteria 154966
429 Ga0209674_100423 3300025226 Bacteria 20465
430 Ga0209672_100001 3300025228 Bacteria 2828210
431 Ga0209672_100014 3300025228 Bacteria 546252
432 Ga0209672_100052 3300025228 Bacteria 231179
433 Ga0209672_100085 3300025228 Bacteria 129172
434 Ga0209672_101885 3300025228 Bacteria 6152
435 Ga0209147_100001 3300025229 Bacteria 2384371
436 Ga0209147_100002 3300025229 Bacteria 2158988
437 Ga0209147_100087 3300025229 Bacteria 179835
438 Ga0209147_100125 3300025229 Bacteria 129172
439 Ga0209563_100004 3300025230 Bacteria 1814108
440 Ga0209563_100007 3300025230 Bacteria 1579402
441 Ga0209563_100072 3300025230 Bacteria 232021
442 Ga0209563_100892 3300025230 Bacteria 8831
443 Ga0207427_100513 3300025231 Bacteria 20535
444 Ga0207427_101254 3300025231 Bacteria 9731
445 Ga0209437_100097 3300025233 Bacteria 232021
446 Ga0209258_100001 3300025242 Bacteria 2384269
447 Ga0209258_100002 3300025242 Bacteria 2158988
448 Ga0209258_100040 3300025242 Bacteria 385401
449 Ga0209258_100203 3300025242 Bacteria 121725
450 Ga0207425_1000284 3300025245 Bacteria 37103
451 Ga0209646_1000059 3300025246 Bacteria 256909
452 Ga0209646_1000087 3300025246 Bacteria 193273
453 Ga0209026_1003130 3300025250 Bacteria 5634
454 Ga0209677_100009 3300025253 Bacteria 749530
455 Ga0209677_100041 3300025253 Bacteria 232021
456 Ga0209677_103052 3300025253 Bacteria 5734
457 Ga0209148_1000003 3300025254 Bacteria 2384288
458 Ga0209148_1000021 3300025254 Bacteria 714645
459 Ga0209148_1000035 3300025254 Bacteria 548413
460 Ga0209148_1000211 3300025254 Bacteria 102391
461 Ga0209148_1000553 3300025254 Bacteria 35527
462 Ga0209148_1005780 3300025254 Bacteria 2772
463 Ga0209759_1000188 3300025256 Bacteria 99987
464 Ga0209759_1000284 3300025256 Bacteria 70505
465 Ga0209759_1000519 3300025256 Bacteria 41644
466 Ga0209759_1002173 3300025256 Bacteria 8983
467 Ga0209759_1002486 3300025256 Bacteria 8044
468 Ga0209759_1008232 3300025256 Bacteria 3266
469 Ga0209233_1000043 3300025261 Bacteria 509723
470 Ga0209233_1000122 3300025261 Bacteria 232021
471 Ga0207666_1005297 3300025271 Bacteria 1646
472 Ga0209455_1000001 3300025272 Bacteria 2384278
473 Ga0209455_1000021 3300025272 Bacteria 699993
474 Ga0209455_1000026 3300025272 Bacteria 653778
475 Ga0209455_1000200 3300025272 Bacteria 87009
476 Ga0209673_1000030 3300025273 Bacteria 351933
477 Ga0209025_1000178 3300025294 Bacteria 158040
478 Ga0209025_1006590 3300025294 Bacteria 8948
479 Ga0209564_1000009 3300025295 Bacteria 950196
480 Ga0209564_1000045 3300025295 Bacteria 376549
481 Ga0209564_1004734 3300025295 Bacteria 8147
482 Ga0209564_1013455 3300025295 Bacteria 3472
483 Ga0209758_1000489 3300025297 Bacteria 64758
484 Ga0207426_1000050 3300025302 Bacteria 393022
485 Ga0207426_1002220 3300025302 Bacteria 13025
486 Ga0209051_1028714 3300025303 Bacteria 2191
487 Ga0207656_10073863 3300025321 Bacteria 1521
488 Ga0207656_10112379 3300025321 Bacteria 1260
489 Ga0207696_1000106 3300025711 Bacteria 159964
490 Ga0207655_1002220 3300025728 Bacteria 16087
491 Ga0207655_1021992 3300025728 Bacteria 3214
492 Ga0207713_1001542 3300025735 Bacteria 18104
493 Ga0207713_1025007 3300025735 Bacteria 2767
494 Ga0207682_10005455 3300025893 Bacteria 5177
495 Ga0207682_10014750 3300025893 Bacteria 3044
496 Ga0207642_10006349 3300025899 Bacteria 3925
497 Ga0207642_10071307 3300025899 Bacteria 1654
498 Ga0207642_10087743 3300025899 Bacteria 1528
499 Ga0207642_10118430 3300025899 Bacteria 1362
500 Ga0207680_10002694 3300025903 Bacteria 8302
501 Ga0207680_10021359 3300025903 Bacteria 3501
502 Ga0207680_10041483 3300025903 Bacteria 2685
503 Ga0207647_10000310 3300025904 Bacteria 40366
504 Ga0207647_10002433 3300025904 Bacteria 14128
505 Ga0207647_10009655 3300025904 Bacteria 6851
506 Ga0207645_10006661 3300025907 Bacteria 8250
507 Ga0207645_10012955 3300025907 Bacteria 5640
508 Ga0207645_10159775 3300025907 Bacteria 1474
509 Ga0207645_10171204 3300025907 Bacteria 1423
510 Ga0207643_10004408 3300025908 Bacteria 7571
511 Ga0207705_10002739 3300025909 Bacteria 13510
512 Ga0207705_10004282 3300025909 Bacteria 10806
513 Ga0207705_10025889 3300025909 Bacteria 4187
514 Ga0207705_10089152 3300025909 Bacteria 2257
515 Ga0207705_10174932 3300025909 Bacteria 1618
516 Ga0207684_10223120 3300025910 Bacteria 1626
517 Ga0207654_10039705 3300025911 Bacteria 2649
518 Ga0207707_10002855 3300025912 Bacteria 15431
519 Ga0207707_10227942 3300025912 Bacteria 1621
520 Ga0207695_10001909 3300025913 Bacteria 32457
521 Ga0207695_10005290 3300025913 Bacteria 17201
522 Ga0207695_10014738 3300025913 Bacteria 9243
523 Ga0207695_10021190 3300025913 Bacteria 7423
524 Ga0207695_10086432 3300025913 Bacteria 3163
525 Ga0207695_10095513 3300025913 Bacteria 2976
526 Ga0207695_10121166 3300025913 Bacteria 2584
527 Ga0207695_10286291 3300025913 Bacteria 1541
528 Ga0207695_10369677 3300025913 Bacteria 1320
529 Ga0207671_10023429 3300025914 Bacteria 4656
530 Ga0207671_10032527 3300025914 Bacteria 3882
531 Ga0207671_10040198 3300025914 Bacteria 3462
532 Ga0207671_10074464 3300025914 Bacteria 2538
533 Ga0207663_10044605 3300025916 Bacteria 2723
534 Ga0207660_10059452 3300025917 Bacteria 2744
535 Ga0207662_10013387 3300025918 Bacteria 4588
536 Ga0207657_10000004 3300025919 Bacteria 247179
537 Ga0207657_10000974 3300025919 Bacteria 30418
538 Ga0207657_10017545 3300025919 Bacteria 6858
539 Ga0207657_10103608 3300025919 Bacteria 2358
540 Ga0207657_10111711 3300025919 Bacteria 2256
541 Ga0207649_10000321 3300025920 Bacteria 36438
542 Ga0207649_10006430 3300025920 Bacteria 6380
543 Ga0207649_10043427 3300025920 Bacteria 2748
544 Ga0207649_10113460 3300025920 Bacteria 1815
545 Ga0207649_10161945 3300025920 Bacteria 1551
546 Ga0207652_10007499 3300025921 Bacteria 8784
547 Ga0207646_10307961 3300025922 Bacteria 1431
548 Ga0207681_10069468 3300025923 Bacteria 2450
549 Ga0207681_10123940 3300025923 Bacteria 1899
550 Ga0207681_10128694 3300025923 Bacteria 1869
551 Ga0207694_10005553 3300025924 Bacteria 9664
552 Ga0207694_10041086 3300025924 Bacteria 3563
553 Ga0207650_10004906 3300025925 Bacteria 9132
554 Ga0207650_10010329 3300025925 Bacteria 6401
555 Ga0207650_10045979 3300025925 Bacteria 3213
556 Ga0207650_10165999 3300025925 Bacteria 1752
557 Ga0207659_10000771 3300025926 Bacteria 18985
558 Ga0207659_10001624 3300025926 Bacteria 13330
559 Ga0207659_10052733 3300025926 Bacteria 2899
560 Ga0207687_10002292 3300025927 Bacteria 13037
561 Ga0207687_10224731 3300025927 Bacteria 1480
562 Ga0207664_10059393 3300025929 Bacteria 3045
563 Ga0207664_10181073 3300025929 Bacteria 1809
564 Ga0207664_10240736 3300025929 Bacteria 1576
565 Ga0207644_10002036 3300025931 Bacteria 13083
566 Ga0207644_10003925 3300025931 Bacteria 9648
567 Ga0207644_10032467 3300025931 Bacteria 3643
568 Ga0207644_10073856 3300025931 Bacteria 2501
569 Ga0207690_10000015 3300025932 Bacteria 257457
570 Ga0207690_10002377 3300025932 Bacteria 11402
571 Ga0207690_10002753 3300025932 Bacteria 10624
572 Ga0207706_10015304 3300025933 Bacteria 6935
573 Ga0207706_10028137 3300025933 Bacteria 5022
574 Ga0207706_10055728 3300025933 Bacteria 3485
575 Ga0207706_10165742 3300025933 Bacteria 1942
576 Ga0207686_10001170 3300025934 Bacteria 15162
577 Ga0207686_10091538 3300025934 Bacteria 2009
578 Ga0207686_10129376 3300025934 Bacteria 1730
579 Ga0207709_10101869 3300025935 Bacteria 1900
580 Ga0207709_10135983 3300025935 Bacteria 1683
581 Ga0207670_10009527 3300025936 Bacteria 5546
582 Ga0207670_10143651 3300025936 Bacteria 1762
583 Ga0207669_10004101 3300025937 Bacteria 6381
584 Ga0207669_10004845 3300025937 Bacteria 5974
585 Ga0207669_10057512 3300025937 Bacteria 2368
586 Ga0207669_10149603 3300025937 Bacteria 1633
587 Ga0207704_10002682 3300025938 Bacteria 8029
588 Ga0207704_10009290 3300025938 Bacteria 4734
589 Ga0207704_10029386 3300025938 Bacteria 3065
590 Ga0207704_10159156 3300025938 Bacteria 1604
591 Ga0207704_10242480 3300025938 Bacteria 1348
592 Ga0207665_10005065 3300025939 Bacteria 8797
593 Ga0207691_10002661 3300025940 Bacteria 17455
594 Ga0207691_10003475 3300025940 Bacteria 15338
595 Ga0207691_10013941 3300025940 Bacteria 7668
596 Ga0207691_10014690 3300025940 Bacteria 7463
597 Ga0207691_10126716 3300025940 Bacteria 2259
598 Ga0207691_10217818 3300025940 Bacteria 1656
599 Ga0207711_10014772 3300025941 Bacteria 6489
600 Ga0207711_10019262 3300025941 Bacteria 5683
601 Ga0207711_10099337 3300025941 Bacteria 2573
602 Ga0207711_10121155 3300025941 Bacteria 2335
603 Ga0207689_10000262 3300025942 Bacteria 47258
604 Ga0207689_10000320 3300025942 Bacteria 44520
605 Ga0207689_10034893 3300025942 Bacteria 4178
606 Ga0207689_10138736 3300025942 Bacteria 2003
607 Ga0207661_10030207 3300025944 Bacteria 4171
608 Ga0207679_10000001 3300025945 Bacteria 777444
609 Ga0207679_10009872 3300025945 Bacteria 6129
610 Ga0207679_10020920 3300025945 Bacteria 4425
611 Ga0207667_10000025 3300025949 Bacteria 350159
612 Ga0207667_10000067 3300025949 Bacteria 184547
613 Ga0207667_10000524 3300025949 Bacteria 50648
614 Ga0207667_10004154 3300025949 Bacteria 17795
615 Ga0207667_10023097 3300025949 Bacteria 6852
616 Ga0207667_10148763 3300025949 Bacteria 2411
617 Ga0207667_10258319 3300025949 Bacteria 1781
618 Ga0207651_10003548 3300025960 Bacteria 7666
619 Ga0207651_10008458 3300025960 Bacteria 5561
620 Ga0207651_10115169 3300025960 Bacteria 2027
621 Ga0207651_10195788 3300025960 Bacteria 1615
622 Ga0207712_10006896 3300025961 Bacteria 7172
623 Ga0207712_10026515 3300025961 Bacteria 3862
624 Ga0207712_10029591 3300025961 Bacteria 3676
625 Ga0207668_10200597 3300025972 Bacteria 1588
626 Ga0207640_10000035 3300025981 Bacteria 111369
627 Ga0207640_10004211 3300025981 Bacteria 7779
628 Ga0207658_10001963 3300025986 Bacteria 15342
629 Ga0207658_10022693 3300025986 Bacteria 4371
630 Ga0207658_10043501 3300025986 Bacteria 3265
631 Ga0207658_10054480 3300025986 Bacteria 2960
632 Ga0207677_10001098 3300026023 Bacteria 14745
633 Ga0207677_10002070 3300026023 Bacteria 10561
634 Ga0207677_10087840 3300026023 Bacteria 2252
635 Ga0207677_10175582 3300026023 Bacteria 1680
636 Ga0207703_10003733 3300026035 Bacteria 12677
637 Ga0207703_10004880 3300026035 Bacteria 10906
638 Ga0207639_10053857 3300026041 Bacteria 3072
639 Ga0207639_10073257 3300026041 Bacteria 2684
640 Ga0207639_10561477 3300026041 Bacteria 1049
641 Ga0207678_10000001 3300026067 Bacteria 433184
642 Ga0207678_10003809 3300026067 Bacteria 13573
643 Ga0207678_10036529 3300026067 Bacteria 4276
644 Ga0207678_10144662 3300026067 Bacteria 2029
645 Ga0207708_10000360 3300026075 Bacteria 35736
646 Ga0207708_10005611 3300026075 Bacteria 9260
647 Ga0207708_10053167 3300026075 Bacteria 3085
648 Ga0207702_10001757 3300026078 Bacteria 21331
649 Ga0207702_10195031 3300026078 Bacteria 1874
650 Ga0207641_10004096 3300026088 Bacteria 12708
651 Ga0207641_10028228 3300026088 Bacteria 4636
652 Ga0207641_10030375 3300026088 Bacteria 4476
653 Ga0207641_10030589 3300026088 Bacteria 4460
654 Ga0207641_10045055 3300026088 Bacteria 3712
655 Ga0207641_10084526 3300026088 Bacteria 2763
656 Ga0207648_10000376 3300026089 Bacteria 49108
657 Ga0207648_10000853 3300026089 Bacteria 34345
658 Ga0207648_10009628 3300026089 Bacteria 9240
659 Ga0207648_10051572 3300026089 Bacteria 3596
660 Ga0207648_10059286 3300026089 Bacteria 3338
661 Ga0207648_10069098 3300026089 Bacteria 3078
662 Ga0207648_10142950 3300026089 Bacteria 2110
663 Ga0207676_10000951 3300026095 Bacteria 22372
664 Ga0207676_10077387 3300026095 Bacteria 2691
665 Ga0207676_10095953 3300026095 Bacteria 2447
666 Ga0207674_10003354 3300026116 Bacteria 19652
667 Ga0207674_10030381 3300026116 Bacteria 5681
668 Ga0207674_10172302 3300026116 Bacteria 2117
669 Ga0207675_100000300 3300026118 Bacteria 47402
670 Ga0207675_100000415 3300026118 Bacteria 41041
671 Ga0207675_100008514 3300026118 Bacteria 9650
672 Ga0207675_100011304 3300026118 Bacteria 8357
673 Ga0207675_100066430 3300026118 Bacteria 3371
674 Ga0207675_100102890 3300026118 Bacteria 2691
675 Ga0207675_100281068 3300026118 Bacteria 1617
676 Ga0207683_10002476 3300026121 Bacteria 16110
677 Ga0207683_10003438 3300026121 Bacteria 13801
678 Ga0207683_10007432 3300026121 Bacteria 9394
679 Ga0207683_10025141 3300026121 Bacteria 5135
680 Ga0207683_10040768 3300026121 Bacteria 4053
681 Ga0207683_10056418 3300026121 Bacteria 3445
682 Ga0207683_10218872 3300026121 Bacteria 1735
683 Ga0207683_10231700 3300026121 Bacteria 1684
684 Ga0207683_10553540 3300026121 Bacteria 1064
685 Ga0207698_10006837 3300026142 Bacteria 7136
686 Ga0207698_10073804 3300026142 Bacteria 2718
687 Ga0207698_10552491 3300026142 Bacteria 1129
688 Ga0209371_1000399 3300027312 Bacteria 45543
689 Ga0209179_1000750 3300027512 Bacteria 3519
690 Ga0209282_1000019 3300027666 Bacteria 184034
691 Ga0265356_1000985 3300028017 Bacteria 4528
692 Ga0268266_10094225 3300028379 Bacteria 2628
693 Ga0268266_10129822 3300028379 Bacteria 2253
694 Ga0268266_10174342 3300028379 Bacteria 1954
695 Ga0268265_10030320 3300028380 Bacteria 3893
696 Ga0268265_10079835 3300028380 Bacteria 2578
697 Ga0268264_10009764 3300028381 Bacteria 7946
698 Ga0268264_10501233 3300028381 Bacteria 1184
699 Ga0265334_10000010 3300028573 Bacteria 188179
700 Ga0265318_10054665 3300028577 Bacteria 1495
701 Ga0265336_10000529 3300028666 Bacteria 22054
702 Ga0307517_10031334 3300028786 Bacteria 6192
703 Ga0307515_10122568 3300028794 Bacteria 2931
704 Ga0307515_10184217 3300028794 Bacteria 2025
705 Ga0265338_10000022 3300028800 Bacteria 308414
706 Ga0265338_10001008 3300028800 Bacteria 47358
707 Ga0265338_10028579 3300028800 Bacteria 5556
708 Ga0265324_10000034 3300029957 Bacteria 124255
709 Ga0265324_10000669 3300029957 Bacteria 23139
710 Ga0268256_1000238 3300030500 Bacteria 57894
711 Ga0265760_10002495 3300031090 Bacteria 5370
712 Ga0265332_10005254 3300031238 Bacteria 5988
713 Ga0265320_10023346 3300031240 Bacteria 3294
714 Ga0265325_10000663 3300031241 Bacteria 25141
715 Ga0265325_10003426 3300031241 Bacteria 10348
716 Ga0265331_10003526 3300031250 Bacteria 10053
717 Ga0265331_10006877 3300031250 Bacteria 6643
718 Ga0265331_10040228 3300031250 Bacteria 2276
719 Ga0265327_10000572 3300031251 Bacteria 62611
720 Ga0265327_10000638 3300031251 Bacteria 56987
721 Ga0265327_10001646 3300031251 Bacteria 26957
722 Ga0265327_10002259 3300031251 Bacteria 20791
723 Ga0265316_10039434 3300031344 Bacteria 3793
724 Ga0265316_10155450 3300031344 Bacteria 1712
725 Ga0307513_10088095 3300031456 Bacteria 3174
726 Ga0265313_10000068 3300031595 Bacteria 100563
727 Ga0265313_10006502 3300031595 Bacteria 8260
728 Ga0316575_10000457 3300031665 Bacteria 11697
729 Ga0265314_10001850 3300031711 Bacteria 22707
730 Ga0265314_10058682 3300031711 Bacteria 2636
731 Ga0265314_10074206 3300031711 Bacteria 2266
732 Ga0265314_10074775 3300031711 Bacteria 2256
733 Ga0265342_10007593 3300031712 Bacteria 7915
734 Ga0316576_10017518 3300031727 Bacteria 4870
735 Ga0307516_10000012 3300031730 Bacteria 224120
736 Ga0307412_10000024 3300031911 Bacteria 235467
737 Ga0316583_10000196 3300032133 Bacteria 15776
738 Ga0373953_0079184 3300035117 Bacteria 1364
739 Ga0373960_0006680 3300035121 Bacteria 2713
740 Ga0373943_0223809 3300035170 Bacteria 1049
741 Ga0316574_0010832 3300035398 Bacteria 5165
742 Ga0373924_0110445 3300035410 Bacteria 1188
743 Ga0373927_0000002 3300035695 Bacteria 966219
744 Ga0373927_0023190 3300035695 Bacteria 4066
745 Ga0373937_0090490 3300036401 Bacteria 2834
746 Ga0373937_0349722 3300036401 Bacteria 1400
747 Ga0316584_0019586 3300036712 Bacteria 4893
748 Ga0316584_0019651 3300036712 Bacteria 4885
749 Ga0395899_0000035 3300037312 Bacteria 295584
750 Ga0395899_0000344 3300037312 Bacteria 57423
751 Ga0395899_0002002 3300037312 Bacteria 16777
752 Ga0395899_0002788 3300037312 Bacteria 14079
753 Ga0395899_0010729 3300037312 Bacteria 7024
754 Ga0395899_0014012 3300037312 Bacteria 6121
755 Ga0395899_0040985 3300037312 Bacteria 3461
756 Ga0395899_0087664 3300037312 Bacteria 2258
757 Ga0395900_0000190 3300037418 Bacteria 98820
758 Ga0395900_0000198 3300037418 Bacteria 94894
759 Ga0395900_0001100 3300037418 Bacteria 34383
760 Ga0395900_0001935 3300037418 Bacteria 23472
761 Ga0395900_0007915 3300037418 Bacteria 10944
762 Ga0395900_0015064 3300037418 Bacteria 7882
763 Ga0395900_0018384 3300037418 Bacteria 7128
764 Ga0395900_0026828 3300037418 Bacteria 5895
765 Ga0395900_0044784 3300037418 Bacteria 4558
766 Ga0395900_0088619 3300037418 Bacteria 3181
767 Ga0395900_0118808 3300037418 Bacteria 2713
768 Ga0395900_0211239 3300037418 Bacteria 1959
769 Ga0395898_0000199 3300037466 Bacteria 154631
770 Ga0395898_0000374 3300037466 Bacteria 98025
771 Ga0395898_0016768 3300037466 Bacteria 7484
772 Ga0395898_0059651 3300037466 Bacteria 3710
773 Ga0395898_0115582 3300037466 Bacteria 2571
774 Ga0395898_0176886 3300037466 Bacteria 2039
775 Ga0395898_0228302 3300037466 Bacteria 1775
776 Ga0395905_0000041 3300037471 Bacteria 250958
777 Ga0395905_0001591 3300037471 Bacteria 27005
778 Ga0395905_0009860 3300037471 Bacteria 9310
779 Ga0395905_0016277 3300037471 Bacteria 7065
780 Ga0395905_0085997 3300037471 Bacteria 2946
781 Ga0395905_0105715 3300037471 Bacteria 2643
782 Ga0395905_0139127 3300037471 Bacteria 2284
783 Ga0436364_0817049 3300037853 Bacteria 1283
784 Ga0395901_0000062 3300038443 Bacteria 150171
785 Ga0395901_0000533 3300038443 Bacteria 43906
786 Ga0395901_0001105 3300038443 Bacteria 28682
787 Ga0395901_0001593 3300038443 Bacteria 23483
788 Ga0395901_0002094 3300038443 Bacteria 20478
789 Ga0395901_0015314 3300038443 Bacteria 7804
790 Ga0395901_0055086 3300038443 Bacteria 4134
791 Ga0395901_0187733 3300038443 Bacteria 2168
792 Ga0395901_0196405 3300038443 Bacteria 2115
793 Ga0436365_1589949 3300039437 Bacteria 1946
794 Ga0436361_0598612 3300039447 Bacteria 13813
795 Ga0436361_0695623 3300039447 Bacteria 37214
796 Ga0436361_0836240 3300039447 Bacteria 2768
797 Ga0436361_0900465 3300039447 Bacteria 24867
798 Ga0436361_0904231 3300039447 Bacteria 1523
799 Ga0436361_1196706 3300039447 Bacteria 36697
800 Ga0451843_0123709 3300041509 Bacteria 2123
801 Ga0451853_0053840 3300041512 Bacteria 1861
802 Ga0439448_0000093 3300042005 Bacteria 16024
803 Ga0439448_0033168 3300042005 Bacteria 1646
804 Ga0439455_0010495 3300042012 Bacteria 2038
805 Ga0439458_0007162 3300042157 Bacteria 2480
806 Ga0451577_0000002 3300042876 Bacteria 1731375
807 Ga0451577_0060007 3300042876 Bacteria 3391
808 Ga0451577_0115543 3300042876 Bacteria 2403
809 Ga0451577_0125081 3300042876 Bacteria 2304
810 Ga0466969_0004435 3300044656 Bacteria 7463
811 Ga0466969_0031708 3300044656 Bacteria 2689
812 Ga0466969_0084529 3300044656 Bacteria 1510
813 Ga0466972_0000070 3300044658 Bacteria 100242
814 Ga0466972_0012234 3300044658 Bacteria 4314
815 Ga0466972_0017028 3300044658 Bacteria 3636
816 Ga0466972_0036629 3300044658 Bacteria 2399
817 Ga0453683_0000003 3300044673 Bacteria 942572
818 Ga0466965_0000058 3300044683 Bacteria 36392
819 Ga0466965_0008647 3300044683 Bacteria 4711
820 Ga0466965_0034770 3300044683 Bacteria 2466
821 Ga0466966_0001378 3300044684 Bacteria 15639
822 Ga0466966_0021502 3300044684 Bacteria 4236
823 Ga0466966_0046014 3300044684 Bacteria 2788
824 Ga0466966_0149103 3300044684 Bacteria 1427
825 Ga0466961_0000830 3300044693 Bacteria 19308
826 Ga0466961_0004504 3300044693 Bacteria 8736
827 Ga0466961_0014767 3300044693 Bacteria 5017
828 Ga0466963_0001295 3300044694 Bacteria 13287
829 Ga0466963_0015296 3300044694 Bacteria 4747
830 Ga0466963_0020392 3300044694 Bacteria 4168
831 Ga0466964_0000748 3300044706 Bacteria 10556
832 Ga0453684_0000002 3300044712 Bacteria 1731375
833 Ga0466971_0001966 3300044719 Bacteria 8702
834 Ga0466968_0004778 3300044735 Bacteria 5071
835 Ga0466968_0006364 3300044735 Bacteria 4447
836 Ga0466968_0047003 3300044735 Bacteria 1834
837 Ga0466970_0002802 3300044765 Bacteria 8418
838 Ga0466970_0070017 3300044765 Bacteria 1886
839 Ga0466957_0000140 3300044842 Bacteria 31164
840 Ga0466957_0003144 3300044842 Bacteria 8992
841 Ga0466957_0008820 3300044842 Bacteria 5742
842 Ga0466957_0038666 3300044842 Bacteria 2875
843 Ga0466957_0091231 3300044842 Bacteria 1909
844 Ga0466959_0000387 3300045049 Bacteria 26018
845 Ga0466959_0014205 3300045049 Bacteria 5778
846 Ga0466959_0026242 3300045049 Bacteria 4318
847 Ga0466959_0026333 3300045049 Bacteria 4310
848 Ga0466959_0047272 3300045049 Bacteria 3165
849 Ga0466959_0063245 3300045049 Bacteria 2687
850 Ga0451576_0001215 3300045051 Bacteria 45894
851 Ga0466958_0001550 3300045836 Bacteria 11007
852 Ga0466958_0005578 3300045836 Bacteria 6786
853 Ga0466958_0027829 3300045836 Bacteria 3346
854 Ga0466967_0093791 3300045976 Bacteria 2732
855 Ga0466967_0148667 3300045976 Bacteria 2187
856 Ga0495617_000029 3300046452 Bacteria 153239
857 Ga0495617_000049 3300046452 Bacteria 113032
858 Ga0495617_002469 3300046452 Bacteria 7345
859 Ga0495617_003907 3300046452 Bacteria 5491
860 Ga0495627_000243 3300046453 Bacteria 57215
861 Ga0495627_014622 3300046453 Bacteria 2733
862 Ga0495627_044236 3300046453 Bacteria 1359
863 Ga0495592_0001143 3300046454 Bacteria 18460
864 Ga0495592_0021865 3300046454 Bacteria 4867
865 Ga0495603_0007272 3300046455 Bacteria 6652
866 Ga0495603_0030796 3300046455 Bacteria 3231
867 Ga0495603_0032291 3300046455 Bacteria 3150
868 Ga0495590_0000003 3300046457 Bacteria 478593
869 Ga0495590_0000071 3300046457 Bacteria 71082
870 Ga0495590_0000520 3300046457 Bacteria 18634
871 Ga0495590_0002164 3300046457 Bacteria 8236
872 Ga0495590_0016567 3300046457 Bacteria 2660
873 Ga0495590_0020173 3300046457 Bacteria 2369
874 Ga0495591_000302 3300046458 Bacteria 45128
875 Ga0495591_010370 3300046458 Bacteria 3618
876 Ga0495629_0001179 3300046459 Bacteria 20626
877 Ga0495629_0002054 3300046459 Bacteria 15654
878 Ga0495629_0016485 3300046459 Bacteria 5303
879 Ga0495629_0021355 3300046459 Bacteria 4620
880 Ga0495629_0038980 3300046459 Bacteria 3346
881 Ga0495638_0000091 3300046460 Bacteria 146548
882 Ga0495638_0003603 3300046460 Bacteria 12113
883 Ga0495638_0022951 3300046460 Bacteria 4089
884 Ga0495638_0044764 3300046460 Bacteria 2787
885 Ga0495638_0066869 3300046460 Bacteria 2208
886 Ga0495651_0004530 3300046462 Bacteria 10628
887 Ga0495651_0033766 3300046462 Bacteria 3990
888 Ga0495651_0061436 3300046462 Bacteria 2875
889 Ga0495653_0000013 3300046463 Bacteria 250453
890 Ga0495653_0011174 3300046463 Bacteria 7341
891 Ga0495653_0014977 3300046463 Bacteria 6324
892 Ga0495653_0026309 3300046463 Bacteria 4666
893 Ga0495653_0032069 3300046463 Bacteria 4175
894 Ga0495653_0039805 3300046463 Bacteria 3679
895 Ga0495653_0050022 3300046463 Bacteria 3215
896 Ga0495650_0000011 3300046471 Bacteria 615329
897 Ga0495650_0000051 3300046471 Bacteria 318297
898 Ga0495650_0000097 3300046471 Bacteria 216051
899 Ga0495650_0000314 3300046471 Bacteria 86867
900 Ga0495650_0000343 3300046471 Bacteria 83112
901 Ga0495650_0000928 3300046471 Bacteria 34124
902 Ga0495650_0002256 3300046471 Bacteria 16114
903 Ga0495650_0003703 3300046471 Bacteria 10947
904 Ga0495650_0007227 3300046471 Bacteria 6727
905 Ga0495650_0008161 3300046471 Bacteria 6161
906 Ga0495650_0012542 3300046471 Bacteria 4552
907 Ga0495650_0014413 3300046471 Bacteria 4116
908 Ga0495650_0022575 3300046471 Bacteria 3015
909 Ga0495580_0001176 3300046472 Bacteria 23020
910 Ga0495580_0018947 3300046472 Bacteria 5119
911 Ga0495580_0021175 3300046472 Bacteria 4800
912 Ga0495580_0030459 3300046472 Bacteria 3907
913 Ga0495580_0089451 3300046472 Bacteria 2143
914 Ga0495580_0095561 3300046472 Bacteria 2067
915 Ga0495580_0104952 3300046472 Bacteria 1963
916 Ga0495582_0004931 3300046473 Bacteria 7481
917 Ga0495582_0011386 3300046473 Bacteria 4901
918 Ga0495582_0045514 3300046473 Bacteria 2417
919 Ga0495605_0000234 3300046474 Bacteria 68169
920 Ga0495605_0000251 3300046474 Bacteria 63553
921 Ga0495605_0005192 3300046474 Bacteria 7590
922 Ga0495605_0005507 3300046474 Bacteria 7370
923 Ga0495605_0006769 3300046474 Bacteria 6550
924 Ga0495605_0007871 3300046474 Bacteria 6032
925 Ga0495605_0008862 3300046474 Bacteria 5672
926 Ga0495605_0018518 3300046474 Bacteria 3732
927 Ga0495605_0037474 3300046474 Bacteria 2438
928 Ga0495605_0041092 3300046474 Bacteria 2304
929 Ga0495605_0042368 3300046474 Bacteria 2263
930 Ga0495639_0039762 3300046475 Bacteria 2115
931 Ga0495639_0074782 3300046475 Bacteria 1570
932 Ga0495664_0015882 3300046477 Bacteria 4284
933 Ga0495664_0085430 3300046477 Bacteria 1894
934 Ga0495584_0000008 3300046491 Bacteria 283067
935 Ga0495584_0000155 3300046491 Bacteria 47880
936 Ga0495584_0002111 3300046491 Bacteria 11382
937 Ga0495584_0002139 3300046491 Bacteria 11293
938 Ga0495584_0003852 3300046491 Bacteria 8139
939 Ga0495584_0007277 3300046491 Bacteria 5773
940 Ga0495584_0021584 3300046491 Bacteria 3270
941 Ga0495584_0035140 3300046491 Bacteria 2533
942 Ga0495584_0046173 3300046491 Bacteria 2197
943 Ga0495585_0000139 3300046492 Bacteria 79372
944 Ga0495585_0000285 3300046492 Bacteria 50703
945 Ga0495585_0001306 3300046492 Bacteria 19875
946 Ga0495585_0001720 3300046492 Bacteria 16677
947 Ga0495585_0005485 3300046492 Bacteria 7986
948 Ga0495585_0008284 3300046492 Bacteria 6310
949 Ga0495585_0013629 3300046492 Bacteria 4753
950 Ga0495585_0022115 3300046492 Bacteria 3650
951 Ga0495585_0045464 3300046492 Bacteria 2450
952 Ga0495585_0045747 3300046492 Bacteria 2442
953 Ga0495585_0057009 3300046492 Bacteria 2156
954 Ga0495585_0072560 3300046492 Bacteria 1875
955 Ga0495594_0003334 3300046499 Bacteria 8303
956 Ga0495594_0059105 3300046499 Bacteria 2119
957 Ga0495594_0180999 3300046499 Bacteria 1200
958 Ga0495596_0000533 3300046500 Bacteria 23909
959 Ga0495596_0000734 3300046500 Bacteria 20197
960 Ga0495596_0002070 3300046500 Bacteria 11022
961 Ga0495596_0004202 3300046500 Bacteria 7073
962 Ga0495596_0006292 3300046500 Bacteria 5488
963 Ga0495596_0007656 3300046500 Bacteria 4857
964 Ga0495596_0008125 3300046500 Bacteria 4685
965 Ga0495596_0013632 3300046500 Bacteria 3440
966 Ga0495596_0015649 3300046500 Bacteria 3170
967 Ga0495596_0026109 3300046500 Bacteria 2355
968 Ga0495607_0005443 3300046501 Bacteria 9112
969 Ga0495607_0008143 3300046501 Bacteria 7189
970 Ga0495607_0009072 3300046501 Bacteria 6759
971 Ga0495607_0011726 3300046501 Bacteria 5816
972 Ga0495607_0015950 3300046501 Bacteria 4857
973 Ga0495607_0018697 3300046501 Bacteria 4411
974 Ga0495607_0033307 3300046501 Bacteria 3136
975 Ga0495607_0035729 3300046501 Bacteria 3003
976 Ga0495607_0052196 3300046501 Bacteria 2369
977 Ga0495607_0133794 3300046501 Bacteria 1286
978 Ga0495607_0138793 3300046501 Bacteria 1256
979 Ga0495583_0000068 3300046506 Bacteria 188922
980 Ga0495583_0000197 3300046506 Bacteria 101236
981 Ga0495583_0000232 3300046506 Bacteria 93029
982 Ga0495583_0000280 3300046506 Bacteria 82145
983 Ga0495583_0000568 3300046506 Bacteria 51044
984 Ga0495583_0023503 3300046506 Bacteria 3116
985 Ga0495606_0000141 3300046507 Bacteria 123586
986 Ga0495606_0000266 3300046507 Bacteria 92444
987 Ga0495606_0000935 3300046507 Bacteria 43005
988 Ga0495606_0006074 3300046507 Bacteria 11285
989 Ga0495606_0007191 3300046507 Bacteria 10042
990 Ga0495606_0008896 3300046507 Bacteria 8602
991 Ga0495606_0011924 3300046507 Bacteria 7030
992 Ga0495606_0011964 3300046507 Bacteria 7011
993 Ga0495606_0013174 3300046507 Bacteria 6561
994 Ga0495606_0013999 3300046507 Bacteria 6289
995 Ga0495606_0022484 3300046507 Bacteria 4593
996 Ga0495606_0023201 3300046507 Bacteria 4503
997 Ga0495606_0026282 3300046507 Bacteria 4151
998 Ga0495606_0028934 3300046507 Bacteria 3899
999 Ga0495606_0050067 3300046507 Bacteria 2735
1000 Ga0495606_0062689 3300046507 Bacteria 2372
1001 Ga0495606_0065767 3300046507 Bacteria 2302
1002 Ga0495606_0073876 3300046507 Bacteria 2137
1003 Ga0495608_0000766 3300046511 Bacteria 22480
1004 Ga0495608_0005430 3300046511 Bacteria 9114
1005 Ga0495608_0021182 3300046511 Bacteria 4462
1006 Ga0495608_0046988 3300046511 Bacteria 2871
1007 Ga0495610_0000003 3300046512 Bacteria 1203910
1008 Ga0495610_0000715 3300046512 Bacteria 31576
1009 Ga0495610_0002557 3300046512 Bacteria 15140
1010 Ga0495610_0009229 3300046512 Bacteria 6258
1011 Ga0495610_0010336 3300046512 Bacteria 5811
1012 Ga0495610_0011374 3300046512 Bacteria 5447
1013 Ga0495610_0015506 3300046512 Bacteria 4424
1014 Ga0495610_0023467 3300046512 Bacteria 3352
1015 Ga0495610_0034995 3300046512 Bacteria 2582
1016 Ga0495616_0000173 3300046513 Bacteria 54951
1017 Ga0495616_0001567 3300046513 Bacteria 15760
1018 Ga0495616_0001770 3300046513 Bacteria 14699
1019 Ga0495616_0003040 3300046513 Bacteria 10864
1020 Ga0495616_0016379 3300046513 Bacteria 4104
1021 Ga0495616_0016824 3300046513 Bacteria 4040
1022 Ga0495616_0038980 3300046513 Bacteria 2436
1023 Ga0495616_0040056 3300046513 Bacteria 2396
1024 Ga0495616_0046662 3300046513 Bacteria 2185
1025 Ga0495616_0094047 3300046513 Bacteria 1414
1026 Ga0495618_0004670 3300046514 Bacteria 8378
1027 Ga0495618_0018606 3300046514 Bacteria 4266
1028 Ga0495620_0003682 3300046515 Bacteria 8753
1029 Ga0495620_0021159 3300046515 Bacteria 3163
1030 Ga0495628_0006004 3300046516 Bacteria 10624
1031 Ga0495628_0015479 3300046516 Bacteria 6370
1032 Ga0495628_0044665 3300046516 Bacteria 3523
1033 Ga0495628_0054760 3300046516 Bacteria 3144
1034 Ga0495628_0097516 3300046516 Bacteria 2271
1035 Ga0495630_0001572 3300046517 Bacteria 15867
1036 Ga0495630_0005461 3300046517 Bacteria 8979
1037 Ga0495630_0345795 3300046517 Bacteria 1138
1038 Ga0495631_0000103 3300046518 Bacteria 55680
1039 Ga0495631_0002483 3300046518 Bacteria 10381
1040 Ga0495631_0014124 3300046518 Bacteria 3859
1041 Ga0495631_0018497 3300046518 Bacteria 3278
1042 Ga0495631_0035003 3300046518 Bacteria 2248
1043 Ga0495631_0058114 3300046518 Bacteria 1682
1044 Ga0495632_0000063 3300046519 Bacteria 117984
1045 Ga0495632_0000461 3300046519 Bacteria 38731
1046 Ga0495632_0001335 3300046519 Bacteria 20726
1047 Ga0495632_0001954 3300046519 Bacteria 16450
1048 Ga0495632_0006624 3300046519 Bacteria 7410
1049 Ga0495632_0010421 3300046519 Bacteria 5507
1050 Ga0495632_0012834 3300046519 Bacteria 4807
1051 Ga0495632_0045115 3300046519 Bacteria 2197
1052 Ga0495637_0000004 3300046520 Bacteria 589740
1053 Ga0495637_0000087 3300046520 Bacteria 72113
1054 Ga0495637_0000443 3300046520 Bacteria 30281
1055 Ga0495637_0000715 3300046520 Bacteria 22720
1056 Ga0495637_0020601 3300046520 Bacteria 3032
1057 Ga0495637_0035761 3300046520 Bacteria 2167
1058 Ga0495643_0000179 3300046522 Bacteria 100406
1059 Ga0495643_0000194 3300046522 Bacteria 96362
1060 Ga0495643_0001483 3300046522 Bacteria 21369
1061 Ga0495643_0003103 3300046522 Bacteria 12434
1062 Ga0495643_0007505 3300046522 Bacteria 7017
1063 Ga0495643_0011094 3300046522 Bacteria 5507
1064 Ga0495643_0016657 3300046522 Bacteria 4315
1065 Ga0495643_0018118 3300046522 Bacteria 4100
1066 Ga0495643_0036164 3300046522 Bacteria 2714
1067 Ga0495643_0047896 3300046522 Bacteria 2312
1068 Ga0495644_0005431 3300046523 Bacteria 4978
1069 Ga0495644_0019647 3300046523 Bacteria 2579
1070 Ga0495644_0020261 3300046523 Bacteria 2537
1071 Ga0495648_0000030 3300046524 Bacteria 216178
1072 Ga0495648_0000058 3300046524 Bacteria 156717
1073 Ga0495648_0000288 3300046524 Bacteria 57183
1074 Ga0495648_0006444 3300046524 Bacteria 9581
1075 Ga0495648_0020957 3300046524 Bacteria 4544
1076 Ga0495648_0022571 3300046524 Bacteria 4327
1077 Ga0495648_0022599 3300046524 Bacteria 4324
1078 Ga0495648_0026542 3300046524 Bacteria 3896
1079 Ga0495648_0033671 3300046524 Bacteria 3343
1080 Ga0495648_0040603 3300046524 Bacteria 2948
1081 Ga0495648_0041119 3300046524 Bacteria 2923
1082 Ga0495648_0051313 3300046524 Bacteria 2514
1083 Ga0495648_0087272 3300046524 Bacteria 1757
1084 Ga0495663_0016751 3300046525 Bacteria 2073
1085 Ga0495663_0046117 3300046525 Bacteria 1338
1086 Ga0495666_0001341 3300046526 Bacteria 11928
1087 Ga0495666_0001622 3300046526 Bacteria 11086
1088 Ga0495666_0006371 3300046526 Bacteria 5943
1089 Ga0495666_0007801 3300046526 Bacteria 5358
1090 Ga0495666_0065341 3300046526 Bacteria 1735
1091 Ga0495642_0000038 3300046528 Bacteria 79256
1092 Ga0495642_0001686 3300046528 Bacteria 9566
1093 Ga0495642_0001822 3300046528 Bacteria 9120
1094 Ga0495642_0007379 3300046528 Bacteria 4216
1095 Ga0495642_0022419 3300046528 Bacteria 2488
1096 Ga0495642_0028452 3300046528 Bacteria 2227
1097 Ga0495642_0035911 3300046528 Bacteria 2002
1098 Ga0495642_0037192 3300046528 Bacteria 1969
1099 Ga0495642_0090471 3300046528 Bacteria 1295
1100 Ga0495642_0104510 3300046528 Bacteria 1208
1101 Ga0495652_0003591 3300046529 Bacteria 15216
1102 Ga0495652_0034086 3300046529 Bacteria 4439
1103 Ga0495652_0050830 3300046529 Bacteria 3542
1104 Ga0495652_0083324 3300046529 Bacteria 2632
1105 Ga0495652_0118635 3300046529 Bacteria 2114
1106 Ga0495652_0152421 3300046529 Bacteria 1804
1107 Ga0495654_0000002 3300046530 Bacteria 1021205
1108 Ga0495654_0000074 3300046530 Bacteria 114325
1109 Ga0495654_0001298 3300046530 Bacteria 17498
1110 Ga0495654_0009807 3300046530 Bacteria 5233
1111 Ga0495654_0012668 3300046530 Bacteria 4527
1112 Ga0495654_0048366 3300046530 Bacteria 2087
1113 Ga0495654_0050608 3300046530 Bacteria 2029
1114 Ga0495665_0002821 3300046531 Bacteria 9374
1115 Ga0495665_0004778 3300046531 Bacteria 7316
1116 Ga0495665_0015085 3300046531 Bacteria 4164
1117 Ga0495665_0022696 3300046531 Bacteria 3371
1118 Ga0495640_0000384 3300046533 Bacteria 31361
1119 Ga0495586_0000938 3300046535 Bacteria 16544
1120 Ga0495586_0002348 3300046535 Bacteria 10296
1121 Ga0495586_0004178 3300046535 Bacteria 7736
1122 Ga0495586_0037866 3300046535 Bacteria 2589
1123 Ga0495586_0038223 3300046535 Bacteria 2576
1124 Ga0495587_0013822 3300046536 Bacteria 5071
1125 Ga0495598_0048790 3300046537 Bacteria 1267
1126 Ga0495609_0000021 3300046538 Bacteria 281770
1127 Ga0495609_0003555 3300046538 Bacteria 8886
1128 Ga0495609_0003830 3300046538 Bacteria 8463
1129 Ga0495609_0009073 3300046538 Bacteria 4832
1130 Ga0495609_0009412 3300046538 Bacteria 4729
1131 Ga0495609_0022200 3300046538 Bacteria 2924
1132 Ga0495609_0025432 3300046538 Bacteria 2714
1133 Ga0495609_0039336 3300046538 Bacteria 2129
1134 Ga0495597_0001756 3300046542 Bacteria 14923
1135 Ga0495597_0002353 3300046542 Bacteria 12173
1136 Ga0495597_0002945 3300046542 Bacteria 10328
1137 Ga0495597_0003156 3300046542 Bacteria 9858
1138 Ga0495597_0004756 3300046542 Bacteria 7346
1139 Ga0495597_0005049 3300046542 Bacteria 7062
1140 Ga0495597_0007908 3300046542 Bacteria 5359
1141 Ga0495597_0009349 3300046542 Bacteria 4847
1142 Ga0495597_0013813 3300046542 Bacteria 3860
1143 Ga0495597_0014016 3300046542 Bacteria 3828
1144 Ga0495597_0024876 3300046542 Bacteria 2760
1145 Ga0495645_0006284 3300046543 Bacteria 8238
1146 Ga0495645_0025686 3300046543 Bacteria 4277
1147 Ga0495645_0036985 3300046543 Bacteria 3557
1148 Ga0495645_0078869 3300046543 Bacteria 2366
1149 Ga0495645_0120509 3300046543 Bacteria 1847
1150 Ga0495645_0143827 3300046543 Bacteria 1662
1151 Ga0495622_0000054 3300046557 Bacteria 102782
1152 Ga0495622_0001760 3300046557 Bacteria 10690
1153 Ga0495622_0001770 3300046557 Bacteria 10654
1154 Ga0495633_0000119 3300046558 Bacteria 106455
1155 Ga0495633_0000249 3300046558 Bacteria 64232
1156 Ga0495633_0003574 3300046558 Bacteria 10280
1157 Ga0495633_0004345 3300046558 Bacteria 9047
1158 Ga0495633_0005254 3300046558 Bacteria 7985
1159 Ga0495633_0006155 3300046558 Bacteria 7173
1160 Ga0495633_0007353 3300046558 Bacteria 6347
1161 Ga0495633_0008446 3300046558 Bacteria 5794
1162 Ga0495633_0013888 3300046558 Bacteria 4223
1163 Ga0495633_0023469 3300046558 Bacteria 3056
1164 Ga0495633_0040011 3300046558 Bacteria 2235
1165 Ga0495667_0003921 3300046559 Bacteria 9985
1166 Ga0495656_0009208 3300046615 Bacteria 3546
1167 Ga0495656_0059394 3300046615 Bacteria 1663
1168 Ga0495668_0000383 3300046616 Bacteria 58324
1169 Ga0495668_0000466 3300046616 Bacteria 51377
1170 Ga0495668_0000935 3300046616 Bacteria 32582
1171 Ga0495668_0000980 3300046616 Bacteria 31179
1172 Ga0495668_0005855 3300046616 Bacteria 8202
1173 Ga0495668_0006288 3300046616 Bacteria 7824
1174 Ga0495668_0007471 3300046616 Bacteria 6982
1175 Ga0495668_0031332 3300046616 Bacteria 2997
1176 Ga0495634_0008233 3300046642 Bacteria 7776
1177 Ga0495634_0038246 3300046642 Bacteria 3272
1178 Ga0495634_0048583 3300046642 Bacteria 2856
1179 Ga0495634_0106643 3300046642 Bacteria 1805
1180 Ga0495611_0000517 3300046648 Bacteria 22920
1181 Ga0495611_0001481 3300046648 Bacteria 11663
1182 Ga0495611_0002945 3300046648 Bacteria 7585
1183 Ga0495611_0018088 3300046648 Bacteria 3020
1184 Ga0495611_0030436 3300046648 Bacteria 2373
1185 Ga0495611_0035916 3300046648 Bacteria 2197
1186 Ga0495611_0120214 3300046648 Bacteria 1225
1187 Ga0495625_0000132 3300046660 Bacteria 115728
1188 Ga0495625_0000139 3300046660 Bacteria 112271
1189 Ga0495625_0005799 3300046660 Bacteria 11158
1190 Ga0495625_0006766 3300046660 Bacteria 10146
1191 Ga0495625_0038343 3300046660 Bacteria 3509
1192 Ga0495625_0039103 3300046660 Bacteria 3466
1193 Ga0495625_0068948 3300046660 Bacteria 2485
1194 Ga0495625_0120043 3300046660 Bacteria 1790
1195 Ga0495625_0203433 3300046660 Bacteria 1305
1196 Ga0495635_0021073 3300046663 Bacteria 4542
1197 Ga0495635_0091593 3300046663 Bacteria 2079
1198 Ga0495659_0053244 3300046664 Bacteria 1478
1199 Ga0495661_0000052 3300046665 Bacteria 140244
1200 Ga0495661_0009467 3300046665 Bacteria 6686
1201 Ga0495661_0010711 3300046665 Bacteria 6245
1202 Ga0495661_0012664 3300046665 Bacteria 5692
1203 Ga0495661_0014126 3300046665 Bacteria 5350
1204 Ga0495661_0014206 3300046665 Bacteria 5335
1205 Ga0495661_0018018 3300046665 Bacteria 4651
1206 Ga0495661_0026257 3300046665 Bacteria 3752
1207 Ga0495661_0037177 3300046665 Bacteria 3041
1208 Ga0495661_0040145 3300046665 Bacteria 2904
1209 Ga0495661_0043388 3300046665 Bacteria 2764
1210 Ga0495661_0051066 3300046665 Bacteria 2499
1211 Ga0495661_0064886 3300046665 Bacteria 2152
1212 Ga0495588_0000083 3300046674 Bacteria 197018
1213 Ga0495588_0047810 3300046674 Bacteria 2197
1214 Ga0495588_0083697 3300046674 Bacteria 1666
1215 Ga0495588_0089115 3300046674 Bacteria 1615
1216 Ga0495599_0001313 3300046678 Bacteria 14157
1217 Ga0495599_0003110 3300046678 Bacteria 9670
1218 Ga0495599_0018809 3300046678 Bacteria 4306
1219 Ga0495623_0012947 3300046679 Bacteria 5399
1220 Ga0495623_0123122 3300046679 Bacteria 1559
1221 Ga0495646_0002069 3300046680 Bacteria 12169
1222 Ga0495646_0008027 3300046680 Bacteria 6710
1223 Ga0495658_0048770 3300046683 Bacteria 2389
1224 Ga0495658_0165545 3300046683 Bacteria 1366
1225 Ga0495669_0000086 3300046684 Bacteria 61977
1226 Ga0495669_0000734 3300046684 Bacteria 14179
1227 Ga0495669_0018994 3300046684 Bacteria 2963
1228 Ga0495669_0019307 3300046684 Bacteria 2941
1229 Ga0495669_0037863 3300046684 Bacteria 2135
1230 Ga0495669_0103976 3300046684 Bacteria 1321
1231 Ga0495613_0005741 3300046689 Bacteria 9297
1232 Ga0495613_0018060 3300046689 Bacteria 5255
1233 Ga0495613_0032254 3300046689 Bacteria 3890
1234 Ga0495613_0040133 3300046689 Bacteria 3469
1235 Ga0495624_0002244 3300046690 Bacteria 14729
1236 Ga0495624_0021769 3300046690 Bacteria 4248
1237 Ga0495624_0034973 3300046690 Bacteria 3246
1238 Ga0495624_0047581 3300046690 Bacteria 2725
1239 Ga0495624_0076277 3300046690 Bacteria 2080
1240 Ga0495624_0095406 3300046690 Bacteria 1833
1241 Ga0495624_0105223 3300046690 Bacteria 1736
1242 Ga0495670_0003781 3300046691 Bacteria 7437
1243 Ga0495670_0004207 3300046691 Bacteria 7052
1244 Ga0495670_0013889 3300046691 Bacteria 3960
1245 Ga0495670_0041825 3300046691 Bacteria 2287
1246 Ga0495670_0042883 3300046691 Bacteria 2258
1247 Ga0495670_0064429 3300046691 Bacteria 1846
1248 Ga0495671_0000001 3300046692 Bacteria 1169494
1249 Ga0495671_0001547 3300046692 Bacteria 15291
1250 Ga0495671_0012227 3300046692 Bacteria 4692
1251 Ga0495671_0012468 3300046692 Bacteria 4641
1252 Ga0495671_0012531 3300046692 Bacteria 4626
1253 Ga0495671_0022645 3300046692 Bacteria 3289
1254 Ga0495649_0000138 3300046694 Bacteria 63264
1255 Ga0495649_0001419 3300046694 Bacteria 18111
1256 Ga0495649_0009719 3300046694 Bacteria 5698
1257 Ga0495649_0012333 3300046694 Bacteria 4978
1258 Ga0495649_0168631 3300046694 Bacteria 1146
1259 Ga0495589_0000012 3300046794 Bacteria 248641
1260 Ga0495589_0001013 3300046794 Bacteria 17019
1261 Ga0495589_0002523 3300046794 Bacteria 10191
1262 Ga0495589_0004690 3300046794 Bacteria 7260
1263 Ga0495589_0005172 3300046794 Bacteria 6900
1264 Ga0495589_0005498 3300046794 Bacteria 6682
1265 Ga0495589_0013534 3300046794 Bacteria 4207
1266 Ga0495589_0023143 3300046794 Bacteria 3166
1267 Ga0495600_0004658 3300046809 Bacteria 8216
1268 Ga0495600_0100279 3300046809 Bacteria 1887
1269 Ga0495600_0198059 3300046809 Bacteria 1290
1270 Ga0495660_0000921 3300046810 Bacteria 21636
1271 Ga0495660_0008376 3300046810 Bacteria 6047
1272 Ga0495660_0010852 3300046810 Bacteria 5292
1273 Ga0495660_0017627 3300046810 Bacteria 4109
1274 Ga0495660_0027386 3300046810 Bacteria 3225
1275 Ga0495660_0032340 3300046810 Bacteria 2937
1276 Ga0495660_0103721 3300046810 Bacteria 1460
1277 Ga0495581_0000409 3300047315 Bacteria 21661
1278 Ga0495581_0005132 3300047315 Bacteria 7577
1279 Ga0495581_0024397 3300047315 Bacteria 3504
1280 Ga0495581_0035969 3300047315 Bacteria 2864
1281 Ga0495581_0173898 3300047315 Bacteria 1259
1282 Ga0495604_0008259 3300047317 Bacteria 8235
1283 Ga0495604_0026650 3300047317 Bacteria 4600
1284 Ga0495604_0046170 3300047317 Bacteria 3396
1285 Ga0495604_0080173 3300047317 Bacteria 2446
1286 Ga0495604_0170575 3300047317 Bacteria 1530
1287 Ga0495636_0002974 3300047318 Bacteria 6553
1288 Ga0495636_0004077 3300047318 Bacteria 5716
1289 Ga0495636_0033472 3300047318 Bacteria 2112
1290 Ga0495674_0041330 3300047319 Bacteria 4119
1291 Ga0495674_0053500 3300047319 Bacteria 3548
1292 Ga0495674_0056273 3300047319 Bacteria 3445
1293 Ga0495674_0315882 3300047319 Bacteria 1274
1294 Ga0495674_0388287 3300047319 Bacteria 1128
1295 Ga0495672_0000170 3300047320 Bacteria 94669
1296 Ga0495672_0000240 3300047320 Bacteria 77639
1297 Ga0495672_0000801 3300047320 Bacteria 33909
1298 Ga0495672_0000896 3300047320 Bacteria 31234
1299 Ga0495672_0003434 3300047320 Bacteria 13566
1300 Ga0495672_0005376 3300047320 Bacteria 10183
1301 Ga0495672_0009345 3300047320 Bacteria 7116
1302 Ga0495672_0073444 3300047320 Bacteria 1928
1303 Ga0495676_0000670 3300047321 Bacteria 28462
1304 Ga0495676_0027149 3300047321 Bacteria 4914
1305 Ga0495676_0089324 3300047321 Bacteria 2309
1306 Ga0495676_0150268 3300047321 Bacteria 1658
1307 Ga0495676_0239672 3300047321 Bacteria 1242
1308 Ga0495676_0283294 3300047321 Bacteria 1122
1309 Ga0495680_0001210 3300047322 Bacteria 28304
1310 Ga0495680_0001589 3300047322 Bacteria 24279
1311 Ga0495680_0016580 3300047322 Bacteria 6324
1312 Ga0495680_0026694 3300047322 Bacteria 4756
1313 Ga0495680_0045299 3300047322 Bacteria 3473
1314 Ga0495683_0000035 3300047323 Bacteria 146394
1315 Ga0495683_0000325 3300047323 Bacteria 40032
1316 Ga0495683_0003363 3300047323 Bacteria 9344
1317 Ga0495683_0006003 3300047323 Bacteria 6670
1318 Ga0495683_0010146 3300047323 Bacteria 4992
1319 Ga0495683_0012685 3300047323 Bacteria 4424
1320 Ga0495683_0014466 3300047323 Bacteria 4110
1321 Ga0495683_0015131 3300047323 Bacteria 4018
1322 Ga0495683_0038381 3300047323 Bacteria 2425
1323 Ga0495683_0049087 3300047323 Bacteria 2114
1324 Ga0495683_0067234 3300047323 Bacteria 1764
1325 Ga0495683_0075353 3300047323 Bacteria 1652
1326 Ga0495687_000022 3300047443 Bacteria 327353
1327 Ga0495687_000149 3300047443 Bacteria 106301
1328 Ga0495687_000326 3300047443 Bacteria 61742
1329 Ga0495687_000373 3300047443 Bacteria 55812
1330 Ga0495687_001062 3300047443 Bacteria 27130
1331 Ga0495687_004721 3300047443 Bacteria 9027
1332 Ga0495687_012071 3300047443 Bacteria 4590
1333 Ga0495687_016191 3300047443 Bacteria 3757
1334 Ga0495675_0006167 3300047444 Bacteria 7336
1335 Ga0495675_0007198 3300047444 Bacteria 6851
1336 Ga0495675_0027890 3300047444 Bacteria 3599
1337 Ga0495675_0058691 3300047444 Bacteria 2439
1338 Ga0495677_0002988 3300047445 Bacteria 6577
1339 Ga0495677_0009710 3300047445 Bacteria 3547
1340 Ga0495677_0012815 3300047445 Bacteria 3056
1341 Ga0495677_0019151 3300047445 Bacteria 2483
1342 Ga0495679_000865 3300047446 Bacteria 19139
1343 Ga0495679_000936 3300047446 Bacteria 18161
1344 Ga0495679_002559 3300047446 Bacteria 9180
1345 Ga0495679_015200 3300047446 Bacteria 2822
1346 Ga0495685_012411 3300047447 Bacteria 2887
1347 Ga0495685_028287 3300047447 Bacteria 1928
1348 Ga0495673_0000006 3300047469 Bacteria 908691
1349 Ga0495673_0000015 3300047469 Bacteria 598766
1350 Ga0495673_0000024 3300047469 Bacteria 521349
1351 Ga0495673_0000049 3300047469 Bacteria 265878
1352 Ga0495673_0011801 3300047469 Bacteria 4673
1353 Ga0495673_0022484 3300047469 Bacteria 3089
1354 Ga0495681_0006364 3300047470 Bacteria 7773
1355 Ga0495681_0009450 3300047470 Bacteria 6007
1356 Ga0495681_0020969 3300047470 Bacteria 3531
1357 Ga0495681_0056941 3300047470 Bacteria 1817
1358 Ga0495681_0061554 3300047470 Bacteria 1728
1359 Ga0495686_0000002 3300047472 Bacteria 1050777
1360 Ga0495686_0000312 3300047472 Bacteria 81912
1361 Ga0495686_0000744 3300047472 Bacteria 43385
1362 Ga0495686_0002260 3300047472 Bacteria 18567
1363 Ga0495686_0003592 3300047472 Bacteria 13314
1364 Ga0495686_0015177 3300047472 Bacteria 5275
1365 Ga0495593_0002055 3300047673 Bacteria 12017
1366 Ga0495593_0022835 3300047673 Bacteria 3481
1367 Ga0495593_0024770 3300047673 Bacteria 3322
1368 Ga0495593_0107344 3300047673 Bacteria 1427
1369 Ga0495602_0004187 3300048088 Bacteria 15010
1370 Ga0495602_0007746 3300048088 Bacteria 11225
1371 Ga0495602_0070288 3300048088 Bacteria 2997
1372 Ga0495602_0175482 3300048088 Bacteria 1658
1373 Ga0495602_0190064 3300048088 Bacteria 1575
1374 Ga0495614_0004682 3300048089 Bacteria 6168
1375 Ga0495614_0022369 3300048089 Bacteria 2728
1376 Ga0495615_0045588 3300048090 Bacteria 1111
1377 Ga0495626_0000082 3300048091 Bacteria 128002
1378 Ga0495626_0000564 3300048091 Bacteria 36841
1379 Ga0495626_0000805 3300048091 Bacteria 28379
1380 Ga0495626_0007028 3300048091 Bacteria 6320
1381 Ga0495626_0007562 3300048091 Bacteria 6032
1382 Ga0495626_0013551 3300048091 Bacteria 4234
1383 Ga0495626_0014017 3300048091 Bacteria 4148
1384 Ga0495626_0019263 3300048091 Bacteria 3413
1385 Ga0495626_0020399 3300048091 Bacteria 3303
1386 Ga0495626_0027194 3300048091 Bacteria 2783
1387 Ga0495626_0034592 3300048091 Bacteria 2416
1388 Ga0496100_0002007 3300048903 Bacteria 10177
1389 Ga0496100_0021276 3300048903 Bacteria 3903
1390 Ga0496100_0034399 3300048903 Bacteria 3179
1391 Ga0496100_0122698 3300048903 Bacteria 1820
1392 Ga0496100_0245657 3300048903 Bacteria 1322
1393 Ga0496101_0003262 3300048904 Bacteria 10080
1394 Ga0496101_0004357 3300048904 Bacteria 8889
1395 Ga0496101_0005768 3300048904 Bacteria 7915
1396 Ga0496101_0015923 3300048904 Bacteria 5073
1397 Ga0496101_0030404 3300048904 Bacteria 3786
1398 Ga0496101_0066919 3300048904 Bacteria 2622
1399 Ga0496102_0000231 3300048905 Bacteria 73157
1400 Ga0496102_0000410 3300048905 Bacteria 49794
1401 Ga0496102_0001160 3300048905 Bacteria 24083
1402 Ga0496102_0001615 3300048905 Bacteria 19875
1403 Ga0496102_0006411 3300048905 Bacteria 10030
1404 Ga0496102_0007060 3300048905 Bacteria 9586
1405 Ga0496102_0045378 3300048905 Bacteria 3990
1406 Ga0496102_0197890 3300048905 Bacteria 1894
1407 Ga0496102_0272930 3300048905 Bacteria 1594
1408 Ga0496103_0000526 3300048906 Bacteria 31220
1409 Ga0496103_0000758 3300048906 Bacteria 23818
1410 Ga0496103_0003846 3300048906 Bacteria 9136
1411 Ga0496103_0013506 3300048906 Bacteria 4845
1412 Ga0496103_0014487 3300048906 Bacteria 4681
1413 Ga0496103_0031196 3300048906 Bacteria 3246
1414 Ga0496104_0002107 3300048907 Bacteria 17270
1415 Ga0496104_0057947 3300048907 Bacteria 3666
1416 Ga0496104_0159239 3300048907 Bacteria 2166
1417 Ga0496104_0303976 3300048907 Bacteria 1507
1418 Ga0496105_0004353 3300048908 Bacteria 10663
1419 Ga0496105_0054030 3300048908 Bacteria 3317
1420 Ga0496105_0143419 3300048908 Bacteria 1965
1421 Ga0496105_0144583 3300048908 Bacteria 1956
1422 Ga0496106_0000029 3300048909 Bacteria 141097
1423 Ga0496106_0075066 3300048909 Bacteria 2589
1424 Ga0496107_0031872 3300048910 Bacteria 3764
1425 Ga0496107_0069094 3300048910 Bacteria 2563
1426 Ga0496107_0113508 3300048910 Bacteria 1993
1427 Ga0496107_0137781 3300048910 Bacteria 1803
1428 Ga0496107_0176739 3300048910 Bacteria 1585
1429 Ga0496108_0007605 3300048911 Bacteria 8774
1430 Ga0496108_0028121 3300048911 Bacteria 4651
1431 Ga0496108_0168445 3300048911 Bacteria 1894
1432 Ga0496108_0277540 3300048911 Bacteria 1459
1433 Ga0496109_0028543 3300048912 Bacteria 4991
1434 Ga0496110_0000779 3300048913 Bacteria 22181
1435 Ga0496110_0001082 3300048913 Bacteria 19190
1436 Ga0496110_0004874 3300048913 Bacteria 10469
1437 Ga0496110_0011024 3300048913 Bacteria 7377
1438 Ga0496110_0193456 3300048913 Bacteria 1847
1439 Ga0496110_0230038 3300048913 Bacteria 1686
1440 Ga0496111_0088110 3300048914 Bacteria 2273
1441 Ga0496112_0000694 3300048915 Bacteria 23483
1442 Ga0496112_0022903 3300048915 Bacteria 5959
1443 Ga0496112_0079568 3300048915 Bacteria 3242
1444 Ga0496113_0023520 3300048916 Bacteria 4369
1445 Ga0496113_0098129 3300048916 Bacteria 2267
1446 Ga0496114_0016577 3300048917 Bacteria 5939
1447 Ga0496114_0054376 3300048917 Bacteria 3338
1448 Ga0496114_0148098 3300048917 Bacteria 2036
1449 Ga0496115_0023344 3300048918 Bacteria 4799
1450 Ga0496115_0056602 3300048918 Bacteria 3152
1451 Ga0496115_0089511 3300048918 Bacteria 2514
1452 Ga0496115_0214007 3300048918 Bacteria 1591
1453 Ga0496116_0004796 3300048919 Bacteria 12761
1454 Ga0496116_0005572 3300048919 Bacteria 11613
1455 Ga0496116_0014372 3300048919 Bacteria 6328
1456 Ga0496116_0016701 3300048919 Bacteria 5733
1457 Ga0496116_0033865 3300048919 Bacteria 3617
1458 Ga0496117_0000001 3300048920 Bacteria 2526244
1459 Ga0496117_0000755 3300048920 Bacteria 50943
1460 Ga0496117_0002426 3300048920 Bacteria 23567
1461 Ga0496117_0004332 3300048920 Bacteria 15777
1462 Ga0496117_0015767 3300048920 Bacteria 6416
1463 Ga0496117_0092636 3300048920 Bacteria 1940
1464 Ga0496118_0000078 3300048921 Bacteria 190946
1465 Ga0496118_0004181 3300048921 Bacteria 17368
1466 Ga0496118_0011820 3300048921 Bacteria 8470
1467 Ga0496118_0012940 3300048921 Bacteria 7944
1468 Ga0496118_0016090 3300048921 Bacteria 6881
1469 Ga0496118_0059827 3300048921 Bacteria 2833
1470 Ga0496118_0061387 3300048921 Bacteria 2784
1471 Ga0496119_0071699 3300048922 Bacteria 2027
1472 Ga0496121_0004482 3300048924 Bacteria 18741
1473 Ga0496121_0007119 3300048924 Bacteria 13577
1474 Ga0496121_0012818 3300048924 Bacteria 9075
1475 Ga0496121_0016195 3300048924 Bacteria 7717
1476 Ga0496121_0016657 3300048924 Bacteria 7568
1477 Ga0496121_0024151 3300048924 Bacteria 5823
1478 Ga0496121_0033907 3300048924 Bacteria 4607
1479 Ga0496121_0044023 3300048924 Bacteria 3857
1480 Ga0496121_0101645 3300048924 Bacteria 2216
1481 Ga0496121_0110043 3300048924 Bacteria 2103
1482 Ga0496122_0001026 3300048925 Bacteria 49313
1483 Ga0496122_0005297 3300048925 Bacteria 15434
1484 Ga0496122_0005801 3300048925 Bacteria 14515
1485 Ga0496122_0015357 3300048925 Bacteria 7325
1486 Ga0496122_0040382 3300048925 Bacteria 3709
1487 Ga0496122_0058838 3300048925 Bacteria 2841
1488 Ga0496122_0124279 3300048925 Bacteria 1656
1489 Ga0496122_0153753 3300048925 Bacteria 1415
1490 Ga0496123_0002474 3300048926 Bacteria 22801
1491 Ga0496123_0004250 3300048926 Bacteria 15250
1492 Ga0496123_0010211 3300048926 Bacteria 8330
1493 Ga0496123_0014295 3300048926 Bacteria 6590
1494 Ga0496123_0021284 3300048926 Bacteria 5045
1495 Ga0496123_0032993 3300048926 Bacteria 3734
1496 Ga0496123_0033673 3300048926 Bacteria 3682
1497 Ga0496124_0002429 3300048927 Bacteria 24422
1498 Ga0496124_0053740 3300048927 Bacteria 3412
1499 Ga0496124_0103400 3300048927 Bacteria 2304
1500 Ga0496124_0120953 3300048927 Bacteria 2092
1501 Ga0496124_0127282 3300048927 Bacteria 2027
1502 Ga0496125_0003324 3300048928 Bacteria 19642
1503 Ga0496125_0004189 3300048928 Bacteria 16803
1504 Ga0496125_0147310 3300048928 Bacteria 1624
1505 Ga0496126_0000192 3300048929 Bacteria 136536
1506 Ga0496126_0000604 3300048929 Bacteria 67945
1507 Ga0496126_0018997 3300048929 Bacteria 6787
1508 Ga0496126_0023849 3300048929 Bacteria 5921
1509 Ga0496126_0030750 3300048929 Bacteria 5083
1510 Ga0496126_0150321 3300048929 Bacteria 1997
1511 Ga0496126_0191503 3300048929 Bacteria 1732
1512 Ga0501308_000648 3300049128 Bacteria 2386
1513 Ga0501304_001077 3300049160 Bacteria 1661
1514 Ga0495678_000185 3300049459 Bacteria 72410
1515 Ga0495678_000240 3300049459 Bacteria 61885
1516 Ga0495678_000374 3300049459 Bacteria 45408
1517 Ga0495678_000679 3300049459 Bacteria 31270
1518 Ga0495678_001937 3300049459 Bacteria 14986
1519 Ga0495678_003621 3300049459 Bacteria 9415
1520 Ga0495678_004540 3300049459 Bacteria 7994
1521 Ga0495678_015969 3300049459 Bacteria 3445
1522 Ga0495678_021387 3300049459 Bacteria 2849
1523 Ga0495682_0003433 3300049460 Bacteria 7038
1524 Ga0495682_0006008 3300049460 Bacteria 4960
1525 Ga0495682_0013866 3300049460 Bacteria 3060
1526 Ga0495682_0019113 3300049460 Bacteria 2578
1527 Ga0495682_0050595 3300049460 Bacteria 1511
1528 Ga0501032_0008558 3300049569 Bacteria 7464
1529 Ga0501033_0000693 3300049570 Bacteria 31157
1530 Ga0501034_0000628 3300049571 Bacteria 54785
1531 Ga0501034_0113456 3300049571 Bacteria 2700
1532 Ga0501036_0005253 3300049572 Bacteria 10479
1533 Ga0501037_0042698 3300049573 Bacteria 3332
1534 Ga0501038_0003200 3300049574 Bacteria 15271
1535 Ga0501039_0000950 3300049575 Bacteria 21060
1536 Ga0501040_0002182 3300049576 Bacteria 12622
1537 Ga0501041_0010690 3300049577 Bacteria 5415
1538 Ga0501042_0001629 3300049578 Bacteria 13359
1539 Ga0501043_0005031 3300049579 Bacteria 10700
1540 Ga0501046_0001055 3300049580 Bacteria 26972
1541 Ga0501048_0001193 3300049582 Bacteria 19672
1542 Ga0501068_0076038 3300049584 Bacteria 2054
1543 Ga0501070_0173369 3300049586 Bacteria 1776
1544 Ga0501071_0017226 3300049587 Bacteria 4980
1545 Ga0501072_0004690 3300049588 Bacteria 10413
1546 Ga0501074_0005903 3300049590 Bacteria 8828
1547 Ga0501075_0002813 3300049591 Bacteria 11666
1548 Ga0501076_0008797 3300049592 Bacteria 7419
1549 Ga0501077_0003308 3300049593 Bacteria 9697
1550 Ga0501079_0003996 3300049741 Bacteria 10900
1551 Ga0501080_0006070 3300049742 Bacteria 10830
1552 Ga0501080_0227072 3300049742 Bacteria 1707
1553 Ga0501081_0000437 3300049743 Bacteria 23051
1554 Ga0501035_0000793 3300049822 Bacteria 33614
1555 Ga0501035_0025915 3300049822 Bacteria 5372
1556 Ga0501044_0163539 3300049823 Bacteria 2201
1557 Ga0501045_0000054 3300049824 Bacteria 51274
1558 nmdc:mga07m45_28124_c1 3300050496 Bacteria 3103
1559 nmdc:mga08x19_47843_c1 3300050514 Bacteria 2738
1560 Ga0495601_0013846 3300053077 Bacteria 4856
1561 Ga0495601_0140368 3300053077 Bacteria 1576
1562 Ga0495595_0066767 3300053084 Bacteria 1694
1563 Ga0500618_000104 3300053125 Bacteria 68104
1564 Ga0500618_001996 3300053125 Bacteria 8323
1565 Ga0500618_003269 3300053125 Bacteria 5633
1566 Ga0500586_001331 3300053145 Bacteria 5194
1567 Ga0500590_021784 3300053148 Bacteria 3325
1568 Ga0500619_004943 3300053154 Bacteria 2920
1569 Ga0501084_0012495 3300054114 Bacteria 7033
1570 Ga0587077_002155 3300059493 Bacteria 2282
1571 Ga0587082_005003 3300059504 Bacteria 1699
1572 Ga0587083_0009799 3300059505 Bacteria 1536
1573 Ga0587091_016590 3300059511 Bacteria 1230
1574 Ga0587068_001216 3300059641 Bacteria 2810
1575 Ga0587079_014993 3300059647 Bacteria 1310
1576 Ga0501082_0003677 3300060353 Bacteria 13401
1577 Ga0466962_0000565 3300061719 Bacteria 16266
1578 Ga0466962_0003588 3300061719 Bacteria 7398
1579 Ga0530510_0000330 3300061734 Bacteria 30479
1580 Ga0530510_0069753 3300061734 Bacteria 2551
1581 2501073627 2501025501 Bacteria 7768574
1582 2501082232 2501025502 Bacteria 9641094
1583 2501410977 2501025504 Bacteria 8008976
1584 2509128673 2508501125 Bacteria 7208311
1585 2510250883 2510065045 Bacteria 7761063
1586 2511086422 2510917013 Bacteria 9951648
1587 2511096567 2510917014 Bacteria 8296963
1588 2511102796 2510917015 Bacteria 7950052
1589 2511251224 2511231003 Bacteria 5606035
1590 2511384463 2511231026 Bacteria 5225445
1591 2512346222 2512047030 Bacteria 9031815
1592 2513552102 2513237082 Bacteria 8640282
1593 2513560888 2513237083 Bacteria 8410967
1594 2513957889 2513237150 Bacteria 6553639
1595 2513960931 2513237151 Bacteria 6309801
1596 2514041827 2513237165 Bacteria 6771773
1597 2514048122 2513237166 Bacteria 10373764
1598 2515679674 2515154122 Bacteria 8609520
1599 2515692509 2515154123 Bacteria 6387382
1600 2516020337 2515154189 Bacteria 9629850
1601 2519458910 2519103095 Bacteria 6629912
1602 2527075168 2526164713 Bacteria 6780608
1603 2547375434 2547132103 Bacteria 5115736
1604 2550694348 2548876994 Bacteria 4904866
1605 2563063000 2562617112 Bacteria 10918404
1606 2585291588 2582581311 Bacteria 6763856
1607 2597028599 2596583598 Bacteria 5251611
1608 2599445285 2599185178 Bacteria 5365746
1609 2599736508 2599185239 Bacteria 8686614
1610 2599744569 2599185240 Bacteria 7968121
1611 2600206070 2599185355 Bacteria 7968906
1612 2600809747 2600255067 Bacteria 6795583
1613 2601667262 2600255292 Bacteria 6300551
1614 2643798555 2643221556 Bacteria 7251154
1615 2644475561 2643221684 Bacteria 7145183
1616 2676742695 2675903129 Bacteria 7964495
1617 2713477200 2711768613 Bacteria 11048459
1618 2719640019 2718217991 Bacteria 7829542
1619 2723877401 2721755763 Bacteria 4464185
1620 2738820760 2738541296 Bacteria 7285013
1621 2738829668 2738541297 Bacteria 6549566
1622 2738833240 2738541298 Bacteria 7286732
1623 2738874768 2738541306 Bacteria 7284992
1624 2739153464 2738541357 Bacteria 6549408
1625 2739186397 2738543002 Bacteria 7284546
1626 2739195384 2738543003 Bacteria 6549560
1627 2739221366 2738543008 Bacteria 7282815
1628 2739321860 2738543026 Bacteria 6549408
1629 2739339584 2738543029 Bacteria 6549249
1630 2746089635 2744054900 Bacteria 8399525
1631 2746099476 2744054901 Bacteria 8397047
1632 2753570355 2751185846 Bacteria 7242164
1633 2765569168 2765235838 Bacteria 5445269
1634 2792836445 2791355137 Bacteria 9654227
1635 2808969911 2808606384 Bacteria 8474373
1636 2809004444 2808606390 Bacteria 8476311
1637 2809011617 2808606391 Bacteria 8308166
1638 2809145000 2808606418 Bacteria 6724496
1639 2817261178 2816332253 Bacteria 6764532
1640 2817278890 2816332256 Bacteria 6891714
1641 2817457116 2816332286 Bacteria 6853759
1642 2819541180 2818991436 Bacteria 5376622
1643 2819592464 2818991445 Bacteria 4955017
1644 2819620201 2818991450 Bacteria 6962147
1645 2819630992 2818991452 Bacteria 8442785
1646 2821131170 2821131069 Bacteria 6108407
1647 2839095943 2839094727 Bacteria 5534556
1648 2842328137 2842324504 Bacteria 9364110
1649 2842352454 2842348783 Bacteria 9002918
1650 2842459490 2842454564 Bacteria 8730687
1651 2842713667 2842711865 Bacteria 7155354
1652 2842714521 2842711865 Bacteria 7155354
1653 2843695080 2843690924 Bacteria 5169057
1654 2846037442 2846033681 Bacteria 4377894
1655 2846042060 2846037992 Bacteria 4526407
1656 2856293662 2856287931 Bacteria 7223934
1657 2857362420 2857357740 Bacteria 9937880
1658 2857552547 2857547612 Bacteria 6179999
1659 2857560201 2857558681 Bacteria 6617694
1660 2857561628 2857558681 Bacteria 6617694
1661 2857565182 2857564685 Bacteria 6290584
1662 2857568910 2857564685 Bacteria 6290584
1663 2863424906 2863421361 Bacteria 7300805
1664 2870071190 2870068957 Bacteria 8925310
1665 2883088887 2883087390 Bacteria 9532701
1666 2884811992 2884811622 Bacteria 5552861
1667 2884840055 2884836552 Bacteria 5219991
1668 2884857177 2884852848 Bacteria 5221161
1669 2885085161 2885080285 Bacteria 6355622
1670 2885267059 2885266251 Bacteria 4796748
1671 2885278742 2885270888 Bacteria 9831543
1672 2896157764 2896154374 Bacteria 5221518
1673 2900580219 2900577576 Bacteria 5438534
1674 2900635056 2900634093 Bacteria 10263517
1675 2902689678 2902682994 Bacteria 8951596
1676 2904438615 2904434214 Bacteria 6230908
1677 2904484916 2904483920 Bacteria 7545285
1678 2904568931 2904564687 Bacteria 7609577
1679 2904576313 2904571731 Bacteria 7608790
1680 2904617105 2904615490 Bacteria 10047340
1681 2919530639 2919527303 Bacteria 7718827
1682 2928062615 2928058823 Bacteria 5520022
1683 2928110240 2928108538 Bacteria 7360024
1684 2928131226 2928130867 Bacteria 5467269
1685 2928138626 2928135762 Bacteria 7259641
1686 2928160202 2928157003 Bacteria 7522202
1687 2928168694 2928163908 Bacteria 7561269
1688 2928171894 2928170801 Bacteria 8785406
1689 2928505288 2928503688 Bacteria 7268108
1690 2928540108 2928536128 Bacteria 7657547
1691 2932414858 2932410948 Bacteria 6312192
1692 2932419544 2932416698 Bacteria 6315112
1693 2939634950 2939631187 Bacteria 6118131
1694 2945936955 2945934425 Bacteria 7444609
1695 2981994647 2981990288 Bacteria 7590678
1696 2990706317 2990703756 Bacteria 7715990
1697 642423140 641736151 Bacteria 7477263
1698 642419517 641736154 Bacteria 7689995
1699 642592701 642555112 Bacteria 8676562
1700 642621363 642555113 Bacteria 8214658
1701 644751481 644736347 Bacteria 6476522
1702 8003955456 8003955200 Bacteria 8601927
1703 8018851533 8018845410 Bacteria 8933938
1704 8020810720 8020807995 Bacteria 6801506
1705 8020942034 8020938398 Bacteria 7472757
1706 8020946114 8020945358 Bacteria 8467355
1707 8020956770 8020953355 Bacteria 7439080
1708 8021122368 8021120328 Bacteria 8782274
1709 8039102385 8039098773 Bacteria 6602928
1710 8040172849 8040167225 Bacteria 6542727
1711 8040174876 8040173305 Bacteria 6827067
1712 8047675574 8047673197 Bacteria 7395230
1713 8055268284 8055266321 Bacteria 7999742
1714 8055302398 8055301274 Bacteria 8587385
1715 Ga0207678_10214638
1716 JGI24741J21665_1000126
1717 JGI24740J21852_10002156
1718 JGI24740J21852_10002843
1719 JGI24740J21852_10036406
1720 JGI24739J22299_10003819
1721 JGI24739J22299_10021874
1722 JGI24735J21928_10000091
1723 JGI24735J21928_10006360
1724 JGI24735J21928_10007474
1725 JGI24738J21930_10010650
1726 JGI25155J39150_1000304
1727 JGI25155J39150_1000311
1728 JGI25156J39149_1000736
1729 JGI25156J39149_1001156
1730 JGI25156J39149_1001924
1731 JGI25156J39149_1003390
1732 JGI25156J39149_1011453
1733 JGI25162J39368_1000142
1734 JGI25154J39366_1000220
1735 JGI25154J39366_1000628
1736 JGI25154J39366_1000634
1737 JGI25154J39366_1000718
1738 JGI25157J39369_1000265
1739 JGI25163J39215_1002551
1740 JGI25164J39214_1004295
1741 JGI25150J39212_1002698
1742 JGI25151J46595_10019719
1743 JGI25165J46597_1000064
1744 JGI25165J46597_1001227
1745 rootH2_10058489
1746 JGI25160J50197_1000421
1747 Ga0055538_1000031
1748 Ga0055539_1000041
1749 Ga0055539_1000123
1750 Ga0055533_1000051
1751 Ga0055533_1000217
1752 Ga0055532_1000002
1753 Ga0055532_1000015
1754 Ga0055532_1000027
1755 Ga0055532_1000029
1756 Ga0055525_1000001
1757 Ga0055525_1000061
1758 Ga0055525_1000571
1759 Ga0055527_1000019
1760 Ga0055527_1000533
1761 Ga0055527_1002805
1762 Ga0055535_1000021
1763 Ga0055542_1000032
1764 Ga0055542_1001163
1765 Ga0055529_1000038
1766 Ga0055529_1000060
1767 Ga0055529_1000062
1768 Ga0055526_1000066
1769 Ga0055526_1000100
1770 Ga0055541_1000028
1771 Ga0055541_1000208
1772 Ga0055541_1000811
1773 Ga0055543_1004650
1774 Ga0065165_1000281
1775 Ga0065165_1000475
1776 Ga0065165_1002621
1777 Ga0065714_10098877
1778 Ga0065715_10180223
1779 Ga0065707_10000578
1780 Ga0065707_10084248
1781 Ga0070658_10003869
1782 Ga0070658_10105944
1783 Ga0070658_10148699
1784 Ga0070676_10014576
1785 Ga0070676_10018588
1786 Ga0070683_100003358
1787 Ga0070690_100000415
1788 Ga0070690_100000970
1789 Ga0070690_100260120
1790 Ga0070670_100007422
1791 Ga0070670_100026302
1792 Ga0070670_100094973
1793 Ga0070670_100158748
1794 Ga0070677_10004523
1795 Ga0070677_10005761
1796 Ga0068869_100002853
1797 Ga0068869_100004401
1798 Ga0068869_100024754
1799 Ga0070666_10002232
1800 Ga0070666_10014823
1801 Ga0070666_10016331
1802 Ga0070666_10044770
1803 Ga0070680_100061995
1804 Ga0070682_100008747
1805 Ga0068868_100002963
1806 Ga0068868_100003118
1807 Ga0068868_100159628
1808 Ga0068868_100314403
1809 Ga0070660_100000007
1810 Ga0070660_100000221
1811 Ga0070660_100009312
1812 Ga0070660_100198388
1813 Ga0070689_100001396
1814 Ga0070691_10020767
1815 Ga0070687_100018754
1816 Ga0070661_100000077
1817 Ga0070661_100010322
1818 Ga0070661_100017351
1819 Ga0070661_100199786
1820 Ga0070692_10092334
1821 Ga0070668_100002323
1822 Ga0070668_100304008
1823 Ga0070669_100020775
1824 Ga0070669_100044728
1825 Ga0070669_100051433
1826 Ga0070675_100000340
1827 Ga0070675_100003765
1828 Ga0070675_100006646
1829 Ga0070675_100007231
1830 Ga0070675_100128187
1831 Ga0070671_100002234
1832 Ga0070671_100003372
1833 Ga0070671_100035825
1834 Ga0070671_100168090
1835 Ga0070674_100009567
1836 Ga0070674_100014411
1837 Ga0070674_100018134
1838 Ga0070674_100066505
1839 Ga0070674_100133902
1840 Ga0070673_100002105
1841 Ga0070673_100029426
1842 Ga0070673_100061468
1843 Ga0070673_100062840
1844 Ga0070673_100074616
1845 Ga0070673_100192842
1846 Ga0070688_100141301
1847 Ga0070659_100000019
1848 Ga0070659_100001051
1849 Ga0070659_100003354
1850 Ga0070659_100039263
1851 Ga0070667_100002371
1852 Ga0070667_100004918
1853 Ga0070667_100044551
1854 Ga0070714_100020500
1855 Ga0070714_100208036
1856 Ga0070701_10000844
1857 Ga0070700_100000812
1858 Ga0070700_100152900
1859 Ga0070700_100171807
1860 Ga0070694_100027033
1861 Ga0070708_100204078
1862 Ga0070663_100000011
1863 Ga0070663_100001639
1864 Ga0070663_100031877
1865 Ga0070663_100131322
1866 Ga0070663_100168417
1867 Ga0070678_100001667
1868 Ga0070678_100037495
1869 Ga0070678_100064893
1870 Ga0070678_100184777
1871 Ga0070678_100285388
1872 Ga0070662_100010536
1873 Ga0070681_10092877
1874 Ga0068867_100000579
1875 Ga0068867_100008360
1876 Ga0068867_100049630
1877 Ga0068867_100071971
1878 Ga0068867_100098608
1879 Ga0068867_100106121
1880 Ga0068867_100343060
1881 Ga0070685_10057439
1882 Ga0070685_10061169
1883 Ga0070706_100053802
1884 Ga0070707_100231307
1885 Ga0070679_100009410
1886 Ga0070679_100211019
1887 Ga0068853_100038063
1888 Ga0070672_100002630
1889 Ga0070672_100006856
1890 Ga0070672_100186632
1891 Ga0070686_100000272
1892 Ga0070695_100023988
1893 Ga0070696_100001233
1894 Ga0070696_100141265
1895 Ga0070693_100023166
1896 Ga0070693_100108794
1897 Ga0070693_100152543
1898 Ga0070665_100041154
1899 Ga0070665_100160574
1900 Ga0070665_100168686
1901 Ga0070665_100308882
1902 Ga0070704_100056358
1903 Ga0068855_100000737
1904 Ga0068855_100000815
1905 Ga0068855_100001553
1906 Ga0068855_100040158
1907 Ga0068855_100095907
1908 Ga0068855_100325935
1909 Ga0068855_100476898
1910 Ga0070664_100000008
1911 Ga0070664_100003658
1912 Ga0070664_100004893
1913 Ga0070664_100161817
1914 Ga0068857_100055062
1915 Ga0068857_100318888
1916 Ga0068854_100000052
1917 Ga0068854_100008124
1918 Ga0068856_100000009
1919 Ga0068856_100149005
1920 Ga0070702_100000407
1921 Ga0070702_100004309
1922 Ga0068852_100002640
1923 Ga0068852_100160333
1924 Ga0068852_100219161
1925 Ga0068852_100389284
1926 Ga0068852_100413954
1927 Ga0068859_100008729
1928 Ga0068859_100018133
1929 Ga0068859_100032679
1930 Ga0068859_100032776
1931 Ga0068859_100098274
1932 Ga0068859_100285290
1933 Ga0068864_100000301
1934 Ga0068864_100001408
1935 Ga0068864_100001954
1936 Ga0068864_100049249
1937 Ga0068864_100066142
1938 Ga0068864_100066178
1939 Ga0068864_100128503
1940 Ga0068866_10000770
1941 Ga0068866_10013144
1942 Ga0068866_10018051
1943 Ga0068866_10137178
1944 Ga0068861_100000996
1945 Ga0068861_100030681
1946 Ga0068861_100130472
1947 Ga0068861_100244937
1948 Ga0068851_10066176
1949 Ga0068851_10073071
1950 Ga0068870_10036270
1951 Ga0068870_10046154
1952 Ga0068863_100003618
1953 Ga0068863_100010572
1954 Ga0068863_100034955
1955 Ga0068863_100035413
1956 Ga0068863_100052718
1957 Ga0068863_100141743
1958 Ga0068858_100002585
1959 Ga0068858_100004088
1960 Ga0068858_100013329
1961 Ga0068858_100134144
1962 Ga0068858_100374660
1963 Ga0068860_100003547
1964 Ga0068860_100006642
1965 Ga0068860_100029667
1966 Ga0068860_100162999
1967 Ga0068862_100016245
1968 Ga0068862_100191503
1969 Ga0068862_100341891
1970 Ga0075363_100034013
1971 Ga0075364_10118996
1972 Ga0070712_100085781
1973 Ga0070712_100332577
1974 Ga0075366_10055199
1975 Ga0075366_10178045
1976 Ga0097621_100002183
1977 Ga0097621_100003026
1978 Ga0097621_100013211
1979 Ga0097621_100053316
1980 Ga0097621_100174544
1981 Ga0097621_100229009
1982 Ga0075370_10004770
1983 Ga0068871_100001574
1984 Ga0068871_100004804
1985 Ga0068871_100011159
1986 Ga0068871_100042062
1987 Ga0068871_100061397
1988 Ga0068871_100093508
1989 Ga0068865_100008523
1990 Ga0068865_100019794
1991 Ga0068865_100023667
1992 Ga0097620_100008729
1993 Ga0097620_100018133
1994 Ga0097620_100032680
1995 Ga0097620_100032778
1996 Ga0097620_100098272
1997 Ga0097620_100285291
1998 Ga0079104_1006336
1999 Ga0099795_10000125
2000 Ga0105251_10000134
2001 Ga0105251_10005177
2002 Ga0105251_10013971
2003 Ga0105251_10022862
2004 Ga0105244_10005315
2005 Ga0105244_10013656
2006 Ga0105244_10038044
2007 Ga0105250_10000008
2008 Ga0105240_10003806
2009 Ga0105240_10005169
2010 Ga0105240_10027418
2011 Ga0105240_10089502
2012 Ga0105240_10094157
2013 Ga0105240_10097409
2014 Ga0105245_10000811
2015 Ga0105245_10028867
2016 Ga0105245_10107064
2017 Ga0105245_10160119
2018 Ga0105245_10163390
2019 Ga0105245_10267668
2020 Ga0105245_10477174
2021 Ga0105243_10004077
2022 Ga0105243_10008031
2023 Ga0105243_10016549
2024 Ga0105243_10141916
2025 Ga0105241_10027698
2026 Ga0105241_10044354
2027 Ga0105241_10084332
2028 Ga0105242_10005513
2029 Ga0105242_10017277
2030 Ga0105242_10066139
2031 Ga0105242_10128169
2032 Ga0105242_10227497
2033 Ga0105248_10001495
2034 Ga0105248_10005155
2035 Ga0105248_10009050
2036 Ga0105248_10015971
2037 Ga0105248_10089029
2038 Ga0105248_10151138
2039 Ga0105237_10000784
2040 Ga0105237_10066264
2041 Ga0105237_10107544
2042 Ga0105238_10005552
2043 Ga0105238_10071538
2044 Ga0105249_10025378
2045 Ga0105249_10045520
2046 Ga0099796_10026691
2047 Ga0105239_10008150
2048 Ga0105239_10021748
2049 Ga0105239_10059776
2050 Ga0105239_10156668
2051 Ga0105239_10201344
2052 Ga0105246_10171772
2053 Ga0157373_10001549
2054 Ga0157373_10015465
2055 Ga0157373_10020555
2056 Ga0157371_10000068
2057 Ga0157371_10015589
2058 Ga0157370_10001130
2059 Ga0157370_10002304
2060 Ga0157370_10002933
2061 Ga0157370_10165182
2062 Ga0157369_10000724
2063 Ga0157369_10001199
2064 Ga0157369_10002274
2065 Ga0157369_10008205
2066 Ga0157369_10201089
2067 Ga0157374_10000044
2068 Ga0157374_10004186
2069 Ga0157374_10303450
2070 Ga0157374_10339350
2071 Ga0157378_10000762
2072 Ga0157378_10002340
2073 Ga0157378_10009123
2074 Ga0157378_10012649
2075 Ga0157378_10129186
2076 Ga0163162_10001049
2077 Ga0163162_10002545
2078 Ga0163162_10003910
2079 Ga0163162_10018428
2080 Ga0163162_10025300
2081 Ga0163162_10030772
2082 Ga0163162_10215707
2083 Ga0163162_10336427
2084 Ga0157372_10000271
2085 Ga0157372_10001941
2086 Ga0157375_10003567
2087 Ga0157375_10003891
2088 Ga0157375_10009927
2089 Ga0157375_10014532
2090 Ga0157375_10086658
2091 Ga0157375_10124474
2092 Ga0157375_10181589
2093 Ga0163163_10002307
2094 Ga0157380_10002831
2095 Ga0182008_10003181
2096 Ga0157379_10000072
2097 Ga0157379_10001980
2098 Ga0157379_10007685
2099 Ga0157379_10092868
2100 Ga0157376_10027762
2101 Ga0157376_10124972
2102 Ga0157376_10134964
2103 Ga0157376_10196684
2104 Ga0157376_10322571
2105 Ga0182006_1000002
2106 Ga0182006_1005807
2107 Ga0182006_1037965
2108 Ga0182007_10000090
2109 Ga0182007_10002950
2110 Ga0182007_10011396
2111 Ga0182007_10020871
2112 Ga0182005_1000070
2113 Ga0182005_1000656
2114 Ga0182005_1031815
2115 Ga0183362_10005
2116 Ga0183361_10013
2117 Ga0163161_10012761
2118 Ga0163161_10024519
2119 Ga0163161_10031877
2120 Ga0163161_10064501
2121 Ga0163161_10172340
2122 Ga0163161_10176084
2123 Ga0206349_1385556
2124 Ga0206351_10134375
2125 Ga0154015_1636926
2126 Ga0213872_10000769
2127 Ga0213872_10001970
2128 Ga0213872_10030368
2129 Ga0213875_10125441
2130 Ga0224712_10000142
2131 Ga0209784_100003
2132 Ga0209784_100039
2133 Ga0209784_100860
2134 Ga0209566_100002
2135 Ga0209566_100023
2136 Ga0209566_100545
2137 Ga0209566_100699
2138 Ga0209566_101882
2139 Ga0209674_100005
2140 Ga0209674_100008
2141 Ga0209674_100040
2142 Ga0209674_100103
2143 Ga0209674_100423
2144 Ga0209672_100001
2145 Ga0209672_100014
2146 Ga0209672_100052
2147 Ga0209672_100085
2148 Ga0209672_101885
2149 Ga0209147_100001
2150 Ga0209147_100002
2151 Ga0209147_100087
2152 Ga0209147_100125
2153 Ga0209563_100004
2154 Ga0209563_100007
2155 Ga0209563_100072
2156 Ga0209563_100892
2157 Ga0207427_100513
2158 Ga0207427_101254
2159 Ga0209437_100097
2160 Ga0209258_100001
2161 Ga0209258_100002
2162 Ga0209258_100040
2163 Ga0209258_100203
2164 Ga0207425_1000284
2165 Ga0209646_1000059
2166 Ga0209646_1000087
2167 Ga0209026_1003130
2168 Ga0209677_100009
2169 Ga0209677_100041
2170 Ga0209677_103052
2171 Ga0209148_1000003
2172 Ga0209148_1000021
2173 Ga0209148_1000035
2174 Ga0209148_1000211
2175 Ga0209148_1000553
2176 Ga0209148_1005780
2177 Ga0209759_1000188
2178 Ga0209759_1000284
2179 Ga0209759_1000519
2180 Ga0209759_1002173
2181 Ga0209759_1002486
2182 Ga0209759_1008232
2183 Ga0209233_1000043
2184 Ga0209233_1000122
2185 Ga0207666_1005297
2186 Ga0209455_1000001
2187 Ga0209455_1000021
2188 Ga0209455_1000026
2189 Ga0209455_1000200
2190 Ga0209673_1000030
2191 Ga0209025_1000178
2192 Ga0209025_1006590
2193 Ga0209564_1000009
2194 Ga0209564_1000045
2195 Ga0209564_1004734
2196 Ga0209564_1013455
2197 Ga0209758_1000489
2198 Ga0207426_1000050
2199 Ga0207426_1002220
2200 Ga0209051_1028714
2201 Ga0207656_10073863
2202 Ga0207656_10112379
2203 Ga0207696_1000106
2204 Ga0207655_1002220
2205 Ga0207655_1021992
2206 Ga0207713_1001542
2207 Ga0207713_1025007
2208 Ga0207682_10005455
2209 Ga0207682_10014750
2210 Ga0207642_10006349
2211 Ga0207642_10071307
2212 Ga0207642_10087743
2213 Ga0207642_10118430
2214 Ga0207680_10002694
2215 Ga0207680_10021359
2216 Ga0207680_10041483
2217 Ga0207647_10000310
2218 Ga0207647_10002433
2219 Ga0207647_10009655
2220 Ga0207645_10006661
2221 Ga0207645_10012955
2222 Ga0207645_10159775
2223 Ga0207645_10171204
2224 Ga0207643_10004408
2225 Ga0207705_10002739
2226 Ga0207705_10004282
2227 Ga0207705_10025889
2228 Ga0207705_10089152
2229 Ga0207705_10174932
2230 Ga0207684_10223120
2231 Ga0207654_10039705
2232 Ga0207707_10002855
2233 Ga0207707_10227942
2234 Ga0207695_10001909
2235 Ga0207695_10005290
2236 Ga0207695_10014738
2237 Ga0207695_10021190
2238 Ga0207695_10086432
2239 Ga0207695_10095513
2240 Ga0207695_10121166
2241 Ga0207695_10286291
2242 Ga0207695_10369677
2243 Ga0207671_10023429
2244 Ga0207671_10032527
2245 Ga0207671_10040198
2246 Ga0207671_10074464
2247 Ga0207663_10044605
2248 Ga0207660_10059452
2249 Ga0207662_10013387
2250 Ga0207657_10000004
2251 Ga0207657_10000974
2252 Ga0207657_10017545
2253 Ga0207657_10103608
2254 Ga0207657_10111711
2255 Ga0207649_10000321
2256 Ga0207649_10006430
2257 Ga0207649_10043427
2258 Ga0207649_10113460
2259 Ga0207649_10161945
2260 Ga0207652_10007499
2261 Ga0207646_10307961
2262 Ga0207681_10069468
2263 Ga0207681_10123940
2264 Ga0207681_10128694
2265 Ga0207694_10005553
2266 Ga0207694_10041086
2267 Ga0207650_10004906
2268 Ga0207650_10010329
2269 Ga0207650_10045979
2270 Ga0207650_10165999
2271 Ga0207659_10000771
2272 Ga0207659_10001624
2273 Ga0207659_10052733
2274 Ga0207687_10002292
2275 Ga0207687_10224731
2276 Ga0207664_10059393
2277 Ga0207664_10181073
2278 Ga0207664_10240736
2279 Ga0207644_10002036
2280 Ga0207644_10003925
2281 Ga0207644_10032467
2282 Ga0207644_10073856
2283 Ga0207690_10000015
2284 Ga0207690_10002377
2285 Ga0207690_10002753
2286 Ga0207706_10015304
2287 Ga0207706_10028137
2288 Ga0207706_10055728
2289 Ga0207706_10165742
2290 Ga0207686_10001170
2291 Ga0207686_10091538
2292 Ga0207686_10129376
2293 Ga0207709_10101869
2294 Ga0207709_10135983
2295 Ga0207670_10009527
2296 Ga0207670_10143651
2297 Ga0207669_10004101
2298 Ga0207669_10004845
2299 Ga0207669_10057512
2300 Ga0207669_10149603
2301 Ga0207704_10002682
2302 Ga0207704_10009290
2303 Ga0207704_10029386
2304 Ga0207704_10159156
2305 Ga0207704_10242480
2306 Ga0207665_10005065
2307 Ga0207691_10002661
2308 Ga0207691_10003475
2309 Ga0207691_10013941
2310 Ga0207691_10014690
2311 Ga0207691_10126716
2312 Ga0207691_10217818
2313 Ga0207711_10014772
2314 Ga0207711_10019262
2315 Ga0207711_10099337
2316 Ga0207711_10121155
2317 Ga0207689_10000262
2318 Ga0207689_10000320
2319 Ga0207689_10034893
2320 Ga0207689_10138736
2321 Ga0207661_10030207
2322 Ga0207679_10000001
2323 Ga0207679_10009872
2324 Ga0207679_10020920
2325 Ga0207667_10000025
2326 Ga0207667_10000067
2327 Ga0207667_10000524
2328 Ga0207667_10004154
2329 Ga0207667_10023097
2330 Ga0207667_10148763
2331 Ga0207667_10258319
2332 Ga0207651_10003548
2333 Ga0207651_10008458
2334 Ga0207651_10115169
2335 Ga0207651_10195788
2336 Ga0207712_10006896
2337 Ga0207712_10026515
2338 Ga0207712_10029591
2339 Ga0207668_10200597
2340 Ga0207640_10000035
2341 Ga0207640_10004211
2342 Ga0207658_10001963
2343 Ga0207658_10022693
2344 Ga0207658_10043501
2345 Ga0207658_10054480
2346 Ga0207677_10001098
2347 Ga0207677_10002070
2348 Ga0207677_10087840
2349 Ga0207677_10175582
2350 Ga0207703_10003733
2351 Ga0207703_10004880
2352 Ga0207639_10053857
2353 Ga0207639_10073257
2354 Ga0207639_10561477
2355 Ga0207678_10000001
2356 Ga0207678_10003809
2357 Ga0207678_10036529
2358 Ga0207678_10144662
2359 Ga0207708_10000360
2360 Ga0207708_10005611
2361 Ga0207708_10053167
2362 Ga0207702_10001757
2363 Ga0207702_10195031
2364 Ga0207641_10004096
2365 Ga0207641_10028228
2366 Ga0207641_10030375
2367 Ga0207641_10030589
2368 Ga0207641_10045055
2369 Ga0207641_10084526
2370 Ga0207648_10000376
2371 Ga0207648_10000853
2372 Ga0207648_10009628
2373 Ga0207648_10051572
2374 Ga0207648_10059286
2375 Ga0207648_10069098
2376 Ga0207648_10142950
2377 Ga0207676_10000951
2378 Ga0207676_10077387
2379 Ga0207676_10095953
2380 Ga0207674_10003354
2381 Ga0207674_10030381
2382 Ga0207674_10172302
2383 Ga0207675_100000300
2384 Ga0207675_100000415
2385 Ga0207675_100008514
2386 Ga0207675_100011304
2387 Ga0207675_100066430
2388 Ga0207675_100102890
2389 Ga0207675_100281068
2390 Ga0207683_10002476
2391 Ga0207683_10003438
2392 Ga0207683_10007432
2393 Ga0207683_10025141
2394 Ga0207683_10040768
2395 Ga0207683_10056418
2396 Ga0207683_10218872
2397 Ga0207683_10231700
2398 Ga0207683_10553540
2399 Ga0207698_10006837
2400 Ga0207698_10073804
2401 Ga0207698_10552491
2402 Ga0209371_1000399
2403 Ga0209179_1000750
2404 Ga0209282_1000019
2405 Ga0265356_1000985
2406 Ga0268266_10094225
2407 Ga0268266_10129822
2408 Ga0268266_10174342
2409 Ga0268265_10030320
2410 Ga0268265_10079835
2411 Ga0268264_10009764
2412 Ga0268264_10501233
2413 Ga0265334_10000010
2414 Ga0265318_10054665
2415 Ga0265336_10000529
2416 Ga0307517_10031334
2417 Ga0307515_10122568
2418 Ga0307515_10184217
2419 Ga0265338_10000022
2420 Ga0265338_10001008
2421 Ga0265338_10028579
2422 Ga0265324_10000034
2423 Ga0265324_10000669
2424 Ga0268256_1000238
2425 Ga0265760_10002495
2426 Ga0265332_10005254
2427 Ga0265320_10023346
2428 Ga0265325_10000663
2429 Ga0265325_10003426
2430 Ga0265331_10003526
2431 Ga0265331_10006877
2432 Ga0265331_10040228
2433 Ga0265327_10000572
2434 Ga0265327_10000638
2435 Ga0265327_10001646
2436 Ga0265327_10002259
2437 Ga0265316_10039434
2438 Ga0265316_10155450
2439 Ga0307513_10088095
2440 Ga0265313_10000068
2441 Ga0265313_10006502
2442 Ga0316575_10000457
2443 Ga0265314_10001850
2444 Ga0265314_10058682
2445 Ga0265314_10074206
2446 Ga0265314_10074775
2447 Ga0265342_10007593
2448 Ga0316576_10017518
2449 Ga0307516_10000012
2450 Ga0307412_10000024
2451 Ga0316583_10000196
2452 Ga0373953_0079184
2453 Ga0373960_0006680
2454 Ga0373943_0223809
2455 Ga0316574_0010832
2456 Ga0373924_0110445
2457 Ga0373927_0000002
2458 Ga0373927_0023190
2459 Ga0373937_0090490
2460 Ga0373937_0349722
2461 Ga0316584_0019586
2462 Ga0316584_0019651
2463 Ga0395899_0000035
2464 Ga0395899_0000344
2465 Ga0395899_0002002
2466 Ga0395899_0002788
2467 Ga0395899_0010729
2468 Ga0395899_0014012
2469 Ga0395899_0040985
2470 Ga0395899_0087664
2471 Ga0395900_0000190
2472 Ga0395900_0000198
2473 Ga0395900_0001100
2474 Ga0395900_0001935
2475 Ga0395900_0007915
2476 Ga0395900_0015064
2477 Ga0395900_0018384
2478 Ga0395900_0026828
2479 Ga0395900_0044784
2480 Ga0395900_0088619
2481 Ga0395900_0118808
2482 Ga0395900_0211239
2483 Ga0395898_0000199
2484 Ga0395898_0000374
2485 Ga0395898_0016768
2486 Ga0395898_0059651
2487 Ga0395898_0115582
2488 Ga0395898_0176886
2489 Ga0395898_0228302
2490 Ga0395905_0000041
2491 Ga0395905_0001591
2492 Ga0395905_0009860
2493 Ga0395905_0016277
2494 Ga0395905_0085997
2495 Ga0395905_0105715
2496 Ga0395905_0139127
2497 Ga0436364_0817049
2498 Ga0395901_0000062
2499 Ga0395901_0000533
2500 Ga0395901_0001105
2501 Ga0395901_0001593
2502 Ga0395901_0002094
2503 Ga0395901_0015314
2504 Ga0395901_0055086
2505 Ga0395901_0187733
2506 Ga0395901_0196405
2507 Ga0436365_1589949
2508 Ga0436361_0598612
2509 Ga0436361_0695623
2510 Ga0436361_0836240
2511 Ga0436361_0900465
2512 Ga0436361_0904231
2513 Ga0436361_1196706
2514 Ga0451843_0123709
2515 Ga0451853_0053840
2516 Ga0439448_0000093
2517 Ga0439448_0033168
2518 Ga0439455_0010495
2519 Ga0439458_0007162
2520 Ga0451577_0000002
2521 Ga0451577_0060007
2522 Ga0451577_0115543
2523 Ga0451577_0125081
2524 Ga0466969_0004435
2525 Ga0466969_0031708
2526 Ga0466969_0084529
2527 Ga0466972_0000070
2528 Ga0466972_0012234
2529 Ga0466972_0017028
2530 Ga0466972_0036629
2531 Ga0453683_0000003
2532 Ga0466965_0000058
2533 Ga0466965_0008647
2534 Ga0466965_0034770
2535 Ga0466966_0001378
2536 Ga0466966_0021502
2537 Ga0466966_0046014
2538 Ga0466966_0149103
2539 Ga0466961_0000830
2540 Ga0466961_0004504
2541 Ga0466961_0014767
2542 Ga0466963_0001295
2543 Ga0466963_0015296
2544 Ga0466963_0020392
2545 Ga0466964_0000748
2546 Ga0453684_0000002
2547 Ga0466971_0001966
2548 Ga0466968_0004778
2549 Ga0466968_0006364
2550 Ga0466968_0047003
2551 Ga0466970_0002802
2552 Ga0466970_0070017
2553 Ga0466957_0000140
2554 Ga0466957_0003144
2555 Ga0466957_0008820
2556 Ga0466957_0038666
2557 Ga0466957_0091231
2558 Ga0466959_0000387
2559 Ga0466959_0014205
2560 Ga0466959_0026242
2561 Ga0466959_0026333
2562 Ga0466959_0047272
2563 Ga0466959_0063245
2564 Ga0451576_0001215
2565 Ga0466958_0001550
2566 Ga0466958_0005578
2567 Ga0466958_0027829
2568 Ga0466967_0093791
2569 Ga0466967_0148667
2570 Ga0495617_000029
2571 Ga0495617_000049
2572 Ga0495617_002469
2573 Ga0495617_003907
2574 Ga0495627_000243
2575 Ga0495627_014622
2576 Ga0495627_044236
2577 Ga0495592_0001143
2578 Ga0495592_0021865
2579 Ga0495603_0007272
2580 Ga0495603_0030796
2581 Ga0495603_0032291
2582 Ga0495590_0000003
2583 Ga0495590_0000071
2584 Ga0495590_0000520
2585 Ga0495590_0002164
2586 Ga0495590_0016567
2587 Ga0495590_0020173
2588 Ga0495591_000302
2589 Ga0495591_010370
2590 Ga0495629_0001179
2591 Ga0495629_0002054
2592 Ga0495629_0016485
2593 Ga0495629_0021355
2594 Ga0495629_0038980
2595 Ga0495638_0000091
2596 Ga0495638_0003603
2597 Ga0495638_0022951
2598 Ga0495638_0044764
2599 Ga0495638_0066869
2600 Ga0495651_0004530
2601 Ga0495651_0033766
2602 Ga0495651_0061436
2603 Ga0495653_0000013
2604 Ga0495653_0011174
2605 Ga0495653_0014977
2606 Ga0495653_0026309
2607 Ga0495653_0032069
2608 Ga0495653_0039805
2609 Ga0495653_0050022
2610 Ga0495650_0000011
2611 Ga0495650_0000051
2612 Ga0495650_0000097
2613 Ga0495650_0000314
2614 Ga0495650_0000343
2615 Ga0495650_0000928
2616 Ga0495650_0002256
2617 Ga0495650_0003703
2618 Ga0495650_0007227
2619 Ga0495650_0008161
2620 Ga0495650_0012542
2621 Ga0495650_0014413
2622 Ga0495650_0022575
2623 Ga0495580_0001176
2624 Ga0495580_0018947
2625 Ga0495580_0021175
2626 Ga0495580_0030459
2627 Ga0495580_0089451
2628 Ga0495580_0095561
2629 Ga0495580_0104952
2630 Ga0495582_0004931
2631 Ga0495582_0011386
2632 Ga0495582_0045514
2633 Ga0495605_0000234
2634 Ga0495605_0000251
2635 Ga0495605_0005192
2636 Ga0495605_0005507
2637 Ga0495605_0006769
2638 Ga0495605_0007871
2639 Ga0495605_0008862
2640 Ga0495605_0018518
2641 Ga0495605_0037474
2642 Ga0495605_0041092
2643 Ga0495605_0042368
2644 Ga0495639_0039762
2645 Ga0495639_0074782
2646 Ga0495664_0015882
2647 Ga0495664_0085430
2648 Ga0495584_0000008
2649 Ga0495584_0000155
2650 Ga0495584_0002111
2651 Ga0495584_0002139
2652 Ga0495584_0003852
2653 Ga0495584_0007277
2654 Ga0495584_0021584
2655 Ga0495584_0035140
2656 Ga0495584_0046173
2657 Ga0495585_0000139
2658 Ga0495585_0000285
2659 Ga0495585_0001306
2660 Ga0495585_0001720
2661 Ga0495585_0005485
2662 Ga0495585_0008284
2663 Ga0495585_0013629
2664 Ga0495585_0022115
2665 Ga0495585_0045464
2666 Ga0495585_0045747
2667 Ga0495585_0057009
2668 Ga0495585_0072560
2669 Ga0495594_0003334
2670 Ga0495594_0059105
2671 Ga0495594_0180999
2672 Ga0495596_0000533
2673 Ga0495596_0000734
2674 Ga0495596_0002070
2675 Ga0495596_0004202
2676 Ga0495596_0006292
2677 Ga0495596_0007656
2678 Ga0495596_0008125
2679 Ga0495596_0013632
2680 Ga0495596_0015649
2681 Ga0495596_0026109
2682 Ga0495607_0005443
2683 Ga0495607_0008143
2684 Ga0495607_0009072
2685 Ga0495607_0011726
2686 Ga0495607_0015950
2687 Ga0495607_0018697
2688 Ga0495607_0033307
2689 Ga0495607_0035729
2690 Ga0495607_0052196
2691 Ga0495607_0133794
2692 Ga0495607_0138793
2693 Ga0495583_0000068
2694 Ga0495583_0000197
2695 Ga0495583_0000232
2696 Ga0495583_0000280
2697 Ga0495583_0000568
2698 Ga0495583_0023503
2699 Ga0495606_0000141
2700 Ga0495606_0000266
2701 Ga0495606_0000935
2702 Ga0495606_0006074
2703 Ga0495606_0007191
2704 Ga0495606_0008896
2705 Ga0495606_0011924
2706 Ga0495606_0011964
2707 Ga0495606_0013174
2708 Ga0495606_0013999
2709 Ga0495606_0022484
2710 Ga0495606_0023201
2711 Ga0495606_0026282
2712 Ga0495606_0028934
2713 Ga0495606_0050067
2714 Ga0495606_0062689
2715 Ga0495606_0065767
2716 Ga0495606_0073876
2717 Ga0495608_0000766
2718 Ga0495608_0005430
2719 Ga0495608_0021182
2720 Ga0495608_0046988
2721 Ga0495610_0000003
2722 Ga0495610_0000715
2723 Ga0495610_0002557
2724 Ga0495610_0009229
2725 Ga0495610_0010336
2726 Ga0495610_0011374
2727 Ga0495610_0015506
2728 Ga0495610_0023467
2729 Ga0495610_0034995
2730 Ga0495616_0000173
2731 Ga0495616_0001567
2732 Ga0495616_0001770
2733 Ga0495616_0003040
2734 Ga0495616_0016379
2735 Ga0495616_0016824
2736 Ga0495616_0038980
2737 Ga0495616_0040056
2738 Ga0495616_0046662
2739 Ga0495616_0094047
2740 Ga0495618_0004670
2741 Ga0495618_0018606
2742 Ga0495620_0003682
2743 Ga0495620_0021159
2744 Ga0495628_0006004
2745 Ga0495628_0015479
2746 Ga0495628_0044665
2747 Ga0495628_0054760
2748 Ga0495628_0097516
2749 Ga0495630_0001572
2750 Ga0495630_0005461
2751 Ga0495630_0345795
2752 Ga0495631_0000103
2753 Ga0495631_0002483
2754 Ga0495631_0014124
2755 Ga0495631_0018497
2756 Ga0495631_0035003
2757 Ga0495631_0058114
2758 Ga0495632_0000063
2759 Ga0495632_0000461
2760 Ga0495632_0001335
2761 Ga0495632_0001954
2762 Ga0495632_0006624
2763 Ga0495632_0010421
2764 Ga0495632_0012834
2765 Ga0495632_0045115
2766 Ga0495637_0000004
2767 Ga0495637_0000087
2768 Ga0495637_0000443
2769 Ga0495637_0000715
2770 Ga0495637_0020601
2771 Ga0495637_0035761
2772 Ga0495643_0000179
2773 Ga0495643_0000194
2774 Ga0495643_0001483
2775 Ga0495643_0003103
2776 Ga0495643_0007505
2777 Ga0495643_0011094
2778 Ga0495643_0016657
2779 Ga0495643_0018118
2780 Ga0495643_0036164
2781 Ga0495643_0047896
2782 Ga0495644_0005431
2783 Ga0495644_0019647
2784 Ga0495644_0020261
2785 Ga0495648_0000030
2786 Ga0495648_0000058
2787 Ga0495648_0000288
2788 Ga0495648_0006444
2789 Ga0495648_0020957
2790 Ga0495648_0022571
2791 Ga0495648_0022599
2792 Ga0495648_0026542
2793 Ga0495648_0033671
2794 Ga0495648_0040603
2795 Ga0495648_0041119
2796 Ga0495648_0051313
2797 Ga0495648_0087272
2798 Ga0495663_0016751
2799 Ga0495663_0046117
2800 Ga0495666_0001341
2801 Ga0495666_0001622
2802 Ga0495666_0006371
2803 Ga0495666_0007801
2804 Ga0495666_0065341
2805 Ga0495642_0000038
2806 Ga0495642_0001686
2807 Ga0495642_0001822
2808 Ga0495642_0007379
2809 Ga0495642_0022419
2810 Ga0495642_0028452
2811 Ga0495642_0035911
2812 Ga0495642_0037192
2813 Ga0495642_0090471
2814 Ga0495642_0104510
2815 Ga0495652_0003591
2816 Ga0495652_0034086
2817 Ga0495652_0050830
2818 Ga0495652_0083324
2819 Ga0495652_0118635
2820 Ga0495652_0152421
2821 Ga0495654_0000002
2822 Ga0495654_0000074
2823 Ga0495654_0001298
2824 Ga0495654_0009807
2825 Ga0495654_0012668
2826 Ga0495654_0048366
2827 Ga0495654_0050608
2828 Ga0495665_0002821
2829 Ga0495665_0004778
2830 Ga0495665_0015085
2831 Ga0495665_0022696
2832 Ga0495640_0000384
2833 Ga0495586_0000938
2834 Ga0495586_0002348
2835 Ga0495586_0004178
2836 Ga0495586_0037866
2837 Ga0495586_0038223
2838 Ga0495587_0013822
2839 Ga0495598_0048790
2840 Ga0495609_0000021
2841 Ga0495609_0003555
2842 Ga0495609_0003830
2843 Ga0495609_0009073
2844 Ga0495609_0009412
2845 Ga0495609_0022200
2846 Ga0495609_0025432
2847 Ga0495609_0039336
2848 Ga0495597_0001756
2849 Ga0495597_0002353
2850 Ga0495597_0002945
2851 Ga0495597_0003156
2852 Ga0495597_0004756
2853 Ga0495597_0005049
2854 Ga0495597_0007908
2855 Ga0495597_0009349
2856 Ga0495597_0013813
2857 Ga0495597_0014016
2858 Ga0495597_0024876
2859 Ga0495645_0006284
2860 Ga0495645_0025686
2861 Ga0495645_0036985
2862 Ga0495645_0078869
2863 Ga0495645_0120509
2864 Ga0495645_0143827
2865 Ga0495622_0000054
2866 Ga0495622_0001760
2867 Ga0495622_0001770
2868 Ga0495633_0000119
2869 Ga0495633_0000249
2870 Ga0495633_0003574
2871 Ga0495633_0004345
2872 Ga0495633_0005254
2873 Ga0495633_0006155
2874 Ga0495633_0007353
2875 Ga0495633_0008446
2876 Ga0495633_0013888
2877 Ga0495633_0023469
2878 Ga0495633_0040011
2879 Ga0495667_0003921
2880 Ga0495656_0009208
2881 Ga0495656_0059394
2882 Ga0495668_0000383
2883 Ga0495668_0000466
2884 Ga0495668_0000935
2885 Ga0495668_0000980
2886 Ga0495668_0005855
2887 Ga0495668_0006288
2888 Ga0495668_0007471
2889 Ga0495668_0031332
2890 Ga0495634_0008233
2891 Ga0495634_0038246
2892 Ga0495634_0048583
2893 Ga0495634_0106643
2894 Ga0495611_0000517
2895 Ga0495611_0001481
2896 Ga0495611_0002945
2897 Ga0495611_0018088
2898 Ga0495611_0030436
2899 Ga0495611_0035916
2900 Ga0495611_0120214
2901 Ga0495625_0000132
2902 Ga0495625_0000139
2903 Ga0495625_0005799
2904 Ga0495625_0006766
2905 Ga0495625_0038343
2906 Ga0495625_0039103
2907 Ga0495625_0068948
2908 Ga0495625_0120043
2909 Ga0495625_0203433
2910 Ga0495635_0021073
2911 Ga0495635_0091593
2912 Ga0495659_0053244
2913 Ga0495661_0000052
2914 Ga0495661_0009467
2915 Ga0495661_0010711
2916 Ga0495661_0012664
2917 Ga0495661_0014126
2918 Ga0495661_0014206
2919 Ga0495661_0018018
2920 Ga0495661_0026257
2921 Ga0495661_0037177
2922 Ga0495661_0040145
2923 Ga0495661_0043388
2924 Ga0495661_0051066
2925 Ga0495661_0064886
2926 Ga0495588_0000083
2927 Ga0495588_0047810
2928 Ga0495588_0083697
2929 Ga0495588_0089115
2930 Ga0495599_0001313
2931 Ga0495599_0003110
2932 Ga0495599_0018809
2933 Ga0495623_0012947
2934 Ga0495623_0123122
2935 Ga0495646_0002069
2936 Ga0495646_0008027
2937 Ga0495658_0048770
2938 Ga0495658_0165545
2939 Ga0495669_0000086
2940 Ga0495669_0000734
2941 Ga0495669_0018994
2942 Ga0495669_0019307
2943 Ga0495669_0037863
2944 Ga0495669_0103976
2945 Ga0495613_0005741
2946 Ga0495613_0018060
2947 Ga0495613_0032254
2948 Ga0495613_0040133
2949 Ga0495624_0002244
2950 Ga0495624_0021769
2951 Ga0495624_0034973
2952 Ga0495624_0047581
2953 Ga0495624_0076277
2954 Ga0495624_0095406
2955 Ga0495624_0105223
2956 Ga0495670_0003781
2957 Ga0495670_0004207
2958 Ga0495670_0013889
2959 Ga0495670_0041825
2960 Ga0495670_0042883
2961 Ga0495670_0064429
2962 Ga0495671_0000001
2963 Ga0495671_0001547
2964 Ga0495671_0012227
2965 Ga0495671_0012468
2966 Ga0495671_0012531
2967 Ga0495671_0022645
2968 Ga0495649_0000138
2969 Ga0495649_0001419
2970 Ga0495649_0009719
2971 Ga0495649_0012333
2972 Ga0495649_0168631
2973 Ga0495589_0000012
2974 Ga0495589_0001013
2975 Ga0495589_0002523
2976 Ga0495589_0004690
2977 Ga0495589_0005172
2978 Ga0495589_0005498
2979 Ga0495589_0013534
2980 Ga0495589_0023143
2981 Ga0495600_0004658
2982 Ga0495600_0100279
2983 Ga0495600_0198059
2984 Ga0495660_0000921
2985 Ga0495660_0008376
2986 Ga0495660_0010852
2987 Ga0495660_0017627
2988 Ga0495660_0027386
2989 Ga0495660_0032340
2990 Ga0495660_0103721
2991 Ga0495581_0000409
2992 Ga0495581_0005132
2993 Ga0495581_0024397
2994 Ga0495581_0035969
2995 Ga0495581_0173898
2996 Ga0495604_0008259
2997 Ga0495604_0026650
2998 Ga0495604_0046170
2999 Ga0495604_0080173
3000 Ga0495604_0170575
3001 Ga0495636_0002974
3002 Ga0495636_0004077
3003 Ga0495636_0033472
3004 Ga0495674_0041330
3005 Ga0495674_0053500
3006 Ga0495674_0056273
3007 Ga0495674_0315882
3008 Ga0495674_0388287
3009 Ga0495672_0000170
3010 Ga0495672_0000240
3011 Ga0495672_0000801
3012 Ga0495672_0000896
3013 Ga0495672_0003434
3014 Ga0495672_0005376
3015 Ga0495672_0009345
3016 Ga0495672_0073444
3017 Ga0495676_0000670
3018 Ga0495676_0027149
3019 Ga0495676_0089324
3020 Ga0495676_0150268
3021 Ga0495676_0239672
3022 Ga0495676_0283294
3023 Ga0495680_0001210
3024 Ga0495680_0001589
3025 Ga0495680_0016580
3026 Ga0495680_0026694
3027 Ga0495680_0045299
3028 Ga0495683_0000035
3029 Ga0495683_0000325
3030 Ga0495683_0003363
3031 Ga0495683_0006003
3032 Ga0495683_0010146
3033 Ga0495683_0012685
3034 Ga0495683_0014466
3035 Ga0495683_0015131
3036 Ga0495683_0038381
3037 Ga0495683_0049087
3038 Ga0495683_0067234
3039 Ga0495683_0075353
3040 Ga0495687_000022
3041 Ga0495687_000149
3042 Ga0495687_000326
3043 Ga0495687_000373
3044 Ga0495687_001062
3045 Ga0495687_004721
3046 Ga0495687_012071
3047 Ga0495687_016191
3048 Ga0495675_0006167
3049 Ga0495675_0007198
3050 Ga0495675_0027890
3051 Ga0495675_0058691
3052 Ga0495677_0002988
3053 Ga0495677_0009710
3054 Ga0495677_0012815
3055 Ga0495677_0019151
3056 Ga0495679_000865
3057 Ga0495679_000936
3058 Ga0495679_002559
3059 Ga0495679_015200
3060 Ga0495685_012411
3061 Ga0495685_028287
3062 Ga0495673_0000006
3063 Ga0495673_0000015
3064 Ga0495673_0000024
3065 Ga0495673_0000049
3066 Ga0495673_0011801
3067 Ga0495673_0022484
3068 Ga0495681_0006364
3069 Ga0495681_0009450
3070 Ga0495681_0020969
3071 Ga0495681_0056941
3072 Ga0495681_0061554
3073 Ga0495686_0000002
3074 Ga0495686_0000312
3075 Ga0495686_0000744
3076 Ga0495686_0002260
3077 Ga0495686_0003592
3078 Ga0495686_0015177
3079 Ga0495593_0002055
3080 Ga0495593_0022835
3081 Ga0495593_0024770
3082 Ga0495593_0107344
3083 Ga0495602_0004187
3084 Ga0495602_0007746
3085 Ga0495602_0070288
3086 Ga0495602_0175482
3087 Ga0495602_0190064
3088 Ga0495614_0004682
3089 Ga0495614_0022369
3090 Ga0495615_0045588
3091 Ga0495626_0000082
3092 Ga0495626_0000564
3093 Ga0495626_0000805
3094 Ga0495626_0007028
3095 Ga0495626_0007562
3096 Ga0495626_0013551
3097 Ga0495626_0014017
3098 Ga0495626_0019263
3099 Ga0495626_0020399
3100 Ga0495626_0027194
3101 Ga0495626_0034592
3102 Ga0496100_0002007
3103 Ga0496100_0021276
3104 Ga0496100_0034399
3105 Ga0496100_0122698
3106 Ga0496100_0245657
3107 Ga0496101_0003262
3108 Ga0496101_0004357
3109 Ga0496101_0005768
3110 Ga0496101_0015923
3111 Ga0496101_0030404
3112 Ga0496101_0066919
3113 Ga0496102_0000231
3114 Ga0496102_0000410
3115 Ga0496102_0001160
3116 Ga0496102_0001615
3117 Ga0496102_0006411
3118 Ga0496102_0007060
3119 Ga0496102_0045378
3120 Ga0496102_0197890
3121 Ga0496102_0272930
3122 Ga0496103_0000526
3123 Ga0496103_0000758
3124 Ga0496103_0003846
3125 Ga0496103_0013506
3126 Ga0496103_0014487
3127 Ga0496103_0031196
3128 Ga0496104_0002107
3129 Ga0496104_0057947
3130 Ga0496104_0159239
3131 Ga0496104_0303976
3132 Ga0496105_0004353
3133 Ga0496105_0054030
3134 Ga0496105_0143419
3135 Ga0496105_0144583
3136 Ga0496106_0000029
3137 Ga0496106_0075066
3138 Ga0496107_0031872
3139 Ga0496107_0069094
3140 Ga0496107_0113508
3141 Ga0496107_0137781
3142 Ga0496107_0176739
3143 Ga0496108_0007605
3144 Ga0496108_0028121
3145 Ga0496108_0168445
3146 Ga0496108_0277540
3147 Ga0496109_0028543
3148 Ga0496110_0000779
3149 Ga0496110_0001082
3150 Ga0496110_0004874
3151 Ga0496110_0011024
3152 Ga0496110_0193456
3153 Ga0496110_0230038
3154 Ga0496111_0088110
3155 Ga0496112_0000694
3156 Ga0496112_0022903
3157 Ga0496112_0079568
3158 Ga0496113_0023520
3159 Ga0496113_0098129
3160 Ga0496114_0016577
3161 Ga0496114_0054376
3162 Ga0496114_0148098
3163 Ga0496115_0023344
3164 Ga0496115_0056602
3165 Ga0496115_0089511
3166 Ga0496115_0214007
3167 Ga0496116_0004796
3168 Ga0496116_0005572
3169 Ga0496116_0014372
3170 Ga0496116_0016701
3171 Ga0496116_0033865
3172 Ga0496117_0000001
3173 Ga0496117_0000755
3174 Ga0496117_0002426
3175 Ga0496117_0004332
3176 Ga0496117_0015767
3177 Ga0496117_0092636
3178 Ga0496118_0000078
3179 Ga0496118_0004181
3180 Ga0496118_0011820
3181 Ga0496118_0012940
3182 Ga0496118_0016090
3183 Ga0496118_0059827
3184 Ga0496118_0061387
3185 Ga0496119_0071699
3186 Ga0496121_0004482
3187 Ga0496121_0007119
3188 Ga0496121_0012818
3189 Ga0496121_0016195
3190 Ga0496121_0016657
3191 Ga0496121_0024151
3192 Ga0496121_0033907
3193 Ga0496121_0044023
3194 Ga0496121_0101645
3195 Ga0496121_0110043
3196 Ga0496122_0001026
3197 Ga0496122_0005297
3198 Ga0496122_0005801
3199 Ga0496122_0015357
3200 Ga0496122_0040382
3201 Ga0496122_0058838
3202 Ga0496122_0124279
3203 Ga0496122_0153753
3204 Ga0496123_0002474
3205 Ga0496123_0004250
3206 Ga0496123_0010211
3207 Ga0496123_0014295
3208 Ga0496123_0021284
3209 Ga0496123_0032993
3210 Ga0496123_0033673
3211 Ga0496124_0002429
3212 Ga0496124_0053740
3213 Ga0496124_0103400
3214 Ga0496124_0120953
3215 Ga0496124_0127282
3216 Ga0496125_0003324
3217 Ga0496125_0004189
3218 Ga0496125_0147310
3219 Ga0496126_0000192
3220 Ga0496126_0000604
3221 Ga0496126_0018997
3222 Ga0496126_0023849
3223 Ga0496126_0030750
3224 Ga0496126_0150321
3225 Ga0496126_0191503
3226 Ga0501308_000648
3227 Ga0501304_001077
3228 Ga0495678_000185
3229 Ga0495678_000240
3230 Ga0495678_000374
3231 Ga0495678_000679
3232 Ga0495678_001937
3233 Ga0495678_003621
3234 Ga0495678_004540
3235 Ga0495678_015969
3236 Ga0495678_021387
3237 Ga0495682_0003433
3238 Ga0495682_0006008
3239 Ga0495682_0013866
3240 Ga0495682_0019113
3241 Ga0495682_0050595
3242 Ga0501032_0008558
3243 Ga0501033_0000693
3244 Ga0501034_0000628
3245 Ga0501034_0113456
3246 Ga0501036_0005253
3247 Ga0501037_0042698
3248 Ga0501038_0003200
3249 Ga0501039_0000950
3250 Ga0501040_0002182
3251 Ga0501041_0010690
3252 Ga0501042_0001629
3253 Ga0501043_0005031
3254 Ga0501046_0001055
3255 Ga0501048_0001193
3256 Ga0501068_0076038
3257 Ga0501070_0173369
3258 Ga0501071_0017226
3259 Ga0501072_0004690
3260 Ga0501074_0005903
3261 Ga0501075_0002813
3262 Ga0501076_0008797
3263 Ga0501077_0003308
3264 Ga0501079_0003996
3265 Ga0501080_0006070
3266 Ga0501080_0227072
3267 Ga0501081_0000437
3268 Ga0501035_0000793
3269 Ga0501035_0025915
3270 Ga0501044_0163539
3271 Ga0501045_0000054
3272 nmdc:mga07m45_28124_c1
3273 nmdc:mga08x19_47843_c1
3274 Ga0495601_0013846
3275 Ga0495601_0140368
3276 Ga0495595_0066767
3277 Ga0500618_000104
3278 Ga0500618_001996
3279 Ga0500618_003269
3280 Ga0500586_001331
3281 Ga0500590_021784
3282 Ga0500619_004943
3283 Ga0501084_0012495
3284 Ga0587077_002155
3285 Ga0587082_005003
3286 Ga0587083_0009799
3287 Ga0587091_016590
3288 Ga0587068_001216
3289 Ga0587079_014993
3290 Ga0501082_0003677
3291 Ga0466962_0000565
3292 Ga0466962_0003588
3293 Ga0530510_0000330
3294 Ga0530510_0069753
3295 2501073627
3296 2501082232
3297 2501410977
3298 2509128673
3299 2510250883
3300 2511086422
3301 2511096567
3302 2511102796
3303 2511251224
3304 2511384463
3305 2512346222
3306 2513552102
3307 2513560888
3308 2513957889
3309 2513960931
3310 2514041827
3311 2514048122
3312 2515679674
3313 2515692509
3314 2516020337
3315 2519458910
3316 2527075168
3317 2547375434
3318 2550694348
3319 2563063000
3320 2585291588
3321 2597028599
3322 2599445285
3323 2599736508
3324 2599744569
3325 2600206070
3326 2600809747
3327 2601667262
3328 2643798555
3329 2644475561
3330 2676742695
3331 2713477200
3332 2719640019
3333 2723877401
3334 2738820760
3335 2738829668
3336 2738833240
3337 2738874768
3338 2739153464
3339 2739186397
3340 2739195384
3341 2739221366
3342 2739321860
3343 2739339584
3344 2746089635
3345 2746099476
3346 2753570355
3347 2765569168
3348 2792836445
3349 2808969911
3350 2809004444
3351 2809011617
3352 2809145000
3353 2817261178
3354 2817278890
3355 2817457116
3356 2819541180
3357 2819592464
3358 2819620201
3359 2819630992
3360 2821131170
3361 2839095943
3362 2842328137
3363 2842352454
3364 2842459490
3365 2842713667
3366 2842714521
3367 2843695080
3368 2846037442
3369 2846042060
3370 2856293662
3371 2857362420
3372 2857552547
3373 2857560201
3374 2857561628
3375 2857565182
3376 2857568910
3377 2863424906
3378 2870071190
3379 2883088887
3380 2884811992
3381 2884840055
3382 2884857177
3383 2885085161
3384 2885267059
3385 2885278742
3386 2896157764
3387 2900580219
3388 2900635056
3389 2902689678
3390 2904438615
3391 2904484916
3392 2904568931
3393 2904576313
3394 2904617105
3395 2919530639
3396 2928062615
3397 2928110240
3398 2928131226
3399 2928138626
3400 2928160202
3401 2928168694
3402 2928171894
3403 2928505288
3404 2928540108
3405 2932414858
3406 2932419544
3407 2939634950
3408 2945936955
3409 2981994647
3410 2990706317
3411 642423140
3412 642419517
3413 642592701
3414 642621363
3415 644751481
3416 8003955456
3417 8018851533
3418 8020810720
3419 8020942034
3420 8020946114
3421 8020956770
3422 8021122368
3423 8039102385
3424 8040172849
3425 8040174876
3426 8047675574
3427 8055268284
3428 8055302398

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

7

170

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mm0-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) 0.7638 1 237
6iwr-assembly1.cif.gz_B crystal structure of galnac-t7 with udp, galnac and mn2+ 0.7519 3 124
6iwr-assembly2.cif.gz_D crystal structure of galnac-t7 with udp, galnac and mn2+ 0.7519 2 124
5ekp-assembly1.cif.gz_A structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (wt) 0.7494 1 294
5eke-assembly1.cif.gz_A structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (f215a mutant) 0.746 1 294
ID Description Score Start End Superfamily
af_P77757_4_230_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9264 1 225 3.90.550.10
af_P77757_4_230_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9146 1 225 3.90.550.10
af_Q2G2T7_1_208_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8995 6 206 3.90.550.10
af_P9WMX5_1_216_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8964 6 219 3.90.550.10
af_P77293_1_188_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8804 6 190 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A3D2J9K3-F1-model_v4 Glycosyltransferase 0.9751 2 106 GO:0005886
GO:0016757
AF-A0A2N2SBJ6-F1-model_v4 Glycosyltransferase 0.9506 10 186 GO:0005886
GO:0016757
AF-A0A6D2G6W1-F1-model_v4 Lipopolysaccharide modification protein (EC 2.7.8.30) 0.9437 6 132 GO:0005886
GO:0099621
AF-A0A3M0WV41-F1-model_v4 Glycosyltransferase 0.9366 3 174 GO:0005886
GO:0016757
AF-A0A2N2SBJ6-F1-model_v4 Glycosyltransferase 0.9302 10 186 GO:0005886
GO:0016757

Map