F495444
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1714 | 607 | 3428 | 332 |
Family's Representative Sequence
| Representative Sequence | 3300026067|Ga0207678_10214638|Ga0207678_102146382 |
| Length | 375 |
| Sequence | MTAPILSVIIPVYNEEQTLPLLFGRLYPALDSLNVNYEVLFVSDGSRDRSPAVLREQFQRRPDVTRVILFSANFGQHMAIMAGFEYCRGARVVTLDADLQNPPEEIGNLLVAMDAGHDYVGTIRRNRQDTVFRRCASQAMNWLRERITKIRMTDQGCMLRAYDRQIVDAIKVSCEVNTFIPALAYTYASSPIEIEVAHEERAAGESKYSIYSLLRLNFDLVTGFSIVPLQVFSLLGMFVALVSAVVYIGIIIQRWIAADTMREGVLALWDRDVLQFFLTGLVLFGLGLLGEYVGRMYQQVRSRPRYVVQAVLESDVDSFAARDLSSGRPAHDAARLSRTAPRDIAGPRITRLPGASCTTSSSAMVSTMPSEAASR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 8 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 9 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 10 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 11 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 12 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 13 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 14 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 15 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 16 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 17 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 18 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 19 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 30 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 31 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 32 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 35 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 42 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 46 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 59 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 71 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 75 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 76 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 84 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 86 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 87 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 88 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 90 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 91 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 92 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 93 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 94 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 95 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 96 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 97 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 98 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 99 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 100 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 101 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 102 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 103 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 104 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 106 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 107 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 108 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 110 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 111 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 124 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 138 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 141 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 142 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 143 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 144 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 145 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 148 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 149 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 150 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 151 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 152 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 163 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 164 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 167 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 171 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 173 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 240 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 241 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 245 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 246 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 247 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 248 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 249 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 250 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 251 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 252 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 253 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 254 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 255 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 256 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 257 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 258 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 259 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 260 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 261 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 262 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 263 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 264 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 265 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 266 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 267 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 268 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 269 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 270 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 271 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 272 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 273 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 274 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 275 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 276 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 277 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 278 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 279 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 280 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 281 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 282 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 283 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 284 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 285 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 286 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 287 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 288 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 289 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 290 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 291 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 292 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 293 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 294 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 295 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 296 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 297 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 298 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 299 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 300 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 301 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 302 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 303 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 304 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 305 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 306 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 307 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 403 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 404 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 405 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 406 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 407 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 408 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 409 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 410 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 411 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 412 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 413 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 414 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 415 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 416 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 417 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 418 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 419 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 420 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 421 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 422 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 423 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 424 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 425 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 426 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 427 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 428 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 429 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 430 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 436 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 437 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 438 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 439 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 444 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 445 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 447 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 448 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 449 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 450 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 451 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 452 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 453 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 456 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 458 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 459 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 460 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 461 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 464 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 465 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 466 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 467 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 468 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 469 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 470 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 471 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 472 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 473 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 474 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 475 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 476 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 477 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 478 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 479 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 480 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 481 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 482 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 483 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 484 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 485 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 486 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 487 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 488 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 489 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 490 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 491 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 492 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 493 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 494 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 495 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 496 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 497 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 498 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 499 | 2547132103 | Chromobacterium sp. C-61 | Isolate | Rhizosphere |
| 500 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 501 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 502 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 503 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 504 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 505 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 506 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 507 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 508 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 509 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 510 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 511 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 512 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 513 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 514 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 515 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 516 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 517 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 518 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 519 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 520 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 521 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 522 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 523 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 524 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 525 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 526 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 527 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 528 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 529 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 530 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 531 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 532 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 533 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 534 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 535 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 536 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 537 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 538 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 539 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 540 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 541 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 542 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 543 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 544 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 545 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 546 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 547 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 548 | 2843690924 | Chromobacterium rhizoryzae JP2-74 | Isolate | Rhizosphere |
| 549 | 2846033681 | Chromobacterium sinusclupearum MWU13-2610 | Isolate | Rhizosphere |
| 550 | 2846037992 | Chromobacterium alticapitis MWU14-2602 | Isolate | Rhizosphere |
| 551 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 552 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 553 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 554 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 555 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 556 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 557 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 558 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 559 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 560 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 561 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 562 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 563 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 564 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 565 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 566 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 567 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 568 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 569 | 2904434214 | Robbsia andropogonis 1567 | Isolate | Rhizosphere |
| 570 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 571 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 572 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 573 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 574 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 575 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 576 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 577 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 578 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 579 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 580 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 581 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 582 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 583 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 584 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 585 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 586 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 587 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 588 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 589 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 590 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 591 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 592 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 593 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 594 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 595 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 596 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 597 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 598 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 599 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 600 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 601 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 602 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 603 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 604 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 605 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
| 606 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 607 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.42 |
| Metatranscriptomes | 0.76 |
| Isolates | 7.82 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.42 |
| Nodule | 1.63 |
| Rhizoplane | 4.2 |
| Rhizosphere | 78.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207678_10214638 | 3300026067 | Bacteria | 1646 |
| 2 | JGI24741J21665_1000126 | 3300001915 | Bacteria | 20797 |
| 3 | JGI24740J21852_10002156 | 3300001979 | Bacteria | 8994 |
| 4 | JGI24740J21852_10002843 | 3300001979 | Bacteria | 7737 |
| 5 | JGI24740J21852_10036406 | 3300001979 | Bacteria | 1529 |
| 6 | JGI24739J22299_10003819 | 3300001989 | Bacteria | 5751 |
| 7 | JGI24739J22299_10021874 | 3300001989 | Bacteria | 2272 |
| 8 | JGI24735J21928_10000091 | 3300002067 | Bacteria | 34002 |
| 9 | JGI24735J21928_10006360 | 3300002067 | Bacteria | 3897 |
| 10 | JGI24735J21928_10007474 | 3300002067 | Bacteria | 3563 |
| 11 | JGI24738J21930_10010650 | 3300002075 | Bacteria | 2041 |
| 12 | JGI25155J39150_1000304 | 3300002704 | Bacteria | 16690 |
| 13 | JGI25155J39150_1000311 | 3300002704 | Bacteria | 16587 |
| 14 | JGI25156J39149_1000736 | 3300002705 | Bacteria | 17339 |
| 15 | JGI25156J39149_1001156 | 3300002705 | Bacteria | 11814 |
| 16 | JGI25156J39149_1001924 | 3300002705 | Bacteria | 8059 |
| 17 | JGI25156J39149_1003390 | 3300002705 | Bacteria | 5242 |
| 18 | JGI25156J39149_1011453 | 3300002705 | Bacteria | 2005 |
| 19 | JGI25162J39368_1000142 | 3300002737 | Bacteria | 77413 |
| 20 | JGI25154J39366_1000220 | 3300002738 | Bacteria | 39001 |
| 21 | JGI25154J39366_1000628 | 3300002738 | Bacteria | 16690 |
| 22 | JGI25154J39366_1000634 | 3300002738 | Bacteria | 16587 |
| 23 | JGI25154J39366_1000718 | 3300002738 | Bacteria | 15018 |
| 24 | JGI25157J39369_1000265 | 3300002741 | Bacteria | 38301 |
| 25 | JGI25163J39215_1002551 | 3300002771 | Bacteria | 1815 |
| 26 | JGI25164J39214_1004295 | 3300002772 | Bacteria | 1660 |
| 27 | JGI25150J39212_1002698 | 3300002774 | Bacteria | 4324 |
| 28 | JGI25151J46595_10019719 | 3300003187 | Bacteria | 2857 |
| 29 | JGI25165J46597_1000064 | 3300003214 | Bacteria | 199878 |
| 30 | JGI25165J46597_1001227 | 3300003214 | Bacteria | 15281 |
| 31 | rootH2_10058489 | 3300003320 | Bacteria | 2855 |
| 32 | JGI25160J50197_1000421 | 3300003354 | Bacteria | 26769 |
| 33 | Ga0055538_1000031 | 3300003751 | Bacteria | 199878 |
| 34 | Ga0055539_1000041 | 3300003752 | Bacteria | 199878 |
| 35 | Ga0055539_1000123 | 3300003752 | Bacteria | 83036 |
| 36 | Ga0055533_1000051 | 3300003756 | Bacteria | 199878 |
| 37 | Ga0055533_1000217 | 3300003756 | Bacteria | 41969 |
| 38 | Ga0055532_1000002 | 3300003758 | Bacteria | 576000 |
| 39 | Ga0055532_1000015 | 3300003758 | Bacteria | 340197 |
| 40 | Ga0055532_1000027 | 3300003758 | Bacteria | 234571 |
| 41 | Ga0055532_1000029 | 3300003758 | Bacteria | 232900 |
| 42 | Ga0055525_1000001 | 3300003759 | Bacteria | 1016948 |
| 43 | Ga0055525_1000061 | 3300003759 | Bacteria | 199878 |
| 44 | Ga0055525_1000571 | 3300003759 | Bacteria | 16338 |
| 45 | Ga0055527_1000019 | 3300003760 | Bacteria | 234571 |
| 46 | Ga0055527_1000533 | 3300003760 | Bacteria | 12814 |
| 47 | Ga0055527_1002805 | 3300003760 | Bacteria | 2791 |
| 48 | Ga0055535_1000021 | 3300003761 | Bacteria | 234571 |
| 49 | Ga0055542_1000032 | 3300003762 | Bacteria | 234571 |
| 50 | Ga0055542_1001163 | 3300003762 | Bacteria | 15269 |
| 51 | Ga0055529_1000038 | 3300003763 | Bacteria | 234571 |
| 52 | Ga0055529_1000060 | 3300003763 | Bacteria | 191230 |
| 53 | Ga0055529_1000062 | 3300003763 | Bacteria | 183782 |
| 54 | Ga0055526_1000066 | 3300003771 | Bacteria | 101329 |
| 55 | Ga0055526_1000100 | 3300003771 | Bacteria | 76578 |
| 56 | Ga0055541_1000028 | 3300003841 | Bacteria | 199878 |
| 57 | Ga0055541_1000208 | 3300003841 | Bacteria | 24817 |
| 58 | Ga0055541_1000811 | 3300003841 | Bacteria | 7712 |
| 59 | Ga0055543_1004650 | 3300004625 | Bacteria | 3680 |
| 60 | Ga0065165_1000281 | 3300005262 | Bacteria | 86863 |
| 61 | Ga0065165_1000475 | 3300005262 | Bacteria | 62656 |
| 62 | Ga0065165_1002621 | 3300005262 | Bacteria | 14658 |
| 63 | Ga0065714_10098877 | 3300005288 | Bacteria | 1700 |
| 64 | Ga0065715_10180223 | 3300005293 | Bacteria | 1482 |
| 65 | Ga0065707_10000578 | 3300005295 | Bacteria | 20614 |
| 66 | Ga0065707_10084248 | 3300005295 | Bacteria | 7459 |
| 67 | Ga0070658_10003869 | 3300005327 | Bacteria | 12279 |
| 68 | Ga0070658_10105944 | 3300005327 | Bacteria | 2326 |
| 69 | Ga0070658_10148699 | 3300005327 | Bacteria | 1960 |
| 70 | Ga0070676_10014576 | 3300005328 | Bacteria | 4323 |
| 71 | Ga0070676_10018588 | 3300005328 | Bacteria | 3854 |
| 72 | Ga0070683_100003358 | 3300005329 | Bacteria | 12961 |
| 73 | Ga0070690_100000415 | 3300005330 | Bacteria | 21579 |
| 74 | Ga0070690_100000970 | 3300005330 | Bacteria | 14592 |
| 75 | Ga0070690_100260120 | 3300005330 | Bacteria | 1231 |
| 76 | Ga0070670_100007422 | 3300005331 | Bacteria | 9311 |
| 77 | Ga0070670_100026302 | 3300005331 | Bacteria | 5009 |
| 78 | Ga0070670_100094973 | 3300005331 | Bacteria | 2564 |
| 79 | Ga0070670_100158748 | 3300005331 | Bacteria | 1959 |
| 80 | Ga0070677_10004523 | 3300005333 | Bacteria | 4540 |
| 81 | Ga0070677_10005761 | 3300005333 | Bacteria | 4097 |
| 82 | Ga0068869_100002853 | 3300005334 | Bacteria | 10477 |
| 83 | Ga0068869_100004401 | 3300005334 | Bacteria | 8751 |
| 84 | Ga0068869_100024754 | 3300005334 | Bacteria | 4160 |
| 85 | Ga0070666_10002232 | 3300005335 | Bacteria | 11718 |
| 86 | Ga0070666_10014823 | 3300005335 | Bacteria | 4967 |
| 87 | Ga0070666_10016331 | 3300005335 | Bacteria | 4748 |
| 88 | Ga0070666_10044770 | 3300005335 | Bacteria | 2966 |
| 89 | Ga0070680_100061995 | 3300005336 | Bacteria | 3062 |
| 90 | Ga0070682_100008747 | 3300005337 | Bacteria | 5713 |
| 91 | Ga0068868_100002963 | 3300005338 | Bacteria | 11785 |
| 92 | Ga0068868_100003118 | 3300005338 | Bacteria | 11539 |
| 93 | Ga0068868_100159628 | 3300005338 | Bacteria | 1861 |
| 94 | Ga0068868_100314403 | 3300005338 | Bacteria | 1333 |
| 95 | Ga0070660_100000007 | 3300005339 | Bacteria | 162039 |
| 96 | Ga0070660_100000221 | 3300005339 | Bacteria | 37678 |
| 97 | Ga0070660_100009312 | 3300005339 | Bacteria | 6902 |
| 98 | Ga0070660_100198388 | 3300005339 | Bacteria | 1627 |
| 99 | Ga0070689_100001396 | 3300005340 | Bacteria | 15389 |
| 100 | Ga0070691_10020767 | 3300005341 | Bacteria | 3035 |
| 101 | Ga0070687_100018754 | 3300005343 | Bacteria | 3207 |
| 102 | Ga0070661_100000077 | 3300005344 | Bacteria | 77659 |
| 103 | Ga0070661_100010322 | 3300005344 | Bacteria | 6492 |
| 104 | Ga0070661_100017351 | 3300005344 | Bacteria | 5107 |
| 105 | Ga0070661_100199786 | 3300005344 | Bacteria | 1527 |
| 106 | Ga0070692_10092334 | 3300005345 | Bacteria | 1647 |
| 107 | Ga0070668_100002323 | 3300005347 | Bacteria | 13996 |
| 108 | Ga0070668_100304008 | 3300005347 | Bacteria | 1338 |
| 109 | Ga0070669_100020775 | 3300005353 | Bacteria | 4691 |
| 110 | Ga0070669_100044728 | 3300005353 | Bacteria | 3226 |
| 111 | Ga0070669_100051433 | 3300005353 | Bacteria | 3011 |
| 112 | Ga0070675_100000340 | 3300005354 | Bacteria | 31670 |
| 113 | Ga0070675_100003765 | 3300005354 | Bacteria | 11517 |
| 114 | Ga0070675_100006646 | 3300005354 | Bacteria | 8891 |
| 115 | Ga0070675_100007231 | 3300005354 | Bacteria | 8561 |
| 116 | Ga0070675_100128187 | 3300005354 | Bacteria | 2160 |
| 117 | Ga0070671_100002234 | 3300005355 | Bacteria | 14949 |
| 118 | Ga0070671_100003372 | 3300005355 | Bacteria | 12462 |
| 119 | Ga0070671_100035825 | 3300005355 | Bacteria | 4112 |
| 120 | Ga0070671_100168090 | 3300005355 | Bacteria | 1854 |
| 121 | Ga0070674_100009567 | 3300005356 | Bacteria | 5806 |
| 122 | Ga0070674_100014411 | 3300005356 | Bacteria | 4916 |
| 123 | Ga0070674_100018134 | 3300005356 | Bacteria | 4443 |
| 124 | Ga0070674_100066505 | 3300005356 | Bacteria | 2533 |
| 125 | Ga0070674_100133902 | 3300005356 | Bacteria | 1852 |
| 126 | Ga0070673_100002105 | 3300005364 | Bacteria | 12029 |
| 127 | Ga0070673_100029426 | 3300005364 | Bacteria | 4096 |
| 128 | Ga0070673_100061468 | 3300005364 | Bacteria | 2980 |
| 129 | Ga0070673_100062840 | 3300005364 | Bacteria | 2952 |
| 130 | Ga0070673_100074616 | 3300005364 | Bacteria | 2734 |
| 131 | Ga0070673_100192842 | 3300005364 | Bacteria | 1751 |
| 132 | Ga0070688_100141301 | 3300005365 | Bacteria | 1636 |
| 133 | Ga0070659_100000019 | 3300005366 | Bacteria | 156016 |
| 134 | Ga0070659_100001051 | 3300005366 | Bacteria | 20160 |
| 135 | Ga0070659_100003354 | 3300005366 | Bacteria | 11396 |
| 136 | Ga0070659_100039263 | 3300005366 | Bacteria | 3695 |
| 137 | Ga0070667_100002371 | 3300005367 | Bacteria | 16505 |
| 138 | Ga0070667_100004918 | 3300005367 | Bacteria | 11200 |
| 139 | Ga0070667_100044551 | 3300005367 | Bacteria | 3727 |
| 140 | Ga0070714_100020500 | 3300005435 | Bacteria | 5399 |
| 141 | Ga0070714_100208036 | 3300005435 | Bacteria | 1792 |
| 142 | Ga0070701_10000844 | 3300005438 | Bacteria | 10986 |
| 143 | Ga0070700_100000812 | 3300005441 | Bacteria | 15344 |
| 144 | Ga0070700_100152900 | 3300005441 | Bacteria | 1580 |
| 145 | Ga0070700_100171807 | 3300005441 | Bacteria | 1501 |
| 146 | Ga0070694_100027033 | 3300005444 | Bacteria | 3723 |
| 147 | Ga0070708_100204078 | 3300005445 | Bacteria | 1851 |
| 148 | Ga0070663_100000011 | 3300005455 | Bacteria | 146097 |
| 149 | Ga0070663_100001639 | 3300005455 | Bacteria | 12358 |
| 150 | Ga0070663_100031877 | 3300005455 | Bacteria | 3627 |
| 151 | Ga0070663_100131322 | 3300005455 | Bacteria | 1902 |
| 152 | Ga0070663_100168417 | 3300005455 | Bacteria | 1691 |
| 153 | Ga0070678_100001667 | 3300005456 | Bacteria | 11896 |
| 154 | Ga0070678_100037495 | 3300005456 | Bacteria | 3405 |
| 155 | Ga0070678_100064893 | 3300005456 | Bacteria | 2708 |
| 156 | Ga0070678_100184777 | 3300005456 | Bacteria | 1710 |
| 157 | Ga0070678_100285388 | 3300005456 | Bacteria | 1397 |
| 158 | Ga0070662_100010536 | 3300005457 | Bacteria | 6072 |
| 159 | Ga0070681_10092877 | 3300005458 | Bacteria | 2966 |
| 160 | Ga0068867_100000579 | 3300005459 | Bacteria | 24267 |
| 161 | Ga0068867_100008360 | 3300005459 | Bacteria | 7304 |
| 162 | Ga0068867_100049630 | 3300005459 | Bacteria | 3090 |
| 163 | Ga0068867_100071971 | 3300005459 | Bacteria | 2587 |
| 164 | Ga0068867_100098608 | 3300005459 | Bacteria | 2228 |
| 165 | Ga0068867_100106121 | 3300005459 | Bacteria | 2151 |
| 166 | Ga0068867_100343060 | 3300005459 | Bacteria | 1244 |
| 167 | Ga0070685_10057439 | 3300005466 | Bacteria | 2265 |
| 168 | Ga0070685_10061169 | 3300005466 | Bacteria | 2204 |
| 169 | Ga0070706_100053802 | 3300005467 | Bacteria | 3715 |
| 170 | Ga0070707_100231307 | 3300005468 | Bacteria | 1799 |
| 171 | Ga0070679_100009410 | 3300005530 | Bacteria | 9241 |
| 172 | Ga0070679_100211019 | 3300005530 | Bacteria | 1906 |
| 173 | Ga0068853_100038063 | 3300005539 | Bacteria | 4096 |
| 174 | Ga0070672_100002630 | 3300005543 | Bacteria | 11484 |
| 175 | Ga0070672_100006856 | 3300005543 | Bacteria | 7695 |
| 176 | Ga0070672_100186632 | 3300005543 | Bacteria | 1730 |
| 177 | Ga0070686_100000272 | 3300005544 | Bacteria | 35374 |
| 178 | Ga0070695_100023988 | 3300005545 | Bacteria | 3755 |
| 179 | Ga0070696_100001233 | 3300005546 | Bacteria | 16612 |
| 180 | Ga0070696_100141265 | 3300005546 | Bacteria | 1760 |
| 181 | Ga0070693_100023166 | 3300005547 | Bacteria | 3315 |
| 182 | Ga0070693_100108794 | 3300005547 | Bacteria | 1701 |
| 183 | Ga0070693_100152543 | 3300005547 | Bacteria | 1465 |
| 184 | Ga0070665_100041154 | 3300005548 | Bacteria | 4644 |
| 185 | Ga0070665_100160574 | 3300005548 | Bacteria | 2249 |
| 186 | Ga0070665_100168686 | 3300005548 | Bacteria | 2191 |
| 187 | Ga0070665_100308882 | 3300005548 | Bacteria | 1585 |
| 188 | Ga0070704_100056358 | 3300005549 | Bacteria | 2790 |
| 189 | Ga0068855_100000737 | 3300005563 | Bacteria | 40209 |
| 190 | Ga0068855_100000815 | 3300005563 | Bacteria | 38516 |
| 191 | Ga0068855_100001553 | 3300005563 | Bacteria | 28892 |
| 192 | Ga0068855_100040158 | 3300005563 | Bacteria | 5555 |
| 193 | Ga0068855_100095907 | 3300005563 | Bacteria | 3418 |
| 194 | Ga0068855_100325935 | 3300005563 | Bacteria | 1696 |
| 195 | Ga0068855_100476898 | 3300005563 | Bacteria | 1358 |
| 196 | Ga0070664_100000008 | 3300005564 | Bacteria | 173734 |
| 197 | Ga0070664_100003658 | 3300005564 | Bacteria | 12383 |
| 198 | Ga0070664_100004893 | 3300005564 | Bacteria | 10730 |
| 199 | Ga0070664_100161817 | 3300005564 | Bacteria | 1981 |
| 200 | Ga0068857_100055062 | 3300005577 | Bacteria | 3530 |
| 201 | Ga0068857_100318888 | 3300005577 | Bacteria | 1435 |
| 202 | Ga0068854_100000052 | 3300005578 | Bacteria | 85499 |
| 203 | Ga0068854_100008124 | 3300005578 | Bacteria | 6733 |
| 204 | Ga0068856_100000009 | 3300005614 | Bacteria | 181448 |
| 205 | Ga0068856_100149005 | 3300005614 | Bacteria | 2348 |
| 206 | Ga0070702_100000407 | 3300005615 | Bacteria | 15267 |
| 207 | Ga0070702_100004309 | 3300005615 | Bacteria | 6486 |
| 208 | Ga0068852_100002640 | 3300005616 | Bacteria | 12381 |
| 209 | Ga0068852_100160333 | 3300005616 | Bacteria | 2100 |
| 210 | Ga0068852_100219161 | 3300005616 | Bacteria | 1809 |
| 211 | Ga0068852_100389284 | 3300005616 | Bacteria | 1369 |
| 212 | Ga0068852_100413954 | 3300005616 | Bacteria | 1328 |
| 213 | Ga0068859_100008729 | 3300005617 | Bacteria | 10239 |
| 214 | Ga0068859_100018133 | 3300005617 | Bacteria | 7074 |
| 215 | Ga0068859_100032679 | 3300005617 | Bacteria | 5227 |
| 216 | Ga0068859_100032776 | 3300005617 | Bacteria | 5218 |
| 217 | Ga0068859_100098274 | 3300005617 | Bacteria | 2981 |
| 218 | Ga0068859_100285290 | 3300005617 | Bacteria | 1744 |
| 219 | Ga0068864_100000301 | 3300005618 | Bacteria | 43932 |
| 220 | Ga0068864_100001408 | 3300005618 | Bacteria | 19888 |
| 221 | Ga0068864_100001954 | 3300005618 | Bacteria | 16951 |
| 222 | Ga0068864_100049249 | 3300005618 | Bacteria | 3625 |
| 223 | Ga0068864_100066142 | 3300005618 | Bacteria | 3137 |
| 224 | Ga0068864_100066178 | 3300005618 | Bacteria | 3136 |
| 225 | Ga0068864_100128503 | 3300005618 | Bacteria | 2273 |
| 226 | Ga0068866_10000770 | 3300005718 | Bacteria | 14409 |
| 227 | Ga0068866_10013144 | 3300005718 | Bacteria | 3624 |
| 228 | Ga0068866_10018051 | 3300005718 | Bacteria | 3185 |
| 229 | Ga0068866_10137178 | 3300005718 | Bacteria | 1399 |
| 230 | Ga0068861_100000996 | 3300005719 | Bacteria | 17286 |
| 231 | Ga0068861_100030681 | 3300005719 | Bacteria | 3942 |
| 232 | Ga0068861_100130472 | 3300005719 | Bacteria | 2039 |
| 233 | Ga0068861_100244937 | 3300005719 | Bacteria | 1527 |
| 234 | Ga0068851_10066176 | 3300005834 | Bacteria | 1862 |
| 235 | Ga0068851_10073071 | 3300005834 | Bacteria | 1778 |
| 236 | Ga0068870_10036270 | 3300005840 | Bacteria | 2536 |
| 237 | Ga0068870_10046154 | 3300005840 | Bacteria | 2283 |
| 238 | Ga0068863_100003618 | 3300005841 | Bacteria | 15258 |
| 239 | Ga0068863_100010572 | 3300005841 | Bacteria | 8960 |
| 240 | Ga0068863_100034955 | 3300005841 | Bacteria | 4787 |
| 241 | Ga0068863_100035413 | 3300005841 | Bacteria | 4755 |
| 242 | Ga0068863_100052718 | 3300005841 | Bacteria | 3855 |
| 243 | Ga0068863_100141743 | 3300005841 | Bacteria | 2297 |
| 244 | Ga0068858_100002585 | 3300005842 | Bacteria | 18229 |
| 245 | Ga0068858_100004088 | 3300005842 | Bacteria | 14378 |
| 246 | Ga0068858_100013329 | 3300005842 | Bacteria | 7754 |
| 247 | Ga0068858_100134144 | 3300005842 | Bacteria | 2322 |
| 248 | Ga0068858_100374660 | 3300005842 | Bacteria | 1365 |
| 249 | Ga0068860_100003547 | 3300005843 | Bacteria | 16047 |
| 250 | Ga0068860_100006642 | 3300005843 | Bacteria | 11617 |
| 251 | Ga0068860_100029667 | 3300005843 | Bacteria | 5262 |
| 252 | Ga0068860_100162999 | 3300005843 | Bacteria | 2150 |
| 253 | Ga0068862_100016245 | 3300005844 | Bacteria | 6195 |
| 254 | Ga0068862_100191503 | 3300005844 | Bacteria | 1840 |
| 255 | Ga0068862_100341891 | 3300005844 | Bacteria | 1386 |
| 256 | Ga0075363_100034013 | 3300006048 | Bacteria | 2659 |
| 257 | Ga0075364_10118996 | 3300006051 | Unclassified | 1767 |
| 258 | Ga0070712_100085781 | 3300006175 | Bacteria | 2293 |
| 259 | Ga0070712_100332577 | 3300006175 | Bacteria | 1238 |
| 260 | Ga0075366_10055199 | 3300006195 | Bacteria | 2360 |
| 261 | Ga0075366_10178045 | 3300006195 | Bacteria | 1291 |
| 262 | Ga0097621_100002183 | 3300006237 | Bacteria | 13390 |
| 263 | Ga0097621_100003026 | 3300006237 | Bacteria | 11544 |
| 264 | Ga0097621_100013211 | 3300006237 | Bacteria | 6144 |
| 265 | Ga0097621_100053316 | 3300006237 | Bacteria | 3297 |
| 266 | Ga0097621_100174544 | 3300006237 | Bacteria | 1854 |
| 267 | Ga0097621_100229009 | 3300006237 | Bacteria | 1622 |
| 268 | Ga0075370_10004770 | 3300006353 | Bacteria | 6634 |
| 269 | Ga0068871_100001574 | 3300006358 | Bacteria | 15332 |
| 270 | Ga0068871_100004804 | 3300006358 | Bacteria | 9450 |
| 271 | Ga0068871_100011159 | 3300006358 | Bacteria | 6586 |
| 272 | Ga0068871_100042062 | 3300006358 | Bacteria | 3666 |
| 273 | Ga0068871_100061397 | 3300006358 | Bacteria | 3069 |
| 274 | Ga0068871_100093508 | 3300006358 | Bacteria | 2509 |
| 275 | Ga0068865_100008523 | 3300006881 | Bacteria | 6338 |
| 276 | Ga0068865_100019794 | 3300006881 | Bacteria | 4358 |
| 277 | Ga0068865_100023667 | 3300006881 | Bacteria | 4024 |
| 278 | Ga0097620_100008729 | 3300006931 | Bacteria | 10239 |
| 279 | Ga0097620_100018133 | 3300006931 | Bacteria | 7074 |
| 280 | Ga0097620_100032680 | 3300006931 | Bacteria | 5227 |
| 281 | Ga0097620_100032778 | 3300006931 | Bacteria | 5218 |
| 282 | Ga0097620_100098272 | 3300006931 | Bacteria | 2981 |
| 283 | Ga0097620_100285291 | 3300006931 | Bacteria | 1744 |
| 284 | Ga0079104_1006336 | 3300006946 | Bacteria | 4502 |
| 285 | Ga0099795_10000125 | 3300007788 | Bacteria | 12966 |
| 286 | Ga0105251_10000134 | 3300009011 | Bacteria | 74820 |
| 287 | Ga0105251_10005177 | 3300009011 | Bacteria | 8608 |
| 288 | Ga0105251_10013971 | 3300009011 | Bacteria | 4461 |
| 289 | Ga0105251_10022862 | 3300009011 | Bacteria | 3236 |
| 290 | Ga0105244_10005315 | 3300009036 | Bacteria | 8575 |
| 291 | Ga0105244_10013656 | 3300009036 | Bacteria | 4734 |
| 292 | Ga0105244_10038044 | 3300009036 | Bacteria | 2511 |
| 293 | Ga0105250_10000008 | 3300009092 | Bacteria | 343965 |
| 294 | Ga0105240_10003806 | 3300009093 | Bacteria | 23315 |
| 295 | Ga0105240_10005169 | 3300009093 | Bacteria | 19516 |
| 296 | Ga0105240_10027418 | 3300009093 | Bacteria | 7455 |
| 297 | Ga0105240_10089502 | 3300009093 | Bacteria | 3764 |
| 298 | Ga0105240_10094157 | 3300009093 | Bacteria | 3655 |
| 299 | Ga0105240_10097409 | 3300009093 | Bacteria | 3584 |
| 300 | Ga0105245_10000811 | 3300009098 | Bacteria | 28425 |
| 301 | Ga0105245_10028867 | 3300009098 | Bacteria | 4897 |
| 302 | Ga0105245_10107064 | 3300009098 | Bacteria | 2595 |
| 303 | Ga0105245_10160119 | 3300009098 | Bacteria | 2135 |
| 304 | Ga0105245_10163390 | 3300009098 | Bacteria | 2114 |
| 305 | Ga0105245_10267668 | 3300009098 | Bacteria | 1665 |
| 306 | Ga0105245_10477174 | 3300009098 | Bacteria | 1260 |
| 307 | Ga0105243_10004077 | 3300009148 | Bacteria | 11637 |
| 308 | Ga0105243_10008031 | 3300009148 | Bacteria | 8102 |
| 309 | Ga0105243_10016549 | 3300009148 | Bacteria | 5576 |
| 310 | Ga0105243_10141916 | 3300009148 | Bacteria | 2050 |
| 311 | Ga0105241_10027698 | 3300009174 | Bacteria | 4220 |
| 312 | Ga0105241_10044354 | 3300009174 | Bacteria | 3369 |
| 313 | Ga0105241_10084332 | 3300009174 | Bacteria | 2495 |
| 314 | Ga0105242_10005513 | 3300009176 | Bacteria | 9764 |
| 315 | Ga0105242_10017277 | 3300009176 | Bacteria | 5619 |
| 316 | Ga0105242_10066139 | 3300009176 | Bacteria | 2984 |
| 317 | Ga0105242_10128169 | 3300009176 | Bacteria | 2187 |
| 318 | Ga0105242_10227497 | 3300009176 | Bacteria | 1670 |
| 319 | Ga0105248_10001495 | 3300009177 | Bacteria | 26017 |
| 320 | Ga0105248_10005155 | 3300009177 | Bacteria | 14406 |
| 321 | Ga0105248_10009050 | 3300009177 | Bacteria | 10952 |
| 322 | Ga0105248_10015971 | 3300009177 | Bacteria | 8267 |
| 323 | Ga0105248_10089029 | 3300009177 | Bacteria | 3474 |
| 324 | Ga0105248_10151138 | 3300009177 | Bacteria | 2620 |
| 325 | Ga0105237_10000784 | 3300009545 | Bacteria | 43457 |
| 326 | Ga0105237_10066264 | 3300009545 | Bacteria | 3606 |
| 327 | Ga0105237_10107544 | 3300009545 | Bacteria | 2781 |
| 328 | Ga0105238_10005552 | 3300009551 | Bacteria | 12457 |
| 329 | Ga0105238_10071538 | 3300009551 | Bacteria | 3466 |
| 330 | Ga0105249_10025378 | 3300009553 | Bacteria | 5334 |
| 331 | Ga0105249_10045520 | 3300009553 | Bacteria | 3991 |
| 332 | Ga0099796_10026691 | 3300010159 | Bacteria | 1837 |
| 333 | Ga0105239_10008150 | 3300010375 | Bacteria | 11956 |
| 334 | Ga0105239_10021748 | 3300010375 | Bacteria | 7071 |
| 335 | Ga0105239_10059776 | 3300010375 | Bacteria | 4183 |
| 336 | Ga0105239_10156668 | 3300010375 | Bacteria | 2544 |
| 337 | Ga0105239_10201344 | 3300010375 | Bacteria | 2231 |
| 338 | Ga0105246_10171772 | 3300011119 | Bacteria | 1661 |
| 339 | Ga0157373_10001549 | 3300013100 | Bacteria | 17549 |
| 340 | Ga0157373_10015465 | 3300013100 | Bacteria | 5579 |
| 341 | Ga0157373_10020555 | 3300013100 | Bacteria | 4797 |
| 342 | Ga0157371_10000068 | 3300013102 | Bacteria | 168110 |
| 343 | Ga0157371_10015589 | 3300013102 | Bacteria | 5697 |
| 344 | Ga0157370_10001130 | 3300013104 | Bacteria | 33346 |
| 345 | Ga0157370_10002304 | 3300013104 | Bacteria | 23107 |
| 346 | Ga0157370_10002933 | 3300013104 | Bacteria | 20306 |
| 347 | Ga0157370_10165182 | 3300013104 | Bacteria | 2059 |
| 348 | Ga0157369_10000724 | 3300013105 | Bacteria | 42487 |
| 349 | Ga0157369_10001199 | 3300013105 | Bacteria | 32259 |
| 350 | Ga0157369_10002274 | 3300013105 | Bacteria | 23109 |
| 351 | Ga0157369_10008205 | 3300013105 | Bacteria | 11978 |
| 352 | Ga0157369_10201089 | 3300013105 | Bacteria | 2091 |
| 353 | Ga0157374_10000044 | 3300013296 | Bacteria | 144848 |
| 354 | Ga0157374_10004186 | 3300013296 | Bacteria | 12121 |
| 355 | Ga0157374_10303450 | 3300013296 | Bacteria | 1580 |
| 356 | Ga0157374_10339350 | 3300013296 | Bacteria | 1491 |
| 357 | Ga0157378_10000762 | 3300013297 | Bacteria | 30119 |
| 358 | Ga0157378_10002340 | 3300013297 | Bacteria | 16832 |
| 359 | Ga0157378_10009123 | 3300013297 | Bacteria | 8631 |
| 360 | Ga0157378_10012649 | 3300013297 | Bacteria | 7385 |
| 361 | Ga0157378_10129186 | 3300013297 | Bacteria | 2337 |
| 362 | Ga0163162_10001049 | 3300013306 | Bacteria | 25667 |
| 363 | Ga0163162_10002545 | 3300013306 | Bacteria | 17253 |
| 364 | Ga0163162_10003910 | 3300013306 | Bacteria | 14311 |
| 365 | Ga0163162_10018428 | 3300013306 | Bacteria | 6840 |
| 366 | Ga0163162_10025300 | 3300013306 | Bacteria | 5865 |
| 367 | Ga0163162_10030772 | 3300013306 | Bacteria | 5319 |
| 368 | Ga0163162_10215707 | 3300013306 | Bacteria | 2049 |
| 369 | Ga0163162_10336427 | 3300013306 | Bacteria | 1642 |
| 370 | Ga0157372_10000271 | 3300013307 | Bacteria | 57411 |
| 371 | Ga0157372_10001941 | 3300013307 | Bacteria | 22444 |
| 372 | Ga0157375_10003567 | 3300013308 | Bacteria | 13509 |
| 373 | Ga0157375_10003891 | 3300013308 | Bacteria | 12952 |
| 374 | Ga0157375_10009927 | 3300013308 | Bacteria | 8374 |
| 375 | Ga0157375_10014532 | 3300013308 | Bacteria | 7026 |
| 376 | Ga0157375_10086658 | 3300013308 | Bacteria | 3183 |
| 377 | Ga0157375_10124474 | 3300013308 | Bacteria | 2691 |
| 378 | Ga0157375_10181589 | 3300013308 | Bacteria | 2256 |
| 379 | Ga0163163_10002307 | 3300014325 | Bacteria | 16107 |
| 380 | Ga0157380_10002831 | 3300014326 | Bacteria | 11794 |
| 381 | Ga0182008_10003181 | 3300014497 | Bacteria | 10043 |
| 382 | Ga0157379_10000072 | 3300014968 | Bacteria | 64603 |
| 383 | Ga0157379_10001980 | 3300014968 | Bacteria | 16946 |
| 384 | Ga0157379_10007685 | 3300014968 | Bacteria | 9334 |
| 385 | Ga0157379_10092868 | 3300014968 | Bacteria | 2707 |
| 386 | Ga0157376_10027762 | 3300014969 | Bacteria | 4491 |
| 387 | Ga0157376_10124972 | 3300014969 | Bacteria | 2286 |
| 388 | Ga0157376_10134964 | 3300014969 | Bacteria | 2207 |
| 389 | Ga0157376_10196684 | 3300014969 | Bacteria | 1852 |
| 390 | Ga0157376_10322571 | 3300014969 | Bacteria | 1469 |
| 391 | Ga0182006_1000002 | 3300015261 | Bacteria | 887990 |
| 392 | Ga0182006_1005807 | 3300015261 | Bacteria | 5816 |
| 393 | Ga0182006_1037965 | 3300015261 | Bacteria | 1907 |
| 394 | Ga0182007_10000090 | 3300015262 | Bacteria | 66706 |
| 395 | Ga0182007_10002950 | 3300015262 | Bacteria | 8252 |
| 396 | Ga0182007_10011396 | 3300015262 | Bacteria | 3463 |
| 397 | Ga0182007_10020871 | 3300015262 | Bacteria | 2334 |
| 398 | Ga0182005_1000070 | 3300015265 | Bacteria | 85687 |
| 399 | Ga0182005_1000656 | 3300015265 | Bacteria | 16502 |
| 400 | Ga0182005_1031815 | 3300015265 | Bacteria | 1437 |
| 401 | Ga0183362_10005 | 3300015683 | Bacteria | 437616 |
| 402 | Ga0183361_10013 | 3300016635 | Bacteria | 179680 |
| 403 | Ga0163161_10012761 | 3300017792 | Bacteria | 5836 |
| 404 | Ga0163161_10024519 | 3300017792 | Bacteria | 4262 |
| 405 | Ga0163161_10031877 | 3300017792 | Bacteria | 3759 |
| 406 | Ga0163161_10064501 | 3300017792 | Bacteria | 2672 |
| 407 | Ga0163161_10172340 | 3300017792 | Bacteria | 1655 |
| 408 | Ga0163161_10176084 | 3300017792 | Bacteria | 1638 |
| 409 | Ga0206349_1385556 | 3300020075 | Bacteria | 1691 |
| 410 | Ga0206351_10134375 | 3300020077 | Bacteria | 14013 |
| 411 | Ga0154015_1636926 | 3300020610 | Bacteria | 26784 |
| 412 | Ga0213872_10000769 | 3300021361 | Bacteria | 23505 |
| 413 | Ga0213872_10001970 | 3300021361 | Bacteria | 12518 |
| 414 | Ga0213872_10030368 | 3300021361 | Bacteria | 2476 |
| 415 | Ga0213875_10125441 | 3300021388 | Bacteria | 1200 |
| 416 | Ga0224712_10000142 | 3300022467 | Bacteria | 12013 |
| 417 | Ga0209784_100003 | 3300025224 | Bacteria | 1379451 |
| 418 | Ga0209784_100039 | 3300025224 | Bacteria | 232021 |
| 419 | Ga0209784_100860 | 3300025224 | Bacteria | 6544 |
| 420 | Ga0209566_100002 | 3300025225 | Bacteria | 2614868 |
| 421 | Ga0209566_100023 | 3300025225 | Bacteria | 396571 |
| 422 | Ga0209566_100545 | 3300025225 | Bacteria | 25433 |
| 423 | Ga0209566_100699 | 3300025225 | Bacteria | 19356 |
| 424 | Ga0209566_101882 | 3300025225 | Bacteria | 4693 |
| 425 | Ga0209674_100005 | 3300025226 | Bacteria | 1708125 |
| 426 | Ga0209674_100008 | 3300025226 | Bacteria | 1076909 |
| 427 | Ga0209674_100040 | 3300025226 | Bacteria | 396571 |
| 428 | Ga0209674_100103 | 3300025226 | Bacteria | 154966 |
| 429 | Ga0209674_100423 | 3300025226 | Bacteria | 20465 |
| 430 | Ga0209672_100001 | 3300025228 | Bacteria | 2828210 |
| 431 | Ga0209672_100014 | 3300025228 | Bacteria | 546252 |
| 432 | Ga0209672_100052 | 3300025228 | Bacteria | 231179 |
| 433 | Ga0209672_100085 | 3300025228 | Bacteria | 129172 |
| 434 | Ga0209672_101885 | 3300025228 | Bacteria | 6152 |
| 435 | Ga0209147_100001 | 3300025229 | Bacteria | 2384371 |
| 436 | Ga0209147_100002 | 3300025229 | Bacteria | 2158988 |
| 437 | Ga0209147_100087 | 3300025229 | Bacteria | 179835 |
| 438 | Ga0209147_100125 | 3300025229 | Bacteria | 129172 |
| 439 | Ga0209563_100004 | 3300025230 | Bacteria | 1814108 |
| 440 | Ga0209563_100007 | 3300025230 | Bacteria | 1579402 |
| 441 | Ga0209563_100072 | 3300025230 | Bacteria | 232021 |
| 442 | Ga0209563_100892 | 3300025230 | Bacteria | 8831 |
| 443 | Ga0207427_100513 | 3300025231 | Bacteria | 20535 |
| 444 | Ga0207427_101254 | 3300025231 | Bacteria | 9731 |
| 445 | Ga0209437_100097 | 3300025233 | Bacteria | 232021 |
| 446 | Ga0209258_100001 | 3300025242 | Bacteria | 2384269 |
| 447 | Ga0209258_100002 | 3300025242 | Bacteria | 2158988 |
| 448 | Ga0209258_100040 | 3300025242 | Bacteria | 385401 |
| 449 | Ga0209258_100203 | 3300025242 | Bacteria | 121725 |
| 450 | Ga0207425_1000284 | 3300025245 | Bacteria | 37103 |
| 451 | Ga0209646_1000059 | 3300025246 | Bacteria | 256909 |
| 452 | Ga0209646_1000087 | 3300025246 | Bacteria | 193273 |
| 453 | Ga0209026_1003130 | 3300025250 | Bacteria | 5634 |
| 454 | Ga0209677_100009 | 3300025253 | Bacteria | 749530 |
| 455 | Ga0209677_100041 | 3300025253 | Bacteria | 232021 |
| 456 | Ga0209677_103052 | 3300025253 | Bacteria | 5734 |
| 457 | Ga0209148_1000003 | 3300025254 | Bacteria | 2384288 |
| 458 | Ga0209148_1000021 | 3300025254 | Bacteria | 714645 |
| 459 | Ga0209148_1000035 | 3300025254 | Bacteria | 548413 |
| 460 | Ga0209148_1000211 | 3300025254 | Bacteria | 102391 |
| 461 | Ga0209148_1000553 | 3300025254 | Bacteria | 35527 |
| 462 | Ga0209148_1005780 | 3300025254 | Bacteria | 2772 |
| 463 | Ga0209759_1000188 | 3300025256 | Bacteria | 99987 |
| 464 | Ga0209759_1000284 | 3300025256 | Bacteria | 70505 |
| 465 | Ga0209759_1000519 | 3300025256 | Bacteria | 41644 |
| 466 | Ga0209759_1002173 | 3300025256 | Bacteria | 8983 |
| 467 | Ga0209759_1002486 | 3300025256 | Bacteria | 8044 |
| 468 | Ga0209759_1008232 | 3300025256 | Bacteria | 3266 |
| 469 | Ga0209233_1000043 | 3300025261 | Bacteria | 509723 |
| 470 | Ga0209233_1000122 | 3300025261 | Bacteria | 232021 |
| 471 | Ga0207666_1005297 | 3300025271 | Bacteria | 1646 |
| 472 | Ga0209455_1000001 | 3300025272 | Bacteria | 2384278 |
| 473 | Ga0209455_1000021 | 3300025272 | Bacteria | 699993 |
| 474 | Ga0209455_1000026 | 3300025272 | Bacteria | 653778 |
| 475 | Ga0209455_1000200 | 3300025272 | Bacteria | 87009 |
| 476 | Ga0209673_1000030 | 3300025273 | Bacteria | 351933 |
| 477 | Ga0209025_1000178 | 3300025294 | Bacteria | 158040 |
| 478 | Ga0209025_1006590 | 3300025294 | Bacteria | 8948 |
| 479 | Ga0209564_1000009 | 3300025295 | Bacteria | 950196 |
| 480 | Ga0209564_1000045 | 3300025295 | Bacteria | 376549 |
| 481 | Ga0209564_1004734 | 3300025295 | Bacteria | 8147 |
| 482 | Ga0209564_1013455 | 3300025295 | Bacteria | 3472 |
| 483 | Ga0209758_1000489 | 3300025297 | Bacteria | 64758 |
| 484 | Ga0207426_1000050 | 3300025302 | Bacteria | 393022 |
| 485 | Ga0207426_1002220 | 3300025302 | Bacteria | 13025 |
| 486 | Ga0209051_1028714 | 3300025303 | Bacteria | 2191 |
| 487 | Ga0207656_10073863 | 3300025321 | Bacteria | 1521 |
| 488 | Ga0207656_10112379 | 3300025321 | Bacteria | 1260 |
| 489 | Ga0207696_1000106 | 3300025711 | Bacteria | 159964 |
| 490 | Ga0207655_1002220 | 3300025728 | Bacteria | 16087 |
| 491 | Ga0207655_1021992 | 3300025728 | Bacteria | 3214 |
| 492 | Ga0207713_1001542 | 3300025735 | Bacteria | 18104 |
| 493 | Ga0207713_1025007 | 3300025735 | Bacteria | 2767 |
| 494 | Ga0207682_10005455 | 3300025893 | Bacteria | 5177 |
| 495 | Ga0207682_10014750 | 3300025893 | Bacteria | 3044 |
| 496 | Ga0207642_10006349 | 3300025899 | Bacteria | 3925 |
| 497 | Ga0207642_10071307 | 3300025899 | Bacteria | 1654 |
| 498 | Ga0207642_10087743 | 3300025899 | Bacteria | 1528 |
| 499 | Ga0207642_10118430 | 3300025899 | Bacteria | 1362 |
| 500 | Ga0207680_10002694 | 3300025903 | Bacteria | 8302 |
| 501 | Ga0207680_10021359 | 3300025903 | Bacteria | 3501 |
| 502 | Ga0207680_10041483 | 3300025903 | Bacteria | 2685 |
| 503 | Ga0207647_10000310 | 3300025904 | Bacteria | 40366 |
| 504 | Ga0207647_10002433 | 3300025904 | Bacteria | 14128 |
| 505 | Ga0207647_10009655 | 3300025904 | Bacteria | 6851 |
| 506 | Ga0207645_10006661 | 3300025907 | Bacteria | 8250 |
| 507 | Ga0207645_10012955 | 3300025907 | Bacteria | 5640 |
| 508 | Ga0207645_10159775 | 3300025907 | Bacteria | 1474 |
| 509 | Ga0207645_10171204 | 3300025907 | Bacteria | 1423 |
| 510 | Ga0207643_10004408 | 3300025908 | Bacteria | 7571 |
| 511 | Ga0207705_10002739 | 3300025909 | Bacteria | 13510 |
| 512 | Ga0207705_10004282 | 3300025909 | Bacteria | 10806 |
| 513 | Ga0207705_10025889 | 3300025909 | Bacteria | 4187 |
| 514 | Ga0207705_10089152 | 3300025909 | Bacteria | 2257 |
| 515 | Ga0207705_10174932 | 3300025909 | Bacteria | 1618 |
| 516 | Ga0207684_10223120 | 3300025910 | Bacteria | 1626 |
| 517 | Ga0207654_10039705 | 3300025911 | Bacteria | 2649 |
| 518 | Ga0207707_10002855 | 3300025912 | Bacteria | 15431 |
| 519 | Ga0207707_10227942 | 3300025912 | Bacteria | 1621 |
| 520 | Ga0207695_10001909 | 3300025913 | Bacteria | 32457 |
| 521 | Ga0207695_10005290 | 3300025913 | Bacteria | 17201 |
| 522 | Ga0207695_10014738 | 3300025913 | Bacteria | 9243 |
| 523 | Ga0207695_10021190 | 3300025913 | Bacteria | 7423 |
| 524 | Ga0207695_10086432 | 3300025913 | Bacteria | 3163 |
| 525 | Ga0207695_10095513 | 3300025913 | Bacteria | 2976 |
| 526 | Ga0207695_10121166 | 3300025913 | Bacteria | 2584 |
| 527 | Ga0207695_10286291 | 3300025913 | Bacteria | 1541 |
| 528 | Ga0207695_10369677 | 3300025913 | Bacteria | 1320 |
| 529 | Ga0207671_10023429 | 3300025914 | Bacteria | 4656 |
| 530 | Ga0207671_10032527 | 3300025914 | Bacteria | 3882 |
| 531 | Ga0207671_10040198 | 3300025914 | Bacteria | 3462 |
| 532 | Ga0207671_10074464 | 3300025914 | Bacteria | 2538 |
| 533 | Ga0207663_10044605 | 3300025916 | Bacteria | 2723 |
| 534 | Ga0207660_10059452 | 3300025917 | Bacteria | 2744 |
| 535 | Ga0207662_10013387 | 3300025918 | Bacteria | 4588 |
| 536 | Ga0207657_10000004 | 3300025919 | Bacteria | 247179 |
| 537 | Ga0207657_10000974 | 3300025919 | Bacteria | 30418 |
| 538 | Ga0207657_10017545 | 3300025919 | Bacteria | 6858 |
| 539 | Ga0207657_10103608 | 3300025919 | Bacteria | 2358 |
| 540 | Ga0207657_10111711 | 3300025919 | Bacteria | 2256 |
| 541 | Ga0207649_10000321 | 3300025920 | Bacteria | 36438 |
| 542 | Ga0207649_10006430 | 3300025920 | Bacteria | 6380 |
| 543 | Ga0207649_10043427 | 3300025920 | Bacteria | 2748 |
| 544 | Ga0207649_10113460 | 3300025920 | Bacteria | 1815 |
| 545 | Ga0207649_10161945 | 3300025920 | Bacteria | 1551 |
| 546 | Ga0207652_10007499 | 3300025921 | Bacteria | 8784 |
| 547 | Ga0207646_10307961 | 3300025922 | Bacteria | 1431 |
| 548 | Ga0207681_10069468 | 3300025923 | Bacteria | 2450 |
| 549 | Ga0207681_10123940 | 3300025923 | Bacteria | 1899 |
| 550 | Ga0207681_10128694 | 3300025923 | Bacteria | 1869 |
| 551 | Ga0207694_10005553 | 3300025924 | Bacteria | 9664 |
| 552 | Ga0207694_10041086 | 3300025924 | Bacteria | 3563 |
| 553 | Ga0207650_10004906 | 3300025925 | Bacteria | 9132 |
| 554 | Ga0207650_10010329 | 3300025925 | Bacteria | 6401 |
| 555 | Ga0207650_10045979 | 3300025925 | Bacteria | 3213 |
| 556 | Ga0207650_10165999 | 3300025925 | Bacteria | 1752 |
| 557 | Ga0207659_10000771 | 3300025926 | Bacteria | 18985 |
| 558 | Ga0207659_10001624 | 3300025926 | Bacteria | 13330 |
| 559 | Ga0207659_10052733 | 3300025926 | Bacteria | 2899 |
| 560 | Ga0207687_10002292 | 3300025927 | Bacteria | 13037 |
| 561 | Ga0207687_10224731 | 3300025927 | Bacteria | 1480 |
| 562 | Ga0207664_10059393 | 3300025929 | Bacteria | 3045 |
| 563 | Ga0207664_10181073 | 3300025929 | Bacteria | 1809 |
| 564 | Ga0207664_10240736 | 3300025929 | Bacteria | 1576 |
| 565 | Ga0207644_10002036 | 3300025931 | Bacteria | 13083 |
| 566 | Ga0207644_10003925 | 3300025931 | Bacteria | 9648 |
| 567 | Ga0207644_10032467 | 3300025931 | Bacteria | 3643 |
| 568 | Ga0207644_10073856 | 3300025931 | Bacteria | 2501 |
| 569 | Ga0207690_10000015 | 3300025932 | Bacteria | 257457 |
| 570 | Ga0207690_10002377 | 3300025932 | Bacteria | 11402 |
| 571 | Ga0207690_10002753 | 3300025932 | Bacteria | 10624 |
| 572 | Ga0207706_10015304 | 3300025933 | Bacteria | 6935 |
| 573 | Ga0207706_10028137 | 3300025933 | Bacteria | 5022 |
| 574 | Ga0207706_10055728 | 3300025933 | Bacteria | 3485 |
| 575 | Ga0207706_10165742 | 3300025933 | Bacteria | 1942 |
| 576 | Ga0207686_10001170 | 3300025934 | Bacteria | 15162 |
| 577 | Ga0207686_10091538 | 3300025934 | Bacteria | 2009 |
| 578 | Ga0207686_10129376 | 3300025934 | Bacteria | 1730 |
| 579 | Ga0207709_10101869 | 3300025935 | Bacteria | 1900 |
| 580 | Ga0207709_10135983 | 3300025935 | Bacteria | 1683 |
| 581 | Ga0207670_10009527 | 3300025936 | Bacteria | 5546 |
| 582 | Ga0207670_10143651 | 3300025936 | Bacteria | 1762 |
| 583 | Ga0207669_10004101 | 3300025937 | Bacteria | 6381 |
| 584 | Ga0207669_10004845 | 3300025937 | Bacteria | 5974 |
| 585 | Ga0207669_10057512 | 3300025937 | Bacteria | 2368 |
| 586 | Ga0207669_10149603 | 3300025937 | Bacteria | 1633 |
| 587 | Ga0207704_10002682 | 3300025938 | Bacteria | 8029 |
| 588 | Ga0207704_10009290 | 3300025938 | Bacteria | 4734 |
| 589 | Ga0207704_10029386 | 3300025938 | Bacteria | 3065 |
| 590 | Ga0207704_10159156 | 3300025938 | Bacteria | 1604 |
| 591 | Ga0207704_10242480 | 3300025938 | Bacteria | 1348 |
| 592 | Ga0207665_10005065 | 3300025939 | Bacteria | 8797 |
| 593 | Ga0207691_10002661 | 3300025940 | Bacteria | 17455 |
| 594 | Ga0207691_10003475 | 3300025940 | Bacteria | 15338 |
| 595 | Ga0207691_10013941 | 3300025940 | Bacteria | 7668 |
| 596 | Ga0207691_10014690 | 3300025940 | Bacteria | 7463 |
| 597 | Ga0207691_10126716 | 3300025940 | Bacteria | 2259 |
| 598 | Ga0207691_10217818 | 3300025940 | Bacteria | 1656 |
| 599 | Ga0207711_10014772 | 3300025941 | Bacteria | 6489 |
| 600 | Ga0207711_10019262 | 3300025941 | Bacteria | 5683 |
| 601 | Ga0207711_10099337 | 3300025941 | Bacteria | 2573 |
| 602 | Ga0207711_10121155 | 3300025941 | Bacteria | 2335 |
| 603 | Ga0207689_10000262 | 3300025942 | Bacteria | 47258 |
| 604 | Ga0207689_10000320 | 3300025942 | Bacteria | 44520 |
| 605 | Ga0207689_10034893 | 3300025942 | Bacteria | 4178 |
| 606 | Ga0207689_10138736 | 3300025942 | Bacteria | 2003 |
| 607 | Ga0207661_10030207 | 3300025944 | Bacteria | 4171 |
| 608 | Ga0207679_10000001 | 3300025945 | Bacteria | 777444 |
| 609 | Ga0207679_10009872 | 3300025945 | Bacteria | 6129 |
| 610 | Ga0207679_10020920 | 3300025945 | Bacteria | 4425 |
| 611 | Ga0207667_10000025 | 3300025949 | Bacteria | 350159 |
| 612 | Ga0207667_10000067 | 3300025949 | Bacteria | 184547 |
| 613 | Ga0207667_10000524 | 3300025949 | Bacteria | 50648 |
| 614 | Ga0207667_10004154 | 3300025949 | Bacteria | 17795 |
| 615 | Ga0207667_10023097 | 3300025949 | Bacteria | 6852 |
| 616 | Ga0207667_10148763 | 3300025949 | Bacteria | 2411 |
| 617 | Ga0207667_10258319 | 3300025949 | Bacteria | 1781 |
| 618 | Ga0207651_10003548 | 3300025960 | Bacteria | 7666 |
| 619 | Ga0207651_10008458 | 3300025960 | Bacteria | 5561 |
| 620 | Ga0207651_10115169 | 3300025960 | Bacteria | 2027 |
| 621 | Ga0207651_10195788 | 3300025960 | Bacteria | 1615 |
| 622 | Ga0207712_10006896 | 3300025961 | Bacteria | 7172 |
| 623 | Ga0207712_10026515 | 3300025961 | Bacteria | 3862 |
| 624 | Ga0207712_10029591 | 3300025961 | Bacteria | 3676 |
| 625 | Ga0207668_10200597 | 3300025972 | Bacteria | 1588 |
| 626 | Ga0207640_10000035 | 3300025981 | Bacteria | 111369 |
| 627 | Ga0207640_10004211 | 3300025981 | Bacteria | 7779 |
| 628 | Ga0207658_10001963 | 3300025986 | Bacteria | 15342 |
| 629 | Ga0207658_10022693 | 3300025986 | Bacteria | 4371 |
| 630 | Ga0207658_10043501 | 3300025986 | Bacteria | 3265 |
| 631 | Ga0207658_10054480 | 3300025986 | Bacteria | 2960 |
| 632 | Ga0207677_10001098 | 3300026023 | Bacteria | 14745 |
| 633 | Ga0207677_10002070 | 3300026023 | Bacteria | 10561 |
| 634 | Ga0207677_10087840 | 3300026023 | Bacteria | 2252 |
| 635 | Ga0207677_10175582 | 3300026023 | Bacteria | 1680 |
| 636 | Ga0207703_10003733 | 3300026035 | Bacteria | 12677 |
| 637 | Ga0207703_10004880 | 3300026035 | Bacteria | 10906 |
| 638 | Ga0207639_10053857 | 3300026041 | Bacteria | 3072 |
| 639 | Ga0207639_10073257 | 3300026041 | Bacteria | 2684 |
| 640 | Ga0207639_10561477 | 3300026041 | Bacteria | 1049 |
| 641 | Ga0207678_10000001 | 3300026067 | Bacteria | 433184 |
| 642 | Ga0207678_10003809 | 3300026067 | Bacteria | 13573 |
| 643 | Ga0207678_10036529 | 3300026067 | Bacteria | 4276 |
| 644 | Ga0207678_10144662 | 3300026067 | Bacteria | 2029 |
| 645 | Ga0207708_10000360 | 3300026075 | Bacteria | 35736 |
| 646 | Ga0207708_10005611 | 3300026075 | Bacteria | 9260 |
| 647 | Ga0207708_10053167 | 3300026075 | Bacteria | 3085 |
| 648 | Ga0207702_10001757 | 3300026078 | Bacteria | 21331 |
| 649 | Ga0207702_10195031 | 3300026078 | Bacteria | 1874 |
| 650 | Ga0207641_10004096 | 3300026088 | Bacteria | 12708 |
| 651 | Ga0207641_10028228 | 3300026088 | Bacteria | 4636 |
| 652 | Ga0207641_10030375 | 3300026088 | Bacteria | 4476 |
| 653 | Ga0207641_10030589 | 3300026088 | Bacteria | 4460 |
| 654 | Ga0207641_10045055 | 3300026088 | Bacteria | 3712 |
| 655 | Ga0207641_10084526 | 3300026088 | Bacteria | 2763 |
| 656 | Ga0207648_10000376 | 3300026089 | Bacteria | 49108 |
| 657 | Ga0207648_10000853 | 3300026089 | Bacteria | 34345 |
| 658 | Ga0207648_10009628 | 3300026089 | Bacteria | 9240 |
| 659 | Ga0207648_10051572 | 3300026089 | Bacteria | 3596 |
| 660 | Ga0207648_10059286 | 3300026089 | Bacteria | 3338 |
| 661 | Ga0207648_10069098 | 3300026089 | Bacteria | 3078 |
| 662 | Ga0207648_10142950 | 3300026089 | Bacteria | 2110 |
| 663 | Ga0207676_10000951 | 3300026095 | Bacteria | 22372 |
| 664 | Ga0207676_10077387 | 3300026095 | Bacteria | 2691 |
| 665 | Ga0207676_10095953 | 3300026095 | Bacteria | 2447 |
| 666 | Ga0207674_10003354 | 3300026116 | Bacteria | 19652 |
| 667 | Ga0207674_10030381 | 3300026116 | Bacteria | 5681 |
| 668 | Ga0207674_10172302 | 3300026116 | Bacteria | 2117 |
| 669 | Ga0207675_100000300 | 3300026118 | Bacteria | 47402 |
| 670 | Ga0207675_100000415 | 3300026118 | Bacteria | 41041 |
| 671 | Ga0207675_100008514 | 3300026118 | Bacteria | 9650 |
| 672 | Ga0207675_100011304 | 3300026118 | Bacteria | 8357 |
| 673 | Ga0207675_100066430 | 3300026118 | Bacteria | 3371 |
| 674 | Ga0207675_100102890 | 3300026118 | Bacteria | 2691 |
| 675 | Ga0207675_100281068 | 3300026118 | Bacteria | 1617 |
| 676 | Ga0207683_10002476 | 3300026121 | Bacteria | 16110 |
| 677 | Ga0207683_10003438 | 3300026121 | Bacteria | 13801 |
| 678 | Ga0207683_10007432 | 3300026121 | Bacteria | 9394 |
| 679 | Ga0207683_10025141 | 3300026121 | Bacteria | 5135 |
| 680 | Ga0207683_10040768 | 3300026121 | Bacteria | 4053 |
| 681 | Ga0207683_10056418 | 3300026121 | Bacteria | 3445 |
| 682 | Ga0207683_10218872 | 3300026121 | Bacteria | 1735 |
| 683 | Ga0207683_10231700 | 3300026121 | Bacteria | 1684 |
| 684 | Ga0207683_10553540 | 3300026121 | Bacteria | 1064 |
| 685 | Ga0207698_10006837 | 3300026142 | Bacteria | 7136 |
| 686 | Ga0207698_10073804 | 3300026142 | Bacteria | 2718 |
| 687 | Ga0207698_10552491 | 3300026142 | Bacteria | 1129 |
| 688 | Ga0209371_1000399 | 3300027312 | Bacteria | 45543 |
| 689 | Ga0209179_1000750 | 3300027512 | Bacteria | 3519 |
| 690 | Ga0209282_1000019 | 3300027666 | Bacteria | 184034 |
| 691 | Ga0265356_1000985 | 3300028017 | Bacteria | 4528 |
| 692 | Ga0268266_10094225 | 3300028379 | Bacteria | 2628 |
| 693 | Ga0268266_10129822 | 3300028379 | Bacteria | 2253 |
| 694 | Ga0268266_10174342 | 3300028379 | Bacteria | 1954 |
| 695 | Ga0268265_10030320 | 3300028380 | Bacteria | 3893 |
| 696 | Ga0268265_10079835 | 3300028380 | Bacteria | 2578 |
| 697 | Ga0268264_10009764 | 3300028381 | Bacteria | 7946 |
| 698 | Ga0268264_10501233 | 3300028381 | Bacteria | 1184 |
| 699 | Ga0265334_10000010 | 3300028573 | Bacteria | 188179 |
| 700 | Ga0265318_10054665 | 3300028577 | Bacteria | 1495 |
| 701 | Ga0265336_10000529 | 3300028666 | Bacteria | 22054 |
| 702 | Ga0307517_10031334 | 3300028786 | Bacteria | 6192 |
| 703 | Ga0307515_10122568 | 3300028794 | Bacteria | 2931 |
| 704 | Ga0307515_10184217 | 3300028794 | Bacteria | 2025 |
| 705 | Ga0265338_10000022 | 3300028800 | Bacteria | 308414 |
| 706 | Ga0265338_10001008 | 3300028800 | Bacteria | 47358 |
| 707 | Ga0265338_10028579 | 3300028800 | Bacteria | 5556 |
| 708 | Ga0265324_10000034 | 3300029957 | Bacteria | 124255 |
| 709 | Ga0265324_10000669 | 3300029957 | Bacteria | 23139 |
| 710 | Ga0268256_1000238 | 3300030500 | Bacteria | 57894 |
| 711 | Ga0265760_10002495 | 3300031090 | Bacteria | 5370 |
| 712 | Ga0265332_10005254 | 3300031238 | Bacteria | 5988 |
| 713 | Ga0265320_10023346 | 3300031240 | Bacteria | 3294 |
| 714 | Ga0265325_10000663 | 3300031241 | Bacteria | 25141 |
| 715 | Ga0265325_10003426 | 3300031241 | Bacteria | 10348 |
| 716 | Ga0265331_10003526 | 3300031250 | Bacteria | 10053 |
| 717 | Ga0265331_10006877 | 3300031250 | Bacteria | 6643 |
| 718 | Ga0265331_10040228 | 3300031250 | Bacteria | 2276 |
| 719 | Ga0265327_10000572 | 3300031251 | Bacteria | 62611 |
| 720 | Ga0265327_10000638 | 3300031251 | Bacteria | 56987 |
| 721 | Ga0265327_10001646 | 3300031251 | Bacteria | 26957 |
| 722 | Ga0265327_10002259 | 3300031251 | Bacteria | 20791 |
| 723 | Ga0265316_10039434 | 3300031344 | Bacteria | 3793 |
| 724 | Ga0265316_10155450 | 3300031344 | Bacteria | 1712 |
| 725 | Ga0307513_10088095 | 3300031456 | Bacteria | 3174 |
| 726 | Ga0265313_10000068 | 3300031595 | Bacteria | 100563 |
| 727 | Ga0265313_10006502 | 3300031595 | Bacteria | 8260 |
| 728 | Ga0316575_10000457 | 3300031665 | Bacteria | 11697 |
| 729 | Ga0265314_10001850 | 3300031711 | Bacteria | 22707 |
| 730 | Ga0265314_10058682 | 3300031711 | Bacteria | 2636 |
| 731 | Ga0265314_10074206 | 3300031711 | Bacteria | 2266 |
| 732 | Ga0265314_10074775 | 3300031711 | Bacteria | 2256 |
| 733 | Ga0265342_10007593 | 3300031712 | Bacteria | 7915 |
| 734 | Ga0316576_10017518 | 3300031727 | Bacteria | 4870 |
| 735 | Ga0307516_10000012 | 3300031730 | Bacteria | 224120 |
| 736 | Ga0307412_10000024 | 3300031911 | Bacteria | 235467 |
| 737 | Ga0316583_10000196 | 3300032133 | Bacteria | 15776 |
| 738 | Ga0373953_0079184 | 3300035117 | Bacteria | 1364 |
| 739 | Ga0373960_0006680 | 3300035121 | Bacteria | 2713 |
| 740 | Ga0373943_0223809 | 3300035170 | Bacteria | 1049 |
| 741 | Ga0316574_0010832 | 3300035398 | Bacteria | 5165 |
| 742 | Ga0373924_0110445 | 3300035410 | Bacteria | 1188 |
| 743 | Ga0373927_0000002 | 3300035695 | Bacteria | 966219 |
| 744 | Ga0373927_0023190 | 3300035695 | Bacteria | 4066 |
| 745 | Ga0373937_0090490 | 3300036401 | Bacteria | 2834 |
| 746 | Ga0373937_0349722 | 3300036401 | Bacteria | 1400 |
| 747 | Ga0316584_0019586 | 3300036712 | Bacteria | 4893 |
| 748 | Ga0316584_0019651 | 3300036712 | Bacteria | 4885 |
| 749 | Ga0395899_0000035 | 3300037312 | Bacteria | 295584 |
| 750 | Ga0395899_0000344 | 3300037312 | Bacteria | 57423 |
| 751 | Ga0395899_0002002 | 3300037312 | Bacteria | 16777 |
| 752 | Ga0395899_0002788 | 3300037312 | Bacteria | 14079 |
| 753 | Ga0395899_0010729 | 3300037312 | Bacteria | 7024 |
| 754 | Ga0395899_0014012 | 3300037312 | Bacteria | 6121 |
| 755 | Ga0395899_0040985 | 3300037312 | Bacteria | 3461 |
| 756 | Ga0395899_0087664 | 3300037312 | Bacteria | 2258 |
| 757 | Ga0395900_0000190 | 3300037418 | Bacteria | 98820 |
| 758 | Ga0395900_0000198 | 3300037418 | Bacteria | 94894 |
| 759 | Ga0395900_0001100 | 3300037418 | Bacteria | 34383 |
| 760 | Ga0395900_0001935 | 3300037418 | Bacteria | 23472 |
| 761 | Ga0395900_0007915 | 3300037418 | Bacteria | 10944 |
| 762 | Ga0395900_0015064 | 3300037418 | Bacteria | 7882 |
| 763 | Ga0395900_0018384 | 3300037418 | Bacteria | 7128 |
| 764 | Ga0395900_0026828 | 3300037418 | Bacteria | 5895 |
| 765 | Ga0395900_0044784 | 3300037418 | Bacteria | 4558 |
| 766 | Ga0395900_0088619 | 3300037418 | Bacteria | 3181 |
| 767 | Ga0395900_0118808 | 3300037418 | Bacteria | 2713 |
| 768 | Ga0395900_0211239 | 3300037418 | Bacteria | 1959 |
| 769 | Ga0395898_0000199 | 3300037466 | Bacteria | 154631 |
| 770 | Ga0395898_0000374 | 3300037466 | Bacteria | 98025 |
| 771 | Ga0395898_0016768 | 3300037466 | Bacteria | 7484 |
| 772 | Ga0395898_0059651 | 3300037466 | Bacteria | 3710 |
| 773 | Ga0395898_0115582 | 3300037466 | Bacteria | 2571 |
| 774 | Ga0395898_0176886 | 3300037466 | Bacteria | 2039 |
| 775 | Ga0395898_0228302 | 3300037466 | Bacteria | 1775 |
| 776 | Ga0395905_0000041 | 3300037471 | Bacteria | 250958 |
| 777 | Ga0395905_0001591 | 3300037471 | Bacteria | 27005 |
| 778 | Ga0395905_0009860 | 3300037471 | Bacteria | 9310 |
| 779 | Ga0395905_0016277 | 3300037471 | Bacteria | 7065 |
| 780 | Ga0395905_0085997 | 3300037471 | Bacteria | 2946 |
| 781 | Ga0395905_0105715 | 3300037471 | Bacteria | 2643 |
| 782 | Ga0395905_0139127 | 3300037471 | Bacteria | 2284 |
| 783 | Ga0436364_0817049 | 3300037853 | Bacteria | 1283 |
| 784 | Ga0395901_0000062 | 3300038443 | Bacteria | 150171 |
| 785 | Ga0395901_0000533 | 3300038443 | Bacteria | 43906 |
| 786 | Ga0395901_0001105 | 3300038443 | Bacteria | 28682 |
| 787 | Ga0395901_0001593 | 3300038443 | Bacteria | 23483 |
| 788 | Ga0395901_0002094 | 3300038443 | Bacteria | 20478 |
| 789 | Ga0395901_0015314 | 3300038443 | Bacteria | 7804 |
| 790 | Ga0395901_0055086 | 3300038443 | Bacteria | 4134 |
| 791 | Ga0395901_0187733 | 3300038443 | Bacteria | 2168 |
| 792 | Ga0395901_0196405 | 3300038443 | Bacteria | 2115 |
| 793 | Ga0436365_1589949 | 3300039437 | Bacteria | 1946 |
| 794 | Ga0436361_0598612 | 3300039447 | Bacteria | 13813 |
| 795 | Ga0436361_0695623 | 3300039447 | Bacteria | 37214 |
| 796 | Ga0436361_0836240 | 3300039447 | Bacteria | 2768 |
| 797 | Ga0436361_0900465 | 3300039447 | Bacteria | 24867 |
| 798 | Ga0436361_0904231 | 3300039447 | Bacteria | 1523 |
| 799 | Ga0436361_1196706 | 3300039447 | Bacteria | 36697 |
| 800 | Ga0451843_0123709 | 3300041509 | Bacteria | 2123 |
| 801 | Ga0451853_0053840 | 3300041512 | Bacteria | 1861 |
| 802 | Ga0439448_0000093 | 3300042005 | Bacteria | 16024 |
| 803 | Ga0439448_0033168 | 3300042005 | Bacteria | 1646 |
| 804 | Ga0439455_0010495 | 3300042012 | Bacteria | 2038 |
| 805 | Ga0439458_0007162 | 3300042157 | Bacteria | 2480 |
| 806 | Ga0451577_0000002 | 3300042876 | Bacteria | 1731375 |
| 807 | Ga0451577_0060007 | 3300042876 | Bacteria | 3391 |
| 808 | Ga0451577_0115543 | 3300042876 | Bacteria | 2403 |
| 809 | Ga0451577_0125081 | 3300042876 | Bacteria | 2304 |
| 810 | Ga0466969_0004435 | 3300044656 | Bacteria | 7463 |
| 811 | Ga0466969_0031708 | 3300044656 | Bacteria | 2689 |
| 812 | Ga0466969_0084529 | 3300044656 | Bacteria | 1510 |
| 813 | Ga0466972_0000070 | 3300044658 | Bacteria | 100242 |
| 814 | Ga0466972_0012234 | 3300044658 | Bacteria | 4314 |
| 815 | Ga0466972_0017028 | 3300044658 | Bacteria | 3636 |
| 816 | Ga0466972_0036629 | 3300044658 | Bacteria | 2399 |
| 817 | Ga0453683_0000003 | 3300044673 | Bacteria | 942572 |
| 818 | Ga0466965_0000058 | 3300044683 | Bacteria | 36392 |
| 819 | Ga0466965_0008647 | 3300044683 | Bacteria | 4711 |
| 820 | Ga0466965_0034770 | 3300044683 | Bacteria | 2466 |
| 821 | Ga0466966_0001378 | 3300044684 | Bacteria | 15639 |
| 822 | Ga0466966_0021502 | 3300044684 | Bacteria | 4236 |
| 823 | Ga0466966_0046014 | 3300044684 | Bacteria | 2788 |
| 824 | Ga0466966_0149103 | 3300044684 | Bacteria | 1427 |
| 825 | Ga0466961_0000830 | 3300044693 | Bacteria | 19308 |
| 826 | Ga0466961_0004504 | 3300044693 | Bacteria | 8736 |
| 827 | Ga0466961_0014767 | 3300044693 | Bacteria | 5017 |
| 828 | Ga0466963_0001295 | 3300044694 | Bacteria | 13287 |
| 829 | Ga0466963_0015296 | 3300044694 | Bacteria | 4747 |
| 830 | Ga0466963_0020392 | 3300044694 | Bacteria | 4168 |
| 831 | Ga0466964_0000748 | 3300044706 | Bacteria | 10556 |
| 832 | Ga0453684_0000002 | 3300044712 | Bacteria | 1731375 |
| 833 | Ga0466971_0001966 | 3300044719 | Bacteria | 8702 |
| 834 | Ga0466968_0004778 | 3300044735 | Bacteria | 5071 |
| 835 | Ga0466968_0006364 | 3300044735 | Bacteria | 4447 |
| 836 | Ga0466968_0047003 | 3300044735 | Bacteria | 1834 |
| 837 | Ga0466970_0002802 | 3300044765 | Bacteria | 8418 |
| 838 | Ga0466970_0070017 | 3300044765 | Bacteria | 1886 |
| 839 | Ga0466957_0000140 | 3300044842 | Bacteria | 31164 |
| 840 | Ga0466957_0003144 | 3300044842 | Bacteria | 8992 |
| 841 | Ga0466957_0008820 | 3300044842 | Bacteria | 5742 |
| 842 | Ga0466957_0038666 | 3300044842 | Bacteria | 2875 |
| 843 | Ga0466957_0091231 | 3300044842 | Bacteria | 1909 |
| 844 | Ga0466959_0000387 | 3300045049 | Bacteria | 26018 |
| 845 | Ga0466959_0014205 | 3300045049 | Bacteria | 5778 |
| 846 | Ga0466959_0026242 | 3300045049 | Bacteria | 4318 |
| 847 | Ga0466959_0026333 | 3300045049 | Bacteria | 4310 |
| 848 | Ga0466959_0047272 | 3300045049 | Bacteria | 3165 |
| 849 | Ga0466959_0063245 | 3300045049 | Bacteria | 2687 |
| 850 | Ga0451576_0001215 | 3300045051 | Bacteria | 45894 |
| 851 | Ga0466958_0001550 | 3300045836 | Bacteria | 11007 |
| 852 | Ga0466958_0005578 | 3300045836 | Bacteria | 6786 |
| 853 | Ga0466958_0027829 | 3300045836 | Bacteria | 3346 |
| 854 | Ga0466967_0093791 | 3300045976 | Bacteria | 2732 |
| 855 | Ga0466967_0148667 | 3300045976 | Bacteria | 2187 |
| 856 | Ga0495617_000029 | 3300046452 | Bacteria | 153239 |
| 857 | Ga0495617_000049 | 3300046452 | Bacteria | 113032 |
| 858 | Ga0495617_002469 | 3300046452 | Bacteria | 7345 |
| 859 | Ga0495617_003907 | 3300046452 | Bacteria | 5491 |
| 860 | Ga0495627_000243 | 3300046453 | Bacteria | 57215 |
| 861 | Ga0495627_014622 | 3300046453 | Bacteria | 2733 |
| 862 | Ga0495627_044236 | 3300046453 | Bacteria | 1359 |
| 863 | Ga0495592_0001143 | 3300046454 | Bacteria | 18460 |
| 864 | Ga0495592_0021865 | 3300046454 | Bacteria | 4867 |
| 865 | Ga0495603_0007272 | 3300046455 | Bacteria | 6652 |
| 866 | Ga0495603_0030796 | 3300046455 | Bacteria | 3231 |
| 867 | Ga0495603_0032291 | 3300046455 | Bacteria | 3150 |
| 868 | Ga0495590_0000003 | 3300046457 | Bacteria | 478593 |
| 869 | Ga0495590_0000071 | 3300046457 | Bacteria | 71082 |
| 870 | Ga0495590_0000520 | 3300046457 | Bacteria | 18634 |
| 871 | Ga0495590_0002164 | 3300046457 | Bacteria | 8236 |
| 872 | Ga0495590_0016567 | 3300046457 | Bacteria | 2660 |
| 873 | Ga0495590_0020173 | 3300046457 | Bacteria | 2369 |
| 874 | Ga0495591_000302 | 3300046458 | Bacteria | 45128 |
| 875 | Ga0495591_010370 | 3300046458 | Bacteria | 3618 |
| 876 | Ga0495629_0001179 | 3300046459 | Bacteria | 20626 |
| 877 | Ga0495629_0002054 | 3300046459 | Bacteria | 15654 |
| 878 | Ga0495629_0016485 | 3300046459 | Bacteria | 5303 |
| 879 | Ga0495629_0021355 | 3300046459 | Bacteria | 4620 |
| 880 | Ga0495629_0038980 | 3300046459 | Bacteria | 3346 |
| 881 | Ga0495638_0000091 | 3300046460 | Bacteria | 146548 |
| 882 | Ga0495638_0003603 | 3300046460 | Bacteria | 12113 |
| 883 | Ga0495638_0022951 | 3300046460 | Bacteria | 4089 |
| 884 | Ga0495638_0044764 | 3300046460 | Bacteria | 2787 |
| 885 | Ga0495638_0066869 | 3300046460 | Bacteria | 2208 |
| 886 | Ga0495651_0004530 | 3300046462 | Bacteria | 10628 |
| 887 | Ga0495651_0033766 | 3300046462 | Bacteria | 3990 |
| 888 | Ga0495651_0061436 | 3300046462 | Bacteria | 2875 |
| 889 | Ga0495653_0000013 | 3300046463 | Bacteria | 250453 |
| 890 | Ga0495653_0011174 | 3300046463 | Bacteria | 7341 |
| 891 | Ga0495653_0014977 | 3300046463 | Bacteria | 6324 |
| 892 | Ga0495653_0026309 | 3300046463 | Bacteria | 4666 |
| 893 | Ga0495653_0032069 | 3300046463 | Bacteria | 4175 |
| 894 | Ga0495653_0039805 | 3300046463 | Bacteria | 3679 |
| 895 | Ga0495653_0050022 | 3300046463 | Bacteria | 3215 |
| 896 | Ga0495650_0000011 | 3300046471 | Bacteria | 615329 |
| 897 | Ga0495650_0000051 | 3300046471 | Bacteria | 318297 |
| 898 | Ga0495650_0000097 | 3300046471 | Bacteria | 216051 |
| 899 | Ga0495650_0000314 | 3300046471 | Bacteria | 86867 |
| 900 | Ga0495650_0000343 | 3300046471 | Bacteria | 83112 |
| 901 | Ga0495650_0000928 | 3300046471 | Bacteria | 34124 |
| 902 | Ga0495650_0002256 | 3300046471 | Bacteria | 16114 |
| 903 | Ga0495650_0003703 | 3300046471 | Bacteria | 10947 |
| 904 | Ga0495650_0007227 | 3300046471 | Bacteria | 6727 |
| 905 | Ga0495650_0008161 | 3300046471 | Bacteria | 6161 |
| 906 | Ga0495650_0012542 | 3300046471 | Bacteria | 4552 |
| 907 | Ga0495650_0014413 | 3300046471 | Bacteria | 4116 |
| 908 | Ga0495650_0022575 | 3300046471 | Bacteria | 3015 |
| 909 | Ga0495580_0001176 | 3300046472 | Bacteria | 23020 |
| 910 | Ga0495580_0018947 | 3300046472 | Bacteria | 5119 |
| 911 | Ga0495580_0021175 | 3300046472 | Bacteria | 4800 |
| 912 | Ga0495580_0030459 | 3300046472 | Bacteria | 3907 |
| 913 | Ga0495580_0089451 | 3300046472 | Bacteria | 2143 |
| 914 | Ga0495580_0095561 | 3300046472 | Bacteria | 2067 |
| 915 | Ga0495580_0104952 | 3300046472 | Bacteria | 1963 |
| 916 | Ga0495582_0004931 | 3300046473 | Bacteria | 7481 |
| 917 | Ga0495582_0011386 | 3300046473 | Bacteria | 4901 |
| 918 | Ga0495582_0045514 | 3300046473 | Bacteria | 2417 |
| 919 | Ga0495605_0000234 | 3300046474 | Bacteria | 68169 |
| 920 | Ga0495605_0000251 | 3300046474 | Bacteria | 63553 |
| 921 | Ga0495605_0005192 | 3300046474 | Bacteria | 7590 |
| 922 | Ga0495605_0005507 | 3300046474 | Bacteria | 7370 |
| 923 | Ga0495605_0006769 | 3300046474 | Bacteria | 6550 |
| 924 | Ga0495605_0007871 | 3300046474 | Bacteria | 6032 |
| 925 | Ga0495605_0008862 | 3300046474 | Bacteria | 5672 |
| 926 | Ga0495605_0018518 | 3300046474 | Bacteria | 3732 |
| 927 | Ga0495605_0037474 | 3300046474 | Bacteria | 2438 |
| 928 | Ga0495605_0041092 | 3300046474 | Bacteria | 2304 |
| 929 | Ga0495605_0042368 | 3300046474 | Bacteria | 2263 |
| 930 | Ga0495639_0039762 | 3300046475 | Bacteria | 2115 |
| 931 | Ga0495639_0074782 | 3300046475 | Bacteria | 1570 |
| 932 | Ga0495664_0015882 | 3300046477 | Bacteria | 4284 |
| 933 | Ga0495664_0085430 | 3300046477 | Bacteria | 1894 |
| 934 | Ga0495584_0000008 | 3300046491 | Bacteria | 283067 |
| 935 | Ga0495584_0000155 | 3300046491 | Bacteria | 47880 |
| 936 | Ga0495584_0002111 | 3300046491 | Bacteria | 11382 |
| 937 | Ga0495584_0002139 | 3300046491 | Bacteria | 11293 |
| 938 | Ga0495584_0003852 | 3300046491 | Bacteria | 8139 |
| 939 | Ga0495584_0007277 | 3300046491 | Bacteria | 5773 |
| 940 | Ga0495584_0021584 | 3300046491 | Bacteria | 3270 |
| 941 | Ga0495584_0035140 | 3300046491 | Bacteria | 2533 |
| 942 | Ga0495584_0046173 | 3300046491 | Bacteria | 2197 |
| 943 | Ga0495585_0000139 | 3300046492 | Bacteria | 79372 |
| 944 | Ga0495585_0000285 | 3300046492 | Bacteria | 50703 |
| 945 | Ga0495585_0001306 | 3300046492 | Bacteria | 19875 |
| 946 | Ga0495585_0001720 | 3300046492 | Bacteria | 16677 |
| 947 | Ga0495585_0005485 | 3300046492 | Bacteria | 7986 |
| 948 | Ga0495585_0008284 | 3300046492 | Bacteria | 6310 |
| 949 | Ga0495585_0013629 | 3300046492 | Bacteria | 4753 |
| 950 | Ga0495585_0022115 | 3300046492 | Bacteria | 3650 |
| 951 | Ga0495585_0045464 | 3300046492 | Bacteria | 2450 |
| 952 | Ga0495585_0045747 | 3300046492 | Bacteria | 2442 |
| 953 | Ga0495585_0057009 | 3300046492 | Bacteria | 2156 |
| 954 | Ga0495585_0072560 | 3300046492 | Bacteria | 1875 |
| 955 | Ga0495594_0003334 | 3300046499 | Bacteria | 8303 |
| 956 | Ga0495594_0059105 | 3300046499 | Bacteria | 2119 |
| 957 | Ga0495594_0180999 | 3300046499 | Bacteria | 1200 |
| 958 | Ga0495596_0000533 | 3300046500 | Bacteria | 23909 |
| 959 | Ga0495596_0000734 | 3300046500 | Bacteria | 20197 |
| 960 | Ga0495596_0002070 | 3300046500 | Bacteria | 11022 |
| 961 | Ga0495596_0004202 | 3300046500 | Bacteria | 7073 |
| 962 | Ga0495596_0006292 | 3300046500 | Bacteria | 5488 |
| 963 | Ga0495596_0007656 | 3300046500 | Bacteria | 4857 |
| 964 | Ga0495596_0008125 | 3300046500 | Bacteria | 4685 |
| 965 | Ga0495596_0013632 | 3300046500 | Bacteria | 3440 |
| 966 | Ga0495596_0015649 | 3300046500 | Bacteria | 3170 |
| 967 | Ga0495596_0026109 | 3300046500 | Bacteria | 2355 |
| 968 | Ga0495607_0005443 | 3300046501 | Bacteria | 9112 |
| 969 | Ga0495607_0008143 | 3300046501 | Bacteria | 7189 |
| 970 | Ga0495607_0009072 | 3300046501 | Bacteria | 6759 |
| 971 | Ga0495607_0011726 | 3300046501 | Bacteria | 5816 |
| 972 | Ga0495607_0015950 | 3300046501 | Bacteria | 4857 |
| 973 | Ga0495607_0018697 | 3300046501 | Bacteria | 4411 |
| 974 | Ga0495607_0033307 | 3300046501 | Bacteria | 3136 |
| 975 | Ga0495607_0035729 | 3300046501 | Bacteria | 3003 |
| 976 | Ga0495607_0052196 | 3300046501 | Bacteria | 2369 |
| 977 | Ga0495607_0133794 | 3300046501 | Bacteria | 1286 |
| 978 | Ga0495607_0138793 | 3300046501 | Bacteria | 1256 |
| 979 | Ga0495583_0000068 | 3300046506 | Bacteria | 188922 |
| 980 | Ga0495583_0000197 | 3300046506 | Bacteria | 101236 |
| 981 | Ga0495583_0000232 | 3300046506 | Bacteria | 93029 |
| 982 | Ga0495583_0000280 | 3300046506 | Bacteria | 82145 |
| 983 | Ga0495583_0000568 | 3300046506 | Bacteria | 51044 |
| 984 | Ga0495583_0023503 | 3300046506 | Bacteria | 3116 |
| 985 | Ga0495606_0000141 | 3300046507 | Bacteria | 123586 |
| 986 | Ga0495606_0000266 | 3300046507 | Bacteria | 92444 |
| 987 | Ga0495606_0000935 | 3300046507 | Bacteria | 43005 |
| 988 | Ga0495606_0006074 | 3300046507 | Bacteria | 11285 |
| 989 | Ga0495606_0007191 | 3300046507 | Bacteria | 10042 |
| 990 | Ga0495606_0008896 | 3300046507 | Bacteria | 8602 |
| 991 | Ga0495606_0011924 | 3300046507 | Bacteria | 7030 |
| 992 | Ga0495606_0011964 | 3300046507 | Bacteria | 7011 |
| 993 | Ga0495606_0013174 | 3300046507 | Bacteria | 6561 |
| 994 | Ga0495606_0013999 | 3300046507 | Bacteria | 6289 |
| 995 | Ga0495606_0022484 | 3300046507 | Bacteria | 4593 |
| 996 | Ga0495606_0023201 | 3300046507 | Bacteria | 4503 |
| 997 | Ga0495606_0026282 | 3300046507 | Bacteria | 4151 |
| 998 | Ga0495606_0028934 | 3300046507 | Bacteria | 3899 |
| 999 | Ga0495606_0050067 | 3300046507 | Bacteria | 2735 |
| 1000 | Ga0495606_0062689 | 3300046507 | Bacteria | 2372 |
| 1001 | Ga0495606_0065767 | 3300046507 | Bacteria | 2302 |
| 1002 | Ga0495606_0073876 | 3300046507 | Bacteria | 2137 |
| 1003 | Ga0495608_0000766 | 3300046511 | Bacteria | 22480 |
| 1004 | Ga0495608_0005430 | 3300046511 | Bacteria | 9114 |
| 1005 | Ga0495608_0021182 | 3300046511 | Bacteria | 4462 |
| 1006 | Ga0495608_0046988 | 3300046511 | Bacteria | 2871 |
| 1007 | Ga0495610_0000003 | 3300046512 | Bacteria | 1203910 |
| 1008 | Ga0495610_0000715 | 3300046512 | Bacteria | 31576 |
| 1009 | Ga0495610_0002557 | 3300046512 | Bacteria | 15140 |
| 1010 | Ga0495610_0009229 | 3300046512 | Bacteria | 6258 |
| 1011 | Ga0495610_0010336 | 3300046512 | Bacteria | 5811 |
| 1012 | Ga0495610_0011374 | 3300046512 | Bacteria | 5447 |
| 1013 | Ga0495610_0015506 | 3300046512 | Bacteria | 4424 |
| 1014 | Ga0495610_0023467 | 3300046512 | Bacteria | 3352 |
| 1015 | Ga0495610_0034995 | 3300046512 | Bacteria | 2582 |
| 1016 | Ga0495616_0000173 | 3300046513 | Bacteria | 54951 |
| 1017 | Ga0495616_0001567 | 3300046513 | Bacteria | 15760 |
| 1018 | Ga0495616_0001770 | 3300046513 | Bacteria | 14699 |
| 1019 | Ga0495616_0003040 | 3300046513 | Bacteria | 10864 |
| 1020 | Ga0495616_0016379 | 3300046513 | Bacteria | 4104 |
| 1021 | Ga0495616_0016824 | 3300046513 | Bacteria | 4040 |
| 1022 | Ga0495616_0038980 | 3300046513 | Bacteria | 2436 |
| 1023 | Ga0495616_0040056 | 3300046513 | Bacteria | 2396 |
| 1024 | Ga0495616_0046662 | 3300046513 | Bacteria | 2185 |
| 1025 | Ga0495616_0094047 | 3300046513 | Bacteria | 1414 |
| 1026 | Ga0495618_0004670 | 3300046514 | Bacteria | 8378 |
| 1027 | Ga0495618_0018606 | 3300046514 | Bacteria | 4266 |
| 1028 | Ga0495620_0003682 | 3300046515 | Bacteria | 8753 |
| 1029 | Ga0495620_0021159 | 3300046515 | Bacteria | 3163 |
| 1030 | Ga0495628_0006004 | 3300046516 | Bacteria | 10624 |
| 1031 | Ga0495628_0015479 | 3300046516 | Bacteria | 6370 |
| 1032 | Ga0495628_0044665 | 3300046516 | Bacteria | 3523 |
| 1033 | Ga0495628_0054760 | 3300046516 | Bacteria | 3144 |
| 1034 | Ga0495628_0097516 | 3300046516 | Bacteria | 2271 |
| 1035 | Ga0495630_0001572 | 3300046517 | Bacteria | 15867 |
| 1036 | Ga0495630_0005461 | 3300046517 | Bacteria | 8979 |
| 1037 | Ga0495630_0345795 | 3300046517 | Bacteria | 1138 |
| 1038 | Ga0495631_0000103 | 3300046518 | Bacteria | 55680 |
| 1039 | Ga0495631_0002483 | 3300046518 | Bacteria | 10381 |
| 1040 | Ga0495631_0014124 | 3300046518 | Bacteria | 3859 |
| 1041 | Ga0495631_0018497 | 3300046518 | Bacteria | 3278 |
| 1042 | Ga0495631_0035003 | 3300046518 | Bacteria | 2248 |
| 1043 | Ga0495631_0058114 | 3300046518 | Bacteria | 1682 |
| 1044 | Ga0495632_0000063 | 3300046519 | Bacteria | 117984 |
| 1045 | Ga0495632_0000461 | 3300046519 | Bacteria | 38731 |
| 1046 | Ga0495632_0001335 | 3300046519 | Bacteria | 20726 |
| 1047 | Ga0495632_0001954 | 3300046519 | Bacteria | 16450 |
| 1048 | Ga0495632_0006624 | 3300046519 | Bacteria | 7410 |
| 1049 | Ga0495632_0010421 | 3300046519 | Bacteria | 5507 |
| 1050 | Ga0495632_0012834 | 3300046519 | Bacteria | 4807 |
| 1051 | Ga0495632_0045115 | 3300046519 | Bacteria | 2197 |
| 1052 | Ga0495637_0000004 | 3300046520 | Bacteria | 589740 |
| 1053 | Ga0495637_0000087 | 3300046520 | Bacteria | 72113 |
| 1054 | Ga0495637_0000443 | 3300046520 | Bacteria | 30281 |
| 1055 | Ga0495637_0000715 | 3300046520 | Bacteria | 22720 |
| 1056 | Ga0495637_0020601 | 3300046520 | Bacteria | 3032 |
| 1057 | Ga0495637_0035761 | 3300046520 | Bacteria | 2167 |
| 1058 | Ga0495643_0000179 | 3300046522 | Bacteria | 100406 |
| 1059 | Ga0495643_0000194 | 3300046522 | Bacteria | 96362 |
| 1060 | Ga0495643_0001483 | 3300046522 | Bacteria | 21369 |
| 1061 | Ga0495643_0003103 | 3300046522 | Bacteria | 12434 |
| 1062 | Ga0495643_0007505 | 3300046522 | Bacteria | 7017 |
| 1063 | Ga0495643_0011094 | 3300046522 | Bacteria | 5507 |
| 1064 | Ga0495643_0016657 | 3300046522 | Bacteria | 4315 |
| 1065 | Ga0495643_0018118 | 3300046522 | Bacteria | 4100 |
| 1066 | Ga0495643_0036164 | 3300046522 | Bacteria | 2714 |
| 1067 | Ga0495643_0047896 | 3300046522 | Bacteria | 2312 |
| 1068 | Ga0495644_0005431 | 3300046523 | Bacteria | 4978 |
| 1069 | Ga0495644_0019647 | 3300046523 | Bacteria | 2579 |
| 1070 | Ga0495644_0020261 | 3300046523 | Bacteria | 2537 |
| 1071 | Ga0495648_0000030 | 3300046524 | Bacteria | 216178 |
| 1072 | Ga0495648_0000058 | 3300046524 | Bacteria | 156717 |
| 1073 | Ga0495648_0000288 | 3300046524 | Bacteria | 57183 |
| 1074 | Ga0495648_0006444 | 3300046524 | Bacteria | 9581 |
| 1075 | Ga0495648_0020957 | 3300046524 | Bacteria | 4544 |
| 1076 | Ga0495648_0022571 | 3300046524 | Bacteria | 4327 |
| 1077 | Ga0495648_0022599 | 3300046524 | Bacteria | 4324 |
| 1078 | Ga0495648_0026542 | 3300046524 | Bacteria | 3896 |
| 1079 | Ga0495648_0033671 | 3300046524 | Bacteria | 3343 |
| 1080 | Ga0495648_0040603 | 3300046524 | Bacteria | 2948 |
| 1081 | Ga0495648_0041119 | 3300046524 | Bacteria | 2923 |
| 1082 | Ga0495648_0051313 | 3300046524 | Bacteria | 2514 |
| 1083 | Ga0495648_0087272 | 3300046524 | Bacteria | 1757 |
| 1084 | Ga0495663_0016751 | 3300046525 | Bacteria | 2073 |
| 1085 | Ga0495663_0046117 | 3300046525 | Bacteria | 1338 |
| 1086 | Ga0495666_0001341 | 3300046526 | Bacteria | 11928 |
| 1087 | Ga0495666_0001622 | 3300046526 | Bacteria | 11086 |
| 1088 | Ga0495666_0006371 | 3300046526 | Bacteria | 5943 |
| 1089 | Ga0495666_0007801 | 3300046526 | Bacteria | 5358 |
| 1090 | Ga0495666_0065341 | 3300046526 | Bacteria | 1735 |
| 1091 | Ga0495642_0000038 | 3300046528 | Bacteria | 79256 |
| 1092 | Ga0495642_0001686 | 3300046528 | Bacteria | 9566 |
| 1093 | Ga0495642_0001822 | 3300046528 | Bacteria | 9120 |
| 1094 | Ga0495642_0007379 | 3300046528 | Bacteria | 4216 |
| 1095 | Ga0495642_0022419 | 3300046528 | Bacteria | 2488 |
| 1096 | Ga0495642_0028452 | 3300046528 | Bacteria | 2227 |
| 1097 | Ga0495642_0035911 | 3300046528 | Bacteria | 2002 |
| 1098 | Ga0495642_0037192 | 3300046528 | Bacteria | 1969 |
| 1099 | Ga0495642_0090471 | 3300046528 | Bacteria | 1295 |
| 1100 | Ga0495642_0104510 | 3300046528 | Bacteria | 1208 |
| 1101 | Ga0495652_0003591 | 3300046529 | Bacteria | 15216 |
| 1102 | Ga0495652_0034086 | 3300046529 | Bacteria | 4439 |
| 1103 | Ga0495652_0050830 | 3300046529 | Bacteria | 3542 |
| 1104 | Ga0495652_0083324 | 3300046529 | Bacteria | 2632 |
| 1105 | Ga0495652_0118635 | 3300046529 | Bacteria | 2114 |
| 1106 | Ga0495652_0152421 | 3300046529 | Bacteria | 1804 |
| 1107 | Ga0495654_0000002 | 3300046530 | Bacteria | 1021205 |
| 1108 | Ga0495654_0000074 | 3300046530 | Bacteria | 114325 |
| 1109 | Ga0495654_0001298 | 3300046530 | Bacteria | 17498 |
| 1110 | Ga0495654_0009807 | 3300046530 | Bacteria | 5233 |
| 1111 | Ga0495654_0012668 | 3300046530 | Bacteria | 4527 |
| 1112 | Ga0495654_0048366 | 3300046530 | Bacteria | 2087 |
| 1113 | Ga0495654_0050608 | 3300046530 | Bacteria | 2029 |
| 1114 | Ga0495665_0002821 | 3300046531 | Bacteria | 9374 |
| 1115 | Ga0495665_0004778 | 3300046531 | Bacteria | 7316 |
| 1116 | Ga0495665_0015085 | 3300046531 | Bacteria | 4164 |
| 1117 | Ga0495665_0022696 | 3300046531 | Bacteria | 3371 |
| 1118 | Ga0495640_0000384 | 3300046533 | Bacteria | 31361 |
| 1119 | Ga0495586_0000938 | 3300046535 | Bacteria | 16544 |
| 1120 | Ga0495586_0002348 | 3300046535 | Bacteria | 10296 |
| 1121 | Ga0495586_0004178 | 3300046535 | Bacteria | 7736 |
| 1122 | Ga0495586_0037866 | 3300046535 | Bacteria | 2589 |
| 1123 | Ga0495586_0038223 | 3300046535 | Bacteria | 2576 |
| 1124 | Ga0495587_0013822 | 3300046536 | Bacteria | 5071 |
| 1125 | Ga0495598_0048790 | 3300046537 | Bacteria | 1267 |
| 1126 | Ga0495609_0000021 | 3300046538 | Bacteria | 281770 |
| 1127 | Ga0495609_0003555 | 3300046538 | Bacteria | 8886 |
| 1128 | Ga0495609_0003830 | 3300046538 | Bacteria | 8463 |
| 1129 | Ga0495609_0009073 | 3300046538 | Bacteria | 4832 |
| 1130 | Ga0495609_0009412 | 3300046538 | Bacteria | 4729 |
| 1131 | Ga0495609_0022200 | 3300046538 | Bacteria | 2924 |
| 1132 | Ga0495609_0025432 | 3300046538 | Bacteria | 2714 |
| 1133 | Ga0495609_0039336 | 3300046538 | Bacteria | 2129 |
| 1134 | Ga0495597_0001756 | 3300046542 | Bacteria | 14923 |
| 1135 | Ga0495597_0002353 | 3300046542 | Bacteria | 12173 |
| 1136 | Ga0495597_0002945 | 3300046542 | Bacteria | 10328 |
| 1137 | Ga0495597_0003156 | 3300046542 | Bacteria | 9858 |
| 1138 | Ga0495597_0004756 | 3300046542 | Bacteria | 7346 |
| 1139 | Ga0495597_0005049 | 3300046542 | Bacteria | 7062 |
| 1140 | Ga0495597_0007908 | 3300046542 | Bacteria | 5359 |
| 1141 | Ga0495597_0009349 | 3300046542 | Bacteria | 4847 |
| 1142 | Ga0495597_0013813 | 3300046542 | Bacteria | 3860 |
| 1143 | Ga0495597_0014016 | 3300046542 | Bacteria | 3828 |
| 1144 | Ga0495597_0024876 | 3300046542 | Bacteria | 2760 |
| 1145 | Ga0495645_0006284 | 3300046543 | Bacteria | 8238 |
| 1146 | Ga0495645_0025686 | 3300046543 | Bacteria | 4277 |
| 1147 | Ga0495645_0036985 | 3300046543 | Bacteria | 3557 |
| 1148 | Ga0495645_0078869 | 3300046543 | Bacteria | 2366 |
| 1149 | Ga0495645_0120509 | 3300046543 | Bacteria | 1847 |
| 1150 | Ga0495645_0143827 | 3300046543 | Bacteria | 1662 |
| 1151 | Ga0495622_0000054 | 3300046557 | Bacteria | 102782 |
| 1152 | Ga0495622_0001760 | 3300046557 | Bacteria | 10690 |
| 1153 | Ga0495622_0001770 | 3300046557 | Bacteria | 10654 |
| 1154 | Ga0495633_0000119 | 3300046558 | Bacteria | 106455 |
| 1155 | Ga0495633_0000249 | 3300046558 | Bacteria | 64232 |
| 1156 | Ga0495633_0003574 | 3300046558 | Bacteria | 10280 |
| 1157 | Ga0495633_0004345 | 3300046558 | Bacteria | 9047 |
| 1158 | Ga0495633_0005254 | 3300046558 | Bacteria | 7985 |
| 1159 | Ga0495633_0006155 | 3300046558 | Bacteria | 7173 |
| 1160 | Ga0495633_0007353 | 3300046558 | Bacteria | 6347 |
| 1161 | Ga0495633_0008446 | 3300046558 | Bacteria | 5794 |
| 1162 | Ga0495633_0013888 | 3300046558 | Bacteria | 4223 |
| 1163 | Ga0495633_0023469 | 3300046558 | Bacteria | 3056 |
| 1164 | Ga0495633_0040011 | 3300046558 | Bacteria | 2235 |
| 1165 | Ga0495667_0003921 | 3300046559 | Bacteria | 9985 |
| 1166 | Ga0495656_0009208 | 3300046615 | Bacteria | 3546 |
| 1167 | Ga0495656_0059394 | 3300046615 | Bacteria | 1663 |
| 1168 | Ga0495668_0000383 | 3300046616 | Bacteria | 58324 |
| 1169 | Ga0495668_0000466 | 3300046616 | Bacteria | 51377 |
| 1170 | Ga0495668_0000935 | 3300046616 | Bacteria | 32582 |
| 1171 | Ga0495668_0000980 | 3300046616 | Bacteria | 31179 |
| 1172 | Ga0495668_0005855 | 3300046616 | Bacteria | 8202 |
| 1173 | Ga0495668_0006288 | 3300046616 | Bacteria | 7824 |
| 1174 | Ga0495668_0007471 | 3300046616 | Bacteria | 6982 |
| 1175 | Ga0495668_0031332 | 3300046616 | Bacteria | 2997 |
| 1176 | Ga0495634_0008233 | 3300046642 | Bacteria | 7776 |
| 1177 | Ga0495634_0038246 | 3300046642 | Bacteria | 3272 |
| 1178 | Ga0495634_0048583 | 3300046642 | Bacteria | 2856 |
| 1179 | Ga0495634_0106643 | 3300046642 | Bacteria | 1805 |
| 1180 | Ga0495611_0000517 | 3300046648 | Bacteria | 22920 |
| 1181 | Ga0495611_0001481 | 3300046648 | Bacteria | 11663 |
| 1182 | Ga0495611_0002945 | 3300046648 | Bacteria | 7585 |
| 1183 | Ga0495611_0018088 | 3300046648 | Bacteria | 3020 |
| 1184 | Ga0495611_0030436 | 3300046648 | Bacteria | 2373 |
| 1185 | Ga0495611_0035916 | 3300046648 | Bacteria | 2197 |
| 1186 | Ga0495611_0120214 | 3300046648 | Bacteria | 1225 |
| 1187 | Ga0495625_0000132 | 3300046660 | Bacteria | 115728 |
| 1188 | Ga0495625_0000139 | 3300046660 | Bacteria | 112271 |
| 1189 | Ga0495625_0005799 | 3300046660 | Bacteria | 11158 |
| 1190 | Ga0495625_0006766 | 3300046660 | Bacteria | 10146 |
| 1191 | Ga0495625_0038343 | 3300046660 | Bacteria | 3509 |
| 1192 | Ga0495625_0039103 | 3300046660 | Bacteria | 3466 |
| 1193 | Ga0495625_0068948 | 3300046660 | Bacteria | 2485 |
| 1194 | Ga0495625_0120043 | 3300046660 | Bacteria | 1790 |
| 1195 | Ga0495625_0203433 | 3300046660 | Bacteria | 1305 |
| 1196 | Ga0495635_0021073 | 3300046663 | Bacteria | 4542 |
| 1197 | Ga0495635_0091593 | 3300046663 | Bacteria | 2079 |
| 1198 | Ga0495659_0053244 | 3300046664 | Bacteria | 1478 |
| 1199 | Ga0495661_0000052 | 3300046665 | Bacteria | 140244 |
| 1200 | Ga0495661_0009467 | 3300046665 | Bacteria | 6686 |
| 1201 | Ga0495661_0010711 | 3300046665 | Bacteria | 6245 |
| 1202 | Ga0495661_0012664 | 3300046665 | Bacteria | 5692 |
| 1203 | Ga0495661_0014126 | 3300046665 | Bacteria | 5350 |
| 1204 | Ga0495661_0014206 | 3300046665 | Bacteria | 5335 |
| 1205 | Ga0495661_0018018 | 3300046665 | Bacteria | 4651 |
| 1206 | Ga0495661_0026257 | 3300046665 | Bacteria | 3752 |
| 1207 | Ga0495661_0037177 | 3300046665 | Bacteria | 3041 |
| 1208 | Ga0495661_0040145 | 3300046665 | Bacteria | 2904 |
| 1209 | Ga0495661_0043388 | 3300046665 | Bacteria | 2764 |
| 1210 | Ga0495661_0051066 | 3300046665 | Bacteria | 2499 |
| 1211 | Ga0495661_0064886 | 3300046665 | Bacteria | 2152 |
| 1212 | Ga0495588_0000083 | 3300046674 | Bacteria | 197018 |
| 1213 | Ga0495588_0047810 | 3300046674 | Bacteria | 2197 |
| 1214 | Ga0495588_0083697 | 3300046674 | Bacteria | 1666 |
| 1215 | Ga0495588_0089115 | 3300046674 | Bacteria | 1615 |
| 1216 | Ga0495599_0001313 | 3300046678 | Bacteria | 14157 |
| 1217 | Ga0495599_0003110 | 3300046678 | Bacteria | 9670 |
| 1218 | Ga0495599_0018809 | 3300046678 | Bacteria | 4306 |
| 1219 | Ga0495623_0012947 | 3300046679 | Bacteria | 5399 |
| 1220 | Ga0495623_0123122 | 3300046679 | Bacteria | 1559 |
| 1221 | Ga0495646_0002069 | 3300046680 | Bacteria | 12169 |
| 1222 | Ga0495646_0008027 | 3300046680 | Bacteria | 6710 |
| 1223 | Ga0495658_0048770 | 3300046683 | Bacteria | 2389 |
| 1224 | Ga0495658_0165545 | 3300046683 | Bacteria | 1366 |
| 1225 | Ga0495669_0000086 | 3300046684 | Bacteria | 61977 |
| 1226 | Ga0495669_0000734 | 3300046684 | Bacteria | 14179 |
| 1227 | Ga0495669_0018994 | 3300046684 | Bacteria | 2963 |
| 1228 | Ga0495669_0019307 | 3300046684 | Bacteria | 2941 |
| 1229 | Ga0495669_0037863 | 3300046684 | Bacteria | 2135 |
| 1230 | Ga0495669_0103976 | 3300046684 | Bacteria | 1321 |
| 1231 | Ga0495613_0005741 | 3300046689 | Bacteria | 9297 |
| 1232 | Ga0495613_0018060 | 3300046689 | Bacteria | 5255 |
| 1233 | Ga0495613_0032254 | 3300046689 | Bacteria | 3890 |
| 1234 | Ga0495613_0040133 | 3300046689 | Bacteria | 3469 |
| 1235 | Ga0495624_0002244 | 3300046690 | Bacteria | 14729 |
| 1236 | Ga0495624_0021769 | 3300046690 | Bacteria | 4248 |
| 1237 | Ga0495624_0034973 | 3300046690 | Bacteria | 3246 |
| 1238 | Ga0495624_0047581 | 3300046690 | Bacteria | 2725 |
| 1239 | Ga0495624_0076277 | 3300046690 | Bacteria | 2080 |
| 1240 | Ga0495624_0095406 | 3300046690 | Bacteria | 1833 |
| 1241 | Ga0495624_0105223 | 3300046690 | Bacteria | 1736 |
| 1242 | Ga0495670_0003781 | 3300046691 | Bacteria | 7437 |
| 1243 | Ga0495670_0004207 | 3300046691 | Bacteria | 7052 |
| 1244 | Ga0495670_0013889 | 3300046691 | Bacteria | 3960 |
| 1245 | Ga0495670_0041825 | 3300046691 | Bacteria | 2287 |
| 1246 | Ga0495670_0042883 | 3300046691 | Bacteria | 2258 |
| 1247 | Ga0495670_0064429 | 3300046691 | Bacteria | 1846 |
| 1248 | Ga0495671_0000001 | 3300046692 | Bacteria | 1169494 |
| 1249 | Ga0495671_0001547 | 3300046692 | Bacteria | 15291 |
| 1250 | Ga0495671_0012227 | 3300046692 | Bacteria | 4692 |
| 1251 | Ga0495671_0012468 | 3300046692 | Bacteria | 4641 |
| 1252 | Ga0495671_0012531 | 3300046692 | Bacteria | 4626 |
| 1253 | Ga0495671_0022645 | 3300046692 | Bacteria | 3289 |
| 1254 | Ga0495649_0000138 | 3300046694 | Bacteria | 63264 |
| 1255 | Ga0495649_0001419 | 3300046694 | Bacteria | 18111 |
| 1256 | Ga0495649_0009719 | 3300046694 | Bacteria | 5698 |
| 1257 | Ga0495649_0012333 | 3300046694 | Bacteria | 4978 |
| 1258 | Ga0495649_0168631 | 3300046694 | Bacteria | 1146 |
| 1259 | Ga0495589_0000012 | 3300046794 | Bacteria | 248641 |
| 1260 | Ga0495589_0001013 | 3300046794 | Bacteria | 17019 |
| 1261 | Ga0495589_0002523 | 3300046794 | Bacteria | 10191 |
| 1262 | Ga0495589_0004690 | 3300046794 | Bacteria | 7260 |
| 1263 | Ga0495589_0005172 | 3300046794 | Bacteria | 6900 |
| 1264 | Ga0495589_0005498 | 3300046794 | Bacteria | 6682 |
| 1265 | Ga0495589_0013534 | 3300046794 | Bacteria | 4207 |
| 1266 | Ga0495589_0023143 | 3300046794 | Bacteria | 3166 |
| 1267 | Ga0495600_0004658 | 3300046809 | Bacteria | 8216 |
| 1268 | Ga0495600_0100279 | 3300046809 | Bacteria | 1887 |
| 1269 | Ga0495600_0198059 | 3300046809 | Bacteria | 1290 |
| 1270 | Ga0495660_0000921 | 3300046810 | Bacteria | 21636 |
| 1271 | Ga0495660_0008376 | 3300046810 | Bacteria | 6047 |
| 1272 | Ga0495660_0010852 | 3300046810 | Bacteria | 5292 |
| 1273 | Ga0495660_0017627 | 3300046810 | Bacteria | 4109 |
| 1274 | Ga0495660_0027386 | 3300046810 | Bacteria | 3225 |
| 1275 | Ga0495660_0032340 | 3300046810 | Bacteria | 2937 |
| 1276 | Ga0495660_0103721 | 3300046810 | Bacteria | 1460 |
| 1277 | Ga0495581_0000409 | 3300047315 | Bacteria | 21661 |
| 1278 | Ga0495581_0005132 | 3300047315 | Bacteria | 7577 |
| 1279 | Ga0495581_0024397 | 3300047315 | Bacteria | 3504 |
| 1280 | Ga0495581_0035969 | 3300047315 | Bacteria | 2864 |
| 1281 | Ga0495581_0173898 | 3300047315 | Bacteria | 1259 |
| 1282 | Ga0495604_0008259 | 3300047317 | Bacteria | 8235 |
| 1283 | Ga0495604_0026650 | 3300047317 | Bacteria | 4600 |
| 1284 | Ga0495604_0046170 | 3300047317 | Bacteria | 3396 |
| 1285 | Ga0495604_0080173 | 3300047317 | Bacteria | 2446 |
| 1286 | Ga0495604_0170575 | 3300047317 | Bacteria | 1530 |
| 1287 | Ga0495636_0002974 | 3300047318 | Bacteria | 6553 |
| 1288 | Ga0495636_0004077 | 3300047318 | Bacteria | 5716 |
| 1289 | Ga0495636_0033472 | 3300047318 | Bacteria | 2112 |
| 1290 | Ga0495674_0041330 | 3300047319 | Bacteria | 4119 |
| 1291 | Ga0495674_0053500 | 3300047319 | Bacteria | 3548 |
| 1292 | Ga0495674_0056273 | 3300047319 | Bacteria | 3445 |
| 1293 | Ga0495674_0315882 | 3300047319 | Bacteria | 1274 |
| 1294 | Ga0495674_0388287 | 3300047319 | Bacteria | 1128 |
| 1295 | Ga0495672_0000170 | 3300047320 | Bacteria | 94669 |
| 1296 | Ga0495672_0000240 | 3300047320 | Bacteria | 77639 |
| 1297 | Ga0495672_0000801 | 3300047320 | Bacteria | 33909 |
| 1298 | Ga0495672_0000896 | 3300047320 | Bacteria | 31234 |
| 1299 | Ga0495672_0003434 | 3300047320 | Bacteria | 13566 |
| 1300 | Ga0495672_0005376 | 3300047320 | Bacteria | 10183 |
| 1301 | Ga0495672_0009345 | 3300047320 | Bacteria | 7116 |
| 1302 | Ga0495672_0073444 | 3300047320 | Bacteria | 1928 |
| 1303 | Ga0495676_0000670 | 3300047321 | Bacteria | 28462 |
| 1304 | Ga0495676_0027149 | 3300047321 | Bacteria | 4914 |
| 1305 | Ga0495676_0089324 | 3300047321 | Bacteria | 2309 |
| 1306 | Ga0495676_0150268 | 3300047321 | Bacteria | 1658 |
| 1307 | Ga0495676_0239672 | 3300047321 | Bacteria | 1242 |
| 1308 | Ga0495676_0283294 | 3300047321 | Bacteria | 1122 |
| 1309 | Ga0495680_0001210 | 3300047322 | Bacteria | 28304 |
| 1310 | Ga0495680_0001589 | 3300047322 | Bacteria | 24279 |
| 1311 | Ga0495680_0016580 | 3300047322 | Bacteria | 6324 |
| 1312 | Ga0495680_0026694 | 3300047322 | Bacteria | 4756 |
| 1313 | Ga0495680_0045299 | 3300047322 | Bacteria | 3473 |
| 1314 | Ga0495683_0000035 | 3300047323 | Bacteria | 146394 |
| 1315 | Ga0495683_0000325 | 3300047323 | Bacteria | 40032 |
| 1316 | Ga0495683_0003363 | 3300047323 | Bacteria | 9344 |
| 1317 | Ga0495683_0006003 | 3300047323 | Bacteria | 6670 |
| 1318 | Ga0495683_0010146 | 3300047323 | Bacteria | 4992 |
| 1319 | Ga0495683_0012685 | 3300047323 | Bacteria | 4424 |
| 1320 | Ga0495683_0014466 | 3300047323 | Bacteria | 4110 |
| 1321 | Ga0495683_0015131 | 3300047323 | Bacteria | 4018 |
| 1322 | Ga0495683_0038381 | 3300047323 | Bacteria | 2425 |
| 1323 | Ga0495683_0049087 | 3300047323 | Bacteria | 2114 |
| 1324 | Ga0495683_0067234 | 3300047323 | Bacteria | 1764 |
| 1325 | Ga0495683_0075353 | 3300047323 | Bacteria | 1652 |
| 1326 | Ga0495687_000022 | 3300047443 | Bacteria | 327353 |
| 1327 | Ga0495687_000149 | 3300047443 | Bacteria | 106301 |
| 1328 | Ga0495687_000326 | 3300047443 | Bacteria | 61742 |
| 1329 | Ga0495687_000373 | 3300047443 | Bacteria | 55812 |
| 1330 | Ga0495687_001062 | 3300047443 | Bacteria | 27130 |
| 1331 | Ga0495687_004721 | 3300047443 | Bacteria | 9027 |
| 1332 | Ga0495687_012071 | 3300047443 | Bacteria | 4590 |
| 1333 | Ga0495687_016191 | 3300047443 | Bacteria | 3757 |
| 1334 | Ga0495675_0006167 | 3300047444 | Bacteria | 7336 |
| 1335 | Ga0495675_0007198 | 3300047444 | Bacteria | 6851 |
| 1336 | Ga0495675_0027890 | 3300047444 | Bacteria | 3599 |
| 1337 | Ga0495675_0058691 | 3300047444 | Bacteria | 2439 |
| 1338 | Ga0495677_0002988 | 3300047445 | Bacteria | 6577 |
| 1339 | Ga0495677_0009710 | 3300047445 | Bacteria | 3547 |
| 1340 | Ga0495677_0012815 | 3300047445 | Bacteria | 3056 |
| 1341 | Ga0495677_0019151 | 3300047445 | Bacteria | 2483 |
| 1342 | Ga0495679_000865 | 3300047446 | Bacteria | 19139 |
| 1343 | Ga0495679_000936 | 3300047446 | Bacteria | 18161 |
| 1344 | Ga0495679_002559 | 3300047446 | Bacteria | 9180 |
| 1345 | Ga0495679_015200 | 3300047446 | Bacteria | 2822 |
| 1346 | Ga0495685_012411 | 3300047447 | Bacteria | 2887 |
| 1347 | Ga0495685_028287 | 3300047447 | Bacteria | 1928 |
| 1348 | Ga0495673_0000006 | 3300047469 | Bacteria | 908691 |
| 1349 | Ga0495673_0000015 | 3300047469 | Bacteria | 598766 |
| 1350 | Ga0495673_0000024 | 3300047469 | Bacteria | 521349 |
| 1351 | Ga0495673_0000049 | 3300047469 | Bacteria | 265878 |
| 1352 | Ga0495673_0011801 | 3300047469 | Bacteria | 4673 |
| 1353 | Ga0495673_0022484 | 3300047469 | Bacteria | 3089 |
| 1354 | Ga0495681_0006364 | 3300047470 | Bacteria | 7773 |
| 1355 | Ga0495681_0009450 | 3300047470 | Bacteria | 6007 |
| 1356 | Ga0495681_0020969 | 3300047470 | Bacteria | 3531 |
| 1357 | Ga0495681_0056941 | 3300047470 | Bacteria | 1817 |
| 1358 | Ga0495681_0061554 | 3300047470 | Bacteria | 1728 |
| 1359 | Ga0495686_0000002 | 3300047472 | Bacteria | 1050777 |
| 1360 | Ga0495686_0000312 | 3300047472 | Bacteria | 81912 |
| 1361 | Ga0495686_0000744 | 3300047472 | Bacteria | 43385 |
| 1362 | Ga0495686_0002260 | 3300047472 | Bacteria | 18567 |
| 1363 | Ga0495686_0003592 | 3300047472 | Bacteria | 13314 |
| 1364 | Ga0495686_0015177 | 3300047472 | Bacteria | 5275 |
| 1365 | Ga0495593_0002055 | 3300047673 | Bacteria | 12017 |
| 1366 | Ga0495593_0022835 | 3300047673 | Bacteria | 3481 |
| 1367 | Ga0495593_0024770 | 3300047673 | Bacteria | 3322 |
| 1368 | Ga0495593_0107344 | 3300047673 | Bacteria | 1427 |
| 1369 | Ga0495602_0004187 | 3300048088 | Bacteria | 15010 |
| 1370 | Ga0495602_0007746 | 3300048088 | Bacteria | 11225 |
| 1371 | Ga0495602_0070288 | 3300048088 | Bacteria | 2997 |
| 1372 | Ga0495602_0175482 | 3300048088 | Bacteria | 1658 |
| 1373 | Ga0495602_0190064 | 3300048088 | Bacteria | 1575 |
| 1374 | Ga0495614_0004682 | 3300048089 | Bacteria | 6168 |
| 1375 | Ga0495614_0022369 | 3300048089 | Bacteria | 2728 |
| 1376 | Ga0495615_0045588 | 3300048090 | Bacteria | 1111 |
| 1377 | Ga0495626_0000082 | 3300048091 | Bacteria | 128002 |
| 1378 | Ga0495626_0000564 | 3300048091 | Bacteria | 36841 |
| 1379 | Ga0495626_0000805 | 3300048091 | Bacteria | 28379 |
| 1380 | Ga0495626_0007028 | 3300048091 | Bacteria | 6320 |
| 1381 | Ga0495626_0007562 | 3300048091 | Bacteria | 6032 |
| 1382 | Ga0495626_0013551 | 3300048091 | Bacteria | 4234 |
| 1383 | Ga0495626_0014017 | 3300048091 | Bacteria | 4148 |
| 1384 | Ga0495626_0019263 | 3300048091 | Bacteria | 3413 |
| 1385 | Ga0495626_0020399 | 3300048091 | Bacteria | 3303 |
| 1386 | Ga0495626_0027194 | 3300048091 | Bacteria | 2783 |
| 1387 | Ga0495626_0034592 | 3300048091 | Bacteria | 2416 |
| 1388 | Ga0496100_0002007 | 3300048903 | Bacteria | 10177 |
| 1389 | Ga0496100_0021276 | 3300048903 | Bacteria | 3903 |
| 1390 | Ga0496100_0034399 | 3300048903 | Bacteria | 3179 |
| 1391 | Ga0496100_0122698 | 3300048903 | Bacteria | 1820 |
| 1392 | Ga0496100_0245657 | 3300048903 | Bacteria | 1322 |
| 1393 | Ga0496101_0003262 | 3300048904 | Bacteria | 10080 |
| 1394 | Ga0496101_0004357 | 3300048904 | Bacteria | 8889 |
| 1395 | Ga0496101_0005768 | 3300048904 | Bacteria | 7915 |
| 1396 | Ga0496101_0015923 | 3300048904 | Bacteria | 5073 |
| 1397 | Ga0496101_0030404 | 3300048904 | Bacteria | 3786 |
| 1398 | Ga0496101_0066919 | 3300048904 | Bacteria | 2622 |
| 1399 | Ga0496102_0000231 | 3300048905 | Bacteria | 73157 |
| 1400 | Ga0496102_0000410 | 3300048905 | Bacteria | 49794 |
| 1401 | Ga0496102_0001160 | 3300048905 | Bacteria | 24083 |
| 1402 | Ga0496102_0001615 | 3300048905 | Bacteria | 19875 |
| 1403 | Ga0496102_0006411 | 3300048905 | Bacteria | 10030 |
| 1404 | Ga0496102_0007060 | 3300048905 | Bacteria | 9586 |
| 1405 | Ga0496102_0045378 | 3300048905 | Bacteria | 3990 |
| 1406 | Ga0496102_0197890 | 3300048905 | Bacteria | 1894 |
| 1407 | Ga0496102_0272930 | 3300048905 | Bacteria | 1594 |
| 1408 | Ga0496103_0000526 | 3300048906 | Bacteria | 31220 |
| 1409 | Ga0496103_0000758 | 3300048906 | Bacteria | 23818 |
| 1410 | Ga0496103_0003846 | 3300048906 | Bacteria | 9136 |
| 1411 | Ga0496103_0013506 | 3300048906 | Bacteria | 4845 |
| 1412 | Ga0496103_0014487 | 3300048906 | Bacteria | 4681 |
| 1413 | Ga0496103_0031196 | 3300048906 | Bacteria | 3246 |
| 1414 | Ga0496104_0002107 | 3300048907 | Bacteria | 17270 |
| 1415 | Ga0496104_0057947 | 3300048907 | Bacteria | 3666 |
| 1416 | Ga0496104_0159239 | 3300048907 | Bacteria | 2166 |
| 1417 | Ga0496104_0303976 | 3300048907 | Bacteria | 1507 |
| 1418 | Ga0496105_0004353 | 3300048908 | Bacteria | 10663 |
| 1419 | Ga0496105_0054030 | 3300048908 | Bacteria | 3317 |
| 1420 | Ga0496105_0143419 | 3300048908 | Bacteria | 1965 |
| 1421 | Ga0496105_0144583 | 3300048908 | Bacteria | 1956 |
| 1422 | Ga0496106_0000029 | 3300048909 | Bacteria | 141097 |
| 1423 | Ga0496106_0075066 | 3300048909 | Bacteria | 2589 |
| 1424 | Ga0496107_0031872 | 3300048910 | Bacteria | 3764 |
| 1425 | Ga0496107_0069094 | 3300048910 | Bacteria | 2563 |
| 1426 | Ga0496107_0113508 | 3300048910 | Bacteria | 1993 |
| 1427 | Ga0496107_0137781 | 3300048910 | Bacteria | 1803 |
| 1428 | Ga0496107_0176739 | 3300048910 | Bacteria | 1585 |
| 1429 | Ga0496108_0007605 | 3300048911 | Bacteria | 8774 |
| 1430 | Ga0496108_0028121 | 3300048911 | Bacteria | 4651 |
| 1431 | Ga0496108_0168445 | 3300048911 | Bacteria | 1894 |
| 1432 | Ga0496108_0277540 | 3300048911 | Bacteria | 1459 |
| 1433 | Ga0496109_0028543 | 3300048912 | Bacteria | 4991 |
| 1434 | Ga0496110_0000779 | 3300048913 | Bacteria | 22181 |
| 1435 | Ga0496110_0001082 | 3300048913 | Bacteria | 19190 |
| 1436 | Ga0496110_0004874 | 3300048913 | Bacteria | 10469 |
| 1437 | Ga0496110_0011024 | 3300048913 | Bacteria | 7377 |
| 1438 | Ga0496110_0193456 | 3300048913 | Bacteria | 1847 |
| 1439 | Ga0496110_0230038 | 3300048913 | Bacteria | 1686 |
| 1440 | Ga0496111_0088110 | 3300048914 | Bacteria | 2273 |
| 1441 | Ga0496112_0000694 | 3300048915 | Bacteria | 23483 |
| 1442 | Ga0496112_0022903 | 3300048915 | Bacteria | 5959 |
| 1443 | Ga0496112_0079568 | 3300048915 | Bacteria | 3242 |
| 1444 | Ga0496113_0023520 | 3300048916 | Bacteria | 4369 |
| 1445 | Ga0496113_0098129 | 3300048916 | Bacteria | 2267 |
| 1446 | Ga0496114_0016577 | 3300048917 | Bacteria | 5939 |
| 1447 | Ga0496114_0054376 | 3300048917 | Bacteria | 3338 |
| 1448 | Ga0496114_0148098 | 3300048917 | Bacteria | 2036 |
| 1449 | Ga0496115_0023344 | 3300048918 | Bacteria | 4799 |
| 1450 | Ga0496115_0056602 | 3300048918 | Bacteria | 3152 |
| 1451 | Ga0496115_0089511 | 3300048918 | Bacteria | 2514 |
| 1452 | Ga0496115_0214007 | 3300048918 | Bacteria | 1591 |
| 1453 | Ga0496116_0004796 | 3300048919 | Bacteria | 12761 |
| 1454 | Ga0496116_0005572 | 3300048919 | Bacteria | 11613 |
| 1455 | Ga0496116_0014372 | 3300048919 | Bacteria | 6328 |
| 1456 | Ga0496116_0016701 | 3300048919 | Bacteria | 5733 |
| 1457 | Ga0496116_0033865 | 3300048919 | Bacteria | 3617 |
| 1458 | Ga0496117_0000001 | 3300048920 | Bacteria | 2526244 |
| 1459 | Ga0496117_0000755 | 3300048920 | Bacteria | 50943 |
| 1460 | Ga0496117_0002426 | 3300048920 | Bacteria | 23567 |
| 1461 | Ga0496117_0004332 | 3300048920 | Bacteria | 15777 |
| 1462 | Ga0496117_0015767 | 3300048920 | Bacteria | 6416 |
| 1463 | Ga0496117_0092636 | 3300048920 | Bacteria | 1940 |
| 1464 | Ga0496118_0000078 | 3300048921 | Bacteria | 190946 |
| 1465 | Ga0496118_0004181 | 3300048921 | Bacteria | 17368 |
| 1466 | Ga0496118_0011820 | 3300048921 | Bacteria | 8470 |
| 1467 | Ga0496118_0012940 | 3300048921 | Bacteria | 7944 |
| 1468 | Ga0496118_0016090 | 3300048921 | Bacteria | 6881 |
| 1469 | Ga0496118_0059827 | 3300048921 | Bacteria | 2833 |
| 1470 | Ga0496118_0061387 | 3300048921 | Bacteria | 2784 |
| 1471 | Ga0496119_0071699 | 3300048922 | Bacteria | 2027 |
| 1472 | Ga0496121_0004482 | 3300048924 | Bacteria | 18741 |
| 1473 | Ga0496121_0007119 | 3300048924 | Bacteria | 13577 |
| 1474 | Ga0496121_0012818 | 3300048924 | Bacteria | 9075 |
| 1475 | Ga0496121_0016195 | 3300048924 | Bacteria | 7717 |
| 1476 | Ga0496121_0016657 | 3300048924 | Bacteria | 7568 |
| 1477 | Ga0496121_0024151 | 3300048924 | Bacteria | 5823 |
| 1478 | Ga0496121_0033907 | 3300048924 | Bacteria | 4607 |
| 1479 | Ga0496121_0044023 | 3300048924 | Bacteria | 3857 |
| 1480 | Ga0496121_0101645 | 3300048924 | Bacteria | 2216 |
| 1481 | Ga0496121_0110043 | 3300048924 | Bacteria | 2103 |
| 1482 | Ga0496122_0001026 | 3300048925 | Bacteria | 49313 |
| 1483 | Ga0496122_0005297 | 3300048925 | Bacteria | 15434 |
| 1484 | Ga0496122_0005801 | 3300048925 | Bacteria | 14515 |
| 1485 | Ga0496122_0015357 | 3300048925 | Bacteria | 7325 |
| 1486 | Ga0496122_0040382 | 3300048925 | Bacteria | 3709 |
| 1487 | Ga0496122_0058838 | 3300048925 | Bacteria | 2841 |
| 1488 | Ga0496122_0124279 | 3300048925 | Bacteria | 1656 |
| 1489 | Ga0496122_0153753 | 3300048925 | Bacteria | 1415 |
| 1490 | Ga0496123_0002474 | 3300048926 | Bacteria | 22801 |
| 1491 | Ga0496123_0004250 | 3300048926 | Bacteria | 15250 |
| 1492 | Ga0496123_0010211 | 3300048926 | Bacteria | 8330 |
| 1493 | Ga0496123_0014295 | 3300048926 | Bacteria | 6590 |
| 1494 | Ga0496123_0021284 | 3300048926 | Bacteria | 5045 |
| 1495 | Ga0496123_0032993 | 3300048926 | Bacteria | 3734 |
| 1496 | Ga0496123_0033673 | 3300048926 | Bacteria | 3682 |
| 1497 | Ga0496124_0002429 | 3300048927 | Bacteria | 24422 |
| 1498 | Ga0496124_0053740 | 3300048927 | Bacteria | 3412 |
| 1499 | Ga0496124_0103400 | 3300048927 | Bacteria | 2304 |
| 1500 | Ga0496124_0120953 | 3300048927 | Bacteria | 2092 |
| 1501 | Ga0496124_0127282 | 3300048927 | Bacteria | 2027 |
| 1502 | Ga0496125_0003324 | 3300048928 | Bacteria | 19642 |
| 1503 | Ga0496125_0004189 | 3300048928 | Bacteria | 16803 |
| 1504 | Ga0496125_0147310 | 3300048928 | Bacteria | 1624 |
| 1505 | Ga0496126_0000192 | 3300048929 | Bacteria | 136536 |
| 1506 | Ga0496126_0000604 | 3300048929 | Bacteria | 67945 |
| 1507 | Ga0496126_0018997 | 3300048929 | Bacteria | 6787 |
| 1508 | Ga0496126_0023849 | 3300048929 | Bacteria | 5921 |
| 1509 | Ga0496126_0030750 | 3300048929 | Bacteria | 5083 |
| 1510 | Ga0496126_0150321 | 3300048929 | Bacteria | 1997 |
| 1511 | Ga0496126_0191503 | 3300048929 | Bacteria | 1732 |
| 1512 | Ga0501308_000648 | 3300049128 | Bacteria | 2386 |
| 1513 | Ga0501304_001077 | 3300049160 | Bacteria | 1661 |
| 1514 | Ga0495678_000185 | 3300049459 | Bacteria | 72410 |
| 1515 | Ga0495678_000240 | 3300049459 | Bacteria | 61885 |
| 1516 | Ga0495678_000374 | 3300049459 | Bacteria | 45408 |
| 1517 | Ga0495678_000679 | 3300049459 | Bacteria | 31270 |
| 1518 | Ga0495678_001937 | 3300049459 | Bacteria | 14986 |
| 1519 | Ga0495678_003621 | 3300049459 | Bacteria | 9415 |
| 1520 | Ga0495678_004540 | 3300049459 | Bacteria | 7994 |
| 1521 | Ga0495678_015969 | 3300049459 | Bacteria | 3445 |
| 1522 | Ga0495678_021387 | 3300049459 | Bacteria | 2849 |
| 1523 | Ga0495682_0003433 | 3300049460 | Bacteria | 7038 |
| 1524 | Ga0495682_0006008 | 3300049460 | Bacteria | 4960 |
| 1525 | Ga0495682_0013866 | 3300049460 | Bacteria | 3060 |
| 1526 | Ga0495682_0019113 | 3300049460 | Bacteria | 2578 |
| 1527 | Ga0495682_0050595 | 3300049460 | Bacteria | 1511 |
| 1528 | Ga0501032_0008558 | 3300049569 | Bacteria | 7464 |
| 1529 | Ga0501033_0000693 | 3300049570 | Bacteria | 31157 |
| 1530 | Ga0501034_0000628 | 3300049571 | Bacteria | 54785 |
| 1531 | Ga0501034_0113456 | 3300049571 | Bacteria | 2700 |
| 1532 | Ga0501036_0005253 | 3300049572 | Bacteria | 10479 |
| 1533 | Ga0501037_0042698 | 3300049573 | Bacteria | 3332 |
| 1534 | Ga0501038_0003200 | 3300049574 | Bacteria | 15271 |
| 1535 | Ga0501039_0000950 | 3300049575 | Bacteria | 21060 |
| 1536 | Ga0501040_0002182 | 3300049576 | Bacteria | 12622 |
| 1537 | Ga0501041_0010690 | 3300049577 | Bacteria | 5415 |
| 1538 | Ga0501042_0001629 | 3300049578 | Bacteria | 13359 |
| 1539 | Ga0501043_0005031 | 3300049579 | Bacteria | 10700 |
| 1540 | Ga0501046_0001055 | 3300049580 | Bacteria | 26972 |
| 1541 | Ga0501048_0001193 | 3300049582 | Bacteria | 19672 |
| 1542 | Ga0501068_0076038 | 3300049584 | Bacteria | 2054 |
| 1543 | Ga0501070_0173369 | 3300049586 | Bacteria | 1776 |
| 1544 | Ga0501071_0017226 | 3300049587 | Bacteria | 4980 |
| 1545 | Ga0501072_0004690 | 3300049588 | Bacteria | 10413 |
| 1546 | Ga0501074_0005903 | 3300049590 | Bacteria | 8828 |
| 1547 | Ga0501075_0002813 | 3300049591 | Bacteria | 11666 |
| 1548 | Ga0501076_0008797 | 3300049592 | Bacteria | 7419 |
| 1549 | Ga0501077_0003308 | 3300049593 | Bacteria | 9697 |
| 1550 | Ga0501079_0003996 | 3300049741 | Bacteria | 10900 |
| 1551 | Ga0501080_0006070 | 3300049742 | Bacteria | 10830 |
| 1552 | Ga0501080_0227072 | 3300049742 | Bacteria | 1707 |
| 1553 | Ga0501081_0000437 | 3300049743 | Bacteria | 23051 |
| 1554 | Ga0501035_0000793 | 3300049822 | Bacteria | 33614 |
| 1555 | Ga0501035_0025915 | 3300049822 | Bacteria | 5372 |
| 1556 | Ga0501044_0163539 | 3300049823 | Bacteria | 2201 |
| 1557 | Ga0501045_0000054 | 3300049824 | Bacteria | 51274 |
| 1558 | nmdc:mga07m45_28124_c1 | 3300050496 | Bacteria | 3103 |
| 1559 | nmdc:mga08x19_47843_c1 | 3300050514 | Bacteria | 2738 |
| 1560 | Ga0495601_0013846 | 3300053077 | Bacteria | 4856 |
| 1561 | Ga0495601_0140368 | 3300053077 | Bacteria | 1576 |
| 1562 | Ga0495595_0066767 | 3300053084 | Bacteria | 1694 |
| 1563 | Ga0500618_000104 | 3300053125 | Bacteria | 68104 |
| 1564 | Ga0500618_001996 | 3300053125 | Bacteria | 8323 |
| 1565 | Ga0500618_003269 | 3300053125 | Bacteria | 5633 |
| 1566 | Ga0500586_001331 | 3300053145 | Bacteria | 5194 |
| 1567 | Ga0500590_021784 | 3300053148 | Bacteria | 3325 |
| 1568 | Ga0500619_004943 | 3300053154 | Bacteria | 2920 |
| 1569 | Ga0501084_0012495 | 3300054114 | Bacteria | 7033 |
| 1570 | Ga0587077_002155 | 3300059493 | Bacteria | 2282 |
| 1571 | Ga0587082_005003 | 3300059504 | Bacteria | 1699 |
| 1572 | Ga0587083_0009799 | 3300059505 | Bacteria | 1536 |
| 1573 | Ga0587091_016590 | 3300059511 | Bacteria | 1230 |
| 1574 | Ga0587068_001216 | 3300059641 | Bacteria | 2810 |
| 1575 | Ga0587079_014993 | 3300059647 | Bacteria | 1310 |
| 1576 | Ga0501082_0003677 | 3300060353 | Bacteria | 13401 |
| 1577 | Ga0466962_0000565 | 3300061719 | Bacteria | 16266 |
| 1578 | Ga0466962_0003588 | 3300061719 | Bacteria | 7398 |
| 1579 | Ga0530510_0000330 | 3300061734 | Bacteria | 30479 |
| 1580 | Ga0530510_0069753 | 3300061734 | Bacteria | 2551 |
| 1581 | 2501073627 | 2501025501 | Bacteria | 7768574 |
| 1582 | 2501082232 | 2501025502 | Bacteria | 9641094 |
| 1583 | 2501410977 | 2501025504 | Bacteria | 8008976 |
| 1584 | 2509128673 | 2508501125 | Bacteria | 7208311 |
| 1585 | 2510250883 | 2510065045 | Bacteria | 7761063 |
| 1586 | 2511086422 | 2510917013 | Bacteria | 9951648 |
| 1587 | 2511096567 | 2510917014 | Bacteria | 8296963 |
| 1588 | 2511102796 | 2510917015 | Bacteria | 7950052 |
| 1589 | 2511251224 | 2511231003 | Bacteria | 5606035 |
| 1590 | 2511384463 | 2511231026 | Bacteria | 5225445 |
| 1591 | 2512346222 | 2512047030 | Bacteria | 9031815 |
| 1592 | 2513552102 | 2513237082 | Bacteria | 8640282 |
| 1593 | 2513560888 | 2513237083 | Bacteria | 8410967 |
| 1594 | 2513957889 | 2513237150 | Bacteria | 6553639 |
| 1595 | 2513960931 | 2513237151 | Bacteria | 6309801 |
| 1596 | 2514041827 | 2513237165 | Bacteria | 6771773 |
| 1597 | 2514048122 | 2513237166 | Bacteria | 10373764 |
| 1598 | 2515679674 | 2515154122 | Bacteria | 8609520 |
| 1599 | 2515692509 | 2515154123 | Bacteria | 6387382 |
| 1600 | 2516020337 | 2515154189 | Bacteria | 9629850 |
| 1601 | 2519458910 | 2519103095 | Bacteria | 6629912 |
| 1602 | 2527075168 | 2526164713 | Bacteria | 6780608 |
| 1603 | 2547375434 | 2547132103 | Bacteria | 5115736 |
| 1604 | 2550694348 | 2548876994 | Bacteria | 4904866 |
| 1605 | 2563063000 | 2562617112 | Bacteria | 10918404 |
| 1606 | 2585291588 | 2582581311 | Bacteria | 6763856 |
| 1607 | 2597028599 | 2596583598 | Bacteria | 5251611 |
| 1608 | 2599445285 | 2599185178 | Bacteria | 5365746 |
| 1609 | 2599736508 | 2599185239 | Bacteria | 8686614 |
| 1610 | 2599744569 | 2599185240 | Bacteria | 7968121 |
| 1611 | 2600206070 | 2599185355 | Bacteria | 7968906 |
| 1612 | 2600809747 | 2600255067 | Bacteria | 6795583 |
| 1613 | 2601667262 | 2600255292 | Bacteria | 6300551 |
| 1614 | 2643798555 | 2643221556 | Bacteria | 7251154 |
| 1615 | 2644475561 | 2643221684 | Bacteria | 7145183 |
| 1616 | 2676742695 | 2675903129 | Bacteria | 7964495 |
| 1617 | 2713477200 | 2711768613 | Bacteria | 11048459 |
| 1618 | 2719640019 | 2718217991 | Bacteria | 7829542 |
| 1619 | 2723877401 | 2721755763 | Bacteria | 4464185 |
| 1620 | 2738820760 | 2738541296 | Bacteria | 7285013 |
| 1621 | 2738829668 | 2738541297 | Bacteria | 6549566 |
| 1622 | 2738833240 | 2738541298 | Bacteria | 7286732 |
| 1623 | 2738874768 | 2738541306 | Bacteria | 7284992 |
| 1624 | 2739153464 | 2738541357 | Bacteria | 6549408 |
| 1625 | 2739186397 | 2738543002 | Bacteria | 7284546 |
| 1626 | 2739195384 | 2738543003 | Bacteria | 6549560 |
| 1627 | 2739221366 | 2738543008 | Bacteria | 7282815 |
| 1628 | 2739321860 | 2738543026 | Bacteria | 6549408 |
| 1629 | 2739339584 | 2738543029 | Bacteria | 6549249 |
| 1630 | 2746089635 | 2744054900 | Bacteria | 8399525 |
| 1631 | 2746099476 | 2744054901 | Bacteria | 8397047 |
| 1632 | 2753570355 | 2751185846 | Bacteria | 7242164 |
| 1633 | 2765569168 | 2765235838 | Bacteria | 5445269 |
| 1634 | 2792836445 | 2791355137 | Bacteria | 9654227 |
| 1635 | 2808969911 | 2808606384 | Bacteria | 8474373 |
| 1636 | 2809004444 | 2808606390 | Bacteria | 8476311 |
| 1637 | 2809011617 | 2808606391 | Bacteria | 8308166 |
| 1638 | 2809145000 | 2808606418 | Bacteria | 6724496 |
| 1639 | 2817261178 | 2816332253 | Bacteria | 6764532 |
| 1640 | 2817278890 | 2816332256 | Bacteria | 6891714 |
| 1641 | 2817457116 | 2816332286 | Bacteria | 6853759 |
| 1642 | 2819541180 | 2818991436 | Bacteria | 5376622 |
| 1643 | 2819592464 | 2818991445 | Bacteria | 4955017 |
| 1644 | 2819620201 | 2818991450 | Bacteria | 6962147 |
| 1645 | 2819630992 | 2818991452 | Bacteria | 8442785 |
| 1646 | 2821131170 | 2821131069 | Bacteria | 6108407 |
| 1647 | 2839095943 | 2839094727 | Bacteria | 5534556 |
| 1648 | 2842328137 | 2842324504 | Bacteria | 9364110 |
| 1649 | 2842352454 | 2842348783 | Bacteria | 9002918 |
| 1650 | 2842459490 | 2842454564 | Bacteria | 8730687 |
| 1651 | 2842713667 | 2842711865 | Bacteria | 7155354 |
| 1652 | 2842714521 | 2842711865 | Bacteria | 7155354 |
| 1653 | 2843695080 | 2843690924 | Bacteria | 5169057 |
| 1654 | 2846037442 | 2846033681 | Bacteria | 4377894 |
| 1655 | 2846042060 | 2846037992 | Bacteria | 4526407 |
| 1656 | 2856293662 | 2856287931 | Bacteria | 7223934 |
| 1657 | 2857362420 | 2857357740 | Bacteria | 9937880 |
| 1658 | 2857552547 | 2857547612 | Bacteria | 6179999 |
| 1659 | 2857560201 | 2857558681 | Bacteria | 6617694 |
| 1660 | 2857561628 | 2857558681 | Bacteria | 6617694 |
| 1661 | 2857565182 | 2857564685 | Bacteria | 6290584 |
| 1662 | 2857568910 | 2857564685 | Bacteria | 6290584 |
| 1663 | 2863424906 | 2863421361 | Bacteria | 7300805 |
| 1664 | 2870071190 | 2870068957 | Bacteria | 8925310 |
| 1665 | 2883088887 | 2883087390 | Bacteria | 9532701 |
| 1666 | 2884811992 | 2884811622 | Bacteria | 5552861 |
| 1667 | 2884840055 | 2884836552 | Bacteria | 5219991 |
| 1668 | 2884857177 | 2884852848 | Bacteria | 5221161 |
| 1669 | 2885085161 | 2885080285 | Bacteria | 6355622 |
| 1670 | 2885267059 | 2885266251 | Bacteria | 4796748 |
| 1671 | 2885278742 | 2885270888 | Bacteria | 9831543 |
| 1672 | 2896157764 | 2896154374 | Bacteria | 5221518 |
| 1673 | 2900580219 | 2900577576 | Bacteria | 5438534 |
| 1674 | 2900635056 | 2900634093 | Bacteria | 10263517 |
| 1675 | 2902689678 | 2902682994 | Bacteria | 8951596 |
| 1676 | 2904438615 | 2904434214 | Bacteria | 6230908 |
| 1677 | 2904484916 | 2904483920 | Bacteria | 7545285 |
| 1678 | 2904568931 | 2904564687 | Bacteria | 7609577 |
| 1679 | 2904576313 | 2904571731 | Bacteria | 7608790 |
| 1680 | 2904617105 | 2904615490 | Bacteria | 10047340 |
| 1681 | 2919530639 | 2919527303 | Bacteria | 7718827 |
| 1682 | 2928062615 | 2928058823 | Bacteria | 5520022 |
| 1683 | 2928110240 | 2928108538 | Bacteria | 7360024 |
| 1684 | 2928131226 | 2928130867 | Bacteria | 5467269 |
| 1685 | 2928138626 | 2928135762 | Bacteria | 7259641 |
| 1686 | 2928160202 | 2928157003 | Bacteria | 7522202 |
| 1687 | 2928168694 | 2928163908 | Bacteria | 7561269 |
| 1688 | 2928171894 | 2928170801 | Bacteria | 8785406 |
| 1689 | 2928505288 | 2928503688 | Bacteria | 7268108 |
| 1690 | 2928540108 | 2928536128 | Bacteria | 7657547 |
| 1691 | 2932414858 | 2932410948 | Bacteria | 6312192 |
| 1692 | 2932419544 | 2932416698 | Bacteria | 6315112 |
| 1693 | 2939634950 | 2939631187 | Bacteria | 6118131 |
| 1694 | 2945936955 | 2945934425 | Bacteria | 7444609 |
| 1695 | 2981994647 | 2981990288 | Bacteria | 7590678 |
| 1696 | 2990706317 | 2990703756 | Bacteria | 7715990 |
| 1697 | 642423140 | 641736151 | Bacteria | 7477263 |
| 1698 | 642419517 | 641736154 | Bacteria | 7689995 |
| 1699 | 642592701 | 642555112 | Bacteria | 8676562 |
| 1700 | 642621363 | 642555113 | Bacteria | 8214658 |
| 1701 | 644751481 | 644736347 | Bacteria | 6476522 |
| 1702 | 8003955456 | 8003955200 | Bacteria | 8601927 |
| 1703 | 8018851533 | 8018845410 | Bacteria | 8933938 |
| 1704 | 8020810720 | 8020807995 | Bacteria | 6801506 |
| 1705 | 8020942034 | 8020938398 | Bacteria | 7472757 |
| 1706 | 8020946114 | 8020945358 | Bacteria | 8467355 |
| 1707 | 8020956770 | 8020953355 | Bacteria | 7439080 |
| 1708 | 8021122368 | 8021120328 | Bacteria | 8782274 |
| 1709 | 8039102385 | 8039098773 | Bacteria | 6602928 |
| 1710 | 8040172849 | 8040167225 | Bacteria | 6542727 |
| 1711 | 8040174876 | 8040173305 | Bacteria | 6827067 |
| 1712 | 8047675574 | 8047673197 | Bacteria | 7395230 |
| 1713 | 8055268284 | 8055266321 | Bacteria | 7999742 |
| 1714 | 8055302398 | 8055301274 | Bacteria | 8587385 |
| 1715 | Ga0207678_10214638 | |||
| 1716 | JGI24741J21665_1000126 | |||
| 1717 | JGI24740J21852_10002156 | |||
| 1718 | JGI24740J21852_10002843 | |||
| 1719 | JGI24740J21852_10036406 | |||
| 1720 | JGI24739J22299_10003819 | |||
| 1721 | JGI24739J22299_10021874 | |||
| 1722 | JGI24735J21928_10000091 | |||
| 1723 | JGI24735J21928_10006360 | |||
| 1724 | JGI24735J21928_10007474 | |||
| 1725 | JGI24738J21930_10010650 | |||
| 1726 | JGI25155J39150_1000304 | |||
| 1727 | JGI25155J39150_1000311 | |||
| 1728 | JGI25156J39149_1000736 | |||
| 1729 | JGI25156J39149_1001156 | |||
| 1730 | JGI25156J39149_1001924 | |||
| 1731 | JGI25156J39149_1003390 | |||
| 1732 | JGI25156J39149_1011453 | |||
| 1733 | JGI25162J39368_1000142 | |||
| 1734 | JGI25154J39366_1000220 | |||
| 1735 | JGI25154J39366_1000628 | |||
| 1736 | JGI25154J39366_1000634 | |||
| 1737 | JGI25154J39366_1000718 | |||
| 1738 | JGI25157J39369_1000265 | |||
| 1739 | JGI25163J39215_1002551 | |||
| 1740 | JGI25164J39214_1004295 | |||
| 1741 | JGI25150J39212_1002698 | |||
| 1742 | JGI25151J46595_10019719 | |||
| 1743 | JGI25165J46597_1000064 | |||
| 1744 | JGI25165J46597_1001227 | |||
| 1745 | rootH2_10058489 | |||
| 1746 | JGI25160J50197_1000421 | |||
| 1747 | Ga0055538_1000031 | |||
| 1748 | Ga0055539_1000041 | |||
| 1749 | Ga0055539_1000123 | |||
| 1750 | Ga0055533_1000051 | |||
| 1751 | Ga0055533_1000217 | |||
| 1752 | Ga0055532_1000002 | |||
| 1753 | Ga0055532_1000015 | |||
| 1754 | Ga0055532_1000027 | |||
| 1755 | Ga0055532_1000029 | |||
| 1756 | Ga0055525_1000001 | |||
| 1757 | Ga0055525_1000061 | |||
| 1758 | Ga0055525_1000571 | |||
| 1759 | Ga0055527_1000019 | |||
| 1760 | Ga0055527_1000533 | |||
| 1761 | Ga0055527_1002805 | |||
| 1762 | Ga0055535_1000021 | |||
| 1763 | Ga0055542_1000032 | |||
| 1764 | Ga0055542_1001163 | |||
| 1765 | Ga0055529_1000038 | |||
| 1766 | Ga0055529_1000060 | |||
| 1767 | Ga0055529_1000062 | |||
| 1768 | Ga0055526_1000066 | |||
| 1769 | Ga0055526_1000100 | |||
| 1770 | Ga0055541_1000028 | |||
| 1771 | Ga0055541_1000208 | |||
| 1772 | Ga0055541_1000811 | |||
| 1773 | Ga0055543_1004650 | |||
| 1774 | Ga0065165_1000281 | |||
| 1775 | Ga0065165_1000475 | |||
| 1776 | Ga0065165_1002621 | |||
| 1777 | Ga0065714_10098877 | |||
| 1778 | Ga0065715_10180223 | |||
| 1779 | Ga0065707_10000578 | |||
| 1780 | Ga0065707_10084248 | |||
| 1781 | Ga0070658_10003869 | |||
| 1782 | Ga0070658_10105944 | |||
| 1783 | Ga0070658_10148699 | |||
| 1784 | Ga0070676_10014576 | |||
| 1785 | Ga0070676_10018588 | |||
| 1786 | Ga0070683_100003358 | |||
| 1787 | Ga0070690_100000415 | |||
| 1788 | Ga0070690_100000970 | |||
| 1789 | Ga0070690_100260120 | |||
| 1790 | Ga0070670_100007422 | |||
| 1791 | Ga0070670_100026302 | |||
| 1792 | Ga0070670_100094973 | |||
| 1793 | Ga0070670_100158748 | |||
| 1794 | Ga0070677_10004523 | |||
| 1795 | Ga0070677_10005761 | |||
| 1796 | Ga0068869_100002853 | |||
| 1797 | Ga0068869_100004401 | |||
| 1798 | Ga0068869_100024754 | |||
| 1799 | Ga0070666_10002232 | |||
| 1800 | Ga0070666_10014823 | |||
| 1801 | Ga0070666_10016331 | |||
| 1802 | Ga0070666_10044770 | |||
| 1803 | Ga0070680_100061995 | |||
| 1804 | Ga0070682_100008747 | |||
| 1805 | Ga0068868_100002963 | |||
| 1806 | Ga0068868_100003118 | |||
| 1807 | Ga0068868_100159628 | |||
| 1808 | Ga0068868_100314403 | |||
| 1809 | Ga0070660_100000007 | |||
| 1810 | Ga0070660_100000221 | |||
| 1811 | Ga0070660_100009312 | |||
| 1812 | Ga0070660_100198388 | |||
| 1813 | Ga0070689_100001396 | |||
| 1814 | Ga0070691_10020767 | |||
| 1815 | Ga0070687_100018754 | |||
| 1816 | Ga0070661_100000077 | |||
| 1817 | Ga0070661_100010322 | |||
| 1818 | Ga0070661_100017351 | |||
| 1819 | Ga0070661_100199786 | |||
| 1820 | Ga0070692_10092334 | |||
| 1821 | Ga0070668_100002323 | |||
| 1822 | Ga0070668_100304008 | |||
| 1823 | Ga0070669_100020775 | |||
| 1824 | Ga0070669_100044728 | |||
| 1825 | Ga0070669_100051433 | |||
| 1826 | Ga0070675_100000340 | |||
| 1827 | Ga0070675_100003765 | |||
| 1828 | Ga0070675_100006646 | |||
| 1829 | Ga0070675_100007231 | |||
| 1830 | Ga0070675_100128187 | |||
| 1831 | Ga0070671_100002234 | |||
| 1832 | Ga0070671_100003372 | |||
| 1833 | Ga0070671_100035825 | |||
| 1834 | Ga0070671_100168090 | |||
| 1835 | Ga0070674_100009567 | |||
| 1836 | Ga0070674_100014411 | |||
| 1837 | Ga0070674_100018134 | |||
| 1838 | Ga0070674_100066505 | |||
| 1839 | Ga0070674_100133902 | |||
| 1840 | Ga0070673_100002105 | |||
| 1841 | Ga0070673_100029426 | |||
| 1842 | Ga0070673_100061468 | |||
| 1843 | Ga0070673_100062840 | |||
| 1844 | Ga0070673_100074616 | |||
| 1845 | Ga0070673_100192842 | |||
| 1846 | Ga0070688_100141301 | |||
| 1847 | Ga0070659_100000019 | |||
| 1848 | Ga0070659_100001051 | |||
| 1849 | Ga0070659_100003354 | |||
| 1850 | Ga0070659_100039263 | |||
| 1851 | Ga0070667_100002371 | |||
| 1852 | Ga0070667_100004918 | |||
| 1853 | Ga0070667_100044551 | |||
| 1854 | Ga0070714_100020500 | |||
| 1855 | Ga0070714_100208036 | |||
| 1856 | Ga0070701_10000844 | |||
| 1857 | Ga0070700_100000812 | |||
| 1858 | Ga0070700_100152900 | |||
| 1859 | Ga0070700_100171807 | |||
| 1860 | Ga0070694_100027033 | |||
| 1861 | Ga0070708_100204078 | |||
| 1862 | Ga0070663_100000011 | |||
| 1863 | Ga0070663_100001639 | |||
| 1864 | Ga0070663_100031877 | |||
| 1865 | Ga0070663_100131322 | |||
| 1866 | Ga0070663_100168417 | |||
| 1867 | Ga0070678_100001667 | |||
| 1868 | Ga0070678_100037495 | |||
| 1869 | Ga0070678_100064893 | |||
| 1870 | Ga0070678_100184777 | |||
| 1871 | Ga0070678_100285388 | |||
| 1872 | Ga0070662_100010536 | |||
| 1873 | Ga0070681_10092877 | |||
| 1874 | Ga0068867_100000579 | |||
| 1875 | Ga0068867_100008360 | |||
| 1876 | Ga0068867_100049630 | |||
| 1877 | Ga0068867_100071971 | |||
| 1878 | Ga0068867_100098608 | |||
| 1879 | Ga0068867_100106121 | |||
| 1880 | Ga0068867_100343060 | |||
| 1881 | Ga0070685_10057439 | |||
| 1882 | Ga0070685_10061169 | |||
| 1883 | Ga0070706_100053802 | |||
| 1884 | Ga0070707_100231307 | |||
| 1885 | Ga0070679_100009410 | |||
| 1886 | Ga0070679_100211019 | |||
| 1887 | Ga0068853_100038063 | |||
| 1888 | Ga0070672_100002630 | |||
| 1889 | Ga0070672_100006856 | |||
| 1890 | Ga0070672_100186632 | |||
| 1891 | Ga0070686_100000272 | |||
| 1892 | Ga0070695_100023988 | |||
| 1893 | Ga0070696_100001233 | |||
| 1894 | Ga0070696_100141265 | |||
| 1895 | Ga0070693_100023166 | |||
| 1896 | Ga0070693_100108794 | |||
| 1897 | Ga0070693_100152543 | |||
| 1898 | Ga0070665_100041154 | |||
| 1899 | Ga0070665_100160574 | |||
| 1900 | Ga0070665_100168686 | |||
| 1901 | Ga0070665_100308882 | |||
| 1902 | Ga0070704_100056358 | |||
| 1903 | Ga0068855_100000737 | |||
| 1904 | Ga0068855_100000815 | |||
| 1905 | Ga0068855_100001553 | |||
| 1906 | Ga0068855_100040158 | |||
| 1907 | Ga0068855_100095907 | |||
| 1908 | Ga0068855_100325935 | |||
| 1909 | Ga0068855_100476898 | |||
| 1910 | Ga0070664_100000008 | |||
| 1911 | Ga0070664_100003658 | |||
| 1912 | Ga0070664_100004893 | |||
| 1913 | Ga0070664_100161817 | |||
| 1914 | Ga0068857_100055062 | |||
| 1915 | Ga0068857_100318888 | |||
| 1916 | Ga0068854_100000052 | |||
| 1917 | Ga0068854_100008124 | |||
| 1918 | Ga0068856_100000009 | |||
| 1919 | Ga0068856_100149005 | |||
| 1920 | Ga0070702_100000407 | |||
| 1921 | Ga0070702_100004309 | |||
| 1922 | Ga0068852_100002640 | |||
| 1923 | Ga0068852_100160333 | |||
| 1924 | Ga0068852_100219161 | |||
| 1925 | Ga0068852_100389284 | |||
| 1926 | Ga0068852_100413954 | |||
| 1927 | Ga0068859_100008729 | |||
| 1928 | Ga0068859_100018133 | |||
| 1929 | Ga0068859_100032679 | |||
| 1930 | Ga0068859_100032776 | |||
| 1931 | Ga0068859_100098274 | |||
| 1932 | Ga0068859_100285290 | |||
| 1933 | Ga0068864_100000301 | |||
| 1934 | Ga0068864_100001408 | |||
| 1935 | Ga0068864_100001954 | |||
| 1936 | Ga0068864_100049249 | |||
| 1937 | Ga0068864_100066142 | |||
| 1938 | Ga0068864_100066178 | |||
| 1939 | Ga0068864_100128503 | |||
| 1940 | Ga0068866_10000770 | |||
| 1941 | Ga0068866_10013144 | |||
| 1942 | Ga0068866_10018051 | |||
| 1943 | Ga0068866_10137178 | |||
| 1944 | Ga0068861_100000996 | |||
| 1945 | Ga0068861_100030681 | |||
| 1946 | Ga0068861_100130472 | |||
| 1947 | Ga0068861_100244937 | |||
| 1948 | Ga0068851_10066176 | |||
| 1949 | Ga0068851_10073071 | |||
| 1950 | Ga0068870_10036270 | |||
| 1951 | Ga0068870_10046154 | |||
| 1952 | Ga0068863_100003618 | |||
| 1953 | Ga0068863_100010572 | |||
| 1954 | Ga0068863_100034955 | |||
| 1955 | Ga0068863_100035413 | |||
| 1956 | Ga0068863_100052718 | |||
| 1957 | Ga0068863_100141743 | |||
| 1958 | Ga0068858_100002585 | |||
| 1959 | Ga0068858_100004088 | |||
| 1960 | Ga0068858_100013329 | |||
| 1961 | Ga0068858_100134144 | |||
| 1962 | Ga0068858_100374660 | |||
| 1963 | Ga0068860_100003547 | |||
| 1964 | Ga0068860_100006642 | |||
| 1965 | Ga0068860_100029667 | |||
| 1966 | Ga0068860_100162999 | |||
| 1967 | Ga0068862_100016245 | |||
| 1968 | Ga0068862_100191503 | |||
| 1969 | Ga0068862_100341891 | |||
| 1970 | Ga0075363_100034013 | |||
| 1971 | Ga0075364_10118996 | |||
| 1972 | Ga0070712_100085781 | |||
| 1973 | Ga0070712_100332577 | |||
| 1974 | Ga0075366_10055199 | |||
| 1975 | Ga0075366_10178045 | |||
| 1976 | Ga0097621_100002183 | |||
| 1977 | Ga0097621_100003026 | |||
| 1978 | Ga0097621_100013211 | |||
| 1979 | Ga0097621_100053316 | |||
| 1980 | Ga0097621_100174544 | |||
| 1981 | Ga0097621_100229009 | |||
| 1982 | Ga0075370_10004770 | |||
| 1983 | Ga0068871_100001574 | |||
| 1984 | Ga0068871_100004804 | |||
| 1985 | Ga0068871_100011159 | |||
| 1986 | Ga0068871_100042062 | |||
| 1987 | Ga0068871_100061397 | |||
| 1988 | Ga0068871_100093508 | |||
| 1989 | Ga0068865_100008523 | |||
| 1990 | Ga0068865_100019794 | |||
| 1991 | Ga0068865_100023667 | |||
| 1992 | Ga0097620_100008729 | |||
| 1993 | Ga0097620_100018133 | |||
| 1994 | Ga0097620_100032680 | |||
| 1995 | Ga0097620_100032778 | |||
| 1996 | Ga0097620_100098272 | |||
| 1997 | Ga0097620_100285291 | |||
| 1998 | Ga0079104_1006336 | |||
| 1999 | Ga0099795_10000125 | |||
| 2000 | Ga0105251_10000134 | |||
| 2001 | Ga0105251_10005177 | |||
| 2002 | Ga0105251_10013971 | |||
| 2003 | Ga0105251_10022862 | |||
| 2004 | Ga0105244_10005315 | |||
| 2005 | Ga0105244_10013656 | |||
| 2006 | Ga0105244_10038044 | |||
| 2007 | Ga0105250_10000008 | |||
| 2008 | Ga0105240_10003806 | |||
| 2009 | Ga0105240_10005169 | |||
| 2010 | Ga0105240_10027418 | |||
| 2011 | Ga0105240_10089502 | |||
| 2012 | Ga0105240_10094157 | |||
| 2013 | Ga0105240_10097409 | |||
| 2014 | Ga0105245_10000811 | |||
| 2015 | Ga0105245_10028867 | |||
| 2016 | Ga0105245_10107064 | |||
| 2017 | Ga0105245_10160119 | |||
| 2018 | Ga0105245_10163390 | |||
| 2019 | Ga0105245_10267668 | |||
| 2020 | Ga0105245_10477174 | |||
| 2021 | Ga0105243_10004077 | |||
| 2022 | Ga0105243_10008031 | |||
| 2023 | Ga0105243_10016549 | |||
| 2024 | Ga0105243_10141916 | |||
| 2025 | Ga0105241_10027698 | |||
| 2026 | Ga0105241_10044354 | |||
| 2027 | Ga0105241_10084332 | |||
| 2028 | Ga0105242_10005513 | |||
| 2029 | Ga0105242_10017277 | |||
| 2030 | Ga0105242_10066139 | |||
| 2031 | Ga0105242_10128169 | |||
| 2032 | Ga0105242_10227497 | |||
| 2033 | Ga0105248_10001495 | |||
| 2034 | Ga0105248_10005155 | |||
| 2035 | Ga0105248_10009050 | |||
| 2036 | Ga0105248_10015971 | |||
| 2037 | Ga0105248_10089029 | |||
| 2038 | Ga0105248_10151138 | |||
| 2039 | Ga0105237_10000784 | |||
| 2040 | Ga0105237_10066264 | |||
| 2041 | Ga0105237_10107544 | |||
| 2042 | Ga0105238_10005552 | |||
| 2043 | Ga0105238_10071538 | |||
| 2044 | Ga0105249_10025378 | |||
| 2045 | Ga0105249_10045520 | |||
| 2046 | Ga0099796_10026691 | |||
| 2047 | Ga0105239_10008150 | |||
| 2048 | Ga0105239_10021748 | |||
| 2049 | Ga0105239_10059776 | |||
| 2050 | Ga0105239_10156668 | |||
| 2051 | Ga0105239_10201344 | |||
| 2052 | Ga0105246_10171772 | |||
| 2053 | Ga0157373_10001549 | |||
| 2054 | Ga0157373_10015465 | |||
| 2055 | Ga0157373_10020555 | |||
| 2056 | Ga0157371_10000068 | |||
| 2057 | Ga0157371_10015589 | |||
| 2058 | Ga0157370_10001130 | |||
| 2059 | Ga0157370_10002304 | |||
| 2060 | Ga0157370_10002933 | |||
| 2061 | Ga0157370_10165182 | |||
| 2062 | Ga0157369_10000724 | |||
| 2063 | Ga0157369_10001199 | |||
| 2064 | Ga0157369_10002274 | |||
| 2065 | Ga0157369_10008205 | |||
| 2066 | Ga0157369_10201089 | |||
| 2067 | Ga0157374_10000044 | |||
| 2068 | Ga0157374_10004186 | |||
| 2069 | Ga0157374_10303450 | |||
| 2070 | Ga0157374_10339350 | |||
| 2071 | Ga0157378_10000762 | |||
| 2072 | Ga0157378_10002340 | |||
| 2073 | Ga0157378_10009123 | |||
| 2074 | Ga0157378_10012649 | |||
| 2075 | Ga0157378_10129186 | |||
| 2076 | Ga0163162_10001049 | |||
| 2077 | Ga0163162_10002545 | |||
| 2078 | Ga0163162_10003910 | |||
| 2079 | Ga0163162_10018428 | |||
| 2080 | Ga0163162_10025300 | |||
| 2081 | Ga0163162_10030772 | |||
| 2082 | Ga0163162_10215707 | |||
| 2083 | Ga0163162_10336427 | |||
| 2084 | Ga0157372_10000271 | |||
| 2085 | Ga0157372_10001941 | |||
| 2086 | Ga0157375_10003567 | |||
| 2087 | Ga0157375_10003891 | |||
| 2088 | Ga0157375_10009927 | |||
| 2089 | Ga0157375_10014532 | |||
| 2090 | Ga0157375_10086658 | |||
| 2091 | Ga0157375_10124474 | |||
| 2092 | Ga0157375_10181589 | |||
| 2093 | Ga0163163_10002307 | |||
| 2094 | Ga0157380_10002831 | |||
| 2095 | Ga0182008_10003181 | |||
| 2096 | Ga0157379_10000072 | |||
| 2097 | Ga0157379_10001980 | |||
| 2098 | Ga0157379_10007685 | |||
| 2099 | Ga0157379_10092868 | |||
| 2100 | Ga0157376_10027762 | |||
| 2101 | Ga0157376_10124972 | |||
| 2102 | Ga0157376_10134964 | |||
| 2103 | Ga0157376_10196684 | |||
| 2104 | Ga0157376_10322571 | |||
| 2105 | Ga0182006_1000002 | |||
| 2106 | Ga0182006_1005807 | |||
| 2107 | Ga0182006_1037965 | |||
| 2108 | Ga0182007_10000090 | |||
| 2109 | Ga0182007_10002950 | |||
| 2110 | Ga0182007_10011396 | |||
| 2111 | Ga0182007_10020871 | |||
| 2112 | Ga0182005_1000070 | |||
| 2113 | Ga0182005_1000656 | |||
| 2114 | Ga0182005_1031815 | |||
| 2115 | Ga0183362_10005 | |||
| 2116 | Ga0183361_10013 | |||
| 2117 | Ga0163161_10012761 | |||
| 2118 | Ga0163161_10024519 | |||
| 2119 | Ga0163161_10031877 | |||
| 2120 | Ga0163161_10064501 | |||
| 2121 | Ga0163161_10172340 | |||
| 2122 | Ga0163161_10176084 | |||
| 2123 | Ga0206349_1385556 | |||
| 2124 | Ga0206351_10134375 | |||
| 2125 | Ga0154015_1636926 | |||
| 2126 | Ga0213872_10000769 | |||
| 2127 | Ga0213872_10001970 | |||
| 2128 | Ga0213872_10030368 | |||
| 2129 | Ga0213875_10125441 | |||
| 2130 | Ga0224712_10000142 | |||
| 2131 | Ga0209784_100003 | |||
| 2132 | Ga0209784_100039 | |||
| 2133 | Ga0209784_100860 | |||
| 2134 | Ga0209566_100002 | |||
| 2135 | Ga0209566_100023 | |||
| 2136 | Ga0209566_100545 | |||
| 2137 | Ga0209566_100699 | |||
| 2138 | Ga0209566_101882 | |||
| 2139 | Ga0209674_100005 | |||
| 2140 | Ga0209674_100008 | |||
| 2141 | Ga0209674_100040 | |||
| 2142 | Ga0209674_100103 | |||
| 2143 | Ga0209674_100423 | |||
| 2144 | Ga0209672_100001 | |||
| 2145 | Ga0209672_100014 | |||
| 2146 | Ga0209672_100052 | |||
| 2147 | Ga0209672_100085 | |||
| 2148 | Ga0209672_101885 | |||
| 2149 | Ga0209147_100001 | |||
| 2150 | Ga0209147_100002 | |||
| 2151 | Ga0209147_100087 | |||
| 2152 | Ga0209147_100125 | |||
| 2153 | Ga0209563_100004 | |||
| 2154 | Ga0209563_100007 | |||
| 2155 | Ga0209563_100072 | |||
| 2156 | Ga0209563_100892 | |||
| 2157 | Ga0207427_100513 | |||
| 2158 | Ga0207427_101254 | |||
| 2159 | Ga0209437_100097 | |||
| 2160 | Ga0209258_100001 | |||
| 2161 | Ga0209258_100002 | |||
| 2162 | Ga0209258_100040 | |||
| 2163 | Ga0209258_100203 | |||
| 2164 | Ga0207425_1000284 | |||
| 2165 | Ga0209646_1000059 | |||
| 2166 | Ga0209646_1000087 | |||
| 2167 | Ga0209026_1003130 | |||
| 2168 | Ga0209677_100009 | |||
| 2169 | Ga0209677_100041 | |||
| 2170 | Ga0209677_103052 | |||
| 2171 | Ga0209148_1000003 | |||
| 2172 | Ga0209148_1000021 | |||
| 2173 | Ga0209148_1000035 | |||
| 2174 | Ga0209148_1000211 | |||
| 2175 | Ga0209148_1000553 | |||
| 2176 | Ga0209148_1005780 | |||
| 2177 | Ga0209759_1000188 | |||
| 2178 | Ga0209759_1000284 | |||
| 2179 | Ga0209759_1000519 | |||
| 2180 | Ga0209759_1002173 | |||
| 2181 | Ga0209759_1002486 | |||
| 2182 | Ga0209759_1008232 | |||
| 2183 | Ga0209233_1000043 | |||
| 2184 | Ga0209233_1000122 | |||
| 2185 | Ga0207666_1005297 | |||
| 2186 | Ga0209455_1000001 | |||
| 2187 | Ga0209455_1000021 | |||
| 2188 | Ga0209455_1000026 | |||
| 2189 | Ga0209455_1000200 | |||
| 2190 | Ga0209673_1000030 | |||
| 2191 | Ga0209025_1000178 | |||
| 2192 | Ga0209025_1006590 | |||
| 2193 | Ga0209564_1000009 | |||
| 2194 | Ga0209564_1000045 | |||
| 2195 | Ga0209564_1004734 | |||
| 2196 | Ga0209564_1013455 | |||
| 2197 | Ga0209758_1000489 | |||
| 2198 | Ga0207426_1000050 | |||
| 2199 | Ga0207426_1002220 | |||
| 2200 | Ga0209051_1028714 | |||
| 2201 | Ga0207656_10073863 | |||
| 2202 | Ga0207656_10112379 | |||
| 2203 | Ga0207696_1000106 | |||
| 2204 | Ga0207655_1002220 | |||
| 2205 | Ga0207655_1021992 | |||
| 2206 | Ga0207713_1001542 | |||
| 2207 | Ga0207713_1025007 | |||
| 2208 | Ga0207682_10005455 | |||
| 2209 | Ga0207682_10014750 | |||
| 2210 | Ga0207642_10006349 | |||
| 2211 | Ga0207642_10071307 | |||
| 2212 | Ga0207642_10087743 | |||
| 2213 | Ga0207642_10118430 | |||
| 2214 | Ga0207680_10002694 | |||
| 2215 | Ga0207680_10021359 | |||
| 2216 | Ga0207680_10041483 | |||
| 2217 | Ga0207647_10000310 | |||
| 2218 | Ga0207647_10002433 | |||
| 2219 | Ga0207647_10009655 | |||
| 2220 | Ga0207645_10006661 | |||
| 2221 | Ga0207645_10012955 | |||
| 2222 | Ga0207645_10159775 | |||
| 2223 | Ga0207645_10171204 | |||
| 2224 | Ga0207643_10004408 | |||
| 2225 | Ga0207705_10002739 | |||
| 2226 | Ga0207705_10004282 | |||
| 2227 | Ga0207705_10025889 | |||
| 2228 | Ga0207705_10089152 | |||
| 2229 | Ga0207705_10174932 | |||
| 2230 | Ga0207684_10223120 | |||
| 2231 | Ga0207654_10039705 | |||
| 2232 | Ga0207707_10002855 | |||
| 2233 | Ga0207707_10227942 | |||
| 2234 | Ga0207695_10001909 | |||
| 2235 | Ga0207695_10005290 | |||
| 2236 | Ga0207695_10014738 | |||
| 2237 | Ga0207695_10021190 | |||
| 2238 | Ga0207695_10086432 | |||
| 2239 | Ga0207695_10095513 | |||
| 2240 | Ga0207695_10121166 | |||
| 2241 | Ga0207695_10286291 | |||
| 2242 | Ga0207695_10369677 | |||
| 2243 | Ga0207671_10023429 | |||
| 2244 | Ga0207671_10032527 | |||
| 2245 | Ga0207671_10040198 | |||
| 2246 | Ga0207671_10074464 | |||
| 2247 | Ga0207663_10044605 | |||
| 2248 | Ga0207660_10059452 | |||
| 2249 | Ga0207662_10013387 | |||
| 2250 | Ga0207657_10000004 | |||
| 2251 | Ga0207657_10000974 | |||
| 2252 | Ga0207657_10017545 | |||
| 2253 | Ga0207657_10103608 | |||
| 2254 | Ga0207657_10111711 | |||
| 2255 | Ga0207649_10000321 | |||
| 2256 | Ga0207649_10006430 | |||
| 2257 | Ga0207649_10043427 | |||
| 2258 | Ga0207649_10113460 | |||
| 2259 | Ga0207649_10161945 | |||
| 2260 | Ga0207652_10007499 | |||
| 2261 | Ga0207646_10307961 | |||
| 2262 | Ga0207681_10069468 | |||
| 2263 | Ga0207681_10123940 | |||
| 2264 | Ga0207681_10128694 | |||
| 2265 | Ga0207694_10005553 | |||
| 2266 | Ga0207694_10041086 | |||
| 2267 | Ga0207650_10004906 | |||
| 2268 | Ga0207650_10010329 | |||
| 2269 | Ga0207650_10045979 | |||
| 2270 | Ga0207650_10165999 | |||
| 2271 | Ga0207659_10000771 | |||
| 2272 | Ga0207659_10001624 | |||
| 2273 | Ga0207659_10052733 | |||
| 2274 | Ga0207687_10002292 | |||
| 2275 | Ga0207687_10224731 | |||
| 2276 | Ga0207664_10059393 | |||
| 2277 | Ga0207664_10181073 | |||
| 2278 | Ga0207664_10240736 | |||
| 2279 | Ga0207644_10002036 | |||
| 2280 | Ga0207644_10003925 | |||
| 2281 | Ga0207644_10032467 | |||
| 2282 | Ga0207644_10073856 | |||
| 2283 | Ga0207690_10000015 | |||
| 2284 | Ga0207690_10002377 | |||
| 2285 | Ga0207690_10002753 | |||
| 2286 | Ga0207706_10015304 | |||
| 2287 | Ga0207706_10028137 | |||
| 2288 | Ga0207706_10055728 | |||
| 2289 | Ga0207706_10165742 | |||
| 2290 | Ga0207686_10001170 | |||
| 2291 | Ga0207686_10091538 | |||
| 2292 | Ga0207686_10129376 | |||
| 2293 | Ga0207709_10101869 | |||
| 2294 | Ga0207709_10135983 | |||
| 2295 | Ga0207670_10009527 | |||
| 2296 | Ga0207670_10143651 | |||
| 2297 | Ga0207669_10004101 | |||
| 2298 | Ga0207669_10004845 | |||
| 2299 | Ga0207669_10057512 | |||
| 2300 | Ga0207669_10149603 | |||
| 2301 | Ga0207704_10002682 | |||
| 2302 | Ga0207704_10009290 | |||
| 2303 | Ga0207704_10029386 | |||
| 2304 | Ga0207704_10159156 | |||
| 2305 | Ga0207704_10242480 | |||
| 2306 | Ga0207665_10005065 | |||
| 2307 | Ga0207691_10002661 | |||
| 2308 | Ga0207691_10003475 | |||
| 2309 | Ga0207691_10013941 | |||
| 2310 | Ga0207691_10014690 | |||
| 2311 | Ga0207691_10126716 | |||
| 2312 | Ga0207691_10217818 | |||
| 2313 | Ga0207711_10014772 | |||
| 2314 | Ga0207711_10019262 | |||
| 2315 | Ga0207711_10099337 | |||
| 2316 | Ga0207711_10121155 | |||
| 2317 | Ga0207689_10000262 | |||
| 2318 | Ga0207689_10000320 | |||
| 2319 | Ga0207689_10034893 | |||
| 2320 | Ga0207689_10138736 | |||
| 2321 | Ga0207661_10030207 | |||
| 2322 | Ga0207679_10000001 | |||
| 2323 | Ga0207679_10009872 | |||
| 2324 | Ga0207679_10020920 | |||
| 2325 | Ga0207667_10000025 | |||
| 2326 | Ga0207667_10000067 | |||
| 2327 | Ga0207667_10000524 | |||
| 2328 | Ga0207667_10004154 | |||
| 2329 | Ga0207667_10023097 | |||
| 2330 | Ga0207667_10148763 | |||
| 2331 | Ga0207667_10258319 | |||
| 2332 | Ga0207651_10003548 | |||
| 2333 | Ga0207651_10008458 | |||
| 2334 | Ga0207651_10115169 | |||
| 2335 | Ga0207651_10195788 | |||
| 2336 | Ga0207712_10006896 | |||
| 2337 | Ga0207712_10026515 | |||
| 2338 | Ga0207712_10029591 | |||
| 2339 | Ga0207668_10200597 | |||
| 2340 | Ga0207640_10000035 | |||
| 2341 | Ga0207640_10004211 | |||
| 2342 | Ga0207658_10001963 | |||
| 2343 | Ga0207658_10022693 | |||
| 2344 | Ga0207658_10043501 | |||
| 2345 | Ga0207658_10054480 | |||
| 2346 | Ga0207677_10001098 | |||
| 2347 | Ga0207677_10002070 | |||
| 2348 | Ga0207677_10087840 | |||
| 2349 | Ga0207677_10175582 | |||
| 2350 | Ga0207703_10003733 | |||
| 2351 | Ga0207703_10004880 | |||
| 2352 | Ga0207639_10053857 | |||
| 2353 | Ga0207639_10073257 | |||
| 2354 | Ga0207639_10561477 | |||
| 2355 | Ga0207678_10000001 | |||
| 2356 | Ga0207678_10003809 | |||
| 2357 | Ga0207678_10036529 | |||
| 2358 | Ga0207678_10144662 | |||
| 2359 | Ga0207708_10000360 | |||
| 2360 | Ga0207708_10005611 | |||
| 2361 | Ga0207708_10053167 | |||
| 2362 | Ga0207702_10001757 | |||
| 2363 | Ga0207702_10195031 | |||
| 2364 | Ga0207641_10004096 | |||
| 2365 | Ga0207641_10028228 | |||
| 2366 | Ga0207641_10030375 | |||
| 2367 | Ga0207641_10030589 | |||
| 2368 | Ga0207641_10045055 | |||
| 2369 | Ga0207641_10084526 | |||
| 2370 | Ga0207648_10000376 | |||
| 2371 | Ga0207648_10000853 | |||
| 2372 | Ga0207648_10009628 | |||
| 2373 | Ga0207648_10051572 | |||
| 2374 | Ga0207648_10059286 | |||
| 2375 | Ga0207648_10069098 | |||
| 2376 | Ga0207648_10142950 | |||
| 2377 | Ga0207676_10000951 | |||
| 2378 | Ga0207676_10077387 | |||
| 2379 | Ga0207676_10095953 | |||
| 2380 | Ga0207674_10003354 | |||
| 2381 | Ga0207674_10030381 | |||
| 2382 | Ga0207674_10172302 | |||
| 2383 | Ga0207675_100000300 | |||
| 2384 | Ga0207675_100000415 | |||
| 2385 | Ga0207675_100008514 | |||
| 2386 | Ga0207675_100011304 | |||
| 2387 | Ga0207675_100066430 | |||
| 2388 | Ga0207675_100102890 | |||
| 2389 | Ga0207675_100281068 | |||
| 2390 | Ga0207683_10002476 | |||
| 2391 | Ga0207683_10003438 | |||
| 2392 | Ga0207683_10007432 | |||
| 2393 | Ga0207683_10025141 | |||
| 2394 | Ga0207683_10040768 | |||
| 2395 | Ga0207683_10056418 | |||
| 2396 | Ga0207683_10218872 | |||
| 2397 | Ga0207683_10231700 | |||
| 2398 | Ga0207683_10553540 | |||
| 2399 | Ga0207698_10006837 | |||
| 2400 | Ga0207698_10073804 | |||
| 2401 | Ga0207698_10552491 | |||
| 2402 | Ga0209371_1000399 | |||
| 2403 | Ga0209179_1000750 | |||
| 2404 | Ga0209282_1000019 | |||
| 2405 | Ga0265356_1000985 | |||
| 2406 | Ga0268266_10094225 | |||
| 2407 | Ga0268266_10129822 | |||
| 2408 | Ga0268266_10174342 | |||
| 2409 | Ga0268265_10030320 | |||
| 2410 | Ga0268265_10079835 | |||
| 2411 | Ga0268264_10009764 | |||
| 2412 | Ga0268264_10501233 | |||
| 2413 | Ga0265334_10000010 | |||
| 2414 | Ga0265318_10054665 | |||
| 2415 | Ga0265336_10000529 | |||
| 2416 | Ga0307517_10031334 | |||
| 2417 | Ga0307515_10122568 | |||
| 2418 | Ga0307515_10184217 | |||
| 2419 | Ga0265338_10000022 | |||
| 2420 | Ga0265338_10001008 | |||
| 2421 | Ga0265338_10028579 | |||
| 2422 | Ga0265324_10000034 | |||
| 2423 | Ga0265324_10000669 | |||
| 2424 | Ga0268256_1000238 | |||
| 2425 | Ga0265760_10002495 | |||
| 2426 | Ga0265332_10005254 | |||
| 2427 | Ga0265320_10023346 | |||
| 2428 | Ga0265325_10000663 | |||
| 2429 | Ga0265325_10003426 | |||
| 2430 | Ga0265331_10003526 | |||
| 2431 | Ga0265331_10006877 | |||
| 2432 | Ga0265331_10040228 | |||
| 2433 | Ga0265327_10000572 | |||
| 2434 | Ga0265327_10000638 | |||
| 2435 | Ga0265327_10001646 | |||
| 2436 | Ga0265327_10002259 | |||
| 2437 | Ga0265316_10039434 | |||
| 2438 | Ga0265316_10155450 | |||
| 2439 | Ga0307513_10088095 | |||
| 2440 | Ga0265313_10000068 | |||
| 2441 | Ga0265313_10006502 | |||
| 2442 | Ga0316575_10000457 | |||
| 2443 | Ga0265314_10001850 | |||
| 2444 | Ga0265314_10058682 | |||
| 2445 | Ga0265314_10074206 | |||
| 2446 | Ga0265314_10074775 | |||
| 2447 | Ga0265342_10007593 | |||
| 2448 | Ga0316576_10017518 | |||
| 2449 | Ga0307516_10000012 | |||
| 2450 | Ga0307412_10000024 | |||
| 2451 | Ga0316583_10000196 | |||
| 2452 | Ga0373953_0079184 | |||
| 2453 | Ga0373960_0006680 | |||
| 2454 | Ga0373943_0223809 | |||
| 2455 | Ga0316574_0010832 | |||
| 2456 | Ga0373924_0110445 | |||
| 2457 | Ga0373927_0000002 | |||
| 2458 | Ga0373927_0023190 | |||
| 2459 | Ga0373937_0090490 | |||
| 2460 | Ga0373937_0349722 | |||
| 2461 | Ga0316584_0019586 | |||
| 2462 | Ga0316584_0019651 | |||
| 2463 | Ga0395899_0000035 | |||
| 2464 | Ga0395899_0000344 | |||
| 2465 | Ga0395899_0002002 | |||
| 2466 | Ga0395899_0002788 | |||
| 2467 | Ga0395899_0010729 | |||
| 2468 | Ga0395899_0014012 | |||
| 2469 | Ga0395899_0040985 | |||
| 2470 | Ga0395899_0087664 | |||
| 2471 | Ga0395900_0000190 | |||
| 2472 | Ga0395900_0000198 | |||
| 2473 | Ga0395900_0001100 | |||
| 2474 | Ga0395900_0001935 | |||
| 2475 | Ga0395900_0007915 | |||
| 2476 | Ga0395900_0015064 | |||
| 2477 | Ga0395900_0018384 | |||
| 2478 | Ga0395900_0026828 | |||
| 2479 | Ga0395900_0044784 | |||
| 2480 | Ga0395900_0088619 | |||
| 2481 | Ga0395900_0118808 | |||
| 2482 | Ga0395900_0211239 | |||
| 2483 | Ga0395898_0000199 | |||
| 2484 | Ga0395898_0000374 | |||
| 2485 | Ga0395898_0016768 | |||
| 2486 | Ga0395898_0059651 | |||
| 2487 | Ga0395898_0115582 | |||
| 2488 | Ga0395898_0176886 | |||
| 2489 | Ga0395898_0228302 | |||
| 2490 | Ga0395905_0000041 | |||
| 2491 | Ga0395905_0001591 | |||
| 2492 | Ga0395905_0009860 | |||
| 2493 | Ga0395905_0016277 | |||
| 2494 | Ga0395905_0085997 | |||
| 2495 | Ga0395905_0105715 | |||
| 2496 | Ga0395905_0139127 | |||
| 2497 | Ga0436364_0817049 | |||
| 2498 | Ga0395901_0000062 | |||
| 2499 | Ga0395901_0000533 | |||
| 2500 | Ga0395901_0001105 | |||
| 2501 | Ga0395901_0001593 | |||
| 2502 | Ga0395901_0002094 | |||
| 2503 | Ga0395901_0015314 | |||
| 2504 | Ga0395901_0055086 | |||
| 2505 | Ga0395901_0187733 | |||
| 2506 | Ga0395901_0196405 | |||
| 2507 | Ga0436365_1589949 | |||
| 2508 | Ga0436361_0598612 | |||
| 2509 | Ga0436361_0695623 | |||
| 2510 | Ga0436361_0836240 | |||
| 2511 | Ga0436361_0900465 | |||
| 2512 | Ga0436361_0904231 | |||
| 2513 | Ga0436361_1196706 | |||
| 2514 | Ga0451843_0123709 | |||
| 2515 | Ga0451853_0053840 | |||
| 2516 | Ga0439448_0000093 | |||
| 2517 | Ga0439448_0033168 | |||
| 2518 | Ga0439455_0010495 | |||
| 2519 | Ga0439458_0007162 | |||
| 2520 | Ga0451577_0000002 | |||
| 2521 | Ga0451577_0060007 | |||
| 2522 | Ga0451577_0115543 | |||
| 2523 | Ga0451577_0125081 | |||
| 2524 | Ga0466969_0004435 | |||
| 2525 | Ga0466969_0031708 | |||
| 2526 | Ga0466969_0084529 | |||
| 2527 | Ga0466972_0000070 | |||
| 2528 | Ga0466972_0012234 | |||
| 2529 | Ga0466972_0017028 | |||
| 2530 | Ga0466972_0036629 | |||
| 2531 | Ga0453683_0000003 | |||
| 2532 | Ga0466965_0000058 | |||
| 2533 | Ga0466965_0008647 | |||
| 2534 | Ga0466965_0034770 | |||
| 2535 | Ga0466966_0001378 | |||
| 2536 | Ga0466966_0021502 | |||
| 2537 | Ga0466966_0046014 | |||
| 2538 | Ga0466966_0149103 | |||
| 2539 | Ga0466961_0000830 | |||
| 2540 | Ga0466961_0004504 | |||
| 2541 | Ga0466961_0014767 | |||
| 2542 | Ga0466963_0001295 | |||
| 2543 | Ga0466963_0015296 | |||
| 2544 | Ga0466963_0020392 | |||
| 2545 | Ga0466964_0000748 | |||
| 2546 | Ga0453684_0000002 | |||
| 2547 | Ga0466971_0001966 | |||
| 2548 | Ga0466968_0004778 | |||
| 2549 | Ga0466968_0006364 | |||
| 2550 | Ga0466968_0047003 | |||
| 2551 | Ga0466970_0002802 | |||
| 2552 | Ga0466970_0070017 | |||
| 2553 | Ga0466957_0000140 | |||
| 2554 | Ga0466957_0003144 | |||
| 2555 | Ga0466957_0008820 | |||
| 2556 | Ga0466957_0038666 | |||
| 2557 | Ga0466957_0091231 | |||
| 2558 | Ga0466959_0000387 | |||
| 2559 | Ga0466959_0014205 | |||
| 2560 | Ga0466959_0026242 | |||
| 2561 | Ga0466959_0026333 | |||
| 2562 | Ga0466959_0047272 | |||
| 2563 | Ga0466959_0063245 | |||
| 2564 | Ga0451576_0001215 | |||
| 2565 | Ga0466958_0001550 | |||
| 2566 | Ga0466958_0005578 | |||
| 2567 | Ga0466958_0027829 | |||
| 2568 | Ga0466967_0093791 | |||
| 2569 | Ga0466967_0148667 | |||
| 2570 | Ga0495617_000029 | |||
| 2571 | Ga0495617_000049 | |||
| 2572 | Ga0495617_002469 | |||
| 2573 | Ga0495617_003907 | |||
| 2574 | Ga0495627_000243 | |||
| 2575 | Ga0495627_014622 | |||
| 2576 | Ga0495627_044236 | |||
| 2577 | Ga0495592_0001143 | |||
| 2578 | Ga0495592_0021865 | |||
| 2579 | Ga0495603_0007272 | |||
| 2580 | Ga0495603_0030796 | |||
| 2581 | Ga0495603_0032291 | |||
| 2582 | Ga0495590_0000003 | |||
| 2583 | Ga0495590_0000071 | |||
| 2584 | Ga0495590_0000520 | |||
| 2585 | Ga0495590_0002164 | |||
| 2586 | Ga0495590_0016567 | |||
| 2587 | Ga0495590_0020173 | |||
| 2588 | Ga0495591_000302 | |||
| 2589 | Ga0495591_010370 | |||
| 2590 | Ga0495629_0001179 | |||
| 2591 | Ga0495629_0002054 | |||
| 2592 | Ga0495629_0016485 | |||
| 2593 | Ga0495629_0021355 | |||
| 2594 | Ga0495629_0038980 | |||
| 2595 | Ga0495638_0000091 | |||
| 2596 | Ga0495638_0003603 | |||
| 2597 | Ga0495638_0022951 | |||
| 2598 | Ga0495638_0044764 | |||
| 2599 | Ga0495638_0066869 | |||
| 2600 | Ga0495651_0004530 | |||
| 2601 | Ga0495651_0033766 | |||
| 2602 | Ga0495651_0061436 | |||
| 2603 | Ga0495653_0000013 | |||
| 2604 | Ga0495653_0011174 | |||
| 2605 | Ga0495653_0014977 | |||
| 2606 | Ga0495653_0026309 | |||
| 2607 | Ga0495653_0032069 | |||
| 2608 | Ga0495653_0039805 | |||
| 2609 | Ga0495653_0050022 | |||
| 2610 | Ga0495650_0000011 | |||
| 2611 | Ga0495650_0000051 | |||
| 2612 | Ga0495650_0000097 | |||
| 2613 | Ga0495650_0000314 | |||
| 2614 | Ga0495650_0000343 | |||
| 2615 | Ga0495650_0000928 | |||
| 2616 | Ga0495650_0002256 | |||
| 2617 | Ga0495650_0003703 | |||
| 2618 | Ga0495650_0007227 | |||
| 2619 | Ga0495650_0008161 | |||
| 2620 | Ga0495650_0012542 | |||
| 2621 | Ga0495650_0014413 | |||
| 2622 | Ga0495650_0022575 | |||
| 2623 | Ga0495580_0001176 | |||
| 2624 | Ga0495580_0018947 | |||
| 2625 | Ga0495580_0021175 | |||
| 2626 | Ga0495580_0030459 | |||
| 2627 | Ga0495580_0089451 | |||
| 2628 | Ga0495580_0095561 | |||
| 2629 | Ga0495580_0104952 | |||
| 2630 | Ga0495582_0004931 | |||
| 2631 | Ga0495582_0011386 | |||
| 2632 | Ga0495582_0045514 | |||
| 2633 | Ga0495605_0000234 | |||
| 2634 | Ga0495605_0000251 | |||
| 2635 | Ga0495605_0005192 | |||
| 2636 | Ga0495605_0005507 | |||
| 2637 | Ga0495605_0006769 | |||
| 2638 | Ga0495605_0007871 | |||
| 2639 | Ga0495605_0008862 | |||
| 2640 | Ga0495605_0018518 | |||
| 2641 | Ga0495605_0037474 | |||
| 2642 | Ga0495605_0041092 | |||
| 2643 | Ga0495605_0042368 | |||
| 2644 | Ga0495639_0039762 | |||
| 2645 | Ga0495639_0074782 | |||
| 2646 | Ga0495664_0015882 | |||
| 2647 | Ga0495664_0085430 | |||
| 2648 | Ga0495584_0000008 | |||
| 2649 | Ga0495584_0000155 | |||
| 2650 | Ga0495584_0002111 | |||
| 2651 | Ga0495584_0002139 | |||
| 2652 | Ga0495584_0003852 | |||
| 2653 | Ga0495584_0007277 | |||
| 2654 | Ga0495584_0021584 | |||
| 2655 | Ga0495584_0035140 | |||
| 2656 | Ga0495584_0046173 | |||
| 2657 | Ga0495585_0000139 | |||
| 2658 | Ga0495585_0000285 | |||
| 2659 | Ga0495585_0001306 | |||
| 2660 | Ga0495585_0001720 | |||
| 2661 | Ga0495585_0005485 | |||
| 2662 | Ga0495585_0008284 | |||
| 2663 | Ga0495585_0013629 | |||
| 2664 | Ga0495585_0022115 | |||
| 2665 | Ga0495585_0045464 | |||
| 2666 | Ga0495585_0045747 | |||
| 2667 | Ga0495585_0057009 | |||
| 2668 | Ga0495585_0072560 | |||
| 2669 | Ga0495594_0003334 | |||
| 2670 | Ga0495594_0059105 | |||
| 2671 | Ga0495594_0180999 | |||
| 2672 | Ga0495596_0000533 | |||
| 2673 | Ga0495596_0000734 | |||
| 2674 | Ga0495596_0002070 | |||
| 2675 | Ga0495596_0004202 | |||
| 2676 | Ga0495596_0006292 | |||
| 2677 | Ga0495596_0007656 | |||
| 2678 | Ga0495596_0008125 | |||
| 2679 | Ga0495596_0013632 | |||
| 2680 | Ga0495596_0015649 | |||
| 2681 | Ga0495596_0026109 | |||
| 2682 | Ga0495607_0005443 | |||
| 2683 | Ga0495607_0008143 | |||
| 2684 | Ga0495607_0009072 | |||
| 2685 | Ga0495607_0011726 | |||
| 2686 | Ga0495607_0015950 | |||
| 2687 | Ga0495607_0018697 | |||
| 2688 | Ga0495607_0033307 | |||
| 2689 | Ga0495607_0035729 | |||
| 2690 | Ga0495607_0052196 | |||
| 2691 | Ga0495607_0133794 | |||
| 2692 | Ga0495607_0138793 | |||
| 2693 | Ga0495583_0000068 | |||
| 2694 | Ga0495583_0000197 | |||
| 2695 | Ga0495583_0000232 | |||
| 2696 | Ga0495583_0000280 | |||
| 2697 | Ga0495583_0000568 | |||
| 2698 | Ga0495583_0023503 | |||
| 2699 | Ga0495606_0000141 | |||
| 2700 | Ga0495606_0000266 | |||
| 2701 | Ga0495606_0000935 | |||
| 2702 | Ga0495606_0006074 | |||
| 2703 | Ga0495606_0007191 | |||
| 2704 | Ga0495606_0008896 | |||
| 2705 | Ga0495606_0011924 | |||
| 2706 | Ga0495606_0011964 | |||
| 2707 | Ga0495606_0013174 | |||
| 2708 | Ga0495606_0013999 | |||
| 2709 | Ga0495606_0022484 | |||
| 2710 | Ga0495606_0023201 | |||
| 2711 | Ga0495606_0026282 | |||
| 2712 | Ga0495606_0028934 | |||
| 2713 | Ga0495606_0050067 | |||
| 2714 | Ga0495606_0062689 | |||
| 2715 | Ga0495606_0065767 | |||
| 2716 | Ga0495606_0073876 | |||
| 2717 | Ga0495608_0000766 | |||
| 2718 | Ga0495608_0005430 | |||
| 2719 | Ga0495608_0021182 | |||
| 2720 | Ga0495608_0046988 | |||
| 2721 | Ga0495610_0000003 | |||
| 2722 | Ga0495610_0000715 | |||
| 2723 | Ga0495610_0002557 | |||
| 2724 | Ga0495610_0009229 | |||
| 2725 | Ga0495610_0010336 | |||
| 2726 | Ga0495610_0011374 | |||
| 2727 | Ga0495610_0015506 | |||
| 2728 | Ga0495610_0023467 | |||
| 2729 | Ga0495610_0034995 | |||
| 2730 | Ga0495616_0000173 | |||
| 2731 | Ga0495616_0001567 | |||
| 2732 | Ga0495616_0001770 | |||
| 2733 | Ga0495616_0003040 | |||
| 2734 | Ga0495616_0016379 | |||
| 2735 | Ga0495616_0016824 | |||
| 2736 | Ga0495616_0038980 | |||
| 2737 | Ga0495616_0040056 | |||
| 2738 | Ga0495616_0046662 | |||
| 2739 | Ga0495616_0094047 | |||
| 2740 | Ga0495618_0004670 | |||
| 2741 | Ga0495618_0018606 | |||
| 2742 | Ga0495620_0003682 | |||
| 2743 | Ga0495620_0021159 | |||
| 2744 | Ga0495628_0006004 | |||
| 2745 | Ga0495628_0015479 | |||
| 2746 | Ga0495628_0044665 | |||
| 2747 | Ga0495628_0054760 | |||
| 2748 | Ga0495628_0097516 | |||
| 2749 | Ga0495630_0001572 | |||
| 2750 | Ga0495630_0005461 | |||
| 2751 | Ga0495630_0345795 | |||
| 2752 | Ga0495631_0000103 | |||
| 2753 | Ga0495631_0002483 | |||
| 2754 | Ga0495631_0014124 | |||
| 2755 | Ga0495631_0018497 | |||
| 2756 | Ga0495631_0035003 | |||
| 2757 | Ga0495631_0058114 | |||
| 2758 | Ga0495632_0000063 | |||
| 2759 | Ga0495632_0000461 | |||
| 2760 | Ga0495632_0001335 | |||
| 2761 | Ga0495632_0001954 | |||
| 2762 | Ga0495632_0006624 | |||
| 2763 | Ga0495632_0010421 | |||
| 2764 | Ga0495632_0012834 | |||
| 2765 | Ga0495632_0045115 | |||
| 2766 | Ga0495637_0000004 | |||
| 2767 | Ga0495637_0000087 | |||
| 2768 | Ga0495637_0000443 | |||
| 2769 | Ga0495637_0000715 | |||
| 2770 | Ga0495637_0020601 | |||
| 2771 | Ga0495637_0035761 | |||
| 2772 | Ga0495643_0000179 | |||
| 2773 | Ga0495643_0000194 | |||
| 2774 | Ga0495643_0001483 | |||
| 2775 | Ga0495643_0003103 | |||
| 2776 | Ga0495643_0007505 | |||
| 2777 | Ga0495643_0011094 | |||
| 2778 | Ga0495643_0016657 | |||
| 2779 | Ga0495643_0018118 | |||
| 2780 | Ga0495643_0036164 | |||
| 2781 | Ga0495643_0047896 | |||
| 2782 | Ga0495644_0005431 | |||
| 2783 | Ga0495644_0019647 | |||
| 2784 | Ga0495644_0020261 | |||
| 2785 | Ga0495648_0000030 | |||
| 2786 | Ga0495648_0000058 | |||
| 2787 | Ga0495648_0000288 | |||
| 2788 | Ga0495648_0006444 | |||
| 2789 | Ga0495648_0020957 | |||
| 2790 | Ga0495648_0022571 | |||
| 2791 | Ga0495648_0022599 | |||
| 2792 | Ga0495648_0026542 | |||
| 2793 | Ga0495648_0033671 | |||
| 2794 | Ga0495648_0040603 | |||
| 2795 | Ga0495648_0041119 | |||
| 2796 | Ga0495648_0051313 | |||
| 2797 | Ga0495648_0087272 | |||
| 2798 | Ga0495663_0016751 | |||
| 2799 | Ga0495663_0046117 | |||
| 2800 | Ga0495666_0001341 | |||
| 2801 | Ga0495666_0001622 | |||
| 2802 | Ga0495666_0006371 | |||
| 2803 | Ga0495666_0007801 | |||
| 2804 | Ga0495666_0065341 | |||
| 2805 | Ga0495642_0000038 | |||
| 2806 | Ga0495642_0001686 | |||
| 2807 | Ga0495642_0001822 | |||
| 2808 | Ga0495642_0007379 | |||
| 2809 | Ga0495642_0022419 | |||
| 2810 | Ga0495642_0028452 | |||
| 2811 | Ga0495642_0035911 | |||
| 2812 | Ga0495642_0037192 | |||
| 2813 | Ga0495642_0090471 | |||
| 2814 | Ga0495642_0104510 | |||
| 2815 | Ga0495652_0003591 | |||
| 2816 | Ga0495652_0034086 | |||
| 2817 | Ga0495652_0050830 | |||
| 2818 | Ga0495652_0083324 | |||
| 2819 | Ga0495652_0118635 | |||
| 2820 | Ga0495652_0152421 | |||
| 2821 | Ga0495654_0000002 | |||
| 2822 | Ga0495654_0000074 | |||
| 2823 | Ga0495654_0001298 | |||
| 2824 | Ga0495654_0009807 | |||
| 2825 | Ga0495654_0012668 | |||
| 2826 | Ga0495654_0048366 | |||
| 2827 | Ga0495654_0050608 | |||
| 2828 | Ga0495665_0002821 | |||
| 2829 | Ga0495665_0004778 | |||
| 2830 | Ga0495665_0015085 | |||
| 2831 | Ga0495665_0022696 | |||
| 2832 | Ga0495640_0000384 | |||
| 2833 | Ga0495586_0000938 | |||
| 2834 | Ga0495586_0002348 | |||
| 2835 | Ga0495586_0004178 | |||
| 2836 | Ga0495586_0037866 | |||
| 2837 | Ga0495586_0038223 | |||
| 2838 | Ga0495587_0013822 | |||
| 2839 | Ga0495598_0048790 | |||
| 2840 | Ga0495609_0000021 | |||
| 2841 | Ga0495609_0003555 | |||
| 2842 | Ga0495609_0003830 | |||
| 2843 | Ga0495609_0009073 | |||
| 2844 | Ga0495609_0009412 | |||
| 2845 | Ga0495609_0022200 | |||
| 2846 | Ga0495609_0025432 | |||
| 2847 | Ga0495609_0039336 | |||
| 2848 | Ga0495597_0001756 | |||
| 2849 | Ga0495597_0002353 | |||
| 2850 | Ga0495597_0002945 | |||
| 2851 | Ga0495597_0003156 | |||
| 2852 | Ga0495597_0004756 | |||
| 2853 | Ga0495597_0005049 | |||
| 2854 | Ga0495597_0007908 | |||
| 2855 | Ga0495597_0009349 | |||
| 2856 | Ga0495597_0013813 | |||
| 2857 | Ga0495597_0014016 | |||
| 2858 | Ga0495597_0024876 | |||
| 2859 | Ga0495645_0006284 | |||
| 2860 | Ga0495645_0025686 | |||
| 2861 | Ga0495645_0036985 | |||
| 2862 | Ga0495645_0078869 | |||
| 2863 | Ga0495645_0120509 | |||
| 2864 | Ga0495645_0143827 | |||
| 2865 | Ga0495622_0000054 | |||
| 2866 | Ga0495622_0001760 | |||
| 2867 | Ga0495622_0001770 | |||
| 2868 | Ga0495633_0000119 | |||
| 2869 | Ga0495633_0000249 | |||
| 2870 | Ga0495633_0003574 | |||
| 2871 | Ga0495633_0004345 | |||
| 2872 | Ga0495633_0005254 | |||
| 2873 | Ga0495633_0006155 | |||
| 2874 | Ga0495633_0007353 | |||
| 2875 | Ga0495633_0008446 | |||
| 2876 | Ga0495633_0013888 | |||
| 2877 | Ga0495633_0023469 | |||
| 2878 | Ga0495633_0040011 | |||
| 2879 | Ga0495667_0003921 | |||
| 2880 | Ga0495656_0009208 | |||
| 2881 | Ga0495656_0059394 | |||
| 2882 | Ga0495668_0000383 | |||
| 2883 | Ga0495668_0000466 | |||
| 2884 | Ga0495668_0000935 | |||
| 2885 | Ga0495668_0000980 | |||
| 2886 | Ga0495668_0005855 | |||
| 2887 | Ga0495668_0006288 | |||
| 2888 | Ga0495668_0007471 | |||
| 2889 | Ga0495668_0031332 | |||
| 2890 | Ga0495634_0008233 | |||
| 2891 | Ga0495634_0038246 | |||
| 2892 | Ga0495634_0048583 | |||
| 2893 | Ga0495634_0106643 | |||
| 2894 | Ga0495611_0000517 | |||
| 2895 | Ga0495611_0001481 | |||
| 2896 | Ga0495611_0002945 | |||
| 2897 | Ga0495611_0018088 | |||
| 2898 | Ga0495611_0030436 | |||
| 2899 | Ga0495611_0035916 | |||
| 2900 | Ga0495611_0120214 | |||
| 2901 | Ga0495625_0000132 | |||
| 2902 | Ga0495625_0000139 | |||
| 2903 | Ga0495625_0005799 | |||
| 2904 | Ga0495625_0006766 | |||
| 2905 | Ga0495625_0038343 | |||
| 2906 | Ga0495625_0039103 | |||
| 2907 | Ga0495625_0068948 | |||
| 2908 | Ga0495625_0120043 | |||
| 2909 | Ga0495625_0203433 | |||
| 2910 | Ga0495635_0021073 | |||
| 2911 | Ga0495635_0091593 | |||
| 2912 | Ga0495659_0053244 | |||
| 2913 | Ga0495661_0000052 | |||
| 2914 | Ga0495661_0009467 | |||
| 2915 | Ga0495661_0010711 | |||
| 2916 | Ga0495661_0012664 | |||
| 2917 | Ga0495661_0014126 | |||
| 2918 | Ga0495661_0014206 | |||
| 2919 | Ga0495661_0018018 | |||
| 2920 | Ga0495661_0026257 | |||
| 2921 | Ga0495661_0037177 | |||
| 2922 | Ga0495661_0040145 | |||
| 2923 | Ga0495661_0043388 | |||
| 2924 | Ga0495661_0051066 | |||
| 2925 | Ga0495661_0064886 | |||
| 2926 | Ga0495588_0000083 | |||
| 2927 | Ga0495588_0047810 | |||
| 2928 | Ga0495588_0083697 | |||
| 2929 | Ga0495588_0089115 | |||
| 2930 | Ga0495599_0001313 | |||
| 2931 | Ga0495599_0003110 | |||
| 2932 | Ga0495599_0018809 | |||
| 2933 | Ga0495623_0012947 | |||
| 2934 | Ga0495623_0123122 | |||
| 2935 | Ga0495646_0002069 | |||
| 2936 | Ga0495646_0008027 | |||
| 2937 | Ga0495658_0048770 | |||
| 2938 | Ga0495658_0165545 | |||
| 2939 | Ga0495669_0000086 | |||
| 2940 | Ga0495669_0000734 | |||
| 2941 | Ga0495669_0018994 | |||
| 2942 | Ga0495669_0019307 | |||
| 2943 | Ga0495669_0037863 | |||
| 2944 | Ga0495669_0103976 | |||
| 2945 | Ga0495613_0005741 | |||
| 2946 | Ga0495613_0018060 | |||
| 2947 | Ga0495613_0032254 | |||
| 2948 | Ga0495613_0040133 | |||
| 2949 | Ga0495624_0002244 | |||
| 2950 | Ga0495624_0021769 | |||
| 2951 | Ga0495624_0034973 | |||
| 2952 | Ga0495624_0047581 | |||
| 2953 | Ga0495624_0076277 | |||
| 2954 | Ga0495624_0095406 | |||
| 2955 | Ga0495624_0105223 | |||
| 2956 | Ga0495670_0003781 | |||
| 2957 | Ga0495670_0004207 | |||
| 2958 | Ga0495670_0013889 | |||
| 2959 | Ga0495670_0041825 | |||
| 2960 | Ga0495670_0042883 | |||
| 2961 | Ga0495670_0064429 | |||
| 2962 | Ga0495671_0000001 | |||
| 2963 | Ga0495671_0001547 | |||
| 2964 | Ga0495671_0012227 | |||
| 2965 | Ga0495671_0012468 | |||
| 2966 | Ga0495671_0012531 | |||
| 2967 | Ga0495671_0022645 | |||
| 2968 | Ga0495649_0000138 | |||
| 2969 | Ga0495649_0001419 | |||
| 2970 | Ga0495649_0009719 | |||
| 2971 | Ga0495649_0012333 | |||
| 2972 | Ga0495649_0168631 | |||
| 2973 | Ga0495589_0000012 | |||
| 2974 | Ga0495589_0001013 | |||
| 2975 | Ga0495589_0002523 | |||
| 2976 | Ga0495589_0004690 | |||
| 2977 | Ga0495589_0005172 | |||
| 2978 | Ga0495589_0005498 | |||
| 2979 | Ga0495589_0013534 | |||
| 2980 | Ga0495589_0023143 | |||
| 2981 | Ga0495600_0004658 | |||
| 2982 | Ga0495600_0100279 | |||
| 2983 | Ga0495600_0198059 | |||
| 2984 | Ga0495660_0000921 | |||
| 2985 | Ga0495660_0008376 | |||
| 2986 | Ga0495660_0010852 | |||
| 2987 | Ga0495660_0017627 | |||
| 2988 | Ga0495660_0027386 | |||
| 2989 | Ga0495660_0032340 | |||
| 2990 | Ga0495660_0103721 | |||
| 2991 | Ga0495581_0000409 | |||
| 2992 | Ga0495581_0005132 | |||
| 2993 | Ga0495581_0024397 | |||
| 2994 | Ga0495581_0035969 | |||
| 2995 | Ga0495581_0173898 | |||
| 2996 | Ga0495604_0008259 | |||
| 2997 | Ga0495604_0026650 | |||
| 2998 | Ga0495604_0046170 | |||
| 2999 | Ga0495604_0080173 | |||
| 3000 | Ga0495604_0170575 | |||
| 3001 | Ga0495636_0002974 | |||
| 3002 | Ga0495636_0004077 | |||
| 3003 | Ga0495636_0033472 | |||
| 3004 | Ga0495674_0041330 | |||
| 3005 | Ga0495674_0053500 | |||
| 3006 | Ga0495674_0056273 | |||
| 3007 | Ga0495674_0315882 | |||
| 3008 | Ga0495674_0388287 | |||
| 3009 | Ga0495672_0000170 | |||
| 3010 | Ga0495672_0000240 | |||
| 3011 | Ga0495672_0000801 | |||
| 3012 | Ga0495672_0000896 | |||
| 3013 | Ga0495672_0003434 | |||
| 3014 | Ga0495672_0005376 | |||
| 3015 | Ga0495672_0009345 | |||
| 3016 | Ga0495672_0073444 | |||
| 3017 | Ga0495676_0000670 | |||
| 3018 | Ga0495676_0027149 | |||
| 3019 | Ga0495676_0089324 | |||
| 3020 | Ga0495676_0150268 | |||
| 3021 | Ga0495676_0239672 | |||
| 3022 | Ga0495676_0283294 | |||
| 3023 | Ga0495680_0001210 | |||
| 3024 | Ga0495680_0001589 | |||
| 3025 | Ga0495680_0016580 | |||
| 3026 | Ga0495680_0026694 | |||
| 3027 | Ga0495680_0045299 | |||
| 3028 | Ga0495683_0000035 | |||
| 3029 | Ga0495683_0000325 | |||
| 3030 | Ga0495683_0003363 | |||
| 3031 | Ga0495683_0006003 | |||
| 3032 | Ga0495683_0010146 | |||
| 3033 | Ga0495683_0012685 | |||
| 3034 | Ga0495683_0014466 | |||
| 3035 | Ga0495683_0015131 | |||
| 3036 | Ga0495683_0038381 | |||
| 3037 | Ga0495683_0049087 | |||
| 3038 | Ga0495683_0067234 | |||
| 3039 | Ga0495683_0075353 | |||
| 3040 | Ga0495687_000022 | |||
| 3041 | Ga0495687_000149 | |||
| 3042 | Ga0495687_000326 | |||
| 3043 | Ga0495687_000373 | |||
| 3044 | Ga0495687_001062 | |||
| 3045 | Ga0495687_004721 | |||
| 3046 | Ga0495687_012071 | |||
| 3047 | Ga0495687_016191 | |||
| 3048 | Ga0495675_0006167 | |||
| 3049 | Ga0495675_0007198 | |||
| 3050 | Ga0495675_0027890 | |||
| 3051 | Ga0495675_0058691 | |||
| 3052 | Ga0495677_0002988 | |||
| 3053 | Ga0495677_0009710 | |||
| 3054 | Ga0495677_0012815 | |||
| 3055 | Ga0495677_0019151 | |||
| 3056 | Ga0495679_000865 | |||
| 3057 | Ga0495679_000936 | |||
| 3058 | Ga0495679_002559 | |||
| 3059 | Ga0495679_015200 | |||
| 3060 | Ga0495685_012411 | |||
| 3061 | Ga0495685_028287 | |||
| 3062 | Ga0495673_0000006 | |||
| 3063 | Ga0495673_0000015 | |||
| 3064 | Ga0495673_0000024 | |||
| 3065 | Ga0495673_0000049 | |||
| 3066 | Ga0495673_0011801 | |||
| 3067 | Ga0495673_0022484 | |||
| 3068 | Ga0495681_0006364 | |||
| 3069 | Ga0495681_0009450 | |||
| 3070 | Ga0495681_0020969 | |||
| 3071 | Ga0495681_0056941 | |||
| 3072 | Ga0495681_0061554 | |||
| 3073 | Ga0495686_0000002 | |||
| 3074 | Ga0495686_0000312 | |||
| 3075 | Ga0495686_0000744 | |||
| 3076 | Ga0495686_0002260 | |||
| 3077 | Ga0495686_0003592 | |||
| 3078 | Ga0495686_0015177 | |||
| 3079 | Ga0495593_0002055 | |||
| 3080 | Ga0495593_0022835 | |||
| 3081 | Ga0495593_0024770 | |||
| 3082 | Ga0495593_0107344 | |||
| 3083 | Ga0495602_0004187 | |||
| 3084 | Ga0495602_0007746 | |||
| 3085 | Ga0495602_0070288 | |||
| 3086 | Ga0495602_0175482 | |||
| 3087 | Ga0495602_0190064 | |||
| 3088 | Ga0495614_0004682 | |||
| 3089 | Ga0495614_0022369 | |||
| 3090 | Ga0495615_0045588 | |||
| 3091 | Ga0495626_0000082 | |||
| 3092 | Ga0495626_0000564 | |||
| 3093 | Ga0495626_0000805 | |||
| 3094 | Ga0495626_0007028 | |||
| 3095 | Ga0495626_0007562 | |||
| 3096 | Ga0495626_0013551 | |||
| 3097 | Ga0495626_0014017 | |||
| 3098 | Ga0495626_0019263 | |||
| 3099 | Ga0495626_0020399 | |||
| 3100 | Ga0495626_0027194 | |||
| 3101 | Ga0495626_0034592 | |||
| 3102 | Ga0496100_0002007 | |||
| 3103 | Ga0496100_0021276 | |||
| 3104 | Ga0496100_0034399 | |||
| 3105 | Ga0496100_0122698 | |||
| 3106 | Ga0496100_0245657 | |||
| 3107 | Ga0496101_0003262 | |||
| 3108 | Ga0496101_0004357 | |||
| 3109 | Ga0496101_0005768 | |||
| 3110 | Ga0496101_0015923 | |||
| 3111 | Ga0496101_0030404 | |||
| 3112 | Ga0496101_0066919 | |||
| 3113 | Ga0496102_0000231 | |||
| 3114 | Ga0496102_0000410 | |||
| 3115 | Ga0496102_0001160 | |||
| 3116 | Ga0496102_0001615 | |||
| 3117 | Ga0496102_0006411 | |||
| 3118 | Ga0496102_0007060 | |||
| 3119 | Ga0496102_0045378 | |||
| 3120 | Ga0496102_0197890 | |||
| 3121 | Ga0496102_0272930 | |||
| 3122 | Ga0496103_0000526 | |||
| 3123 | Ga0496103_0000758 | |||
| 3124 | Ga0496103_0003846 | |||
| 3125 | Ga0496103_0013506 | |||
| 3126 | Ga0496103_0014487 | |||
| 3127 | Ga0496103_0031196 | |||
| 3128 | Ga0496104_0002107 | |||
| 3129 | Ga0496104_0057947 | |||
| 3130 | Ga0496104_0159239 | |||
| 3131 | Ga0496104_0303976 | |||
| 3132 | Ga0496105_0004353 | |||
| 3133 | Ga0496105_0054030 | |||
| 3134 | Ga0496105_0143419 | |||
| 3135 | Ga0496105_0144583 | |||
| 3136 | Ga0496106_0000029 | |||
| 3137 | Ga0496106_0075066 | |||
| 3138 | Ga0496107_0031872 | |||
| 3139 | Ga0496107_0069094 | |||
| 3140 | Ga0496107_0113508 | |||
| 3141 | Ga0496107_0137781 | |||
| 3142 | Ga0496107_0176739 | |||
| 3143 | Ga0496108_0007605 | |||
| 3144 | Ga0496108_0028121 | |||
| 3145 | Ga0496108_0168445 | |||
| 3146 | Ga0496108_0277540 | |||
| 3147 | Ga0496109_0028543 | |||
| 3148 | Ga0496110_0000779 | |||
| 3149 | Ga0496110_0001082 | |||
| 3150 | Ga0496110_0004874 | |||
| 3151 | Ga0496110_0011024 | |||
| 3152 | Ga0496110_0193456 | |||
| 3153 | Ga0496110_0230038 | |||
| 3154 | Ga0496111_0088110 | |||
| 3155 | Ga0496112_0000694 | |||
| 3156 | Ga0496112_0022903 | |||
| 3157 | Ga0496112_0079568 | |||
| 3158 | Ga0496113_0023520 | |||
| 3159 | Ga0496113_0098129 | |||
| 3160 | Ga0496114_0016577 | |||
| 3161 | Ga0496114_0054376 | |||
| 3162 | Ga0496114_0148098 | |||
| 3163 | Ga0496115_0023344 | |||
| 3164 | Ga0496115_0056602 | |||
| 3165 | Ga0496115_0089511 | |||
| 3166 | Ga0496115_0214007 | |||
| 3167 | Ga0496116_0004796 | |||
| 3168 | Ga0496116_0005572 | |||
| 3169 | Ga0496116_0014372 | |||
| 3170 | Ga0496116_0016701 | |||
| 3171 | Ga0496116_0033865 | |||
| 3172 | Ga0496117_0000001 | |||
| 3173 | Ga0496117_0000755 | |||
| 3174 | Ga0496117_0002426 | |||
| 3175 | Ga0496117_0004332 | |||
| 3176 | Ga0496117_0015767 | |||
| 3177 | Ga0496117_0092636 | |||
| 3178 | Ga0496118_0000078 | |||
| 3179 | Ga0496118_0004181 | |||
| 3180 | Ga0496118_0011820 | |||
| 3181 | Ga0496118_0012940 | |||
| 3182 | Ga0496118_0016090 | |||
| 3183 | Ga0496118_0059827 | |||
| 3184 | Ga0496118_0061387 | |||
| 3185 | Ga0496119_0071699 | |||
| 3186 | Ga0496121_0004482 | |||
| 3187 | Ga0496121_0007119 | |||
| 3188 | Ga0496121_0012818 | |||
| 3189 | Ga0496121_0016195 | |||
| 3190 | Ga0496121_0016657 | |||
| 3191 | Ga0496121_0024151 | |||
| 3192 | Ga0496121_0033907 | |||
| 3193 | Ga0496121_0044023 | |||
| 3194 | Ga0496121_0101645 | |||
| 3195 | Ga0496121_0110043 | |||
| 3196 | Ga0496122_0001026 | |||
| 3197 | Ga0496122_0005297 | |||
| 3198 | Ga0496122_0005801 | |||
| 3199 | Ga0496122_0015357 | |||
| 3200 | Ga0496122_0040382 | |||
| 3201 | Ga0496122_0058838 | |||
| 3202 | Ga0496122_0124279 | |||
| 3203 | Ga0496122_0153753 | |||
| 3204 | Ga0496123_0002474 | |||
| 3205 | Ga0496123_0004250 | |||
| 3206 | Ga0496123_0010211 | |||
| 3207 | Ga0496123_0014295 | |||
| 3208 | Ga0496123_0021284 | |||
| 3209 | Ga0496123_0032993 | |||
| 3210 | Ga0496123_0033673 | |||
| 3211 | Ga0496124_0002429 | |||
| 3212 | Ga0496124_0053740 | |||
| 3213 | Ga0496124_0103400 | |||
| 3214 | Ga0496124_0120953 | |||
| 3215 | Ga0496124_0127282 | |||
| 3216 | Ga0496125_0003324 | |||
| 3217 | Ga0496125_0004189 | |||
| 3218 | Ga0496125_0147310 | |||
| 3219 | Ga0496126_0000192 | |||
| 3220 | Ga0496126_0000604 | |||
| 3221 | Ga0496126_0018997 | |||
| 3222 | Ga0496126_0023849 | |||
| 3223 | Ga0496126_0030750 | |||
| 3224 | Ga0496126_0150321 | |||
| 3225 | Ga0496126_0191503 | |||
| 3226 | Ga0501308_000648 | |||
| 3227 | Ga0501304_001077 | |||
| 3228 | Ga0495678_000185 | |||
| 3229 | Ga0495678_000240 | |||
| 3230 | Ga0495678_000374 | |||
| 3231 | Ga0495678_000679 | |||
| 3232 | Ga0495678_001937 | |||
| 3233 | Ga0495678_003621 | |||
| 3234 | Ga0495678_004540 | |||
| 3235 | Ga0495678_015969 | |||
| 3236 | Ga0495678_021387 | |||
| 3237 | Ga0495682_0003433 | |||
| 3238 | Ga0495682_0006008 | |||
| 3239 | Ga0495682_0013866 | |||
| 3240 | Ga0495682_0019113 | |||
| 3241 | Ga0495682_0050595 | |||
| 3242 | Ga0501032_0008558 | |||
| 3243 | Ga0501033_0000693 | |||
| 3244 | Ga0501034_0000628 | |||
| 3245 | Ga0501034_0113456 | |||
| 3246 | Ga0501036_0005253 | |||
| 3247 | Ga0501037_0042698 | |||
| 3248 | Ga0501038_0003200 | |||
| 3249 | Ga0501039_0000950 | |||
| 3250 | Ga0501040_0002182 | |||
| 3251 | Ga0501041_0010690 | |||
| 3252 | Ga0501042_0001629 | |||
| 3253 | Ga0501043_0005031 | |||
| 3254 | Ga0501046_0001055 | |||
| 3255 | Ga0501048_0001193 | |||
| 3256 | Ga0501068_0076038 | |||
| 3257 | Ga0501070_0173369 | |||
| 3258 | Ga0501071_0017226 | |||
| 3259 | Ga0501072_0004690 | |||
| 3260 | Ga0501074_0005903 | |||
| 3261 | Ga0501075_0002813 | |||
| 3262 | Ga0501076_0008797 | |||
| 3263 | Ga0501077_0003308 | |||
| 3264 | Ga0501079_0003996 | |||
| 3265 | Ga0501080_0006070 | |||
| 3266 | Ga0501080_0227072 | |||
| 3267 | Ga0501081_0000437 | |||
| 3268 | Ga0501035_0000793 | |||
| 3269 | Ga0501035_0025915 | |||
| 3270 | Ga0501044_0163539 | |||
| 3271 | Ga0501045_0000054 | |||
| 3272 | nmdc:mga07m45_28124_c1 | |||
| 3273 | nmdc:mga08x19_47843_c1 | |||
| 3274 | Ga0495601_0013846 | |||
| 3275 | Ga0495601_0140368 | |||
| 3276 | Ga0495595_0066767 | |||
| 3277 | Ga0500618_000104 | |||
| 3278 | Ga0500618_001996 | |||
| 3279 | Ga0500618_003269 | |||
| 3280 | Ga0500586_001331 | |||
| 3281 | Ga0500590_021784 | |||
| 3282 | Ga0500619_004943 | |||
| 3283 | Ga0501084_0012495 | |||
| 3284 | Ga0587077_002155 | |||
| 3285 | Ga0587082_005003 | |||
| 3286 | Ga0587083_0009799 | |||
| 3287 | Ga0587091_016590 | |||
| 3288 | Ga0587068_001216 | |||
| 3289 | Ga0587079_014993 | |||
| 3290 | Ga0501082_0003677 | |||
| 3291 | Ga0466962_0000565 | |||
| 3292 | Ga0466962_0003588 | |||
| 3293 | Ga0530510_0000330 | |||
| 3294 | Ga0530510_0069753 | |||
| 3295 | 2501073627 | |||
| 3296 | 2501082232 | |||
| 3297 | 2501410977 | |||
| 3298 | 2509128673 | |||
| 3299 | 2510250883 | |||
| 3300 | 2511086422 | |||
| 3301 | 2511096567 | |||
| 3302 | 2511102796 | |||
| 3303 | 2511251224 | |||
| 3304 | 2511384463 | |||
| 3305 | 2512346222 | |||
| 3306 | 2513552102 | |||
| 3307 | 2513560888 | |||
| 3308 | 2513957889 | |||
| 3309 | 2513960931 | |||
| 3310 | 2514041827 | |||
| 3311 | 2514048122 | |||
| 3312 | 2515679674 | |||
| 3313 | 2515692509 | |||
| 3314 | 2516020337 | |||
| 3315 | 2519458910 | |||
| 3316 | 2527075168 | |||
| 3317 | 2547375434 | |||
| 3318 | 2550694348 | |||
| 3319 | 2563063000 | |||
| 3320 | 2585291588 | |||
| 3321 | 2597028599 | |||
| 3322 | 2599445285 | |||
| 3323 | 2599736508 | |||
| 3324 | 2599744569 | |||
| 3325 | 2600206070 | |||
| 3326 | 2600809747 | |||
| 3327 | 2601667262 | |||
| 3328 | 2643798555 | |||
| 3329 | 2644475561 | |||
| 3330 | 2676742695 | |||
| 3331 | 2713477200 | |||
| 3332 | 2719640019 | |||
| 3333 | 2723877401 | |||
| 3334 | 2738820760 | |||
| 3335 | 2738829668 | |||
| 3336 | 2738833240 | |||
| 3337 | 2738874768 | |||
| 3338 | 2739153464 | |||
| 3339 | 2739186397 | |||
| 3340 | 2739195384 | |||
| 3341 | 2739221366 | |||
| 3342 | 2739321860 | |||
| 3343 | 2739339584 | |||
| 3344 | 2746089635 | |||
| 3345 | 2746099476 | |||
| 3346 | 2753570355 | |||
| 3347 | 2765569168 | |||
| 3348 | 2792836445 | |||
| 3349 | 2808969911 | |||
| 3350 | 2809004444 | |||
| 3351 | 2809011617 | |||
| 3352 | 2809145000 | |||
| 3353 | 2817261178 | |||
| 3354 | 2817278890 | |||
| 3355 | 2817457116 | |||
| 3356 | 2819541180 | |||
| 3357 | 2819592464 | |||
| 3358 | 2819620201 | |||
| 3359 | 2819630992 | |||
| 3360 | 2821131170 | |||
| 3361 | 2839095943 | |||
| 3362 | 2842328137 | |||
| 3363 | 2842352454 | |||
| 3364 | 2842459490 | |||
| 3365 | 2842713667 | |||
| 3366 | 2842714521 | |||
| 3367 | 2843695080 | |||
| 3368 | 2846037442 | |||
| 3369 | 2846042060 | |||
| 3370 | 2856293662 | |||
| 3371 | 2857362420 | |||
| 3372 | 2857552547 | |||
| 3373 | 2857560201 | |||
| 3374 | 2857561628 | |||
| 3375 | 2857565182 | |||
| 3376 | 2857568910 | |||
| 3377 | 2863424906 | |||
| 3378 | 2870071190 | |||
| 3379 | 2883088887 | |||
| 3380 | 2884811992 | |||
| 3381 | 2884840055 | |||
| 3382 | 2884857177 | |||
| 3383 | 2885085161 | |||
| 3384 | 2885267059 | |||
| 3385 | 2885278742 | |||
| 3386 | 2896157764 | |||
| 3387 | 2900580219 | |||
| 3388 | 2900635056 | |||
| 3389 | 2902689678 | |||
| 3390 | 2904438615 | |||
| 3391 | 2904484916 | |||
| 3392 | 2904568931 | |||
| 3393 | 2904576313 | |||
| 3394 | 2904617105 | |||
| 3395 | 2919530639 | |||
| 3396 | 2928062615 | |||
| 3397 | 2928110240 | |||
| 3398 | 2928131226 | |||
| 3399 | 2928138626 | |||
| 3400 | 2928160202 | |||
| 3401 | 2928168694 | |||
| 3402 | 2928171894 | |||
| 3403 | 2928505288 | |||
| 3404 | 2928540108 | |||
| 3405 | 2932414858 | |||
| 3406 | 2932419544 | |||
| 3407 | 2939634950 | |||
| 3408 | 2945936955 | |||
| 3409 | 2981994647 | |||
| 3410 | 2990706317 | |||
| 3411 | 642423140 | |||
| 3412 | 642419517 | |||
| 3413 | 642592701 | |||
| 3414 | 642621363 | |||
| 3415 | 644751481 | |||
| 3416 | 8003955456 | |||
| 3417 | 8018851533 | |||
| 3418 | 8020810720 | |||
| 3419 | 8020942034 | |||
| 3420 | 8020946114 | |||
| 3421 | 8020956770 | |||
| 3422 | 8021122368 | |||
| 3423 | 8039102385 | |||
| 3424 | 8040172849 | |||
| 3425 | 8040174876 | |||
| 3426 | 8047675574 | |||
| 3427 | 8055268284 | |||
| 3428 | 8055302398 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5mm0-assembly1.cif.gz_A | dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) | 0.7638 | 1 | 237 |
| 6iwr-assembly1.cif.gz_B | crystal structure of galnac-t7 with udp, galnac and mn2+ | 0.7519 | 3 | 124 |
| 6iwr-assembly2.cif.gz_D | crystal structure of galnac-t7 with udp, galnac and mn2+ | 0.7519 | 2 | 124 |
| 5ekp-assembly1.cif.gz_A | structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (wt) | 0.7494 | 1 | 294 |
| 5eke-assembly1.cif.gz_A | structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (f215a mutant) | 0.746 | 1 | 294 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P77757_4_230_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9264 | 1 | 225 | 3.90.550.10 |
| af_P77757_4_230_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9146 | 1 | 225 | 3.90.550.10 |
| af_Q2G2T7_1_208_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8995 | 6 | 206 | 3.90.550.10 |
| af_P9WMX5_1_216_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8964 | 6 | 219 | 3.90.550.10 |
| af_P77293_1_188_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8804 | 6 | 190 | 3.90.550.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D2J9K3-F1-model_v4 | Glycosyltransferase | 0.9751 | 2 | 106 |
GO:0005886
GO:0016757 |
| AF-A0A2N2SBJ6-F1-model_v4 | Glycosyltransferase | 0.9506 | 10 | 186 |
GO:0005886
GO:0016757 |
| AF-A0A6D2G6W1-F1-model_v4 | Lipopolysaccharide modification protein (EC 2.7.8.30) | 0.9437 | 6 | 132 |
GO:0005886
GO:0099621 |
| AF-A0A3M0WV41-F1-model_v4 | Glycosyltransferase | 0.9366 | 3 | 174 |
GO:0005886
GO:0016757 |
| AF-A0A2N2SBJ6-F1-model_v4 | Glycosyltransferase | 0.9302 | 10 | 186 |
GO:0005886
GO:0016757 |