F495435

General Info

Members Datasets Scaffolds Average Seq Length
1711 490 1693 412

Family's Representative Sequence

Representative Sequence 3300026067|Ga0207678_10016607|Ga0207678_100166074
Length 465
Sequence MVSRRGFLKSGGLALVGVGLMGGIPGFLAEAAASVKLEAPYKKKKILVCIFQRGAMDGLMAVTPFNDEYLKQARPTLFMSAAKNGPGTSLVDLDGHYGLHPSMKAFEPLFREKRLAIVHGIGSPNNTRSHFDAQDFMESGTPFNKGTSSGWLNRAVGMLGHDAATPFRAVSLTSAMPRSFYGDNPAVAISNLQDFAIQMRGTPANANMVAKSFEDLYDQTSSNLLKETGKESFDAVKMLQKTDVRNYKPANNAMYPVSSLGNSLKQIAQLIKMDVGLEVAFTESNGWDTHFNQGTDTGIFARNVNDLSNSITAFWNDLEAYHDDLTVMTMTEFGRTVHQNGTGGTDHGRGSCNFILGNDVNGGLVHGKMQPLAVENLEDGRDLALGMLRIVHVGGELHPVAHGYHQLAVDHRERLELMLQIPADRLRRITQRPAALRDGRMGHDRERHHDEGARERALRGTHSDS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
3 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
4 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
5 2738541284 Pedobacter sp. YR016 Isolate Unclassified
6 2738543023 Pedobacter sp. OK628 Isolate Unclassified
7 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
8 2818991444 Filimonas endophytica 3197 Isolate Unclassified
9 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
10 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
11 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
12 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
13 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
14 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
15 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
16 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
17 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
18 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
19 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
20 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
21 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
22 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
23 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
24 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
25 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
27 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
28 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
29 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
30 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
31 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
32 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
33 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
34 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
35 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
36 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
37 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
38 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
39 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
40 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
41 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
42 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
43 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
44 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
45 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
46 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
47 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
48 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
49 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
50 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
51 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
52 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
53 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
54 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
55 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
56 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
57 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
58 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
59 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
60 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
61 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
62 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
63 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
64 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
65 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
66 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
67 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
68 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
69 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
70 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
71 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
72 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
73 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
74 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
75 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
76 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
77 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
78 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
79 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
80 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
81 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
82 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
83 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
84 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
85 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
86 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
87 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
88 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
89 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
90 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
91 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
92 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
93 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
94 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
95 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
96 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
97 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
98 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
99 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
100 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
101 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
102 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
103 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
104 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
105 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
106 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
107 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
108 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
109 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
110 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
111 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
112 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
113 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
114 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
115 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
116 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
117 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
118 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
119 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
120 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
121 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
122 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
123 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
124 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
125 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
126 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
127 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
128 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
129 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
130 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
131 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
132 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
133 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
134 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
135 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
136 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
137 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
138 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
139 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
140 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
141 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
142 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
143 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
144 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
145 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
146 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
147 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
148 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
149 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
150 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
151 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
152 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
153 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
154 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
155 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
156 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
157 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
158 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
159 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
160 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
161 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
162 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
163 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
164 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
165 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
166 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
167 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
168 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
169 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
170 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
172 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
173 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
175 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
176 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
177 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
245 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
249 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
250 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
251 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
252 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
253 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
254 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
255 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
256 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
257 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
258 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
259 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
260 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
261 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
262 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
263 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
264 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
265 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
266 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
267 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
268 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
269 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
270 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
271 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
272 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
273 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
274 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
275 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
276 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
277 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
278 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
279 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
280 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
281 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
282 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
283 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
284 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
285 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
286 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
287 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
288 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
289 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
290 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
291 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
292 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
293 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
294 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
295 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
296 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
297 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
298 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
299 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
300 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
301 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
302 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
303 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
304 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
305 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
306 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
307 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
308 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
309 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
310 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
311 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
312 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
313 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
314 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
315 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
316 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
317 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
318 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
319 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
320 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
321 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
322 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
323 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
324 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
325 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
326 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
327 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
328 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
329 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
330 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
331 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
332 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
333 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
334 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
335 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
336 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
337 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
338 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
339 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
340 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
341 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
342 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
343 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
344 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
345 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
346 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
347 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
348 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
349 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
350 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
351 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
352 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
353 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
354 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
355 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
356 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
357 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
358 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
359 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
360 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
361 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
362 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
363 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
364 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
365 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
366 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
367 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
368 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
369 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
370 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
371 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
372 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
373 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
374 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
375 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
376 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
377 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
378 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
379 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
380 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
381 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
382 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
383 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
384 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
385 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
386 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
387 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
388 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
389 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
390 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
391 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
392 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
393 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
394 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
395 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
396 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
397 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
398 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
399 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
400 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
401 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
402 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
403 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
404 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
405 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
406 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
407 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
408 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
409 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
410 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
411 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
412 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
413 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
414 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
415 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
416 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
417 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
418 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
419 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
420 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
421 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
422 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
423 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
424 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
425 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
426 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
427 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
428 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
429 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
430 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
431 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
432 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
433 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
434 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
435 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
436 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
437 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
438 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
439 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
440 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
441 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
442 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
443 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
444 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
445 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
446 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
447 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
448 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
449 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
450 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
451 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
452 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
453 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
454 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
455 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
456 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
457 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
458 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
459 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
460 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
461 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
462 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
463 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
464 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
465 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
466 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
467 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
468 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
469 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
470 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
471 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
472 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
473 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
474 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
475 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
476 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
477 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
478 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
479 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
480 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
481 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
482 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
483 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
484 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
485 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
486 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
487 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
488 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
489 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
490 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.13
Metatranscriptomes 0.82
Isolates 1.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.45
Nodule 0
Rhizoplane 1.05
Rhizosphere 93.98
Stem 0
Stem Tuber 0
Unclassified 2.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1948121 2162886007 Bacteria 77420
2 JGI24737J22298_10005684 3300001990 Bacteria 4292
3 JGI24735J21928_10000007 3300002067 Bacteria 333510
4 JGI24748J21848_1000019 3300002074 Bacteria 120384
5 JGI24034J26672_10000003 3300002239 Bacteria 501747
6 JGI24751J29686_10000008 3300002459 Bacteria 128004
7 JGI24751J29686_10000029 3300002459 Bacteria 93445
8 JGI25406J46586_10019830 3300003203 Unclassified 2731
9 rootH1_10041472 3300003316 Bacteria 13430
10 rootH1_10084070 3300003316 Bacteria 6357
11 rootH2_10001414 3300003320 Bacteria 59840
12 rootH2_10054802 3300003320 Bacteria 17503
13 rootL2_10009645 3300003322 Bacteria 7902
14 rootL2_10059364 3300003322 Bacteria 7924
15 rootL2_10103670 3300003322 Bacteria 5042
16 rootL2_10196161 3300003322 Bacteria 1638
17 rootH1_10070385 3300003323 Bacteria 10588
18 rootH1_10080102 3300003323 Bacteria 8749
19 Ga0055525_1000009 3300003759 Bacteria 596899
20 Ga0055531_10002585 3300003794 Bacteria 11988
21 Ga0065165_1001175 3300005262 Bacteria 30429
22 Ga0065714_10002398 3300005288 Bacteria 45890
23 Ga0065714_10009168 3300005288 Bacteria 3246
24 Ga0065714_10064528 3300005288 Bacteria 41587
25 Ga0065714_10064745 3300005288 Bacteria 20344
26 Ga0065704_10070196 3300005289 Bacteria 94899
27 Ga0065712_10069398 3300005290 Bacteria 7382
28 Ga0065712_10095649 3300005290 Unclassified 2211
29 Ga0065712_10116106 3300005290 Bacteria 1741
30 Ga0065715_10092652 3300005293 Bacteria 5004
31 Ga0065715_10168494 3300005293 Bacteria 1566
32 Ga0065707_10097496 3300005295 Bacteria 3169
33 Ga0065707_10190055 3300005295 Bacteria 1366
34 Ga0070658_10002620 3300005327 Bacteria 14987
35 Ga0070658_10003932 3300005327 Bacteria 12183
36 Ga0070658_10006257 3300005327 Bacteria 9644
37 Ga0070658_10011065 3300005327 Bacteria 7232
38 Ga0070658_10023069 3300005327 Bacteria 4996
39 Ga0070658_10024028 3300005327 Bacteria 4891
40 Ga0070658_10026139 3300005327 Bacteria 4682
41 Ga0070658_10037863 3300005327 Bacteria 3889
42 Ga0070658_10083072 3300005327 Bacteria 2633
43 Ga0070658_10084597 3300005327 Bacteria 2608
44 Ga0070658_10175764 3300005327 Bacteria 1800
45 Ga0070676_10069703 3300005328 Unclassified 2108
46 Ga0070683_100000006 3300005329 Bacteria 361071
47 Ga0070683_100000103 3300005329 Bacteria 55332
48 Ga0070683_100003571 3300005329 Bacteria 12657
49 Ga0070683_100010969 3300005329 Bacteria 7807
50 Ga0070683_100018047 3300005329 Bacteria 6241
51 Ga0070683_100024947 3300005329 Bacteria 5362
52 Ga0070683_100036529 3300005329 Bacteria 4496
53 Ga0070683_100053337 3300005329 Bacteria 3747
54 Ga0070683_100075498 3300005329 Bacteria 3149
55 Ga0070683_100080784 3300005329 Bacteria 3043
56 Ga0070683_100088584 3300005329 Bacteria 2904
57 Ga0070683_100096128 3300005329 Bacteria 2786
58 Ga0070683_100141465 3300005329 Bacteria 2280
59 Ga0070690_100002353 3300005330 Bacteria 10163
60 Ga0070690_100026098 3300005330 Bacteria 3601
61 Ga0070690_100040500 3300005330 Bacteria 2947
62 Ga0070670_100000283 3300005331 Bacteria 44752
63 Ga0070670_100000419 3300005331 Bacteria 34947
64 Ga0070670_100001217 3300005331 Bacteria 20470
65 Ga0070670_100003137 3300005331 Bacteria 13671
66 Ga0070670_100004447 3300005331 Bacteria 11735
67 Ga0070670_100004609 3300005331 Bacteria 11564
68 Ga0070670_100036041 3300005331 Bacteria 4258
69 Ga0070670_100066443 3300005331 Bacteria 3094
70 Ga0070670_100116462 3300005331 Bacteria 2304
71 Ga0070670_100169804 3300005331 Bacteria 1892
72 Ga0068869_100010810 3300005334 Bacteria 5965
73 Ga0068869_100015015 3300005334 Bacteria 5182
74 Ga0068869_100036265 3300005334 Bacteria 3501
75 Ga0070666_10001789 3300005335 Bacteria 13094
76 Ga0070666_10004655 3300005335 Bacteria 8376
77 Ga0070666_10009756 3300005335 Bacteria 6001
78 Ga0070666_10104842 3300005335 Bacteria 1952
79 Ga0070666_10169627 3300005335 Bacteria 1528
80 Ga0070680_100000620 3300005336 Bacteria 24634
81 Ga0070680_100010240 3300005336 Bacteria 7228
82 Ga0070680_100020016 3300005336 Bacteria 5305
83 Ga0070680_100067553 3300005336 Bacteria 2932
84 Ga0070680_100218694 3300005336 Bacteria 1607
85 Ga0070682_100217165 3300005337 Unclassified 1358
86 Ga0068868_100000785 3300005338 Bacteria 21501
87 Ga0068868_100000943 3300005338 Bacteria 19752
88 Ga0068868_100014160 3300005338 Bacteria 5872
89 Ga0068868_100031650 3300005338 Bacteria 4066
90 Ga0068868_100033823 3300005338 Bacteria 3943
91 Ga0068868_100034755 3300005338 Bacteria 3893
92 Ga0068868_100078408 3300005338 Bacteria 2645
93 Ga0068868_100142119 3300005338 Bacteria 1971
94 Ga0070660_100009324 3300005339 Bacteria 6896
95 Ga0070660_100026529 3300005339 Bacteria 4314
96 Ga0070660_100030828 3300005339 Bacteria 4024
97 Ga0070660_100070381 3300005339 Bacteria 2730
98 Ga0070660_100075344 3300005339 Bacteria 2642
99 Ga0070660_100107399 3300005339 Bacteria 2217
100 Ga0070660_100123693 3300005339 Bacteria 2066
101 Ga0070689_100000248 3300005340 Bacteria 31524
102 Ga0070689_100016213 3300005340 Bacteria 5448
103 Ga0070689_100016466 3300005340 Bacteria 5411
104 Ga0070689_100075796 3300005340 Bacteria 2634
105 Ga0070689_100109121 3300005340 Bacteria 2199
106 Ga0070691_10026712 3300005341 Unclassified 2692
107 Ga0070691_10042621 3300005341 Bacteria 2148
108 Ga0070687_100012018 3300005343 Bacteria 3808
109 Ga0070687_100012416 3300005343 Bacteria 3762
110 Ga0070687_100023796 3300005343 Bacteria 2915
111 Ga0070661_100002682 3300005344 Bacteria 12191
112 Ga0070661_100013020 3300005344 Bacteria 5831
113 Ga0070661_100017312 3300005344 Bacteria 5112
114 Ga0070661_100019036 3300005344 Bacteria 4888
115 Ga0070661_100032546 3300005344 Bacteria 3775
116 Ga0070661_100041965 3300005344 Bacteria 3338
117 Ga0070661_100059260 3300005344 Unclassified 2807
118 Ga0070661_100096196 3300005344 Bacteria 2197
119 Ga0070692_10072056 3300005345 Bacteria 1842
120 Ga0070668_100021454 3300005347 Bacteria 4880
121 Ga0070669_100004260 3300005353 Bacteria 10330
122 Ga0070669_100066385 3300005353 Bacteria 2659
123 Ga0070669_100071221 3300005353 Unclassified 2572
124 Ga0070669_100170058 3300005353 Bacteria 1698
125 Ga0070669_100173704 3300005353 Bacteria 1681
126 Ga0070675_100018224 3300005354 Bacteria 5589
127 Ga0070675_100073940 3300005354 Bacteria 2830
128 Ga0070675_100155466 3300005354 Bacteria 1963
129 Ga0070671_100013024 3300005355 Bacteria 6703
130 Ga0070671_100020267 3300005355 Bacteria 5422
131 Ga0070671_100078846 3300005355 Bacteria 2753
132 Ga0070671_100145660 3300005355 Bacteria 1999
133 Ga0070674_100004725 3300005356 Bacteria 7797
134 Ga0070673_100033102 3300005364 Unclassified 3898
135 Ga0070673_100311301 3300005364 Bacteria 1389
136 Ga0070688_100077491 3300005365 Bacteria 2142
137 Ga0070659_100000100 3300005366 Bacteria 63786
138 Ga0070659_100017519 3300005366 Bacteria 5395
139 Ga0070659_100065536 3300005366 Bacteria 2877
140 Ga0070659_100088224 3300005366 Bacteria 2484
141 Ga0070659_100102636 3300005366 Bacteria 2302
142 Ga0070659_100146976 3300005366 Unclassified 1921
143 Ga0070667_100000753 3300005367 Bacteria 30884
144 Ga0070667_100002056 3300005367 Bacteria 17807
145 Ga0070667_100016885 3300005367 Bacteria 6041
146 Ga0070703_10000187 3300005406 Bacteria 30058
147 Ga0070709_10000003 3300005434 Bacteria 295541
148 Ga0070709_10000885 3300005434 Bacteria 16785
149 Ga0070709_10134789 3300005434 Bacteria 1690
150 Ga0070714_100008040 3300005435 Bacteria 8220
151 Ga0070714_100009170 3300005435 Bacteria 7766
152 Ga0070714_100009429 3300005435 Bacteria 7676
153 Ga0070714_100065269 3300005435 Unclassified 3135
154 Ga0070713_100000496 3300005436 Bacteria 25189
155 Ga0070713_100026982 3300005436 Bacteria 4517
156 Ga0070713_100044171 3300005436 Unclassified 3646
157 Ga0070713_100044366 3300005436 Bacteria 3639
158 Ga0070713_100050316 3300005436 Bacteria 3442
159 Ga0070711_100000043 3300005439 Bacteria 83982
160 Ga0070711_100022686 3300005439 Bacteria 4072
161 Ga0070711_100067660 3300005439 Bacteria 2507
162 Ga0070705_100000014 3300005440 Bacteria 94384
163 Ga0070705_100005865 3300005440 Bacteria 6005
164 Ga0070705_100023860 3300005440 Bacteria 3292
165 Ga0070705_100107443 3300005440 Bacteria 1776
166 Ga0070700_100000043 3300005441 Bacteria 98943
167 Ga0070700_100005650 3300005441 Bacteria 6634
168 Ga0070700_100020428 3300005441 Bacteria 3836
169 Ga0070700_100073570 3300005441 Unclassified 2187
170 Ga0070694_100016401 3300005444 Bacteria 4663
171 Ga0070694_100055145 3300005444 Bacteria 2695
172 Ga0070694_100124556 3300005444 Bacteria 1854
173 Ga0070708_100001856 3300005445 Bacteria 16207
174 Ga0070708_100009500 3300005445 Bacteria 7839
175 Ga0070708_100017262 3300005445 Bacteria 6013
176 Ga0070708_100055393 3300005445 Bacteria 3526
177 Ga0070708_100183126 3300005445 Bacteria 1958
178 Ga0070708_100204859 3300005445 Bacteria 1848
179 Ga0070663_100041478 3300005455 Unclassified 3228
180 Ga0070663_100089266 3300005455 Bacteria 2281
181 Ga0070678_100094105 3300005456 Bacteria 2306
182 Ga0070678_100143780 3300005456 Bacteria 1912
183 Ga0070662_100018852 3300005457 Bacteria 4675
184 Ga0070662_100035039 3300005457 Bacteria 3542
185 Ga0070662_100074875 3300005457 Bacteria 2506
186 Ga0070662_100119867 3300005457 Unclassified 2015
187 Ga0070662_100137687 3300005457 Bacteria 1889
188 Ga0070681_10000488 3300005458 Bacteria 32338
189 Ga0070681_10000703 3300005458 Bacteria 27785
190 Ga0070681_10001136 3300005458 Bacteria 22889
191 Ga0070681_10012592 3300005458 Bacteria 8394
192 Ga0070681_10013640 3300005458 Bacteria 8087
193 Ga0070681_10014025 3300005458 Bacteria 7976
194 Ga0070681_10040770 3300005458 Bacteria 4651
195 Ga0070681_10068704 3300005458 Bacteria 3510
196 Ga0070681_10167881 3300005458 Bacteria 2117
197 Ga0070681_10280816 3300005458 Bacteria 1576
198 Ga0070681_10293997 3300005458 Bacteria 1534
199 Ga0068867_100011807 3300005459 Bacteria 6168
200 Ga0068867_100033225 3300005459 Bacteria 3734
201 Ga0068867_100135264 3300005459 Bacteria 1920
202 Ga0068867_100148504 3300005459 Bacteria 1839
203 Ga0070685_10084729 3300005466 Unclassified 1907
204 Ga0070685_10088078 3300005466 Unclassified 1874
205 Ga0070706_100000358 3300005467 Bacteria 55073
206 Ga0070706_100001124 3300005467 Bacteria 28932
207 Ga0070706_100001623 3300005467 Bacteria 23456
208 Ga0070706_100012809 3300005467 Bacteria 7762
209 Ga0070706_100028071 3300005467 Bacteria 5179
210 Ga0070706_100183267 3300005467 Bacteria 1955
211 Ga0070707_100000464 3300005468 Bacteria 40168
212 Ga0070707_100001430 3300005468 Bacteria 23360
213 Ga0070707_100015517 3300005468 Bacteria 7148
214 Ga0070707_100059027 3300005468 Bacteria 3680
215 Ga0070707_100129304 3300005468 Unclassified 2455
216 Ga0070707_100181668 3300005468 Bacteria 2051
217 Ga0070698_100004526 3300005471 Bacteria 15276
218 Ga0070698_100048715 3300005471 Bacteria 4329
219 Ga0070698_100056330 3300005471 Bacteria 3984
220 Ga0070698_100067137 3300005471 Bacteria 3607
221 Ga0070698_100082793 3300005471 Bacteria 3200
222 Ga0070698_100112539 3300005471 Bacteria 2687
223 Ga0070698_100191155 3300005471 Bacteria 1985
224 Ga0070699_100000117 3300005518 Bacteria 73065
225 Ga0070699_100005861 3300005518 Bacteria 10729
226 Ga0070699_100006267 3300005518 Bacteria 10380
227 Ga0070699_100010572 3300005518 Bacteria 7990
228 Ga0070699_100041648 3300005518 Unclassified 3975
229 Ga0070699_100055098 3300005518 Bacteria 3443
230 Ga0070699_100077185 3300005518 Bacteria 2899
231 Ga0070699_100187034 3300005518 Bacteria 1839
232 Ga0070699_100237531 3300005518 Bacteria 1626
233 Ga0070679_100000793 3300005530 Bacteria 27410
234 Ga0070679_100005723 3300005530 Bacteria 11525
235 Ga0070679_100006050 3300005530 Bacteria 11256
236 Ga0070679_100058748 3300005530 Bacteria 3833
237 Ga0070679_100078346 3300005530 Bacteria 3293
238 Ga0070679_100124827 3300005530 Bacteria 2557
239 Ga0070684_100000050 3300005535 Bacteria 78974
240 Ga0070684_100001249 3300005535 Bacteria 18217
241 Ga0070684_100008670 3300005535 Bacteria 7969
242 Ga0070684_100036930 3300005535 Bacteria 4188
243 Ga0070684_100072968 3300005535 Bacteria 3023
244 Ga0070684_100087159 3300005535 Bacteria 2772
245 Ga0070684_100169355 3300005535 Bacteria 1984
246 Ga0070684_100232289 3300005535 Bacteria 1684
247 Ga0070697_100003003 3300005536 Bacteria 12950
248 Ga0070697_100014521 3300005536 Bacteria 6186
249 Ga0070697_100064898 3300005536 Bacteria 2982
250 Ga0070697_100075108 3300005536 Bacteria 2778
251 Ga0070697_100167622 3300005536 Bacteria 1858
252 Ga0070697_100172832 3300005536 Bacteria 1829
253 Ga0070697_100289068 3300005536 Bacteria 1408
254 Ga0068853_100000064 3300005539 Bacteria 75224
255 Ga0068853_100032135 3300005539 Bacteria 4444
256 Ga0068853_100054808 3300005539 Bacteria 3436
257 Ga0068853_100071218 3300005539 Bacteria 3027
258 Ga0068853_100316508 3300005539 Bacteria 1446
259 Ga0070672_100000164 3300005543 Bacteria 36773
260 Ga0070672_100000448 3300005543 Bacteria 24120
261 Ga0070672_100004770 3300005543 Bacteria 8896
262 Ga0070672_100009058 3300005543 Bacteria 6844
263 Ga0070672_100095761 3300005543 Unclassified 2401
264 Ga0070686_100012837 3300005544 Unclassified 4781
265 Ga0070686_100226321 3300005544 Bacteria 1354
266 Ga0070695_100021982 3300005545 Unclassified 3910
267 Ga0070695_100113942 3300005545 Unclassified 1840
268 Ga0070695_100207507 3300005545 Unclassified 1404
269 Ga0070696_100000836 3300005546 Bacteria 19841
270 Ga0070696_100034248 3300005546 Bacteria 3493
271 Ga0070696_100078410 3300005546 Bacteria 2336
272 Ga0070696_100261381 3300005546 Bacteria 1313
273 Ga0070693_100007232 3300005547 Bacteria 5419
274 Ga0070693_100019137 3300005547 Bacteria 3585
275 Ga0070693_100056777 3300005547 Bacteria 2260
276 Ga0070693_100075132 3300005547 Unclassified 2000
277 Ga0070665_100000041 3300005548 Bacteria 297849
278 Ga0070665_100026440 3300005548 Bacteria 5843
279 Ga0070665_100412747 3300005548 Bacteria 1359
280 Ga0070704_100061423 3300005549 Bacteria 2689
281 Ga0070704_100094654 3300005549 Bacteria 2235
282 Ga0070704_100189581 3300005549 Bacteria 1652
283 Ga0070704_100203410 3300005549 Bacteria 1600
284 Ga0070704_100239569 3300005549 Bacteria 1484
285 Ga0070704_100261789 3300005549 Bacteria 1425
286 Ga0068855_100001820 3300005563 Bacteria 26602
287 Ga0068855_100006037 3300005563 Bacteria 14775
288 Ga0068855_100012835 3300005563 Bacteria 10108
289 Ga0068855_100014332 3300005563 Bacteria 9546
290 Ga0068855_100029054 3300005563 Bacteria 6612
291 Ga0068855_100044264 3300005563 Bacteria 5268
292 Ga0068855_100057355 3300005563 Bacteria 4565
293 Ga0068855_100084938 3300005563 Bacteria 3663
294 Ga0068855_100087128 3300005563 Bacteria 3610
295 Ga0068855_100100502 3300005563 Bacteria 3330
296 Ga0068855_100144187 3300005563 Bacteria 2713
297 Ga0068855_100159420 3300005563 Bacteria 2562
298 Ga0068855_100174487 3300005563 Bacteria 2433
299 Ga0068855_100315992 3300005563 Bacteria 1727
300 Ga0068855_100336313 3300005563 Bacteria 1666
301 Ga0070664_100000535 3300005564 Bacteria 28978
302 Ga0070664_100001689 3300005564 Bacteria 17683
303 Ga0070664_100004607 3300005564 Bacteria 11068
304 Ga0070664_100005179 3300005564 Bacteria 10466
305 Ga0070664_100035852 3300005564 Bacteria 4165
306 Ga0070664_100070612 3300005564 Bacteria 2991
307 Ga0070664_100083977 3300005564 Bacteria 2748
308 Ga0070664_100091850 3300005564 Bacteria 2628
309 Ga0070664_100110722 3300005564 Bacteria 2396
310 Ga0070664_100114257 3300005564 Unclassified 2359
311 Ga0068857_100000874 3300005577 Bacteria 22706
312 Ga0068857_100003432 3300005577 Bacteria 13224
313 Ga0068857_100003443 3300005577 Bacteria 13201
314 Ga0068857_100008545 3300005577 Bacteria 8853
315 Ga0068857_100011260 3300005577 Bacteria 7778
316 Ga0068857_100015313 3300005577 Bacteria 6695
317 Ga0068857_100020249 3300005577 Bacteria 5850
318 Ga0068857_100044710 3300005577 Bacteria 3929
319 Ga0068857_100070274 3300005577 Bacteria 3118
320 Ga0068857_100212684 3300005577 Bacteria 1765
321 Ga0068854_100000073 3300005578 Bacteria 72344
322 Ga0068854_100041332 3300005578 Bacteria 3257
323 Ga0068854_100053516 3300005578 Bacteria 2899
324 Ga0068854_100065091 3300005578 Bacteria 2650
325 Ga0068854_100243833 3300005578 Bacteria 1432
326 Ga0068856_100007399 3300005614 Bacteria 10714
327 Ga0068856_100026096 3300005614 Bacteria 5697
328 Ga0068856_100064955 3300005614 Bacteria 3606
329 Ga0068856_100066501 3300005614 Bacteria 3561
330 Ga0068856_100072707 3300005614 Bacteria 3404
331 Ga0068856_100074713 3300005614 Unclassified 3356
332 Ga0068856_100079810 3300005614 Bacteria 3245
333 Ga0068856_100090996 3300005614 Bacteria 3035
334 Ga0070702_100013224 3300005615 Bacteria 4162
335 Ga0068852_100015765 3300005616 Bacteria 5876
336 Ga0068852_100117250 3300005616 Bacteria 2431
337 Ga0068852_100140705 3300005616 Bacteria 2233
338 Ga0068852_100156356 3300005616 Bacteria 2124
339 Ga0068852_100238081 3300005616 Bacteria 1738
340 Ga0068852_100424576 3300005616 Bacteria 1312
341 Ga0068859_100002628 3300005617 Bacteria 18276
342 Ga0068859_100003061 3300005617 Bacteria 16959
343 Ga0068859_100009422 3300005617 Bacteria 9866
344 Ga0068859_100014767 3300005617 Bacteria 7846
345 Ga0068859_100024147 3300005617 Bacteria 6100
346 Ga0068859_100026123 3300005617 Bacteria 5857
347 Ga0068859_100042563 3300005617 Bacteria 4562
348 Ga0068859_100050005 3300005617 Bacteria 4199
349 Ga0068859_100054614 3300005617 Unclassified 4018
350 Ga0068859_100070866 3300005617 Bacteria 3521
351 Ga0068859_100091174 3300005617 Bacteria 3098
352 Ga0068859_100098305 3300005617 Bacteria 2981
353 Ga0068859_100145250 3300005617 Bacteria 2447
354 Ga0068864_100000280 3300005618 Bacteria 45611
355 Ga0068864_100001424 3300005618 Bacteria 19746
356 Ga0068864_100003363 3300005618 Bacteria 13219
357 Ga0068864_100013630 3300005618 Bacteria 6739
358 Ga0068864_100026483 3300005618 Bacteria 4890
359 Ga0068864_100032987 3300005618 Bacteria 4401
360 Ga0068864_100062746 3300005618 Bacteria 3220
361 Ga0068864_100070039 3300005618 Unclassified 3051
362 Ga0068861_100003603 3300005719 Bacteria 10313
363 Ga0068861_100015543 3300005719 Bacteria 5367
364 Ga0068861_100027837 3300005719 Bacteria 4121
365 Ga0068861_100072514 3300005719 Bacteria 2672
366 Ga0068861_100114795 3300005719 Bacteria 2163
367 Ga0068851_10006720 3300005834 Bacteria 5261
368 Ga0068870_10001642 3300005840 Bacteria 9131
369 Ga0068863_100011787 3300005841 Bacteria 8451
370 Ga0068863_100027088 3300005841 Bacteria 5466
371 Ga0068863_100042150 3300005841 Bacteria 4336
372 Ga0068863_100054312 3300005841 Bacteria 3795
373 Ga0068863_100059187 3300005841 Unclassified 3625
374 Ga0068863_100072423 3300005841 Unclassified 3260
375 Ga0068863_100073393 3300005841 Bacteria 3237
376 Ga0068863_100173894 3300005841 Bacteria 2066
377 Ga0068863_100311620 3300005841 Unclassified 1528
378 Ga0068858_100000145 3300005842 Bacteria 75245
379 Ga0068858_100006983 3300005842 Bacteria 10967
380 Ga0068858_100007419 3300005842 Bacteria 10607
381 Ga0068858_100012307 3300005842 Bacteria 8069
382 Ga0068860_100000447 3300005843 Bacteria 52095
383 Ga0068860_100005284 3300005843 Bacteria 13105
384 Ga0068860_100006039 3300005843 Bacteria 12188
385 Ga0068860_100016080 3300005843 Bacteria 7299
386 Ga0068860_100018865 3300005843 Bacteria 6702
387 Ga0068860_100028626 3300005843 Bacteria 5363
388 Ga0068860_100145484 3300005843 Bacteria 2280
389 Ga0068862_100009649 3300005844 Bacteria 7979
390 Ga0068862_100046755 3300005844 Bacteria 3692
391 Ga0068862_100055486 3300005844 Bacteria 3393
392 Ga0068862_100115134 3300005844 Bacteria 2364
393 Ga0068862_100122973 3300005844 Bacteria 2289
394 Ga0081455_10013786 3300005937 Bacteria 7954
395 Ga0081455_10066777 3300005937 Bacteria 3001
396 Ga0081539_10000165 3300005985 Bacteria 153824
397 Ga0081539_10000702 3300005985 Bacteria 67205
398 Ga0081539_10001077 3300005985 Bacteria 49686
399 Ga0070717_10000321 3300006028 Bacteria 31361
400 Ga0070717_10005934 3300006028 Bacteria 8942
401 Ga0070717_10011995 3300006028 Bacteria 6599
402 Ga0070717_10073285 3300006028 Unclassified 2862
403 Ga0075365_10075500 3300006038 Bacteria 2275
404 Ga0075368_10003224 3300006042 Bacteria 5427
405 Ga0075364_10093980 3300006051 Bacteria 1992
406 Ga0070716_100114198 3300006173 Bacteria 1679
407 Ga0070716_100125239 3300006173 Bacteria 1615
408 Ga0070712_100011061 3300006175 Bacteria 5711
409 Ga0070712_100058102 3300006175 Bacteria 2720
410 Ga0070712_100125877 3300006175 Bacteria 1935
411 Ga0075367_10013141 3300006178 Bacteria 4440
412 Ga0075367_10022410 3300006178 Bacteria 3542
413 Ga0075366_10000031 3300006195 Bacteria 49332
414 Ga0075366_10023898 3300006195 Bacteria 3562
415 Ga0075366_10077741 3300006195 Bacteria 1980
416 Ga0075366_10137667 3300006195 Bacteria 1475
417 Ga0097621_100001961 3300006237 Bacteria 14038
418 Ga0097621_100006331 3300006237 Bacteria 8401
419 Ga0097621_100008111 3300006237 Bacteria 7547
420 Ga0097621_100019582 3300006237 Bacteria 5198
421 Ga0097621_100024171 3300006237 Bacteria 4741
422 Ga0097621_100057343 3300006237 Bacteria 3185
423 Ga0097621_100131344 3300006237 Bacteria 2132
424 Ga0075370_10038647 3300006353 Bacteria 2686
425 Ga0075370_10076558 3300006353 Bacteria 1919
426 Ga0068871_100006604 3300006358 Bacteria 8225
427 Ga0068871_100019446 3300006358 Bacteria 5185
428 Ga0068871_100021609 3300006358 Bacteria 4948
429 Ga0068871_100048031 3300006358 Bacteria 3444
430 Ga0075428_100001232 3300006844 Bacteria 27372
431 Ga0075428_100002086 3300006844 Bacteria 21561
432 Ga0075428_100013549 3300006844 Bacteria 9078
433 Ga0075428_100017853 3300006844 Bacteria 7840
434 Ga0075428_100026237 3300006844 Bacteria 6453
435 Ga0075428_100029279 3300006844 Bacteria 6093
436 Ga0075428_100031934 3300006844 Bacteria 5818
437 Ga0075428_100061303 3300006844 Bacteria 4119
438 Ga0075428_100073559 3300006844 Bacteria 3733
439 Ga0075428_100087618 3300006844 Bacteria 3396
440 Ga0075428_100094183 3300006844 Bacteria 3265
441 Ga0075428_100095563 3300006844 Bacteria 3240
442 Ga0075428_100153605 3300006844 Bacteria 2501
443 Ga0075428_100161789 3300006844 Bacteria 2430
444 Ga0075428_100167853 3300006844 Unclassified 2380
445 Ga0075428_100175001 3300006844 Bacteria 2325
446 Ga0075428_100189282 3300006844 Bacteria 2226
447 Ga0075428_100189477 3300006844 Bacteria 2225
448 Ga0075428_100198637 3300006844 Bacteria 2169
449 Ga0075428_100273644 3300006844 Bacteria 1817
450 Ga0075428_100366884 3300006844 Bacteria 1544
451 Ga0075430_100001878 3300006846 Bacteria 17198
452 Ga0075430_100002158 3300006846 Bacteria 16291
453 Ga0075430_100003800 3300006846 Bacteria 12709
454 Ga0075430_100006228 3300006846 Bacteria 10064
455 Ga0075430_100011349 3300006846 Bacteria 7560
456 Ga0075430_100027895 3300006846 Bacteria 4796
457 Ga0075430_100157956 3300006846 Bacteria 1887
458 Ga0075431_100001438 3300006847 Bacteria 21928
459 Ga0075431_100001763 3300006847 Bacteria 20387
460 Ga0075431_100002260 3300006847 Bacteria 18464
461 Ga0075431_100019800 3300006847 Bacteria 6869
462 Ga0075431_100027715 3300006847 Bacteria 5815
463 Ga0075431_100054117 3300006847 Bacteria 4139
464 Ga0075431_100084312 3300006847 Bacteria 3281
465 Ga0075431_100138747 3300006847 Bacteria 2506
466 Ga0075431_100140604 3300006847 Bacteria 2488
467 Ga0075431_100170006 3300006847 Bacteria 2240
468 Ga0075431_100234064 3300006847 Bacteria 1871
469 Ga0075433_10000177 3300006852 Bacteria 35403
470 Ga0075433_10001279 3300006852 Bacteria 18380
471 Ga0075433_10005655 3300006852 Bacteria 9823
472 Ga0075433_10010410 3300006852 Bacteria 7464
473 Ga0075433_10017016 3300006852 Bacteria 6010
474 Ga0075433_10025895 3300006852 Bacteria 4960
475 Ga0075433_10030646 3300006852 Bacteria 4590
476 Ga0075433_10054625 3300006852 Bacteria 3484
477 Ga0075433_10057581 3300006852 Bacteria 3397
478 Ga0075433_10061092 3300006852 Bacteria 3301
479 Ga0075433_10083303 3300006852 Bacteria 2823
480 Ga0075433_10162608 3300006852 Bacteria 1987
481 Ga0075434_100002184 3300006871 Bacteria 17055
482 Ga0075434_100017967 3300006871 Bacteria 6824
483 Ga0075434_100021342 3300006871 Bacteria 6294
484 Ga0075434_100025788 3300006871 Bacteria 5754
485 Ga0075434_100027873 3300006871 Bacteria 5546
486 Ga0075434_100037625 3300006871 Bacteria 4790
487 Ga0075434_100040878 3300006871 Bacteria 4592
488 Ga0075434_100042430 3300006871 Bacteria 4509
489 Ga0075434_100064026 3300006871 Bacteria 3660
490 Ga0075434_100094563 3300006871 Bacteria 2993
491 Ga0075434_100156561 3300006871 Bacteria 2297
492 Ga0075434_100242811 3300006871 Bacteria 1821
493 Ga0075429_100003643 3300006880 Bacteria 13121
494 Ga0075429_100022461 3300006880 Bacteria 5471
495 Ga0075429_100051081 3300006880 Bacteria 3598
496 Ga0075429_100063120 3300006880 Bacteria 3228
497 Ga0075429_100092481 3300006880 Bacteria 2638
498 Ga0075429_100098766 3300006880 Bacteria 2547
499 Ga0075429_100140853 3300006880 Bacteria 2111
500 Ga0068865_100007861 3300006881 Bacteria 6578
501 Ga0068865_100018567 3300006881 Bacteria 4489
502 Ga0068865_100192260 3300006881 Bacteria 1579
503 Ga0068865_100245108 3300006881 Bacteria 1412
504 Ga0075436_100000012 3300006914 Bacteria 188052
505 Ga0075436_100000197 3300006914 Bacteria 37393
506 Ga0075436_100008535 3300006914 Bacteria 7003
507 Ga0075436_100010797 3300006914 Bacteria 6266
508 Ga0075436_100030417 3300006914 Bacteria 3717
509 Ga0097620_100002629 3300006931 Bacteria 18276
510 Ga0097620_100003061 3300006931 Bacteria 16959
511 Ga0097620_100009422 3300006931 Bacteria 9866
512 Ga0097620_100014768 3300006931 Bacteria 7846
513 Ga0097620_100024147 3300006931 Bacteria 6100
514 Ga0097620_100026123 3300006931 Bacteria 5857
515 Ga0097620_100042560 3300006931 Bacteria 4562
516 Ga0097620_100050005 3300006931 Bacteria 4199
517 Ga0097620_100054613 3300006931 Unclassified 4018
518 Ga0097620_100070862 3300006931 Bacteria 3521
519 Ga0097620_100091181 3300006931 Bacteria 3098
520 Ga0097620_100098309 3300006931 Bacteria 2981
521 Ga0097620_100145245 3300006931 Bacteria 2447
522 Ga0075435_100002765 3300007076 Bacteria 11718
523 Ga0075435_100008355 3300007076 Bacteria 7421
524 Ga0075435_100009509 3300007076 Bacteria 7045
525 Ga0075435_100012415 3300007076 Bacteria 6307
526 Ga0075435_100015115 3300007076 Bacteria 5794
527 Ga0075435_100016801 3300007076 Bacteria 5522
528 Ga0075435_100053999 3300007076 Unclassified 3242
529 Ga0075435_100060343 3300007076 Bacteria 3075
530 Ga0075435_100196560 3300007076 Bacteria 1708
531 Ga0075435_100230798 3300007076 Bacteria 1572
532 Ga0075435_100275129 3300007076 Bacteria 1437
533 Ga0099794_10000014 3300007265 Bacteria 81481
534 Ga0099794_10030563 3300007265 Bacteria 2516
535 Ga0105240_10000060 3300009093 Bacteria 219839
536 Ga0105240_10000311 3300009093 Bacteria 93752
537 Ga0105240_10000998 3300009093 Bacteria 50528
538 Ga0105240_10003652 3300009093 Bacteria 23822
539 Ga0105240_10007758 3300009093 Bacteria 15523
540 Ga0105240_10008706 3300009093 Bacteria 14477
541 Ga0105240_10021747 3300009093 Bacteria 8523
542 Ga0105240_10058748 3300009093 Bacteria 4801
543 Ga0105240_10062469 3300009093 Bacteria 4637
544 Ga0105240_10082347 3300009093 Bacteria 3952
545 Ga0105240_10107822 3300009093 Bacteria 3376
546 Ga0105240_10109325 3300009093 Bacteria 3348
547 Ga0105240_10164803 3300009093 Bacteria 2629
548 Ga0105240_10244523 3300009093 Unclassified 2078
549 Ga0105240_10271779 3300009093 Unclassified 1951
550 Ga0105240_10351098 3300009093 Bacteria 1673
551 Ga0111539_10002302 3300009094 Bacteria 25379
552 Ga0111539_10004531 3300009094 Bacteria 18166
553 Ga0111539_10009668 3300009094 Bacteria 12169
554 Ga0111539_10020790 3300009094 Bacteria 8080
555 Ga0111539_10025886 3300009094 Bacteria 7182
556 Ga0111539_10052075 3300009094 Bacteria 4874
557 Ga0111539_10090498 3300009094 Bacteria 3596
558 Ga0111539_10108271 3300009094 Bacteria 3261
559 Ga0111539_10119916 3300009094 Bacteria 3082
560 Ga0111539_10140648 3300009094 Bacteria 2826
561 Ga0111539_10146107 3300009094 Bacteria 2768
562 Ga0111539_10154833 3300009094 Unclassified 2682
563 Ga0111539_10331743 3300009094 Bacteria 1771
564 Ga0105245_10006673 3300009098 Bacteria 10128
565 Ga0105245_10007102 3300009098 Bacteria 9826
566 Ga0105245_10023239 3300009098 Bacteria 5443
567 Ga0105245_10030171 3300009098 Bacteria 4793
568 Ga0105245_10046042 3300009098 Bacteria 3897
569 Ga0105245_10058290 3300009098 Bacteria 3476
570 Ga0105245_10090414 3300009098 Bacteria 2816
571 Ga0105245_10121495 3300009098 Unclassified 2441
572 Ga0105245_10129616 3300009098 Bacteria 2365
573 Ga0105245_10155879 3300009098 Bacteria 2163
574 Ga0105245_10215365 3300009098 Bacteria 1850
575 Ga0105245_10336384 3300009098 Bacteria 1492
576 Ga0105247_10000003 3300009101 Bacteria 694517
577 Ga0105247_10001639 3300009101 Bacteria 15826
578 Ga0114129_10002160 3300009147 Bacteria 27095
579 Ga0114129_10002359 3300009147 Bacteria 26209
580 Ga0114129_10002470 3300009147 Bacteria 25675
581 Ga0114129_10003987 3300009147 Bacteria 20856
582 Ga0114129_10004064 3300009147 Bacteria 20660
583 Ga0114129_10006657 3300009147 Bacteria 16407
584 Ga0114129_10010743 3300009147 Bacteria 13050
585 Ga0114129_10034177 3300009147 Bacteria 7179
586 Ga0114129_10049861 3300009147 Bacteria 5881
587 Ga0114129_10052687 3300009147 Bacteria 5711
588 Ga0114129_10053472 3300009147 Bacteria 5663
589 Ga0114129_10062911 3300009147 Bacteria 5183
590 Ga0114129_10067956 3300009147 Bacteria 4969
591 Ga0114129_10122842 3300009147 Bacteria 3572
592 Ga0114129_10216129 3300009147 Bacteria 2589
593 Ga0114129_10219938 3300009147 Bacteria 2562
594 Ga0114129_10263166 3300009147 Bacteria 2310
595 Ga0114129_10400597 3300009147 Unclassified 1809
596 Ga0114129_10417895 3300009147 Bacteria 1764
597 Ga0114129_10478444 3300009147 Bacteria 1630
598 Ga0105243_10020833 3300009148 Bacteria 4975
599 Ga0105243_10034360 3300009148 Bacteria 3925
600 Ga0105241_10001899 3300009174 Bacteria 15819
601 Ga0105241_10009497 3300009174 Bacteria 7144
602 Ga0105241_10011905 3300009174 Bacteria 6392
603 Ga0105241_10041819 3300009174 Bacteria 3464
604 Ga0105241_10058008 3300009174 Bacteria 2972
605 Ga0105241_10070504 3300009174 Bacteria 2712
606 Ga0105242_10000237 3300009176 Bacteria 43474
607 Ga0105242_10003265 3300009176 Bacteria 12642
608 Ga0105242_10010813 3300009176 Bacteria 7007
609 Ga0105242_10037108 3300009176 Bacteria 3913
610 Ga0105248_10001049 3300009177 Bacteria 30595
611 Ga0105248_10001449 3300009177 Bacteria 26404
612 Ga0105248_10010068 3300009177 Bacteria 10413
613 Ga0105248_10019572 3300009177 Bacteria 7491
614 Ga0105248_10019616 3300009177 Bacteria 7484
615 Ga0105248_10022626 3300009177 Bacteria 6975
616 Ga0105248_10023548 3300009177 Bacteria 6840
617 Ga0105248_10027354 3300009177 Bacteria 6348
618 Ga0105248_10164608 3300009177 Bacteria 2500
619 Ga0105248_10199822 3300009177 Bacteria 2252
620 Ga0105248_10520037 3300009177 Bacteria 1342
621 Ga0105237_10001134 3300009545 Bacteria 35751
622 Ga0105237_10001387 3300009545 Bacteria 32008
623 Ga0105237_10001392 3300009545 Bacteria 31950
624 Ga0105237_10001507 3300009545 Bacteria 30622
625 Ga0105237_10002648 3300009545 Bacteria 22020
626 Ga0105237_10003022 3300009545 Bacteria 20297
627 Ga0105237_10003761 3300009545 Bacteria 17860
628 Ga0105237_10004821 3300009545 Bacteria 15494
629 Ga0105237_10007121 3300009545 Bacteria 12288
630 Ga0105237_10015193 3300009545 Bacteria 8021
631 Ga0105237_10032809 3300009545 Bacteria 5257
632 Ga0105237_10034576 3300009545 Bacteria 5117
633 Ga0105237_10047909 3300009545 Bacteria 4297
634 Ga0105237_10156143 3300009545 Bacteria 2279
635 Ga0105238_10000790 3300009551 Bacteria 32827
636 Ga0105238_10007423 3300009551 Bacteria 10980
637 Ga0105238_10009957 3300009551 Bacteria 9531
638 Ga0105238_10011530 3300009551 Bacteria 8904
639 Ga0105238_10024868 3300009551 Bacteria 6103
640 Ga0105238_10032960 3300009551 Bacteria 5272
641 Ga0105238_10040715 3300009551 Bacteria 4708
642 Ga0105238_10076972 3300009551 Bacteria 3328
643 Ga0105238_10181732 3300009551 Bacteria 2080
644 Ga0105238_10236112 3300009551 Bacteria 1806
645 Ga0105238_10329665 3300009551 Unclassified 1513
646 Ga0105249_10000075 3300009553 Bacteria 145150
647 Ga0105249_10000101 3300009553 Bacteria 119072
648 Ga0105249_10017823 3300009553 Bacteria 6309
649 Ga0105249_10025571 3300009553 Bacteria 5316
650 Ga0105249_10034138 3300009553 Bacteria 4608
651 Ga0105249_10046998 3300009553 Bacteria 3931
652 Ga0105249_10069249 3300009553 Bacteria 3256
653 Ga0105239_10000126 3300010375 Bacteria 107921
654 Ga0105239_10004450 3300010375 Bacteria 16753
655 Ga0105239_10006203 3300010375 Bacteria 13914
656 Ga0105239_10022259 3300010375 Bacteria 6986
657 Ga0105239_10023935 3300010375 Bacteria 6726
658 Ga0105239_10025660 3300010375 Bacteria 6489
659 Ga0105239_10051293 3300010375 Bacteria 4523
660 Ga0105239_10056610 3300010375 Bacteria 4301
661 Ga0105239_10064049 3300010375 Bacteria 4036
662 Ga0105239_10147941 3300010375 Bacteria 2621
663 Ga0105246_10006857 3300011119 Bacteria 6966
664 Ga0105246_10018201 3300011119 Bacteria 4476
665 Ga0105246_10048239 3300011119 Bacteria 2911
666 Ga0105246_10066863 3300011119 Bacteria 2517
667 Ga0157373_10000125 3300013100 Bacteria 59653
668 Ga0157373_10012920 3300013100 Bacteria 6130
669 Ga0157373_10024685 3300013100 Bacteria 4354
670 Ga0157373_10029804 3300013100 Bacteria 3928
671 Ga0157373_10043098 3300013100 Unclassified 3224
672 Ga0157373_10181109 3300013100 Bacteria 1483
673 Ga0157371_10000575 3300013102 Bacteria 43514
674 Ga0157371_10001519 3300013102 Bacteria 23982
675 Ga0157371_10004090 3300013102 Bacteria 12891
676 Ga0157371_10008186 3300013102 Bacteria 8359
677 Ga0157371_10030794 3300013102 Bacteria 3868
678 Ga0157370_10020688 3300013104 Bacteria 6567
679 Ga0157370_10036893 3300013104 Bacteria 4741
680 Ga0157370_10044893 3300013104 Bacteria 4244
681 Ga0157370_10053730 3300013104 Bacteria 3841
682 Ga0157370_10085934 3300013104 Bacteria 2955
683 Ga0157370_10090709 3300013104 Bacteria 2869
684 Ga0157370_10091843 3300013104 Bacteria 2850
685 Ga0157370_10093827 3300013104 Bacteria 2816
686 Ga0157370_10139041 3300013104 Bacteria 2263
687 Ga0157369_10000942 3300013105 Bacteria 36964
688 Ga0157369_10002025 3300013105 Bacteria 24446
689 Ga0157369_10008102 3300013105 Bacteria 12042
690 Ga0157369_10017047 3300013105 Bacteria 8162
691 Ga0157369_10037641 3300013105 Bacteria 5296
692 Ga0157369_10063726 3300013105 Bacteria 3971
693 Ga0157369_10094736 3300013105 Bacteria 3187
694 Ga0157369_10109997 3300013105 Bacteria 2929
695 Ga0157369_10142773 3300013105 Bacteria 2532
696 Ga0157369_10223995 3300013105 Bacteria 1968
697 Ga0157369_10325368 3300013105 Bacteria 1598
698 Ga0157374_10007981 3300013296 Bacteria 9045
699 Ga0157374_10011658 3300013296 Bacteria 7621
700 Ga0157374_10018791 3300013296 Bacteria 6108
701 Ga0157374_10023272 3300013296 Bacteria 5539
702 Ga0157374_10056881 3300013296 Bacteria 3652
703 Ga0157374_10190301 3300013296 Unclassified 2007
704 Ga0157374_10310357 3300013296 Bacteria 1561
705 Ga0157378_10000028 3300013297 Bacteria 128346
706 Ga0157378_10011255 3300013297 Bacteria 7827
707 Ga0157378_10020841 3300013297 Bacteria 5765
708 Ga0157378_10084796 3300013297 Bacteria 2869
709 Ga0157378_10086916 3300013297 Bacteria 2835
710 Ga0157378_10100285 3300013297 Bacteria 2643
711 Ga0157378_10101717 3300013297 Bacteria 2625
712 Ga0157378_10214979 3300013297 Bacteria 1825
713 Ga0163162_10002051 3300013306 Bacteria 18927
714 Ga0163162_10002686 3300013306 Bacteria 16863
715 Ga0163162_10003659 3300013306 Bacteria 14751
716 Ga0163162_10003853 3300013306 Bacteria 14396
717 Ga0163162_10012750 3300013306 Bacteria 8211
718 Ga0163162_10022021 3300013306 Bacteria 6279
719 Ga0163162_10035805 3300013306 Bacteria 4945
720 Ga0163162_10088430 3300013306 Bacteria 3177
721 Ga0163162_10108784 3300013306 Bacteria 2869
722 Ga0163162_10144992 3300013306 Bacteria 2490
723 Ga0163162_10217971 3300013306 Bacteria 2038
724 Ga0163162_10420777 3300013306 Unclassified 1468
725 Ga0163162_10532247 3300013306 Unclassified 1304
726 Ga0157372_10000042 3300013307 Bacteria 157651
727 Ga0157372_10000894 3300013307 Bacteria 32388
728 Ga0157372_10002344 3300013307 Bacteria 20484
729 Ga0157372_10002762 3300013307 Bacteria 18980
730 Ga0157372_10006757 3300013307 Bacteria 12194
731 Ga0157372_10009372 3300013307 Bacteria 10418
732 Ga0157372_10012040 3300013307 Bacteria 9212
733 Ga0157372_10019850 3300013307 Bacteria 7242
734 Ga0157372_10033379 3300013307 Bacteria 5653
735 Ga0157372_10040102 3300013307 Bacteria 5170
736 Ga0157372_10048374 3300013307 Bacteria 4727
737 Ga0157372_10092917 3300013307 Bacteria 3432
738 Ga0157372_10255797 3300013307 Bacteria 2033
739 Ga0157372_10262483 3300013307 Bacteria 2006
740 Ga0157372_10434327 3300013307 Bacteria 1530
741 Ga0157375_10000013 3300013308 Bacteria 323500
742 Ga0157375_10001948 3300013308 Bacteria 17800
743 Ga0157375_10013304 3300013308 Bacteria 7318
744 Ga0157375_10034497 3300013308 Bacteria 4822
745 Ga0157375_10080765 3300013308 Bacteria 3290
746 Ga0157375_10098741 3300013308 Bacteria 2997
747 Ga0157375_10123923 3300013308 Bacteria 2697
748 Ga0157375_10131343 3300013308 Bacteria 2624
749 Ga0157375_10234070 3300013308 Bacteria 1996
750 Ga0157375_10308178 3300013308 Bacteria 1747
751 Ga0157375_10384126 3300013308 Bacteria 1571
752 Ga0157375_10521525 3300013308 Bacteria 1351
753 Ga0163163_10001896 3300014325 Bacteria 17684
754 Ga0163163_10003629 3300014325 Bacteria 13121
755 Ga0163163_10007552 3300014325 Bacteria 9600
756 Ga0163163_10011350 3300014325 Bacteria 8078
757 Ga0163163_10013662 3300014325 Bacteria 7437
758 Ga0163163_10029097 3300014325 Bacteria 5312
759 Ga0163163_10029511 3300014325 Bacteria 5276
760 Ga0163163_10041132 3300014325 Unclassified 4518
761 Ga0163163_10071588 3300014325 Bacteria 3455
762 Ga0163163_10217636 3300014325 Unclassified 1959
763 Ga0157380_10000414 3300014326 Bacteria 26000
764 Ga0157380_10008545 3300014326 Bacteria 7320
765 Ga0157380_10012682 3300014326 Bacteria 6119
766 Ga0157380_10032830 3300014326 Unclassified 3995
767 Ga0157380_10049180 3300014326 Bacteria 3324
768 Ga0157380_10121555 3300014326 Bacteria 2213
769 Ga0182008_10000002 3300014497 Bacteria 480216
770 Ga0157377_10078073 3300014745 Bacteria 1929
771 Ga0157379_10113977 3300014968 Bacteria 2430
772 Ga0157379_10147437 3300014968 Bacteria 2122
773 Ga0157376_10007202 3300014969 Bacteria 7911
774 Ga0157376_10008230 3300014969 Bacteria 7510
775 Ga0157376_10152708 3300014969 Bacteria 2084
776 Ga0157376_10261843 3300014969 Bacteria 1621
777 Ga0163161_10005601 3300017792 Bacteria 8707
778 Ga0163161_10009570 3300017792 Bacteria 6700
779 Ga0163161_10084471 3300017792 Bacteria 2341
780 Ga0197907_10588602 3300020069 Unclassified 2432
781 Ga0197907_11491861 3300020069 Bacteria 1499
782 Ga0206355_1325351 3300020076 Bacteria 1592
783 Ga0206351_10222719 3300020077 Bacteria 4684
784 Ga0206351_10424610 3300020077 Bacteria 3521
785 Ga0206352_10516205 3300020078 Bacteria 2665
786 Ga0206352_10928416 3300020078 Unclassified 1625
787 Ga0206350_10041322 3300020080 Unclassified 3572
788 Ga0206350_10906291 3300020080 Bacteria 3394
789 Ga0206354_10863603 3300020081 Bacteria 1387
790 Ga0206353_11181275 3300020082 Bacteria 1939
791 Ga0154015_1394578 3300020610 Bacteria 2998
792 Ga0154015_1619016 3300020610 Unclassified 1737
793 Ga0213875_10000016 3300021388 Bacteria 260448
794 Ga0224712_10004269 3300022467 Bacteria 3836
795 Ga0207672_1000071 3300025223 Bacteria 13582
796 Ga0209437_100024 3300025233 Bacteria 592878
797 Ga0209026_1000762 3300025250 Bacteria 18053
798 Ga0209026_1003945 3300025250 Bacteria 4638
799 Ga0209129_1004267 3300025258 Bacteria 5713
800 Ga0209257_1000006 3300025304 Bacteria 1570111
801 Ga0207697_10029305 3300025315 Bacteria 2252
802 Ga0207656_10009706 3300025321 Bacteria 3578
803 Ga0207653_10000013 3300025885 Bacteria 159236
804 Ga0207653_10001585 3300025885 Bacteria 7349
805 Ga0207682_10016692 3300025893 Bacteria 2865
806 Ga0207710_10000001 3300025900 Bacteria 1797433
807 Ga0207710_10002888 3300025900 Bacteria 7811
808 Ga0207680_10002452 3300025903 Bacteria 8650
809 Ga0207680_10034060 3300025903 Unclassified 2911
810 Ga0207680_10089527 3300025903 Bacteria 1954
811 Ga0207647_10015561 3300025904 Bacteria 5212
812 Ga0207647_10055167 3300025904 Bacteria 2442
813 Ga0207699_10000006 3300025906 Bacteria 430147
814 Ga0207699_10003597 3300025906 Bacteria 7408
815 Ga0207699_10096903 3300025906 Bacteria 1863
816 Ga0207699_10211205 3300025906 Bacteria 1320
817 Ga0207645_10001334 3300025907 Bacteria 20268
818 Ga0207643_10004154 3300025908 Bacteria 7804
819 Ga0207705_10002212 3300025909 Bacteria 15019
820 Ga0207705_10002267 3300025909 Bacteria 14885
821 Ga0207705_10005355 3300025909 Bacteria 9593
822 Ga0207705_10009140 3300025909 Bacteria 7223
823 Ga0207705_10019250 3300025909 Bacteria 4882
824 Ga0207705_10019823 3300025909 Unclassified 4809
825 Ga0207705_10052901 3300025909 Bacteria 2924
826 Ga0207705_10058430 3300025909 Bacteria 2782
827 Ga0207705_10061375 3300025909 Bacteria 2716
828 Ga0207705_10089125 3300025909 Bacteria 2257
829 Ga0207684_10000037 3300025910 Bacteria 284224
830 Ga0207684_10000068 3300025910 Bacteria 191048
831 Ga0207684_10000168 3300025910 Bacteria 110284
832 Ga0207684_10013312 3300025910 Bacteria 7116
833 Ga0207684_10056082 3300025910 Bacteria 3342
834 Ga0207684_10068829 3300025910 Bacteria 3008
835 Ga0207684_10073826 3300025910 Bacteria 2897
836 Ga0207684_10209398 3300025910 Bacteria 1682
837 Ga0207654_10010465 3300025911 Bacteria 4724
838 Ga0207707_10000037 3300025912 Bacteria 144937
839 Ga0207707_10003407 3300025912 Bacteria 14099
840 Ga0207707_10003496 3300025912 Bacteria 13905
841 Ga0207707_10006423 3300025912 Bacteria 10268
842 Ga0207707_10010618 3300025912 Bacteria 7999
843 Ga0207707_10029688 3300025912 Bacteria 4781
844 Ga0207707_10073456 3300025912 Bacteria 2982
845 Ga0207707_10121601 3300025912 Bacteria 2283
846 Ga0207707_10133354 3300025912 Bacteria 2172
847 Ga0207707_10162104 3300025912 Bacteria 1955
848 Ga0207695_10000025 3300025913 Bacteria 627211
849 Ga0207695_10000133 3300025913 Bacteria 222573
850 Ga0207695_10000600 3300025913 Bacteria 72224
851 Ga0207695_10000956 3300025913 Bacteria 51440
852 Ga0207695_10001344 3300025913 Bacteria 41706
853 Ga0207695_10002938 3300025913 Bacteria 24585
854 Ga0207695_10004407 3300025913 Bacteria 19241
855 Ga0207695_10008880 3300025913 Bacteria 12515
856 Ga0207695_10012969 3300025913 Bacteria 9961
857 Ga0207695_10023524 3300025913 Bacteria 6957
858 Ga0207695_10024430 3300025913 Bacteria 6801
859 Ga0207695_10035977 3300025913 Bacteria 5359
860 Ga0207695_10064801 3300025913 Bacteria 3760
861 Ga0207695_10067806 3300025913 Unclassified 3658
862 Ga0207695_10094300 3300025913 Bacteria 3000
863 Ga0207695_10124192 3300025913 Bacteria 2545
864 Ga0207695_10134883 3300025913 Unclassified 2422
865 Ga0207671_10000969 3300025914 Bacteria 35541
866 Ga0207671_10001393 3300025914 Bacteria 28100
867 Ga0207671_10005220 3300025914 Bacteria 12075
868 Ga0207671_10009040 3300025914 Bacteria 8380
869 Ga0207671_10025532 3300025914 Bacteria 4438
870 Ga0207671_10027128 3300025914 Bacteria 4284
871 Ga0207671_10039181 3300025914 Bacteria 3510
872 Ga0207671_10112680 3300025914 Bacteria 2071
873 Ga0207693_10010352 3300025915 Bacteria 7569
874 Ga0207693_10072882 3300025915 Bacteria 2689
875 Ga0207663_10000039 3300025916 Bacteria 84180
876 Ga0207663_10016680 3300025916 Bacteria 4079
877 Ga0207660_10000155 3300025917 Bacteria 42574
878 Ga0207660_10027118 3300025917 Bacteria 3906
879 Ga0207660_10273597 3300025917 Bacteria 1338
880 Ga0207662_10004778 3300025918 Bacteria 7162
881 Ga0207662_10012888 3300025918 Bacteria 4665
882 Ga0207662_10024587 3300025918 Bacteria 3466
883 Ga0207662_10112783 3300025918 Bacteria 1697
884 Ga0207657_10001884 3300025919 Bacteria 22668
885 Ga0207657_10007452 3300025919 Bacteria 11220
886 Ga0207657_10012309 3300025919 Bacteria 8454
887 Ga0207657_10028424 3300025919 Bacteria 5100
888 Ga0207657_10038492 3300025919 Bacteria 4257
889 Ga0207657_10047937 3300025919 Bacteria 3732
890 Ga0207657_10050979 3300025919 Bacteria 3599
891 Ga0207657_10053908 3300025919 Bacteria 3481
892 Ga0207657_10055975 3300025919 Bacteria 3405
893 Ga0207657_10100104 3300025919 Bacteria 2407
894 Ga0207649_10009299 3300025920 Bacteria 5375
895 Ga0207649_10013726 3300025920 Bacteria 4528
896 Ga0207649_10031115 3300025920 Bacteria 3169
897 Ga0207649_10098537 3300025920 Bacteria 1929
898 Ga0207652_10000200 3300025921 Bacteria 63144
899 Ga0207652_10005604 3300025921 Bacteria 10181
900 Ga0207652_10094256 3300025921 Bacteria 2636
901 Ga0207652_10239480 3300025921 Bacteria 1635
902 Ga0207646_10018394 3300025922 Bacteria 6518
903 Ga0207646_10033863 3300025922 Bacteria 4617
904 Ga0207646_10038218 3300025922 Bacteria 4325
905 Ga0207681_10004636 3300025923 Bacteria 8456
906 Ga0207681_10054627 3300025923 Bacteria 2716
907 Ga0207694_10004366 3300025924 Bacteria 11044
908 Ga0207694_10005099 3300025924 Bacteria 10149
909 Ga0207694_10005565 3300025924 Bacteria 9653
910 Ga0207694_10009167 3300025924 Bacteria 7466
911 Ga0207694_10016362 3300025924 Bacteria 5600
912 Ga0207694_10026910 3300025924 Bacteria 4379
913 Ga0207694_10029918 3300025924 Bacteria 4158
914 Ga0207694_10036842 3300025924 Bacteria 3754
915 Ga0207650_10000087 3300025925 Bacteria 123505
916 Ga0207650_10000166 3300025925 Bacteria 79838
917 Ga0207650_10000910 3300025925 Bacteria 22291
918 Ga0207650_10001328 3300025925 Bacteria 17894
919 Ga0207650_10013762 3300025925 Bacteria 5611
920 Ga0207650_10014914 3300025925 Bacteria 5407
921 Ga0207650_10190276 3300025925 Bacteria 1639
922 Ga0207687_10003985 3300025927 Bacteria 9897
923 Ga0207687_10004281 3300025927 Bacteria 9537
924 Ga0207687_10027380 3300025927 Bacteria 3825
925 Ga0207687_10031440 3300025927 Bacteria 3587
926 Ga0207687_10055838 3300025927 Bacteria 2768
927 Ga0207687_10067586 3300025927 Bacteria 2543
928 Ga0207687_10080147 3300025927 Bacteria 2356
929 Ga0207687_10148271 3300025927 Unclassified 1787
930 Ga0207700_10000907 3300025928 Bacteria 16997
931 Ga0207700_10001406 3300025928 Bacteria 13653
932 Ga0207700_10016698 3300025928 Bacteria 4885
933 Ga0207700_10022903 3300025928 Unclassified 4294
934 Ga0207700_10037090 3300025928 Bacteria 3527
935 Ga0207700_10037486 3300025928 Bacteria 3511
936 Ga0207664_10001301 3300025929 Bacteria 16458
937 Ga0207664_10029522 3300025929 Unclassified 4177
938 Ga0207664_10057434 3300025929 Bacteria 3093
939 Ga0207664_10149578 3300025929 Bacteria 1982
940 Ga0207644_10003607 3300025931 Bacteria 10026
941 Ga0207644_10007957 3300025931 Bacteria 6932
942 Ga0207644_10053450 3300025931 Bacteria 2906
943 Ga0207644_10122020 3300025931 Bacteria 1985
944 Ga0207644_10201302 3300025931 Bacteria 1571
945 Ga0207690_10006069 3300025932 Bacteria 7158
946 Ga0207690_10008671 3300025932 Bacteria 6030
947 Ga0207690_10015609 3300025932 Bacteria 4606
948 Ga0207690_10234274 3300025932 Bacteria 1411
949 Ga0207706_10001101 3300025933 Bacteria 27512
950 Ga0207706_10023544 3300025933 Bacteria 5529
951 Ga0207706_10030381 3300025933 Bacteria 4820
952 Ga0207706_10038541 3300025933 Bacteria 4239
953 Ga0207706_10046376 3300025933 Bacteria 3848
954 Ga0207706_10099877 3300025933 Bacteria 2553
955 Ga0207686_10000515 3300025934 Bacteria 25104
956 Ga0207686_10004150 3300025934 Bacteria 7773
957 Ga0207686_10023518 3300025934 Bacteria 3560
958 Ga0207686_10039760 3300025934 Bacteria 2855
959 Ga0207686_10042754 3300025934 Bacteria 2772
960 Ga0207709_10000668 3300025935 Bacteria 27784
961 Ga0207709_10086380 3300025935 Bacteria 2036
962 Ga0207670_10001749 3300025936 Bacteria 11355
963 Ga0207670_10003027 3300025936 Bacteria 8863
964 Ga0207670_10044312 3300025936 Bacteria 2943
965 Ga0207670_10210448 3300025936 Bacteria 1483
966 Ga0207704_10161873 3300025938 Bacteria 1593
967 Ga0207704_10187953 3300025938 Unclassified 1500
968 Ga0207665_10010307 3300025939 Bacteria 6137
969 Ga0207665_10011260 3300025939 Bacteria 5870
970 Ga0207691_10000617 3300025940 Bacteria 35316
971 Ga0207691_10001246 3300025940 Bacteria 25434
972 Ga0207691_10001262 3300025940 Bacteria 25344
973 Ga0207691_10002830 3300025940 Bacteria 16907
974 Ga0207691_10003457 3300025940 Bacteria 15365
975 Ga0207691_10007733 3300025940 Bacteria 10346
976 Ga0207691_10041581 3300025940 Bacteria 4242
977 Ga0207691_10148951 3300025940 Bacteria 2058
978 Ga0207711_10005912 3300025941 Bacteria 10336
979 Ga0207711_10024542 3300025941 Bacteria 5054
980 Ga0207711_10062796 3300025941 Bacteria 3205
981 Ga0207711_10062955 3300025941 Bacteria 3201
982 Ga0207711_10134828 3300025941 Bacteria 2217
983 Ga0207689_10004240 3300025942 Bacteria 13041
984 Ga0207689_10014842 3300025942 Bacteria 6613
985 Ga0207689_10089416 3300025942 Bacteria 2530
986 Ga0207689_10161986 3300025942 Unclassified 1843
987 Ga0207661_10000011 3300025944 Bacteria 361200
988 Ga0207661_10002858 3300025944 Bacteria 11934
989 Ga0207661_10015129 3300025944 Bacteria 5671
990 Ga0207661_10036349 3300025944 Bacteria 3844
991 Ga0207661_10036847 3300025944 Bacteria 3821
992 Ga0207661_10045431 3300025944 Bacteria 3477
993 Ga0207661_10060854 3300025944 Bacteria 3049
994 Ga0207661_10075597 3300025944 Bacteria 2764
995 Ga0207661_10134913 3300025944 Bacteria 2119
996 Ga0207661_10254832 3300025944 Bacteria 1561
997 Ga0207679_10000919 3300025945 Bacteria 18810
998 Ga0207679_10007360 3300025945 Bacteria 6981
999 Ga0207679_10014795 3300025945 Bacteria 5139
1000 Ga0207679_10017354 3300025945 Bacteria 4800
1001 Ga0207679_10050514 3300025945 Bacteria 3040
1002 Ga0207679_10057592 3300025945 Bacteria 2875
1003 Ga0207679_10091099 3300025945 Bacteria 2359
1004 Ga0207679_10129344 3300025945 Bacteria 2023
1005 Ga0207667_10000997 3300025949 Bacteria 36207
1006 Ga0207667_10002398 3300025949 Bacteria 23465
1007 Ga0207667_10002700 3300025949 Bacteria 21961
1008 Ga0207667_10007644 3300025949 Bacteria 12947
1009 Ga0207667_10008240 3300025949 Bacteria 12404
1010 Ga0207667_10023798 3300025949 Bacteria 6740
1011 Ga0207667_10059358 3300025949 Bacteria 4006
1012 Ga0207667_10079117 3300025949 Unclassified 3407
1013 Ga0207667_10091344 3300025949 Bacteria 3145
1014 Ga0207667_10118254 3300025949 Bacteria 2731
1015 Ga0207667_10242632 3300025949 Bacteria 1844
1016 Ga0207651_10022008 3300025960 Unclassified 3888
1017 Ga0207651_10288520 3300025960 Bacteria 1359
1018 Ga0207712_10000063 3300025961 Bacteria 133704
1019 Ga0207712_10006484 3300025961 Bacteria 7381
1020 Ga0207712_10029600 3300025961 Bacteria 3675
1021 Ga0207712_10052101 3300025961 Bacteria 2866
1022 Ga0207712_10191482 3300025961 Bacteria 1615
1023 Ga0207712_10240486 3300025961 Bacteria 1458
1024 Ga0207668_10031672 3300025972 Bacteria 3486
1025 Ga0207668_10047992 3300025972 Bacteria 2927
1026 Ga0207668_10055705 3300025972 Bacteria 2750
1027 Ga0207640_10000033 3300025981 Bacteria 115787
1028 Ga0207640_10011839 3300025981 Bacteria 4952
1029 Ga0207640_10012365 3300025981 Unclassified 4858
1030 Ga0207658_10010307 3300025986 Bacteria 6352
1031 Ga0207658_10013995 3300025986 Bacteria 5492
1032 Ga0207658_10015578 3300025986 Bacteria 5216
1033 Ga0207658_10054427 3300025986 Bacteria 2961
1034 Ga0207677_10020067 3300026023 Bacteria 4050
1035 Ga0207677_10026449 3300026023 Bacteria 3639
1036 Ga0207677_10039048 3300026023 Bacteria 3117
1037 Ga0207677_10063589 3300026023 Bacteria 2566
1038 Ga0207677_10137797 3300026023 Bacteria 1863
1039 Ga0207703_10000140 3300026035 Bacteria 86439
1040 Ga0207703_10000196 3300026035 Bacteria 70463
1041 Ga0207639_10000384 3300026041 Bacteria 30389
1042 Ga0207639_10029501 3300026041 Bacteria 4017
1043 Ga0207639_10053990 3300026041 Bacteria 3069
1044 Ga0207678_10000331 3300026067 Bacteria 42428
1045 Ga0207678_10001778 3300026067 Bacteria 19735
1046 Ga0207678_10016607 3300026067 Bacteria 6467
1047 Ga0207678_10121063 3300026067 Unclassified 2233
1048 Ga0207708_10000060 3300026075 Bacteria 93846
1049 Ga0207708_10007340 3300026075 Bacteria 8145
1050 Ga0207708_10011463 3300026075 Bacteria 6605
1051 Ga0207708_10032202 3300026075 Bacteria 3983
1052 Ga0207708_10032842 3300026075 Bacteria 3940
1053 Ga0207702_10014935 3300026078 Bacteria 6442
1054 Ga0207702_10020942 3300026078 Bacteria 5412
1055 Ga0207702_10056255 3300026078 Bacteria 3339
1056 Ga0207702_10094357 3300026078 Bacteria 2626
1057 Ga0207702_10273211 3300026078 Bacteria 1595
1058 Ga0207641_10011021 3300026088 Bacteria 7415
1059 Ga0207641_10017239 3300026088 Bacteria 5911
1060 Ga0207641_10023451 3300026088 Bacteria 5084
1061 Ga0207641_10098613 3300026088 Bacteria 2570
1062 Ga0207641_10121700 3300026088 Bacteria 2330
1063 Ga0207641_10172493 3300026088 Bacteria 1975
1064 Ga0207641_10217573 3300026088 Bacteria 1770
1065 Ga0207648_10014753 3300026089 Bacteria 7210
1066 Ga0207648_10068057 3300026089 Bacteria 3103
1067 Ga0207648_10080918 3300026089 Bacteria 2834
1068 Ga0207648_10082359 3300026089 Bacteria 2806
1069 Ga0207648_10344159 3300026089 Bacteria 1343
1070 Ga0207676_10000681 3300026095 Bacteria 27020
1071 Ga0207676_10025477 3300026095 Bacteria 4388
1072 Ga0207676_10108895 3300026095 Bacteria 2314
1073 Ga0207674_10001175 3300026116 Bacteria 33976
1074 Ga0207674_10001855 3300026116 Bacteria 26925
1075 Ga0207674_10003815 3300026116 Bacteria 18373
1076 Ga0207674_10011084 3300026116 Bacteria 10134
1077 Ga0207674_10011509 3300026116 Bacteria 9938
1078 Ga0207674_10013763 3300026116 Bacteria 8953
1079 Ga0207674_10015023 3300026116 Bacteria 8528
1080 Ga0207674_10017294 3300026116 Bacteria 7867
1081 Ga0207674_10024450 3300026116 Bacteria 6455
1082 Ga0207674_10053959 3300026116 Bacteria 4094
1083 Ga0207675_100000677 3300026118 Bacteria 33529
1084 Ga0207675_100005466 3300026118 Bacteria 12174
1085 Ga0207675_100028293 3300026118 Bacteria 5219
1086 Ga0207675_100044222 3300026118 Bacteria 4161
1087 Ga0207675_100117939 3300026118 Bacteria 2509
1088 Ga0207675_100131297 3300026118 Bacteria 2375
1089 Ga0207675_100143061 3300026118 Bacteria 2273
1090 Ga0207675_100292137 3300026118 Bacteria 1586
1091 Ga0207683_10141309 3300026121 Bacteria 2169
1092 Ga0207683_10145403 3300026121 Bacteria 2138
1093 Ga0207683_10177215 3300026121 Bacteria 1932
1094 Ga0207698_10010020 3300026142 Bacteria 6067
1095 Ga0207698_10072804 3300026142 Bacteria 2733
1096 Ga0207698_10084518 3300026142 Bacteria 2573
1097 Ga0207698_10212116 3300026142 Unclassified 1743
1098 Ga0209999_1009365 3300027543 Bacteria 1769
1099 Ga0209588_1000001 3300027671 Bacteria 705877
1100 Ga0209966_1001306 3300027695 Bacteria 4407
1101 Ga0209998_10000136 3300027717 Bacteria 28757
1102 Ga0207428_10000035 3300027907 Bacteria 229100
1103 Ga0207428_10023017 3300027907 Bacteria 5246
1104 Ga0207428_10064208 3300027907 Bacteria 2899
1105 Ga0207428_10073780 3300027907 Bacteria 2676
1106 Ga0207428_10074523 3300027907 Bacteria 2661
1107 Ga0268266_10000014 3300028379 Bacteria 644033
1108 Ga0268266_10038514 3300028379 Bacteria 4070
1109 Ga0268265_10001615 3300028380 Bacteria 18589
1110 Ga0268265_10013238 3300028380 Bacteria 5606
1111 Ga0268265_10036885 3300028380 Bacteria 3584
1112 Ga0268265_10107753 3300028380 Bacteria 2266
1113 Ga0268264_10000327 3300028381 Bacteria 75326
1114 Ga0268264_10003941 3300028381 Bacteria 12707
1115 Ga0268264_10004249 3300028381 Bacteria 12226
1116 Ga0268264_10051466 3300028381 Bacteria 3432
1117 Ga0268264_10094012 3300028381 Bacteria 2591
1118 Ga0268264_10110161 3300028381 Bacteria 2410
1119 Ga0307515_10000290 3300028794 Bacteria 123604
1120 Ga0307515_10006021 3300028794 Bacteria 24408
1121 Ga0307515_10026277 3300028794 Bacteria 10028
1122 Ga0307515_10027550 3300028794 Bacteria 9708
1123 Ga0265338_10056747 3300028800 Unclassified 3469
1124 Ga0265338_10070355 3300028800 Bacteria 3000
1125 Ga0265339_10000003 3300031249 Bacteria 305994
1126 Ga0265327_10017666 3300031251 Bacteria 4461
1127 Ga0265316_10090970 3300031344 Unclassified 2328
1128 Ga0265316_10180282 3300031344 Bacteria 1573
1129 Ga0307513_10005567 3300031456 Bacteria 16611
1130 Ga0307513_10104959 3300031456 Bacteria 2837
1131 Ga0307408_100001060 3300031548 Bacteria 21119
1132 Ga0307408_100040043 3300031548 Bacteria 3317
1133 Ga0307408_100055597 3300031548 Bacteria 2866
1134 Ga0307408_100084218 3300031548 Unclassified 2384
1135 Ga0307408_100177200 3300031548 Bacteria 1707
1136 Ga0265314_10004761 3300031711 Bacteria 12437
1137 Ga0265314_10011744 3300031711 Bacteria 7203
1138 Ga0265342_10003777 3300031712 Bacteria 12217
1139 Ga0307405_10149883 3300031731 Bacteria 1638
1140 Ga0307413_10076928 3300031824 Bacteria 2123
1141 Ga0307410_10005992 3300031852 Bacteria 6511
1142 Ga0307410_10023915 3300031852 Bacteria 3809
1143 Ga0307406_10005334 3300031901 Bacteria 7036
1144 Ga0307406_10009862 3300031901 Bacteria 5374
1145 Ga0307406_10024377 3300031901 Bacteria 3613
1146 Ga0307406_10170499 3300031901 Bacteria 1574
1147 Ga0307407_10020848 3300031903 Bacteria 3367
1148 Ga0307407_10096323 3300031903 Bacteria 1826
1149 Ga0307412_10000038 3300031911 Bacteria 187857
1150 Ga0307412_10015594 3300031911 Bacteria 4510
1151 Ga0307412_10101440 3300031911 Unclassified 2036
1152 Ga0307409_100079876 3300031995 Bacteria 2637
1153 Ga0307416_100265881 3300032002 Bacteria 1680
1154 Ga0307416_100339233 3300032002 Bacteria 1515
1155 Ga0307414_10000281 3300032004 Bacteria 30115
1156 Ga0307414_10014653 3300032004 Bacteria 4708
1157 Ga0307414_10028981 3300032004 Bacteria 3598
1158 Ga0307414_10048720 3300032004 Bacteria 2925
1159 Ga0307414_10152589 3300032004 Bacteria 1824
1160 Ga0307411_10082967 3300032005 Unclassified 2212
1161 Ga0307411_10176075 3300032005 Bacteria 1619
1162 Ga0307415_100025059 3300032126 Bacteria 3737
1163 Ga0307507_10000032 3300033179 Bacteria 194155
1164 Ga0307510_10059851 3300033180 Bacteria 3927
1165 Ga0373948_0000440 3300034817 Bacteria 5140
1166 Ga0373938_0018440 3300034957 Bacteria 1384
1167 Ga0373938_0020717 3300034957 Bacteria 1327
1168 Ga0373934_0066413 3300035086 Unclassified 1440
1169 Ga0373940_0006460 3300035088 Bacteria 2602
1170 Ga0373923_0059078 3300035111 Bacteria 1625
1171 Ga0373941_0000682 3300035115 Bacteria 6907
1172 Ga0373953_0023079 3300035117 Unclassified 2352
1173 Ga0373954_0043311 3300035118 Unclassified 2099
1174 Ga0373956_0023208 3300035119 Bacteria 2660
1175 Ga0373956_0037713 3300035119 Bacteria 2137
1176 Ga0373957_0003364 3300035120 Bacteria 4716
1177 Ga0373955_0005652 3300035172 Bacteria 5629
1178 Ga0373955_0116939 3300035172 Bacteria 1546
1179 Ga0373942_0006073 3300035207 Bacteria 2787
1180 Ga0373942_0026849 3300035207 Unclassified 1493
1181 Ga0373961_0002143 3300035241 Bacteria 5237
1182 Ga0373961_0030020 3300035241 Bacteria 1509
1183 Ga0373962_0001173 3300035242 Bacteria 6127
1184 Ga0373935_0030923 3300035692 Bacteria 3319
1185 Ga0373935_0040774 3300035692 Bacteria 2915
1186 Ga0373927_0010820 3300035695 Bacteria 6078
1187 Ga0373933_0014785 3300035724 Bacteria 4344
1188 Ga0373947_0035648 3300035725 Bacteria 2946
1189 Ga0373947_0183943 3300035725 Bacteria 1361
1190 Ga0373937_0018644 3300036401 Bacteria 6199
1191 Ga0373937_0020910 3300036401 Bacteria 5870
1192 Ga0373937_0026552 3300036401 Bacteria 5232
1193 Ga0373937_0089408 3300036401 Bacteria 2852
1194 Ga0373937_0095648 3300036401 Bacteria 2754
1195 Ga0373937_0099389 3300036401 Bacteria 2699
1196 Ga0373937_0134819 3300036401 Bacteria 2308
1197 Ga0373937_0213072 3300036401 Bacteria 1818
1198 Ga0373937_0261449 3300036401 Bacteria 1632
1199 Ga0373925_0043556 3300037068 Bacteria 3332
1200 Ga0395899_0000401 3300037312 Bacteria 50789
1201 Ga0395899_0007074 3300037312 Bacteria 8685
1202 Ga0395899_0007658 3300037312 Bacteria 8326
1203 Ga0395899_0017623 3300037312 Bacteria 5438
1204 Ga0395900_0000931 3300037418 Bacteria 38293
1205 Ga0395900_0001209 3300037418 Bacteria 31961
1206 Ga0395900_0001610 3300037418 Bacteria 26610
1207 Ga0395900_0026089 3300037418 Bacteria 5983
1208 Ga0395898_0100565 3300037466 Bacteria 2777
1209 Ga0395898_0193902 3300037466 Bacteria 1941
1210 Ga0395905_0000210 3300037471 Bacteria 90096
1211 Ga0395905_0001645 3300037471 Bacteria 26480
1212 Ga0395905_0031057 3300037471 Bacteria 5031
1213 Ga0395905_0055601 3300037471 Bacteria 3704
1214 Ga0395905_0216964 3300037471 Bacteria 1791
1215 Ga0436364_0768558 3300037853 Bacteria 187546
1216 Ga0436364_0773449 3300037853 Bacteria 2308
1217 Ga0436364_1022479 3300037853 Bacteria 2743
1218 Ga0436364_1241863 3300037853 Bacteria 4759
1219 Ga0395901_0000331 3300038443 Bacteria 58263
1220 Ga0395901_0000963 3300038443 Bacteria 31334
1221 Ga0395901_0109916 3300038443 Bacteria 2894
1222 Ga0395901_0174051 3300038443 Bacteria 2258
1223 Ga0242420_013687 3300038996 Bacteria 1385
1224 Ga0436365_0372670 3300039437 Bacteria 8256
1225 Ga0436365_0488699 3300039437 Bacteria 10272
1226 Ga0436365_1684945 3300039437 Bacteria 47686
1227 Ga0436365_1742918 3300039437 Bacteria 1307
1228 Ga0436363_0035913 3300039450 Bacteria 1655
1229 Ga0436363_1199725 3300039450 Bacteria 6230
1230 Ga0439448_0013740 3300042005 Bacteria 2437
1231 Ga0439448_0044155 3300042005 Bacteria 1448
1232 Ga0439450_021151 3300042008 Bacteria 1394
1233 Ga0439455_0001403 3300042012 Bacteria 4013
1234 Ga0451577_0001936 3300042876 Bacteria 26118
1235 Ga0451577_0028624 3300042876 Bacteria 5037
1236 Ga0451577_0056925 3300042876 Bacteria 3486
1237 Ga0451577_0315729 3300042876 Bacteria 1417
1238 Ga0466972_0015756 3300044658 Bacteria 3779
1239 Ga0453683_0040236 3300044673 Bacteria 2936
1240 Ga0453683_0109745 3300044673 Bacteria 1735
1241 Ga0466965_0023536 3300044683 Bacteria 2974
1242 Ga0466966_0035368 3300044684 Bacteria 3227
1243 Ga0466966_0038261 3300044684 Bacteria 3092
1244 Ga0466966_0054484 3300044684 Bacteria 2534
1245 Ga0466961_0076058 3300044693 Bacteria 2128
1246 Ga0466961_0082208 3300044693 Bacteria 2038
1247 Ga0466963_0005484 3300044694 Bacteria 7428
1248 Ga0466963_0046958 3300044694 Bacteria 2849
1249 Ga0466964_0001870 3300044706 Bacteria 7340
1250 Ga0453684_0001021 3300044712 Bacteria 89961
1251 Ga0453684_0025158 3300044712 Bacteria 8654
1252 Ga0453684_0225287 3300044712 Bacteria 2168
1253 Ga0466971_0093319 3300044719 Bacteria 1379
1254 Ga0466968_0006583 3300044735 Bacteria 4383
1255 Ga0466957_0003163 3300044842 Bacteria 8980
1256 Ga0466957_0024810 3300044842 Bacteria 3551
1257 Ga0466957_0039570 3300044842 Bacteria 2845
1258 Ga0466960_0019352 3300044901 Bacteria 2999
1259 Ga0466959_0004931 3300045049 Bacteria 9039
1260 Ga0466959_0069458 3300045049 Bacteria 2552
1261 Ga0466959_0105024 3300045049 Bacteria 2020
1262 Ga0451576_0014079 3300045051 Bacteria 8913
1263 Ga0451576_0085397 3300045051 Bacteria 3283
1264 Ga0451576_0167686 3300045051 Bacteria 2291
1265 Ga0451576_0230439 3300045051 Bacteria 1935
1266 Ga0451576_0273914 3300045051 Bacteria 1764
1267 Ga0466958_0053705 3300045836 Bacteria 2443
1268 Ga0466958_0070085 3300045836 Bacteria 2145
1269 Ga0466967_0021812 3300045976 Bacteria 5212
1270 Ga0466967_0042347 3300045976 Bacteria 3934
1271 Ga0466967_0229388 3300045976 Bacteria 1767
1272 Ga0495617_006061 3300046452 Bacteria 4258
1273 Ga0495592_0010559 3300046454 Bacteria 6965
1274 Ga0495592_0017599 3300046454 Bacteria 5433
1275 Ga0495592_0038634 3300046454 Bacteria 3590
1276 Ga0495592_0054378 3300046454 Unclassified 2966
1277 Ga0495592_0092826 3300046454 Unclassified 2162
1278 Ga0495603_0156756 3300046455 Bacteria 1321
1279 Ga0495629_0003095 3300046459 Bacteria 12622
1280 Ga0495638_0022013 3300046460 Bacteria 4190
1281 Ga0495638_0027684 3300046460 Bacteria 3667
1282 Ga0495651_0004124 3300046462 Bacteria 11127
1283 Ga0495651_0067268 3300046462 Bacteria 2733
1284 Ga0495653_0071161 3300046463 Bacteria 2601
1285 Ga0495653_0079347 3300046463 Bacteria 2431
1286 Ga0495650_0000050 3300046471 Bacteria 318894
1287 Ga0495650_0000676 3300046471 Bacteria 44242
1288 Ga0495580_0003139 3300046472 Bacteria 14158
1289 Ga0495580_0003603 3300046472 Bacteria 13131
1290 Ga0495580_0007235 3300046472 Bacteria 8925
1291 Ga0495580_0041322 3300046472 Bacteria 3289
1292 Ga0495580_0050567 3300046472 Unclassified 2939
1293 Ga0495580_0053594 3300046472 Bacteria 2846
1294 Ga0495580_0080516 3300046472 Bacteria 2270
1295 Ga0495582_0000841 3300046473 Bacteria 16969
1296 Ga0495582_0004948 3300046473 Bacteria 7466
1297 Ga0495582_0088416 3300046473 Unclassified 1726
1298 Ga0495605_0037605 3300046474 Bacteria 2433
1299 Ga0495639_0000600 3300046475 Bacteria 16839
1300 Ga0495639_0046491 3300046475 Bacteria 1965
1301 Ga0495639_0108890 3300046475 Unclassified 1313
1302 Ga0495662_0000410 3300046476 Bacteria 19256
1303 Ga0495662_0051040 3300046476 Bacteria 1997
1304 Ga0495664_0001745 3300046477 Bacteria 11552
1305 Ga0495664_0002393 3300046477 Bacteria 10065
1306 Ga0495664_0013457 3300046477 Bacteria 4639
1307 Ga0495584_0000010 3300046491 Bacteria 225095
1308 Ga0495584_0000371 3300046491 Bacteria 30972
1309 Ga0495584_0012303 3300046491 Bacteria 4370
1310 Ga0495585_0000196 3300046492 Bacteria 62748
1311 Ga0495585_0000459 3300046492 Bacteria 38959
1312 Ga0495585_0000592 3300046492 Bacteria 33996
1313 Ga0495585_0004027 3300046492 Bacteria 9676
1314 Ga0495585_0061028 3300046492 Bacteria 2074
1315 Ga0495594_0000637 3300046499 Bacteria 18054
1316 Ga0495594_0001903 3300046499 Bacteria 10878
1317 Ga0495594_0006322 3300046499 Bacteria 6092
1318 Ga0495594_0153617 3300046499 Bacteria 1307
1319 Ga0495596_0000130 3300046500 Bacteria 51970
1320 Ga0495583_0000084 3300046506 Bacteria 165375
1321 Ga0495583_0000299 3300046506 Bacteria 78832
1322 Ga0495583_0041000 3300046506 Unclassified 2171
1323 Ga0495583_0074914 3300046506 Bacteria 1481
1324 Ga0495606_0000043 3300046507 Bacteria 214367
1325 Ga0495606_0000213 3300046507 Bacteria 103305
1326 Ga0495606_0008408 3300046507 Bacteria 8976
1327 Ga0495606_0070322 3300046507 Bacteria 2208
1328 Ga0495606_0104178 3300046507 Bacteria 1722
1329 Ga0495608_0044206 3300046511 Unclassified 2973
1330 Ga0495610_0001134 3300046512 Bacteria 24228
1331 Ga0495610_0040691 3300046512 Bacteria 2340
1332 Ga0495616_0002990 3300046513 Bacteria 10969
1333 Ga0495616_0004202 3300046513 Bacteria 9125
1334 Ga0495616_0010318 3300046513 Bacteria 5412
1335 Ga0495616_0023720 3300046513 Bacteria 3297
1336 Ga0495618_0012641 3300046514 Bacteria 5128
1337 Ga0495628_0004728 3300046516 Bacteria 12009
1338 Ga0495628_0008309 3300046516 Bacteria 8917
1339 Ga0495628_0101564 3300046516 Bacteria 2219
1340 Ga0495628_0143805 3300046516 Bacteria 1819
1341 Ga0495630_0025111 3300046517 Bacteria 4405
1342 Ga0495630_0189152 3300046517 Bacteria 1570
1343 Ga0495631_0014917 3300046518 Bacteria 3738
1344 Ga0495644_0002451 3300046523 Bacteria 7406
1345 Ga0495648_0000007 3300046524 Bacteria 347305
1346 Ga0495648_0006903 3300046524 Bacteria 9157
1347 Ga0495663_0000215 3300046525 Bacteria 23160
1348 Ga0495663_0003962 3300046525 Bacteria 4213
1349 Ga0495666_0001852 3300046526 Bacteria 10442
1350 Ga0495652_0008507 3300046529 Bacteria 9360
1351 Ga0495652_0042630 3300046529 Bacteria 3912
1352 Ga0495652_0138238 3300046529 Bacteria 1919
1353 Ga0495654_0043936 3300046530 Bacteria 2213
1354 Ga0495665_0000386 3300046531 Bacteria 22329
1355 Ga0495665_0088991 3300046531 Bacteria 1622
1356 Ga0495640_0003040 3300046533 Bacteria 13509
1357 Ga0495586_0001552 3300046535 Bacteria 12683
1358 Ga0495586_0037366 3300046535 Bacteria 2607
1359 Ga0495587_0021119 3300046536 Bacteria 4015
1360 Ga0495587_0077866 3300046536 Bacteria 1924
1361 Ga0495587_0094489 3300046536 Bacteria 1726
1362 Ga0495598_0000908 3300046537 Bacteria 5703
1363 Ga0495609_0025738 3300046538 Bacteria 2696
1364 Ga0495609_0032276 3300046538 Bacteria 2379
1365 Ga0495621_0000037 3300046539 Bacteria 25594
1366 Ga0495597_0041175 3300046542 Bacteria 2064
1367 Ga0495645_0001229 3300046543 Bacteria 17476
1368 Ga0495645_0001562 3300046543 Bacteria 15515
1369 Ga0495645_0002538 3300046543 Bacteria 12385
1370 Ga0495645_0117117 3300046543 Bacteria 1880
1371 Ga0495645_0132218 3300046543 Unclassified 1748
1372 Ga0495622_0029122 3300046557 Bacteria 2580
1373 Ga0495633_0000067 3300046558 Bacteria 139122
1374 Ga0495633_0004603 3300046558 Bacteria 8690
1375 Ga0495633_0006050 3300046558 Bacteria 7258
1376 Ga0495633_0006717 3300046558 Bacteria 6772
1377 Ga0495667_0001013 3300046559 Bacteria 18210
1378 Ga0495667_0001057 3300046559 Bacteria 17895
1379 Ga0495667_0001245 3300046559 Bacteria 16698
1380 Ga0495667_0025372 3300046559 Bacteria 3994
1381 Ga0495667_0162589 3300046559 Bacteria 1436
1382 Ga0495656_0005622 3300046615 Bacteria 4338
1383 Ga0495668_0000009 3300046616 Bacteria 492623
1384 Ga0495668_0000501 3300046616 Bacteria 48914
1385 Ga0495668_0003655 3300046616 Bacteria 11364
1386 Ga0495668_0005629 3300046616 Bacteria 8416
1387 Ga0495634_0000781 3300046642 Bacteria 30783
1388 Ga0495611_0002930 3300046648 Bacteria 7605
1389 Ga0495625_0000110 3300046660 Bacteria 125028
1390 Ga0495625_0000534 3300046660 Bacteria 55918
1391 Ga0495625_0002020 3300046660 Bacteria 22846
1392 Ga0495625_0021839 3300046660 Bacteria 4916
1393 Ga0495625_0043740 3300046660 Bacteria 3247
1394 Ga0495625_0139851 3300046660 Bacteria 1634
1395 Ga0495635_0002246 3300046663 Bacteria 13128
1396 Ga0495635_0038890 3300046663 Bacteria 3293
1397 Ga0495635_0089680 3300046663 Unclassified 2104
1398 Ga0495635_0226026 3300046663 Unclassified 1265
1399 Ga0495659_0048036 3300046664 Bacteria 1545
1400 Ga0495661_0004162 3300046665 Bacteria 10522
1401 Ga0495661_0006880 3300046665 Bacteria 7953
1402 Ga0495661_0012725 3300046665 Bacteria 5678
1403 Ga0495657_0076675 3300046675 Unclassified 2171
1404 Ga0495599_0001114 3300046678 Bacteria 15147
1405 Ga0495599_0004167 3300046678 Bacteria 8541
1406 Ga0495599_0017306 3300046678 Bacteria 4481
1407 Ga0495599_0062909 3300046678 Bacteria 2318
1408 Ga0495623_0024737 3300046679 Bacteria 3867
1409 Ga0495623_0161161 3300046679 Unclassified 1318
1410 Ga0495646_0123258 3300046680 Bacteria 1465
1411 Ga0495658_0103487 3300046683 Bacteria 1703
1412 Ga0495669_0008902 3300046684 Bacteria 4229
1413 Ga0495613_0009495 3300046689 Bacteria 7217
1414 Ga0495613_0014253 3300046689 Bacteria 5900
1415 Ga0495613_0021287 3300046689 Bacteria 4836
1416 Ga0495613_0036339 3300046689 Bacteria 3652
1417 Ga0495613_0072801 3300046689 Bacteria 2505
1418 Ga0495613_0098712 3300046689 Bacteria 2110
1419 Ga0495613_0143650 3300046689 Unclassified 1704
1420 Ga0495624_0001077 3300046690 Bacteria 21556
1421 Ga0495670_0004933 3300046691 Bacteria 6552
1422 Ga0495670_0055646 3300046691 Bacteria 1984
1423 Ga0495671_0045286 3300046692 Bacteria 2203
1424 Ga0495649_0000011 3300046694 Bacteria 416695
1425 Ga0495600_0000406 3300046809 Bacteria 22248
1426 Ga0495604_0001017 3300047317 Bacteria 23370
1427 Ga0495604_0010316 3300047317 Bacteria 7400
1428 Ga0495604_0016975 3300047317 Bacteria 5823
1429 Ga0495604_0046043 3300047317 Bacteria 3402
1430 Ga0495604_0048338 3300047317 Bacteria 3309
1431 Ga0495636_0013717 3300047318 Bacteria 3216
1432 Ga0495674_0001669 3300047319 Bacteria 21835
1433 Ga0495674_0002616 3300047319 Bacteria 17508
1434 Ga0495674_0034228 3300047319 Unclassified 4595
1435 Ga0495674_0042224 3300047319 Bacteria 4069
1436 Ga0495674_0069880 3300047319 Bacteria 3036
1437 Ga0495674_0071580 3300047319 Bacteria 2992
1438 Ga0495676_0000665 3300047321 Bacteria 28580
1439 Ga0495680_0030027 3300047322 Bacteria 4443
1440 Ga0495680_0053710 3300047322 Bacteria 3133
1441 Ga0495680_0093020 3300047322 Bacteria 2257
1442 Ga0495680_0147754 3300047322 Unclassified 1716
1443 Ga0495683_0000159 3300047323 Bacteria 66298
1444 Ga0495683_0005604 3300047323 Bacteria 6958
1445 Ga0495683_0077258 3300047323 Bacteria 1628
1446 Ga0495687_000144 3300047443 Bacteria 108217
1447 Ga0495687_000249 3300047443 Bacteria 72846
1448 Ga0495675_0001449 3300047444 Bacteria 14356
1449 Ga0495675_0007727 3300047444 Bacteria 6632
1450 Ga0495675_0056440 3300047444 Bacteria 2490
1451 Ga0495675_0069864 3300047444 Unclassified 2217
1452 Ga0495675_0080466 3300047444 Bacteria 2052
1453 Ga0495675_0180081 3300047444 Bacteria 1294
1454 Ga0495677_0027143 3300047445 Bacteria 2077
1455 Ga0495685_010864 3300047447 Bacteria 3060
1456 Ga0495684_0042260 3300047471 Bacteria 3492
1457 Ga0495684_0057741 3300047471 Bacteria 2957
1458 Ga0495684_0110015 3300047471 Bacteria 2080
1459 Ga0495686_0000097 3300047472 Bacteria 183450
1460 Ga0495686_0000590 3300047472 Bacteria 50972
1461 Ga0495686_0001188 3300047472 Bacteria 30344
1462 Ga0495686_0001824 3300047472 Bacteria 21456
1463 Ga0495686_0015323 3300047472 Bacteria 5241
1464 Ga0495686_0029880 3300047472 Bacteria 3542
1465 Ga0495602_0053771 3300048088 Bacteria 3562
1466 Ga0495602_0082110 3300048088 Bacteria 2706
1467 Ga0495602_0195142 3300048088 Unclassified 1549
1468 Ga0495614_0000076 3300048089 Bacteria 32649
1469 Ga0495614_0074444 3300048089 Unclassified 1467
1470 Ga0496102_0000088 3300048905 Bacteria 129762
1471 Ga0496102_0236417 3300048905 Bacteria 1723
1472 Ga0496104_0006306 3300048907 Bacteria 10431
1473 Ga0496106_0010736 3300048909 Bacteria 6769
1474 Ga0496106_0090763 3300048909 Unclassified 2358
1475 Ga0496107_0106128 3300048910 Bacteria 2062
1476 Ga0496107_0176587 3300048910 Bacteria 1586
1477 Ga0496108_0019439 3300048911 Bacteria 5579
1478 Ga0496109_0001868 3300048912 Bacteria 17457
1479 Ga0496109_0036474 3300048912 Bacteria 4438
1480 Ga0496110_0006161 3300048913 Bacteria 9460
1481 Ga0496111_0010636 3300048914 Bacteria 6184
1482 Ga0496112_0007575 3300048915 Bacteria 9643
1483 Ga0496115_0020750 3300048918 Bacteria 5069
1484 Ga0496115_0032604 3300048918 Bacteria 4110
1485 Ga0496115_0053714 3300048918 Bacteria 3234
1486 Ga0496115_0062852 3300048918 Bacteria 2995
1487 Ga0496124_0006617 3300048927 Bacteria 12584
1488 Ga0496124_0041289 3300048927 Bacteria 3982
1489 Ga0496126_0000005 3300048929 Bacteria 891906
1490 Ga0496126_0000673 3300048929 Bacteria 63169
1491 Ga0496126_0119191 3300048929 Unclassified 2290
1492 Ga0495678_016717 3300049459 Bacteria 3345
1493 Ga0501292_007118 3300049515 Bacteria 1610
1494 Ga0501297_001083 3300049520 Bacteria 2469
1495 Ga0501031_0020299 3300049568 Bacteria 4332
1496 Ga0501032_0011884 3300049569 Bacteria 6236
1497 Ga0501032_0083000 3300049569 Bacteria 2131
1498 Ga0501034_0002329 3300049571 Bacteria 23199
1499 Ga0501034_0003709 3300049571 Bacteria 17247
1500 Ga0501034_0021007 3300049571 Bacteria 6663
1501 Ga0501036_0064694 3300049572 Bacteria 3095
1502 Ga0501036_0090331 3300049572 Bacteria 2587
1503 Ga0501038_0002334 3300049574 Bacteria 17675
1504 Ga0501038_0014130 3300049574 Bacteria 7273
1505 Ga0501039_0183209 3300049575 Bacteria 1647
1506 Ga0501039_0189296 3300049575 Bacteria 1618
1507 Ga0501040_0023222 3300049576 Bacteria 4158
1508 Ga0501040_0064046 3300049576 Bacteria 2531
1509 Ga0501042_0090692 3300049578 Bacteria 2194
1510 Ga0501042_0112110 3300049578 Bacteria 1964
1511 Ga0501043_0000810 3300049579 Bacteria 27799
1512 Ga0501043_0021831 3300049579 Bacteria 5020
1513 Ga0501046_0014576 3300049580 Bacteria 6626
1514 Ga0501046_0055292 3300049580 Bacteria 3120
1515 Ga0501046_0169556 3300049580 Bacteria 1639
1516 Ga0501046_0183067 3300049580 Bacteria 1566
1517 Ga0501047_0008562 3300049581 Bacteria 9652
1518 Ga0501047_0013452 3300049581 Bacteria 7757
1519 Ga0501047_0073930 3300049581 Bacteria 3281
1520 Ga0501048_0036920 3300049582 Bacteria 3510
1521 Ga0501048_0094118 3300049582 Bacteria 2113
1522 Ga0501048_0179371 3300049582 Bacteria 1501
1523 Ga0501067_0006353 3300049583 Bacteria 6552
1524 Ga0501067_0100538 3300049583 Bacteria 1606
1525 Ga0501069_0059825 3300049585 Bacteria 2126
1526 Ga0501069_0071601 3300049585 Bacteria 1943
1527 Ga0501072_0058369 3300049588 Bacteria 3042
1528 Ga0501073_0009275 3300049589 Bacteria 7259
1529 Ga0501075_0030221 3300049591 Bacteria 4012
1530 Ga0501198_009772 3300049649 Bacteria 1412
1531 Ga0501201_001123 3300049651 Bacteria 2508
1532 Ga0501202_002382 3300049652 Bacteria 3152
1533 Ga0501202_019234 3300049652 Unclassified 1348
1534 Ga0501207_001617 3300049654 Bacteria 2834
1535 Ga0501216_002042 3300049660 Bacteria 2822
1536 Ga0501217_007205 3300049661 Bacteria 2378
1537 Ga0501217_028430 3300049661 Unclassified 1362
1538 Ga0501223_003235 3300049663 Bacteria 3561
1539 Ga0501223_004188 3300049663 Unclassified 3110
1540 Ga0501223_008096 3300049663 Bacteria 2145
1541 Ga0501227_003013 3300049665 Bacteria 3677
1542 Ga0501227_004938 3300049665 Bacteria 2861
1543 Ga0501233_002795 3300049668 Bacteria 3099
1544 Ga0501235_000168 3300049669 Bacteria 11431
1545 Ga0501235_007619 3300049669 Bacteria 2359
1546 Ga0501249_000585 3300049679 Bacteria 8522
1547 Ga0501252_002333 3300049682 Bacteria 1878
1548 Ga0501253_000648 3300049683 Bacteria 3108
1549 Ga0501259_002891 3300049688 Bacteria 2760
1550 Ga0501261_000773 3300049690 Bacteria 3987
1551 Ga0501221_004244 3300049704 Bacteria 2376
1552 Ga0501225_0002036 3300049705 Bacteria 6287
1553 Ga0501225_0006091 3300049705 Bacteria 3522
1554 Ga0501225_0034681 3300049705 Bacteria 1389
1555 Ga0501229_011694 3300049706 Bacteria 1114
1556 Ga0501234_001044 3300049707 Bacteria 4376
1557 Ga0501079_0118109 3300049741 Bacteria 2062
1558 Ga0501079_0168949 3300049741 Bacteria 1705
1559 Ga0501080_0021798 3300049742 Bacteria 5934
1560 Ga0501080_0035813 3300049742 Bacteria 4633
1561 Ga0501080_0153541 3300049742 Bacteria 2127
1562 Ga0501081_0003292 3300049743 Bacteria 10268
1563 Ga0501081_0045671 3300049743 Bacteria 3008
1564 Ga0501081_0089486 3300049743 Bacteria 2164
1565 Ga0501083_0001501 3300049744 Bacteria 15934
1566 Ga0501083_0044174 3300049744 Bacteria 3016
1567 Ga0501266_003453 3300049763 Bacteria 1960
1568 Ga0501268_000026 3300049765 Bacteria 12943
1569 Ga0501270_000094 3300049767 Bacteria 6735
1570 Ga0501271_004451 3300049768 Bacteria 1328
1571 Ga0501280_007993 3300049776 Unclassified 1476
1572 Ga0501283_005679 3300049779 Bacteria 1723
1573 Ga0501035_0001519 3300049822 Bacteria 23703
1574 Ga0501035_0123800 3300049822 Bacteria 2258
1575 Ga0501044_0113532 3300049823 Bacteria 2716
1576 Ga0501045_0036679 3300049824 Bacteria 3561
1577 nmdc:mga00v17_154883_c1 3300050491 Bacteria 1473
1578 nmdc:mga00v17_34568_c1 3300050491 Bacteria 3003
1579 nmdc:mga00v17_94058_c1 3300050491 Bacteria 1885
1580 nmdc:mga0k408_138458_c1 3300050493 Bacteria 1447
1581 nmdc:mga0k408_436_c1 3300050493 Bacteria 16112
1582 nmdc:mga0k408_85_c1 3300050493 Bacteria 43890
1583 nmdc:mga0k408_86021_c1 3300050493 Unclassified 1845
1584 nmdc:mga0k408_9224_c1 3300050493 Bacteria 5316
1585 nmdc:mga06z11_13036_c1 3300050494 Bacteria 3635
1586 nmdc:mga07m45_74978_c1 3300050496 Bacteria 1927
1587 nmdc:mga05p37_18426_c1 3300050507 Bacteria 8434
1588 nmdc:mga05p37_196_c1 3300050507 Bacteria 60348
1589 nmdc:mga05p37_2009_c1 3300050507 Bacteria 23745
1590 nmdc:mga05p37_2095_c1 3300050507 Bacteria 23279
1591 nmdc:mga05p37_26386_c1 3300050507 Bacteria 7066
1592 nmdc:mga05p37_38593_c1 3300050507 Bacteria 5859
1593 nmdc:mga05p37_389468_c1 3300050507 Bacteria 1630
1594 nmdc:mga05p37_4765_c1 3300050507 Bacteria 15845
1595 nmdc:mga05p37_48180_c1 3300050507 Bacteria 5241
1596 nmdc:mga05p37_48325_c1 3300050507 Bacteria 5233
1597 nmdc:mga05p37_49463_c1 3300050507 Bacteria 5171
1598 nmdc:mga05p37_49691_c1 3300050507 Bacteria 5159
1599 nmdc:mga05p37_512116_c1 3300050507 Bacteria 1374
1600 nmdc:mga05p37_651_c1 3300050507 Bacteria 38411
1601 nmdc:mga05p37_72082_c1 3300050507 Bacteria 4250
1602 nmdc:mga05p37_92835_c1 3300050507 Unclassified 3719
1603 nmdc:mga09592_137403_c1 3300050508 Bacteria 2106
1604 nmdc:mga09592_23811_c1 3300050508 Bacteria 5059
1605 nmdc:mga09592_24597_c1 3300050508 Bacteria 4981
1606 nmdc:mga09592_40360_c1 3300050508 Bacteria 3921
1607 nmdc:mga09592_411349_c1 3300050508 Bacteria 1169
1608 nmdc:mga09592_57104_c1 3300050508 Bacteria 3298
1609 nmdc:mga09592_61231_c1 3300050508 Bacteria 3183
1610 nmdc:mga09592_61539_c1 3300050508 Bacteria 3175
1611 nmdc:mga0qj67_15273_c1 3300050509 Bacteria 5813
1612 nmdc:mga0qj67_160402_c1 3300050509 Bacteria 1826
1613 nmdc:mga0qj67_2139_c1 3300050509 Bacteria 14049
1614 nmdc:mga0qj67_2610_c1 3300050509 Bacteria 12909
1615 nmdc:mga0qj67_27113_c1 3300050509 Bacteria 4438
1616 nmdc:mga0qj67_36989_c1 3300050509 Bacteria 3822
1617 nmdc:mga06r32_19986_c1 3300050510 Bacteria 6157
1618 nmdc:mga06r32_246573_c1 3300050510 Bacteria 1774
1619 nmdc:mga06r32_25443_c1 3300050510 Bacteria 5507
1620 nmdc:mga06r32_2844_c1 3300050510 Bacteria 15537
1621 nmdc:mga06r32_284703_c1 3300050510 Bacteria 1640
1622 nmdc:mga06r32_48389_c1 3300050510 Bacteria 4063
1623 nmdc:mga06r32_53684_c1 3300050510 Bacteria 3861
1624 nmdc:mga08y16_142364_c1 3300050511 Bacteria 2493
1625 nmdc:mga08y16_1477_c1 3300050511 Bacteria 23610
1626 nmdc:mga08y16_149957_c1 3300050511 Bacteria 2424
1627 nmdc:mga08y16_272238_c1 3300050511 Bacteria 1748
1628 nmdc:mga08y16_35601_c1 3300050511 Bacteria 5227
1629 nmdc:mga08y16_49126_c1 3300050511 Bacteria 4415
1630 nmdc:mga0n895_1217_c1 3300050512 Bacteria 19007
1631 nmdc:mga0n895_1265_c1 3300050512 Bacteria 18677
1632 nmdc:mga0n895_180677_c1 3300050512 Bacteria 2141
1633 nmdc:mga0n895_246434_c1 3300050512 Bacteria 1813
1634 nmdc:mga0n895_260798_c1 3300050512 Bacteria 1759
1635 nmdc:mga0n895_2708_c1 3300050512 Bacteria 13984
1636 nmdc:mga0n895_27167_c1 3300050512 Bacteria 5434
1637 nmdc:mga0n895_315290_c1 3300050512 Bacteria 1585
1638 nmdc:mga0n895_37496_c1 3300050512 Bacteria 4690
1639 nmdc:mga0n895_44684_c1 3300050512 Bacteria 4320
1640 nmdc:mga0n895_45558_c1 3300050512 Bacteria 4280
1641 nmdc:mga0n895_53025_c1 3300050512 Bacteria 3983
1642 nmdc:mga0n895_92893_c1 3300050512 Bacteria 3021
1643 nmdc:mga0rr50_1289_c1 3300050513 Bacteria 13665
1644 nmdc:mga0rr50_180156_c1 3300050513 Bacteria 1727
1645 nmdc:mga0rr50_1933_c1 3300050513 Bacteria 11522
1646 nmdc:mga0rr50_2234_c1 3300050513 Bacteria 10866
1647 nmdc:mga0rr50_34882_c1 3300050513 Bacteria 3607
1648 nmdc:mga0rr50_35798_c1 3300050513 Bacteria 3568
1649 nmdc:mga0rr50_360717_c1 3300050513 Bacteria 1223
1650 nmdc:mga0rr50_63298_c1 3300050513 Bacteria 2793
1651 nmdc:mga0rr50_8597_c1 3300050513 Bacteria 6363
1652 nmdc:mga08x19_11_c1 3300050514 Bacteria 403007
1653 nmdc:mga08x19_4848_c1 3300050514 Bacteria 7957
1654 nmdc:mga08x19_5_c1 3300050514 Bacteria 464292
1655 nmdc:mga08x19_65939_c1 3300050514 Bacteria 2352
1656 nmdc:mga0a205_12344_c1 3300050515 Bacteria 7903
1657 nmdc:mga0a205_1325_c1 3300050515 Bacteria 20885
1658 nmdc:mga0a205_181715_c1 3300050515 Bacteria 1997
1659 nmdc:mga0a205_277060_c1 3300050515 Bacteria 1553
1660 nmdc:mga0a205_279730_c1 3300050515 Bacteria 1544
1661 nmdc:mga0a205_2962_c1 3300050515 Bacteria 15060
1662 nmdc:mga0a205_3266_c1 3300050515 Bacteria 14421
1663 nmdc:mga0a205_40689_c1 3300050515 Bacteria 4475
1664 nmdc:mga0a205_41819_c1 3300050515 Bacteria 4415
1665 nmdc:mga0a205_58037_c1 3300050515 Bacteria 3738
1666 nmdc:mga0a205_63316_c1 3300050515 Bacteria 3573
1667 nmdc:mga0a205_66208_c1 3300050515 Unclassified 3491
1668 nmdc:mga0a205_7716_c1 3300050515 Bacteria 9765
1669 Ga0495612_0020115 3300053078 Unclassified 2675
1670 Ga0495612_0021734 3300053078 Bacteria 2574
1671 Ga0495595_0004461 3300053084 Bacteria 5635
1672 Ga0495595_0071307 3300053084 Bacteria 1642
1673 Ga0495619_0052523 3300053085 Unclassified 2694
1674 Ga0500644_0023703 3300053088 Bacteria 1867
1675 Ga0500646_0010346 3300053090 Bacteria 2393
1676 Ga0500651_0001128 3300053093 Bacteria 13219
1677 Ga0500562_000005 3300053108 Bacteria 266746
1678 Ga0500595_000037 3300053119 Bacteria 102101
1679 Ga0500618_000029 3300053125 Bacteria 131691
1680 Ga0500618_016788 3300053125 Bacteria 1827
1681 Ga0500568_0000850 3300053139 Bacteria 21493
1682 Ga0500622_0000113 3300053156 Bacteria 83196
1683 Ga0500622_0000133 3300053156 Bacteria 78532
1684 Ga0500622_0004137 3300053156 Bacteria 9286
1685 Ga0500622_0006845 3300053156 Bacteria 6551
1686 Ga0500622_0010075 3300053156 Bacteria 5206
1687 Ga0500624_000557 3300053157 Bacteria 10448
1688 Ga0500627_0042370 3300053158 Unclassified 1960
1689 Ga0501084_0068470 3300054114 Bacteria 2971
1690 Ga0501084_0152131 3300054114 Bacteria 1950
1691 Ga0590077_015988 3300059426 Bacteria 1572
1692 Ga0501082_0000052 3300060353 Bacteria 83141
1693 Ga0501082_0012463 3300060353 Bacteria 7305

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049706 Ga0501229_011694 Ga0501229_011694_13_1026 327
2 3300005937 Ga0081455_10066777 Ga0081455_100667772 331
3 3300009098 Ga0105245_10215365 Ga0105245_102153651 335
4 3300035725 Ga0373947_0183943 Ga0373947_0183943_310_1350 338
5 3300050508 nmdc:mga09592_411349_c1 nmdc:mga09592_411349_c1_28_1134 342
6 3300050512 nmdc:mga0n895_44684_c1 nmdc:mga0n895_44684_c1_3203_4309 342
7 3300045051 Ga0451576_0167686 Ga0451576_0167686_296_1375 344
8 3300046492 Ga0495585_0061028 Ga0495585_0061028_543_1655 346
9 3300050493 nmdc:mga0k408_436_c1 nmdc:mga0k408_436_c1_15051_16094 346
10 3300049682 Ga0501252_002333 Ga0501252_002333_114_1193 349
11 3300050515 nmdc:mga0a205_277060_c1 nmdc:mga0a205_277060_c1_47_1135 356
12 3300049571 Ga0501034_0002329 Ga0501034_0002329_19161_20393 358
13 3300005293 Ga0065715_10168494 Ga0065715_101684941 361
14 3300025920 Ga0207649_10098537 Ga0207649_100985372 363
15 3300005564 Ga0070664_100083977 Ga0070664_1000839772 364
16 3300049663 Ga0501223_008096 Ga0501223_008096_768_1910 365
17 3300049668 Ga0501233_002795 Ga0501233_002795_749_1885 365
18 3300045051 Ga0451576_0085397 Ga0451576_0085397_452_1645 367
19 3300050515 nmdc:mga0a205_40689_c1 nmdc:mga0a205_40689_c1_3140_4333 367
20 3300039437 Ga0436365_0372670 Ga0436365_0372670_5410_6546 368
21 3300046473 Ga0495582_0088416 Ga0495582_0088416_586_1716 369
22 3300046475 Ga0495639_0108890 Ga0495639_0108890_44_1174 369
23 3300050513 nmdc:mga0rr50_360717_c1 nmdc:mga0rr50_360717_c1_35_1162 369
24 3300048907 Ga0496104_0006306 Ga0496104_0006306_2889_4019 370
25 3300048909 Ga0496106_0090763 Ga0496106_0090763_319_1449 370
26 3300048911 Ga0496108_0019439 Ga0496108_0019439_3298_4428 370
27 3300048912 Ga0496109_0001868 Ga0496109_0001868_11351_12481 370
28 3300048913 Ga0496110_0006161 Ga0496110_0006161_3457_4587 370
29 3300048914 Ga0496111_0010636 Ga0496111_0010636_1864_2994 370
30 3300048915 Ga0496112_0007575 Ga0496112_0007575_6939_8069 370
31 3300047318 Ga0495636_0013717 Ga0495636_0013717_527_1759 371
32 3300047447 Ga0495685_010864 Ga0495685_010864_60_1292 371
33 3300005336 Ga0070680_100010240 Ga0070680_1000102402 372
34 3300005530 Ga0070679_100006050 Ga0070679_1000060508 372
35 3300025912 Ga0207707_10003496 Ga0207707_100034964 372
36 3300025917 Ga0207660_10027118 Ga0207660_100271182 372
37 3300025921 Ga0207652_10005604 Ga0207652_100056047 372
38 3300049651 Ga0501201_001123 Ga0501201_001123_1291_2454 372
39 3300049652 Ga0501202_002382 Ga0501202_002382_1740_2903 372
40 3300049660 Ga0501216_002042 Ga0501216_002042_794_1957 372
41 3300049665 Ga0501227_004938 Ga0501227_004938_19_1182 372
42 3300049669 Ga0501235_000168 Ga0501235_000168_5506_6669 372
43 3300049679 Ga0501249_000585 Ga0501249_000585_3366_4529 372
44 3300049683 Ga0501253_000648 Ga0501253_000648_201_1364 372
45 3300049688 Ga0501259_002891 Ga0501259_002891_696_1859 372
46 3300049690 Ga0501261_000773 Ga0501261_000773_1051_2214 372
47 3300049704 Ga0501221_004244 Ga0501221_004244_257_1420 372
48 3300049705 Ga0501225_0002036 Ga0501225_0002036_206_1369 372
49 3300049707 Ga0501234_001044 Ga0501234_001044_2998_4161 372
50 3300049763 Ga0501266_003453 Ga0501266_003453_346_1509 372
51 3300049765 Ga0501268_000026 Ga0501268_000026_357_1520 372
52 3300049767 Ga0501270_000094 Ga0501270_000094_4141_5304 372
53 3300049768 Ga0501271_004451 Ga0501271_004451_111_1274 372
54 3300025919 Ga0207657_10050979 Ga0207657_100509791 373
55 3300013105 Ga0157369_10002025 Ga0157369_100020253 374
56 3300013296 Ga0157374_10310357 Ga0157374_103103572 374
57 3300048905 Ga0496102_0000088 Ga0496102_0000088_23485_24717 374
58 3300048918 Ga0496115_0020750 Ga0496115_0020750_3278_4474 374
59 3300009098 Ga0105245_10121495 Ga0105245_101214951 375
60 3300009551 Ga0105238_10236112 Ga0105238_102361121 375
61 3300046506 Ga0495583_0041000 Ga0495583_0041000_15_1169 375
62 3300048918 Ga0496115_0062852 Ga0496115_0062852_619_1848 376
63 3300050507 nmdc:mga05p37_49463_c1 nmdc:mga05p37_49463_c1_2519_3670 376
64 3300005339 Ga0070660_100070381 Ga0070660_1000703811 377
65 3300005457 Ga0070662_100074875 Ga0070662_1000748752 377
66 3300005564 Ga0070664_100110722 Ga0070664_1001107222 377
67 3300025933 Ga0207706_10099877 Ga0207706_100998773 377
68 3300025945 Ga0207679_10129344 Ga0207679_101293441 377
69 3300026089 Ga0207648_10068057 Ga0207648_100680572 377
70 3300050512 nmdc:mga0n895_180677_c1 nmdc:mga0n895_180677_c1_682_1932 377
71 3300050515 nmdc:mga0a205_2962_c1 nmdc:mga0a205_2962_c1_3928_5178 377
72 3300005467 Ga0070706_100012809 Ga0070706_1000128093 378
73 3300005471 Ga0070698_100082793 Ga0070698_1000827933 378
74 3300005518 Ga0070699_100055098 Ga0070699_1000550982 378
75 3300005563 Ga0068855_100006037 Ga0068855_1000060378 378
76 3300009093 Ga0105240_10244523 Ga0105240_102445232 378
77 3300009174 Ga0105241_10011905 Ga0105241_100119053 378
78 3300009545 Ga0105237_10034576 Ga0105237_100345763 378
79 3300013105 Ga0157369_10037641 Ga0157369_100376413 378
80 3300013307 Ga0157372_10002762 Ga0157372_100027629 378
81 3300025949 Ga0207667_10000997 Ga0207667_1000099711 378
82 3300046525 Ga0495663_0003962 Ga0495663_0003962_1294_2529 378
83 3300046615 Ga0495656_0005622 Ga0495656_0005622_2601_3836 378
84 3300005340 Ga0070689_100016466 Ga0070689_1000164663 379
85 3300005842 Ga0068858_100006983 Ga0068858_1000069833 379
86 3300006844 Ga0075428_100001232 Ga0075428_10000123222 379
87 3300006847 Ga0075431_100001438 Ga0075431_1000014387 379
88 3300009098 Ga0105245_10023239 Ga0105245_100232392 379
89 3300009147 Ga0114129_10002359 Ga0114129_1000235914 379
90 3300009176 Ga0105242_10003265 Ga0105242_100032658 379
91 3300013306 Ga0163162_10088430 Ga0163162_100884302 379
92 3300013308 Ga0157375_10521525 Ga0157375_105215252 379
93 3300025927 Ga0207687_10003985 Ga0207687_100039858 379
94 3300025936 Ga0207670_10003027 Ga0207670_100030277 379
95 3300026035 Ga0207703_10000196 Ga0207703_1000019633 379
96 3300046517 Ga0495630_0189152 Ga0495630_0189152_126_1301 379
97 3300047472 Ga0495686_0001824 Ga0495686_0001824_6820_8151 379
98 3300050507 nmdc:mga05p37_2095_c1 nmdc:mga05p37_2095_c1_5798_7033 379
99 3300050508 nmdc:mga09592_23811_c1 nmdc:mga09592_23811_c1_2447_3682 379
100 3300050510 nmdc:mga06r32_2844_c1 nmdc:mga06r32_2844_c1_2031_3266 379
101 3300005468 Ga0070707_100015517 Ga0070707_1000155172 380
102 3300005543 Ga0070672_100000448 Ga0070672_10000044818 380
103 3300006914 Ga0075436_100010797 Ga0075436_1000107972 380
104 3300009174 Ga0105241_10070504 Ga0105241_100705042 380
105 3300013308 Ga0157375_10000013 Ga0157375_10000013238 380
106 3300013308 Ga0157375_10384126 Ga0157375_103841261 380
107 3300014326 Ga0157380_10012682 Ga0157380_100126824 380
108 3300025922 Ga0207646_10038218 Ga0207646_100382183 380
109 3300025929 Ga0207664_10149578 Ga0207664_101495782 380
110 3300025940 Ga0207691_10000617 Ga0207691_1000061714 380
111 3300060353 Ga0501082_0000052 Ga0501082_0000052_36479_37669 380
112 3300009093 Ga0105240_10109325 Ga0105240_101093252 381
113 3300009098 Ga0105245_10336384 Ga0105245_103363842 381
114 3300009147 Ga0114129_10062911 Ga0114129_100629113 381
115 3300025927 Ga0207687_10055838 Ga0207687_100558382 381
116 3300026078 Ga0207702_10273211 Ga0207702_102732111 381
117 3300039437 Ga0436365_0488699 Ga0436365_0488699_5368_6606 381
118 3300053139 Ga0500568_0000850 Ga0500568_0000850_9647_10813 381
119 3300005327 Ga0070658_10037863 Ga0070658_100378633 382
120 3300005547 Ga0070693_100056777 Ga0070693_1000567772 382
121 3300037312 Ga0395899_0007074 Ga0395899_0007074_4659_5909 382
122 3300038443 Ga0395901_0109916 Ga0395901_0109916_973_2211 382
123 3300044842 Ga0466957_0024810 Ga0466957_0024810_799_2049 382
124 3300045836 Ga0466958_0053705 Ga0466958_0053705_189_1439 382
125 3300046507 Ga0495606_0000043 Ga0495606_0000043_192670_193935 382
126 3300005336 Ga0070680_100000620 Ga0070680_10000062018 383
127 3300005618 Ga0068864_100003363 Ga0068864_1000033639 383
128 3300006844 Ga0075428_100189282 Ga0075428_1001892822 383
129 3300006852 Ga0075433_10001279 Ga0075433_1000127916 383
130 3300006852 Ga0075433_10017016 Ga0075433_100170163 383
131 3300006871 Ga0075434_100021342 Ga0075434_1000213424 383
132 3300006871 Ga0075434_100042430 Ga0075434_1000424302 383
133 3300007076 Ga0075435_100060343 Ga0075435_1000603434 383
134 3300009093 Ga0105240_10082347 Ga0105240_100823472 383
135 3300013296 Ga0157374_10007981 Ga0157374_100079811 383
136 3300013308 Ga0157375_10308178 Ga0157375_103081782 383
137 3300025912 Ga0207707_10000037 Ga0207707_10000037107 383
138 3300025917 Ga0207660_10000155 Ga0207660_1000015518 383
139 3300025921 Ga0207652_10000200 Ga0207652_1000020018 383
140 3300027907 Ga0207428_10073780 Ga0207428_100737801 383
141 3300031251 Ga0265327_10017666 Ga0265327_100176663 383
142 3300037471 Ga0395905_0001645 Ga0395905_0001645_5730_7025 383
143 3300045976 Ga0466967_0229388 Ga0466967_0229388_115_1353 383
144 3300046454 Ga0495592_0017599 Ga0495592_0017599_3103_4323 383
145 3300046459 Ga0495629_0003095 Ga0495629_0003095_5070_6290 383
146 3300046462 Ga0495651_0004124 Ga0495651_0004124_5429_6649 383
147 3300046472 Ga0495580_0080516 Ga0495580_0080516_233_1453 383
148 3300046473 Ga0495582_0000841 Ga0495582_0000841_12630_13850 383
149 3300046475 Ga0495639_0000600 Ga0495639_0000600_9193_10413 383
150 3300046476 Ga0495662_0000410 Ga0495662_0000410_6235_7455 383
151 3300046477 Ga0495664_0002393 Ga0495664_0002393_4570_5790 383
152 3300046499 Ga0495594_0000637 Ga0495594_0000637_10491_11711 383
153 3300046499 Ga0495594_0001903 Ga0495594_0001903_2236_3456 383
154 3300046516 Ga0495628_0004728 Ga0495628_0004728_6344_7564 383
155 3300046526 Ga0495666_0001852 Ga0495666_0001852_8873_10093 383
156 3300046529 Ga0495652_0008507 Ga0495652_0008507_6291_7511 383
157 3300046531 Ga0495665_0000386 Ga0495665_0000386_4276_5496 383
158 3300046533 Ga0495640_0003040 Ga0495640_0003040_4148_5368 383
159 3300046535 Ga0495586_0001552 Ga0495586_0001552_5811_7031 383
160 3300046543 Ga0495645_0001562 Ga0495645_0001562_7622_8842 383
161 3300046559 Ga0495667_0001013 Ga0495667_0001013_966_2186 383
162 3300046642 Ga0495634_0000781 Ga0495634_0000781_18195_19415 383
163 3300046663 Ga0495635_0002246 Ga0495635_0002246_4698_5918 383
164 3300046678 Ga0495599_0001114 Ga0495599_0001114_6498_7718 383
165 3300046679 Ga0495623_0024737 Ga0495623_0024737_1319_2539 383
166 3300046689 Ga0495613_0009495 Ga0495613_0009495_1722_2942 383
167 3300046690 Ga0495624_0001077 Ga0495624_0001077_7778_8998 383
168 3300046809 Ga0495600_0000406 Ga0495600_0000406_11164_12384 383
169 3300047317 Ga0495604_0001017 Ga0495604_0001017_12562_13782 383
170 3300047319 Ga0495674_0001669 Ga0495674_0001669_16340_17560 383
171 3300047321 Ga0495676_0000665 Ga0495676_0000665_4276_5496 383
172 3300047322 Ga0495680_0053710 Ga0495680_0053710_822_2042 383
173 3300047444 Ga0495675_0001449 Ga0495675_0001449_11828_13048 383
174 3300048089 Ga0495614_0000076 Ga0495614_0000076_9406_10626 383
175 3300050510 nmdc:mga06r32_53684_c1 nmdc:mga06r32_53684_c1_42_1280 383
176 3300050512 nmdc:mga0n895_45558_c1 nmdc:mga0n895_45558_c1_2045_3322 383
177 3300050513 nmdc:mga0rr50_63298_c1 nmdc:mga0rr50_63298_c1_532_1809 383
178 3300050515 nmdc:mga0a205_7716_c1 nmdc:mga0a205_7716_c1_3341_4618 383
179 3300005293 Ga0065715_10092652 Ga0065715_100926522 384
180 3300044658 Ga0466972_0015756 Ga0466972_0015756_13_1257 384
181 3300044683 Ga0466965_0023536 Ga0466965_0023536_869_2113 384
182 3300044706 Ga0466964_0001870 Ga0466964_0001870_130_1374 384
183 3300044735 Ga0466968_0006583 Ga0466968_0006583_1084_2328 384
184 3300044842 Ga0466957_0039570 Ga0466957_0039570_1367_2611 384
185 3300044901 Ga0466960_0019352 Ga0466960_0019352_840_2084 384
186 3300045051 Ga0451576_0014079 Ga0451576_0014079_2478_3722 384
187 3300005518 Ga0070699_100041648 Ga0070699_1000416483 385
188 3300046491 Ga0495584_0000371 Ga0495584_0000371_19293_20525 385
189 3300046491 Ga0495584_0012303 Ga0495584_0012303_744_1976 385
190 3300046492 Ga0495585_0000196 Ga0495585_0000196_48336_49568 385
191 3300046500 Ga0495596_0000130 Ga0495596_0000130_29869_31101 385
192 3300046513 Ga0495616_0023720 Ga0495616_0023720_144_1376 385
193 3300046518 Ga0495631_0014917 Ga0495631_0014917_2330_3562 385
194 3300046558 Ga0495633_0006050 Ga0495633_0006050_4194_5426 385
195 3300046684 Ga0495669_0008902 Ga0495669_0008902_178_1410 385
196 3300046691 Ga0495670_0055646 Ga0495670_0055646_605_1837 385
197 3300047323 Ga0495683_0000159 Ga0495683_0000159_101_1333 385
198 3300047445 Ga0495677_0027143 Ga0495677_0027143_195_1427 385
199 3300047472 Ga0495686_0015323 Ga0495686_0015323_2843_4075 385
200 3300005366 Ga0070659_100017519 Ga0070659_1000175192 386
201 3300005436 Ga0070713_100044366 Ga0070713_1000443663 386
202 3300005466 Ga0070685_10084729 Ga0070685_100847291 386
203 3300005615 Ga0070702_100013224 Ga0070702_1000132242 386
204 3300006852 Ga0075433_10061092 Ga0075433_100610922 386
205 3300009093 Ga0105240_10058748 Ga0105240_100587481 386
206 3300010375 Ga0105239_10006203 Ga0105239_100062032 386
207 3300025928 Ga0207700_10037486 Ga0207700_100374862 386
208 3300025932 Ga0207690_10006069 Ga0207690_100060692 386
209 3300044842 Ga0466957_0003163 Ga0466957_0003163_3417_4667 386
210 3300046660 Ga0495625_0021839 Ga0495625_0021839_3355_4575 386
211 3300046679 Ga0495623_0161161 Ga0495623_0161161_50_1234 386
212 3300048910 Ga0496107_0106128 Ga0496107_0106128_179_1417 386
213 3300005563 Ga0068855_100174487 Ga0068855_1001744872 387
214 3300005564 Ga0070664_100035852 Ga0070664_1000358523 387
215 3300006844 Ga0075428_100095563 Ga0075428_1000955632 387
216 3300009174 Ga0105241_10009497 Ga0105241_100094972 387
217 3300009553 Ga0105249_10017823 Ga0105249_100178232 387
218 3300025909 Ga0207705_10089125 Ga0207705_100891252 387
219 3300025911 Ga0207654_10010465 Ga0207654_100104652 387
220 3300025914 Ga0207671_10039181 Ga0207671_100391812 387
221 3300025949 Ga0207667_10023798 Ga0207667_100237984 387
222 3300026023 Ga0207677_10063589 Ga0207677_100635893 387
223 3300037312 Ga0395899_0007658 Ga0395899_0007658_2011_3261 387
224 3300037418 Ga0395900_0001610 Ga0395900_0001610_4261_5511 387
225 3300037471 Ga0395905_0055601 Ga0395905_0055601_1859_3109 387
226 3300038443 Ga0395901_0000963 Ga0395901_0000963_845_2095 387
227 3300042005 Ga0439448_0044155 Ga0439448_0044155_160_1410 387
228 3300042008 Ga0439450_021151 Ga0439450_021151_87_1337 387
229 3300042012 Ga0439455_0001403 Ga0439455_0001403_878_2128 387
230 3300042876 Ga0451577_0001936 Ga0451577_0001936_10168_11418 387
231 3300044712 Ga0453684_0001021 Ga0453684_0001021_73852_75102 387
232 3300046472 Ga0495580_0041322 Ga0495580_0041322_2024_3226 387
233 3300005344 Ga0070661_100019036 Ga0070661_1000190363 388
234 3300005436 Ga0070713_100026982 Ga0070713_1000269823 388
235 3300005436 Ga0070713_100050316 Ga0070713_1000503163 388
236 3300005539 Ga0068853_100071218 Ga0068853_1000712182 388
237 3300005563 Ga0068855_100014332 Ga0068855_1000143321 388
238 3300005564 Ga0070664_100070612 Ga0070664_1000706122 388
239 3300005614 Ga0068856_100007399 Ga0068856_1000073999 388
240 3300005937 Ga0081455_10013786 Ga0081455_100137866 388
241 3300006028 Ga0070717_10011995 Ga0070717_100119953 388
242 3300006237 Ga0097621_100131344 Ga0097621_1001313442 388
243 3300006871 Ga0075434_100242811 Ga0075434_1002428112 388
244 3300013100 Ga0157373_10181109 Ga0157373_101811092 388
245 3300025920 Ga0207649_10031115 Ga0207649_100311152 388
246 3300025929 Ga0207664_10001301 Ga0207664_1000130112 388
247 3300025945 Ga0207679_10050514 Ga0207679_100505142 388
248 3300035111 Ga0373923_0059078 Ga0373923_0059078_380_1576 388
249 3300035119 Ga0373956_0037713 Ga0373956_0037713_653_1849 388
250 3300035241 Ga0373961_0030020 Ga0373961_0030020_157_1377 388
251 3300035692 Ga0373935_0030923 Ga0373935_0030923_960_2156 388
252 3300035725 Ga0373947_0035648 Ga0373947_0035648_1058_2254 388
253 3300046472 Ga0495580_0003603 Ga0495580_0003603_11693_12892 388
254 3300046472 Ga0495580_0007235 Ga0495580_0007235_6275_7471 388
255 3300046499 Ga0495594_0153617 Ga0495594_0153617_20_1219 388
256 3300047471 Ga0495684_0057741 Ga0495684_0057741_1725_2924 388
257 3300006175 Ga0070712_100125877 Ga0070712_1001258772 389
258 3300006846 Ga0075430_100001878 Ga0075430_1000018786 389
259 3300007076 Ga0075435_100008355 Ga0075435_1000083555 389
260 3300014325 Ga0163163_10071588 Ga0163163_100715882 389
261 3300014969 Ga0157376_10152708 Ga0157376_101527082 389
262 3300025922 Ga0207646_10033863 Ga0207646_100338634 389
263 3300025927 Ga0207687_10148271 Ga0207687_101482712 389
264 3300044694 Ga0466963_0005484 Ga0466963_0005484_5856_7055 389
265 3300050491 nmdc:mga00v17_94058_c1 nmdc:mga00v17_94058_c1_406_1632 389
266 3300050508 nmdc:mga09592_24597_c1 nmdc:mga09592_24597_c1_2959_4221 389
267 3300050509 nmdc:mga0qj67_2139_c1 nmdc:mga0qj67_2139_c1_10714_11976 389
268 3300050513 nmdc:mga0rr50_8597_c1 nmdc:mga0rr50_8597_c1_1572_2762 389
269 3300053078 Ga0495612_0021734 Ga0495612_0021734_39_1241 389
270 3300005327 Ga0070658_10084597 Ga0070658_100845972 390
271 3300005841 Ga0068863_100027088 Ga0068863_1000270883 390
272 3300006846 Ga0075430_100006228 Ga0075430_1000062283 390
273 3300006847 Ga0075431_100019800 Ga0075431_1000198004 390
274 3300006880 Ga0075429_100092481 Ga0075429_1000924812 390
275 3300009177 Ga0105248_10027354 Ga0105248_100273542 390
276 3300025924 Ga0207694_10036842 Ga0207694_100368422 390
277 3300026088 Ga0207641_10011021 Ga0207641_100110213 390
278 3300028800 Ga0265338_10056747 Ga0265338_100567472 390
279 3300035692 Ga0373935_0040774 Ga0373935_0040774_287_1531 390
280 3300045049 Ga0466959_0004931 Ga0466959_0004931_5044_6306 390
281 3300046516 Ga0495628_0143805 Ga0495628_0143805_16_1221 390
282 3300047319 Ga0495674_0042224 Ga0495674_0042224_2028_3233 390
283 3300050508 nmdc:mga09592_57104_c1 nmdc:mga09592_57104_c1_136_1380 390
284 3300050509 nmdc:mga0qj67_15273_c1 nmdc:mga0qj67_15273_c1_2886_4151 390
285 3300005344 Ga0070661_100059260 Ga0070661_1000592602 391
286 3300006195 Ga0075366_10137667 Ga0075366_101376672 391
287 3300006844 Ga0075428_100161789 Ga0075428_1001617893 391
288 3300025918 Ga0207662_10112783 Ga0207662_101127832 391
289 3300050493 nmdc:mga0k408_138458_c1 nmdc:mga0k408_138458_c1_59_1279 391
290 3300006844 Ga0075428_100094183 Ga0075428_1000941832 392
291 3300009093 Ga0105240_10007758 Ga0105240_1000775812 392
292 3300009545 Ga0105237_10001392 Ga0105237_1000139236 392
293 3300025913 Ga0207695_10023524 Ga0207695_100235242 392
294 3300025914 Ga0207671_10112680 Ga0207671_101126802 392
295 3300028800 Ga0265338_10070355 Ga0265338_100703552 392
296 3300046472 Ga0495580_0053594 Ga0495580_0053594_206_1462 392
297 3300046491 Ga0495584_0000010 Ga0495584_0000010_61327_62556 392
298 3300046507 Ga0495606_0008408 Ga0495606_0008408_4388_5617 392
299 3300046529 Ga0495652_0138238 Ga0495652_0138238_445_1752 392
300 3300046536 Ga0495587_0021119 Ga0495587_0021119_2207_3514 392
301 3300046543 Ga0495645_0002538 Ga0495645_0002538_920_2227 392
302 3300047317 Ga0495604_0016975 Ga0495604_0016975_2531_3838 392
303 3300048918 Ga0496115_0053714 Ga0496115_0053714_1482_2750 392
304 3300050493 nmdc:mga0k408_9224_c1 nmdc:mga0k408_9224_c1_548_1774 392
305 3300005329 Ga0070683_100000006 Ga0070683_100000006146 393
306 3300005329 Ga0070683_100075498 Ga0070683_1000754983 393
307 3300005338 Ga0068868_100034755 Ga0068868_1000347553 393
308 3300005445 Ga0070708_100183126 Ga0070708_1001831262 393
309 3300005458 Ga0070681_10013640 Ga0070681_100136406 393
310 3300005458 Ga0070681_10068704 Ga0070681_100687042 393
311 3300005459 Ga0068867_100011807 Ga0068867_1000118073 393
312 3300005468 Ga0070707_100059027 Ga0070707_1000590272 393
313 3300005471 Ga0070698_100056330 Ga0070698_1000563302 393
314 3300005471 Ga0070698_100191155 Ga0070698_1001911552 393
315 3300005518 Ga0070699_100187034 Ga0070699_1001870342 393
316 3300005535 Ga0070684_100000050 Ga0070684_10000005054 393
317 3300005535 Ga0070684_100036930 Ga0070684_1000369302 393
318 3300005536 Ga0070697_100167622 Ga0070697_1001676221 393
319 3300005549 Ga0070704_100261789 Ga0070704_1002617892 393
320 3300005563 Ga0068855_100084938 Ga0068855_1000849382 393
321 3300005577 Ga0068857_100003432 Ga0068857_1000034329 393
322 3300005577 Ga0068857_100044710 Ga0068857_1000447102 393
323 3300005578 Ga0068854_100000073 Ga0068854_10000007355 393
324 3300006237 Ga0097621_100008111 Ga0097621_1000081119 393
325 3300006358 Ga0068871_100048031 Ga0068871_1000480312 393
326 3300006881 Ga0068865_100192260 Ga0068865_1001922601 393
327 3300009093 Ga0105240_10003652 Ga0105240_1000365219 393
328 3300009093 Ga0105240_10271779 Ga0105240_102717792 393
329 3300009094 Ga0111539_10108271 Ga0111539_101082712 393
330 3300009094 Ga0111539_10119916 Ga0111539_101199163 393
331 3300009098 Ga0105245_10046042 Ga0105245_100460422 393
332 3300009176 Ga0105242_10037108 Ga0105242_100371082 393
333 3300009177 Ga0105248_10022626 Ga0105248_100226264 393
334 3300009545 Ga0105237_10047909 Ga0105237_100479092 393
335 3300009551 Ga0105238_10011530 Ga0105238_100115306 393
336 3300010375 Ga0105239_10051293 Ga0105239_100512935 393
337 3300011119 Ga0105246_10006857 Ga0105246_100068579 393
338 3300013105 Ga0157369_10223995 Ga0157369_102239952 393
339 3300013296 Ga0157374_10018791 Ga0157374_100187916 393
340 3300013296 Ga0157374_10190301 Ga0157374_101903012 393
341 3300013297 Ga0157378_10020841 Ga0157378_100208416 393
342 3300020078 Ga0206352_10928416 Ga0206352_109284162 393
343 3300025912 Ga0207707_10003407 Ga0207707_100034075 393
344 3300025912 Ga0207707_10073456 Ga0207707_100734562 393
345 3300025913 Ga0207695_10000956 Ga0207695_1000095634 393
346 3300025913 Ga0207695_10024430 Ga0207695_100244305 393
347 3300025913 Ga0207695_10134883 Ga0207695_101348832 393
348 3300025924 Ga0207694_10005565 Ga0207694_100055656 393
349 3300025927 Ga0207687_10027380 Ga0207687_100273804 393
350 3300025934 Ga0207686_10004150 Ga0207686_100041502 393
351 3300025934 Ga0207686_10023518 Ga0207686_100235182 393
352 3300025944 Ga0207661_10000011 Ga0207661_10000011147 393
353 3300025944 Ga0207661_10036349 Ga0207661_100363493 393
354 3300025945 Ga0207679_10057592 Ga0207679_100575923 393
355 3300025949 Ga0207667_10118254 Ga0207667_101182543 393
356 3300025981 Ga0207640_10000033 Ga0207640_1000003357 393
357 3300026023 Ga0207677_10026449 Ga0207677_100264492 393
358 3300026041 Ga0207639_10053990 Ga0207639_100539902 393
359 3300026116 Ga0207674_10011084 Ga0207674_100110844 393
360 3300026116 Ga0207674_10017294 Ga0207674_100172945 393
361 3300031711 Ga0265314_10011744 Ga0265314_100117443 393
362 3300037471 Ga0395905_0216964 Ga0395905_0216964_367_1584 393
363 3300046452 Ga0495617_006061 Ga0495617_006061_2863_4095 393
364 3300046492 Ga0495585_0000592 Ga0495585_0000592_8735_9967 393
365 3300046506 Ga0495583_0000084 Ga0495583_0000084_136777_138009 393
366 3300046506 Ga0495583_0074914 Ga0495583_0074914_164_1450 393
367 3300046513 Ga0495616_0004202 Ga0495616_0004202_7709_8941 393
368 3300046524 Ga0495648_0000007 Ga0495648_0000007_127537_128769 393
369 3300046542 Ga0495597_0041175 Ga0495597_0041175_579_1811 393
370 3300046543 Ga0495645_0117117 Ga0495645_0117117_401_1630 393
371 3300046558 Ga0495633_0004603 Ga0495633_0004603_4621_5853 393
372 3300046616 Ga0495668_0003655 Ga0495668_0003655_4646_5878 393
373 3300046665 Ga0495661_0006880 Ga0495661_0006880_486_1718 393
374 3300046691 Ga0495670_0004933 Ga0495670_0004933_4787_6019 393
375 3300047323 Ga0495683_0005604 Ga0495683_0005604_117_1349 393
376 3300049661 Ga0501217_028430 Ga0501217_028430_151_1338 393
377 3300005290 Ga0065712_10095649 Ga0065712_100956492 394
378 3300005329 Ga0070683_100003571 Ga0070683_1000035719 394
379 3300005329 Ga0070683_100010969 Ga0070683_10001096910 394
380 3300005329 Ga0070683_100053337 Ga0070683_1000533375 394
381 3300005331 Ga0070670_100000419 Ga0070670_1000004195 394
382 3300005331 Ga0070670_100004447 Ga0070670_1000044474 394
383 3300005335 Ga0070666_10001789 Ga0070666_1000178915 394
384 3300005338 Ga0068868_100000943 Ga0068868_10000094313 394
385 3300005344 Ga0070661_100002682 Ga0070661_1000026829 394
386 3300005354 Ga0070675_100018224 Ga0070675_1000182241 394
387 3300005355 Ga0070671_100020267 Ga0070671_1000202675 394
388 3300005364 Ga0070673_100033102 Ga0070673_1000331023 394
389 3300005367 Ga0070667_100000753 Ga0070667_10000075323 394
390 3300005457 Ga0070662_100119867 Ga0070662_1001198672 394
391 3300005466 Ga0070685_10088078 Ga0070685_100880782 394
392 3300005535 Ga0070684_100001249 Ga0070684_1000012494 394
393 3300005543 Ga0070672_100004770 Ga0070672_1000047703 394
394 3300005543 Ga0070672_100095761 Ga0070672_1000957612 394
395 3300005544 Ga0070686_100012837 Ga0070686_1000128371 394
396 3300005564 Ga0070664_100000535 Ga0070664_1000005352 394
397 3300005617 Ga0068859_100054614 Ga0068859_1000546142 394
398 3300005618 Ga0068864_100000280 Ga0068864_10000028017 394
399 3300005841 Ga0068863_100059187 Ga0068863_1000591871 394
400 3300005841 Ga0068863_100173894 Ga0068863_1001738942 394
401 3300005842 Ga0068858_100007419 Ga0068858_10000741911 394
402 3300006237 Ga0097621_100024171 Ga0097621_1000241712 394
403 3300006852 Ga0075433_10054625 Ga0075433_100546252 394
404 3300006871 Ga0075434_100037625 Ga0075434_1000376252 394
405 3300006931 Ga0097620_100054613 Ga0097620_1000546132 394
406 3300007076 Ga0075435_100275129 Ga0075435_1002751291 394
407 3300009147 Ga0114129_10049861 Ga0114129_100498613 394
408 3300009177 Ga0105248_10001049 Ga0105248_1000104915 394
409 3300009551 Ga0105238_10040715 Ga0105238_100407154 394
410 3300013306 Ga0163162_10002686 Ga0163162_100026869 394
411 3300013308 Ga0157375_10013304 Ga0157375_100133045 394
412 3300014325 Ga0163163_10029097 Ga0163163_100290976 394
413 3300025903 Ga0207680_10034060 Ga0207680_100340602 394
414 3300025920 Ga0207649_10009299 Ga0207649_100092995 394
415 3300025925 Ga0207650_10013762 Ga0207650_100137625 394
416 3300025933 Ga0207706_10030381 Ga0207706_100303812 394
417 3300025940 Ga0207691_10007733 Ga0207691_100077335 394
418 3300025940 Ga0207691_10041581 Ga0207691_100415813 394
419 3300025944 Ga0207661_10002858 Ga0207661_100028583 394
420 3300025945 Ga0207679_10014795 Ga0207679_100147953 394
421 3300025945 Ga0207679_10017354 Ga0207679_100173542 394
422 3300025960 Ga0207651_10022008 Ga0207651_100220081 394
423 3300025961 Ga0207712_10029600 Ga0207712_100296002 394
424 3300025986 Ga0207658_10015578 Ga0207658_100155783 394
425 3300026067 Ga0207678_10121063 Ga0207678_101210631 394
426 3300026088 Ga0207641_10023451 Ga0207641_100234513 394
427 3300026088 Ga0207641_10172493 Ga0207641_101724932 394
428 3300026095 Ga0207676_10000681 Ga0207676_100006814 394
429 3300031344 Ga0265316_10180282 Ga0265316_101802822 394
430 3300031711 Ga0265314_10004761 Ga0265314_100047616 394
431 3300036401 Ga0373937_0099389 Ga0373937_0099389_1006_2211 394
432 3300036401 Ga0373937_0134819 Ga0373937_0134819_368_1573 394
433 3300037418 Ga0395900_0000931 Ga0395900_0000931_26330_27565 394
434 3300038443 Ga0395901_0000331 Ga0395901_0000331_26029_27264 394
435 3300046454 Ga0495592_0010559 Ga0495592_0010559_4890_6095 394
436 3300046476 Ga0495662_0051040 Ga0495662_0051040_697_1902 394
437 3300046559 Ga0495667_0001245 Ga0495667_0001245_3299_4504 394
438 3300046689 Ga0495613_0098712 Ga0495613_0098712_647_1852 394
439 3300047319 Ga0495674_0071580 Ga0495674_0071580_858_2063 394
440 3300049652 Ga0501202_019234 Ga0501202_019234_29_1234 394
441 3300049822 Ga0501035_0001519 Ga0501035_0001519_3229_4464 394
442 3300050491 nmdc:mga00v17_154883_c1 nmdc:mga00v17_154883_c1_165_1394 394
443 3300050491 nmdc:mga00v17_34568_c1 nmdc:mga00v17_34568_c1_872_2101 394
444 3300050507 nmdc:mga05p37_48325_c1 nmdc:mga05p37_48325_c1_2559_3761 394
445 3300050512 nmdc:mga0n895_27167_c1 nmdc:mga0n895_27167_c1_3355_4557 394
446 3300003759 Ga0055525_1000009 Ga0055525_1000009136 395
447 3300006844 Ga0075428_100198637 Ga0075428_1001986372 395
448 3300006871 Ga0075434_100025788 Ga0075434_1000257883 395
449 3300006871 Ga0075434_100064026 Ga0075434_1000640263 395
450 3300009147 Ga0114129_10052687 Ga0114129_100526874 395
451 3300009147 Ga0114129_10219938 Ga0114129_102199382 395
452 3300009147 Ga0114129_10263166 Ga0114129_102631662 395
453 3300036401 Ga0373937_0089408 Ga0373937_0089408_689_1915 395
454 3300037312 Ga0395899_0017623 Ga0395899_0017623_2789_4027 395
455 3300037418 Ga0395900_0001209 Ga0395900_0001209_11809_13047 395
456 3300046454 Ga0495592_0054378 Ga0495592_0054378_1224_2450 395
457 3300046514 Ga0495618_0012641 Ga0495618_0012641_2081_3307 395
458 3300046663 Ga0495635_0226026 Ga0495635_0226026_10_1236 395
459 3300046678 Ga0495599_0017306 Ga0495599_0017306_2754_3980 395
460 3300046689 Ga0495613_0014253 Ga0495613_0014253_3191_4417 395
461 3300047319 Ga0495674_0034228 Ga0495674_0034228_220_1446 395
462 3300047472 Ga0495686_0000590 Ga0495686_0000590_48242_49492 395
463 3300048927 Ga0496124_0006617 Ga0496124_0006617_7216_8454 395
464 3300050507 nmdc:mga05p37_48180_c1 nmdc:mga05p37_48180_c1_2993_4222 395
465 3300050512 nmdc:mga0n895_246434_c1 nmdc:mga0n895_246434_c1_534_1760 395
466 3300005330 Ga0070690_100002353 Ga0070690_1000023532 396
467 3300005331 Ga0070670_100004609 Ga0070670_1000046092 396
468 3300005338 Ga0068868_100000785 Ga0068868_1000007854 396
469 3300005343 Ga0070687_100012416 Ga0070687_1000124162 396
470 3300005344 Ga0070661_100017312 Ga0070661_1000173122 396
471 3300005355 Ga0070671_100013024 Ga0070671_1000130242 396
472 3300005364 Ga0070673_100311301 Ga0070673_1003113011 396
473 3300005367 Ga0070667_100002056 Ga0070667_1000020568 396
474 3300005439 Ga0070711_100067660 Ga0070711_1000676602 396
475 3300005536 Ga0070697_100075108 Ga0070697_1000751081 396
476 3300005543 Ga0070672_100000164 Ga0070672_1000001645 396
477 3300005564 Ga0070664_100001689 Ga0070664_10000168916 396
478 3300005618 Ga0068864_100001424 Ga0068864_10000142411 396
479 3300005841 Ga0068863_100011787 Ga0068863_1000117874 396
480 3300005841 Ga0068863_100042150 Ga0068863_1000421503 396
481 3300006173 Ga0070716_100125239 Ga0070716_1001252392 396
482 3300006237 Ga0097621_100006331 Ga0097621_1000063315 396
483 3300009176 Ga0105242_10000237 Ga0105242_1000023712 396
484 3300009177 Ga0105248_10001449 Ga0105248_1000144918 396
485 3300013296 Ga0157374_10023272 Ga0157374_100232723 396
486 3300013297 Ga0157378_10000028 Ga0157378_1000002825 396
487 3300013306 Ga0163162_10003853 Ga0163162_100038532 396
488 3300013307 Ga0157372_10434327 Ga0157372_104343272 396
489 3300013308 Ga0157375_10001948 Ga0157375_100019482 396
490 3300014325 Ga0163163_10003629 Ga0163163_100036296 396
491 3300014325 Ga0163163_10041132 Ga0163163_100411322 396
492 3300025925 Ga0207650_10000910 Ga0207650_100009107 396
493 3300025928 Ga0207700_10022903 Ga0207700_100229032 396
494 3300025931 Ga0207644_10007957 Ga0207644_100079576 396
495 3300025934 Ga0207686_10000515 Ga0207686_1000051510 396
496 3300025935 Ga0207709_10000668 Ga0207709_1000066815 396
497 3300025940 Ga0207691_10001246 Ga0207691_1000124614 396
498 3300025941 Ga0207711_10005912 Ga0207711_100059127 396
499 3300025945 Ga0207679_10000919 Ga0207679_1000091910 396
500 3300025960 Ga0207651_10288520 Ga0207651_102885201 396
501 3300025986 Ga0207658_10010307 Ga0207658_100103076 396
502 3300035207 Ga0373942_0026849 Ga0373942_0026849_20_1249 396
503 3300044673 Ga0453683_0040236 Ga0453683_0040236_1604_2824 396
504 3300046471 Ga0495650_0000676 Ga0495650_0000676_1435_2718 396
505 3300046475 Ga0495639_0046491 Ga0495639_0046491_23_1270 396
506 3300046506 Ga0495583_0000299 Ga0495583_0000299_59724_61007 396
507 3300046511 Ga0495608_0044206 Ga0495608_0044206_93_1334 396
508 3300046543 Ga0495645_0132218 Ga0495645_0132218_41_1255 396
509 3300046559 Ga0495667_0001057 Ga0495667_0001057_8598_9839 396
510 3300047317 Ga0495604_0010316 Ga0495604_0010316_2151_3365 396
511 3300047319 Ga0495674_0002616 Ga0495674_0002616_7391_8605 396
512 3300047444 Ga0495675_0069864 Ga0495675_0069864_913_2127 396
513 3300048089 Ga0495614_0074444 Ga0495614_0074444_209_1450 396
514 3300048909 Ga0496106_0010736 Ga0496106_0010736_232_1488 396
515 3300050515 nmdc:mga0a205_279730_c1 nmdc:mga0a205_279730_c1_98_1306 396
516 3300059426 Ga0590077_015988 Ga0590077_015988_271_1509 396
517 3300005329 Ga0070683_100096128 Ga0070683_1000961282 397
518 3300005335 Ga0070666_10009756 Ga0070666_100097562 397
519 3300005338 Ga0068868_100078408 Ga0068868_1000784081 397
520 3300005458 Ga0070681_10167881 Ga0070681_101678812 397
521 3300005458 Ga0070681_10293997 Ga0070681_102939971 397
522 3300005459 Ga0068867_100033225 Ga0068867_1000332255 397
523 3300005471 Ga0070698_100112539 Ga0070698_1001125392 397
524 3300005535 Ga0070684_100087159 Ga0070684_1000871592 397
525 3300005539 Ga0068853_100316508 Ga0068853_1003165081 397
526 3300005564 Ga0070664_100114257 Ga0070664_1001142573 397
527 3300005577 Ga0068857_100011260 Ga0068857_10001126011 397
528 3300005577 Ga0068857_100020249 Ga0068857_1000202492 397
529 3300005617 Ga0068859_100050005 Ga0068859_1000500056 397
530 3300005842 Ga0068858_100012307 Ga0068858_1000123077 397
531 3300005843 Ga0068860_100005284 Ga0068860_1000052846 397
532 3300006237 Ga0097621_100019582 Ga0097621_1000195821 397
533 3300006358 Ga0068871_100021609 Ga0068871_1000216096 397
534 3300006881 Ga0068865_100007861 Ga0068865_1000078616 397
535 3300006931 Ga0097620_100050005 Ga0097620_1000500056 397
536 3300009093 Ga0105240_10107822 Ga0105240_101078223 397
537 3300009093 Ga0105240_10351098 Ga0105240_103510982 397
538 3300009098 Ga0105245_10006673 Ga0105245_100066739 397
539 3300009098 Ga0105245_10030171 Ga0105245_100301716 397
540 3300009147 Ga0114129_10003987 Ga0114129_1000398714 397
541 3300009176 Ga0105242_10010813 Ga0105242_100108132 397
542 3300009177 Ga0105248_10019616 Ga0105248_100196163 397
543 3300009545 Ga0105237_10032809 Ga0105237_100328095 397
544 3300011119 Ga0105246_10048239 Ga0105246_100482392 397
545 3300011119 Ga0105246_10066863 Ga0105246_100668632 397
546 3300013104 Ga0157370_10053730 Ga0157370_100537301 397
547 3300013104 Ga0157370_10085934 Ga0157370_100859342 397
548 3300013104 Ga0157370_10093827 Ga0157370_100938272 397
549 3300013105 Ga0157369_10017047 Ga0157369_100170475 397
550 3300013307 Ga0157372_10009372 Ga0157372_100093722 397
551 3300013307 Ga0157372_10019850 Ga0157372_100198504 397
552 3300013308 Ga0157375_10123923 Ga0157375_101239232 397
553 3300013308 Ga0157375_10131343 Ga0157375_101313432 397
554 3300014325 Ga0163163_10007552 Ga0163163_100075526 397
555 3300014325 Ga0163163_10013662 Ga0163163_100136629 397
556 3300014325 Ga0163163_10217636 Ga0163163_102176362 397
557 3300014969 Ga0157376_10007202 Ga0157376_100072025 397
558 3300014969 Ga0157376_10008230 Ga0157376_100082306 397
559 3300025909 Ga0207705_10005355 Ga0207705_100053557 397
560 3300025912 Ga0207707_10121601 Ga0207707_101216011 397
561 3300025913 Ga0207695_10094300 Ga0207695_100943002 397
562 3300025927 Ga0207687_10004281 Ga0207687_100042817 397
563 3300025927 Ga0207687_10067586 Ga0207687_100675862 397
564 3300025934 Ga0207686_10039760 Ga0207686_100397602 397
565 3300025941 Ga0207711_10062955 Ga0207711_100629554 397
566 3300025944 Ga0207661_10060854 Ga0207661_100608542 397
567 3300025945 Ga0207679_10091099 Ga0207679_100910992 397
568 3300025961 Ga0207712_10191482 Ga0207712_101914821 397
569 3300025986 Ga0207658_10013995 Ga0207658_100139952 397
570 3300026023 Ga0207677_10039048 Ga0207677_100390482 397
571 3300026089 Ga0207648_10014753 Ga0207648_100147539 397
572 3300026116 Ga0207674_10001855 Ga0207674_100018556 397
573 3300026116 Ga0207674_10015023 Ga0207674_100150234 397
574 3300028381 Ga0268264_10094012 Ga0268264_100940123 397
575 3300035172 Ga0373955_0116939 Ga0373955_0116939_155_1372 397
576 3300036401 Ga0373937_0026552 Ga0373937_0026552_2719_3936 397
577 3300036401 Ga0373937_0261449 Ga0373937_0261449_190_1407 397
578 3300037471 Ga0395905_0000210 Ga0395905_0000210_16407_17669 397
579 3300046474 Ga0495605_0037605 Ga0495605_0037605_204_1424 397
580 3300046499 Ga0495594_0006322 Ga0495594_0006322_2678_3898 397
581 3300046523 Ga0495644_0002451 Ga0495644_0002451_4953_6173 397
582 3300046538 Ga0495609_0025738 Ga0495609_0025738_1429_2649 397
583 3300046660 Ga0495625_0043740 Ga0495625_0043740_1476_2696 397
584 3300046689 Ga0495613_0072801 Ga0495613_0072801_559_1776 397
585 3300047471 Ga0495684_0110015 Ga0495684_0110015_654_1871 397
586 3300048929 Ga0496126_0000673 Ga0496126_0000673_45371_46591 397
587 3300050515 nmdc:mga0a205_66208_c1 nmdc:mga0a205_66208_c1_122_1348 397
588 iso_pu_bacteria 2524614729 2525557361 397
589 iso_pu_bacteria 2627854209 2630648952 397
590 3300005327 Ga0070658_10011065 Ga0070658_100110657 398
591 3300005435 Ga0070714_100009170 Ga0070714_1000091704 398
592 3300005436 Ga0070713_100044171 Ga0070713_1000441713 398
593 3300005617 Ga0068859_100145250 Ga0068859_1001452502 398
594 3300006028 Ga0070717_10000321 Ga0070717_100003212 398
595 3300006028 Ga0070717_10005934 Ga0070717_100059344 398
596 3300006844 Ga0075428_100002086 Ga0075428_1000020862 398
597 3300006931 Ga0097620_100145245 Ga0097620_1001452451 398
598 3300009094 Ga0111539_10002302 Ga0111539_1000230210 398
599 3300009177 Ga0105248_10164608 Ga0105248_101646083 398
600 3300009551 Ga0105238_10024868 Ga0105238_100248683 398
601 3300014325 Ga0163163_10029511 Ga0163163_100295112 398
602 3300025906 Ga0207699_10211205 Ga0207699_102112051 398
603 3300025909 Ga0207705_10009140 Ga0207705_100091402 398
604 3300025928 Ga0207700_10001406 Ga0207700_100014069 398
605 3300025928 Ga0207700_10037090 Ga0207700_100370902 398
606 3300025929 Ga0207664_10057434 Ga0207664_100574343 398
607 3300025931 Ga0207644_10122020 Ga0207644_101220202 398
608 3300027907 Ga0207428_10023017 Ga0207428_100230173 398
609 3300035086 Ga0373934_0066413 Ga0373934_0066413_40_1311 398
610 3300035117 Ga0373953_0023079 Ga0373953_0023079_599_1870 398
611 3300035118 Ga0373954_0043311 Ga0373954_0043311_418_1689 398
612 3300035119 Ga0373956_0023208 Ga0373956_0023208_609_1880 398
613 3300035120 Ga0373957_0003364 Ga0373957_0003364_2074_3345 398
614 3300035172 Ga0373955_0005652 Ga0373955_0005652_341_1612 398
615 3300035724 Ga0373933_0014785 Ga0373933_0014785_243_1514 398
616 3300036401 Ga0373937_0018644 Ga0373937_0018644_3814_5085 398
617 3300046454 Ga0495592_0092826 Ga0495592_0092826_785_2056 398
618 3300046463 Ga0495653_0079347 Ga0495653_0079347_296_1567 398
619 3300046516 Ga0495628_0008309 Ga0495628_0008309_7464_8735 398
620 3300046559 Ga0495667_0025372 Ga0495667_0025372_147_1418 398
621 3300046689 Ga0495613_0021287 Ga0495613_0021287_2129_3364 398
622 3300047322 Ga0495680_0093020 Ga0495680_0093020_623_1894 398
623 3300047322 Ga0495680_0147754 Ga0495680_0147754_197_1432 398
624 3300047444 Ga0495675_0007727 Ga0495675_0007727_5207_6478 398
625 3300047471 Ga0495684_0042260 Ga0495684_0042260_2196_3431 398
626 3300048912 Ga0496109_0036474 Ga0496109_0036474_1706_2950 398
627 3300050511 nmdc:mga08y16_272238_c1 nmdc:mga08y16_272238_c1_366_1607 398
628 3300053084 Ga0495595_0071307 Ga0495595_0071307_244_1515 398
629 3300006914 Ga0075436_100000012 Ga0075436_10000001212 399
630 3300025910 Ga0207684_10073826 Ga0207684_100738262 399
631 3300035695 Ga0373927_0010820 Ga0373927_0010820_3171_4406 399
632 3300050514 nmdc:mga08x19_5_c1 nmdc:mga08x19_5_c1_253397_254659 399
633 3300005327 Ga0070658_10024028 Ga0070658_100240282 400
634 3300005338 Ga0068868_100033823 Ga0068868_1000338232 400
635 3300005458 Ga0070681_10014025 Ga0070681_100140257 400
636 3300005530 Ga0070679_100078346 Ga0070679_1000783463 400
637 3300005535 Ga0070684_100169355 Ga0070684_1001693552 400
638 3300005563 Ga0068855_100012835 Ga0068855_1000128352 400
639 3300005563 Ga0068855_100087128 Ga0068855_1000871282 400
640 3300005577 Ga0068857_100015313 Ga0068857_1000153133 400
641 3300005614 Ga0068856_100066501 Ga0068856_1000665012 400
642 3300005614 Ga0068856_100072707 Ga0068856_1000727071 400
643 3300005616 Ga0068852_100424576 Ga0068852_1004245761 400
644 3300005617 Ga0068859_100024147 Ga0068859_1000241472 400
645 3300005618 Ga0068864_100032987 Ga0068864_1000329874 400
646 3300006237 Ga0097621_100057343 Ga0097621_1000573432 400
647 3300006358 Ga0068871_100019446 Ga0068871_1000194462 400
648 3300006931 Ga0097620_100024147 Ga0097620_1000241472 400
649 3300007076 Ga0075435_100002765 Ga0075435_1000027654 400
650 3300009093 Ga0105240_10164803 Ga0105240_101648032 400
651 3300009098 Ga0105245_10007102 Ga0105245_100071024 400
652 3300009148 Ga0105243_10020833 Ga0105243_100208332 400
653 3300009174 Ga0105241_10041819 Ga0105241_100418192 400
654 3300009551 Ga0105238_10009957 Ga0105238_100099574 400
655 3300013104 Ga0157370_10044893 Ga0157370_100448932 400
656 3300013297 Ga0157378_10084796 Ga0157378_100847962 400
657 3300013297 Ga0157378_10086916 Ga0157378_100869162 400
658 3300014325 Ga0163163_10011350 Ga0163163_100113504 400
659 3300025909 Ga0207705_10019250 Ga0207705_100192502 400
660 3300025912 Ga0207707_10133354 Ga0207707_101333541 400
661 3300025913 Ga0207695_10002938 Ga0207695_1000293822 400
662 3300025919 Ga0207657_10001884 Ga0207657_100018847 400
663 3300025924 Ga0207694_10026910 Ga0207694_100269102 400
664 3300025927 Ga0207687_10080147 Ga0207687_100801472 400
665 3300025931 Ga0207644_10053450 Ga0207644_100534502 400
666 3300025949 Ga0207667_10002700 Ga0207667_100027001 400
667 3300025949 Ga0207667_10242632 Ga0207667_102426321 400
668 3300026116 Ga0207674_10001175 Ga0207674_1000117514 400
669 3300036401 Ga0373937_0095648 Ga0373937_0095648_934_2163 400
670 3300046463 Ga0495653_0071161 Ga0495653_0071161_345_1574 400
671 3300046477 Ga0495664_0013457 Ga0495664_0013457_1521_2747 400
672 3300046529 Ga0495652_0042630 Ga0495652_0042630_566_1795 400
673 3300046535 Ga0495586_0037366 Ga0495586_0037366_1195_2424 400
674 3300046536 Ga0495587_0077866 Ga0495587_0077866_677_1903 400
675 3300046559 Ga0495667_0162589 Ga0495667_0162589_99_1325 400
676 3300046678 Ga0495599_0004167 Ga0495599_0004167_4508_5737 400
677 3300046689 Ga0495613_0036339 Ga0495613_0036339_1025_2254 400
678 3300047317 Ga0495604_0048338 Ga0495604_0048338_1152_2381 400
679 3300047319 Ga0495674_0069880 Ga0495674_0069880_1455_2681 400
680 3300047322 Ga0495680_0030027 Ga0495680_0030027_1423_2652 400
681 3300047444 Ga0495675_0056440 Ga0495675_0056440_232_1458 400
682 3300047444 Ga0495675_0080466 Ga0495675_0080466_748_1977 400
683 3300047444 Ga0495675_0180081 Ga0495675_0180081_55_1281 400
684 3300048088 Ga0495602_0082110 Ga0495602_0082110_890_2119 400
685 3300048929 Ga0496126_0119191 Ga0496126_0119191_788_2020 400
686 3300050513 nmdc:mga0rr50_1933_c1 nmdc:mga0rr50_1933_c1_4322_5569 400
687 3300005327 Ga0070658_10002620 Ga0070658_1000262011 401
688 3300005339 Ga0070660_100075344 Ga0070660_1000753442 401
689 3300005434 Ga0070709_10000885 Ga0070709_1000088514 401
690 3300005436 Ga0070713_100000496 Ga0070713_1000004965 401
691 3300005439 Ga0070711_100022686 Ga0070711_1000226866 401
692 3300005614 Ga0068856_100026096 Ga0068856_1000260965 401
693 3300006038 Ga0075365_10075500 Ga0075365_100755002 401
694 3300006175 Ga0070712_100011061 Ga0070712_1000110612 401
695 3300006846 Ga0075430_100027895 Ga0075430_1000278952 401
696 3300006914 Ga0075436_100008535 Ga0075436_1000085352 401
697 3300009545 Ga0105237_10007121 Ga0105237_100071215 401
698 3300009551 Ga0105238_10329665 Ga0105238_103296652 401
699 3300010375 Ga0105239_10023935 Ga0105239_100239354 401
700 3300010375 Ga0105239_10147941 Ga0105239_101479413 401
701 3300013100 Ga0157373_10029804 Ga0157373_100298042 401
702 3300013105 Ga0157369_10063726 Ga0157369_100637263 401
703 3300013296 Ga0157374_10011658 Ga0157374_100116586 401
704 3300025893 Ga0207682_10016692 Ga0207682_100166923 401
705 3300025906 Ga0207699_10003597 Ga0207699_100035973 401
706 3300025909 Ga0207705_10002212 Ga0207705_100022124 401
707 3300025915 Ga0207693_10010352 Ga0207693_100103523 401
708 3300025916 Ga0207663_10016680 Ga0207663_100166801 401
709 3300025919 Ga0207657_10100104 Ga0207657_101001042 401
710 3300025928 Ga0207700_10016698 Ga0207700_100166985 401
711 3300025939 Ga0207665_10010307 Ga0207665_100103076 401
712 3300025944 Ga0207661_10134913 Ga0207661_101349132 401
713 3300026078 Ga0207702_10094357 Ga0207702_100943572 401
714 3300036401 Ga0373937_0020910 Ga0373937_0020910_3630_4874 401
715 3300036401 Ga0373937_0213072 Ga0373937_0213072_46_1281 401
716 3300037853 Ga0436364_0773449 Ga0436364_0773449_76_1314 401
717 3300037853 Ga0436364_1241863 Ga0436364_1241863_1871_3115 401
718 3300039450 Ga0436363_0035913 Ga0436363_0035913_214_1452 401
719 3300042876 Ga0451577_0315729 Ga0451577_0315729_151_1407 401
720 3300045976 Ga0466967_0021812 Ga0466967_0021812_462_1697 401
721 3300045976 Ga0466967_0042347 Ga0466967_0042347_2586_3818 401
722 3300046454 Ga0495592_0038634 Ga0495592_0038634_2179_3414 401
723 3300046462 Ga0495651_0067268 Ga0495651_0067268_557_1792 401
724 3300046477 Ga0495664_0001745 Ga0495664_0001745_9336_10571 401
725 3300046516 Ga0495628_0101564 Ga0495628_0101564_598_1833 401
726 3300046517 Ga0495630_0025111 Ga0495630_0025111_503_1738 401
727 3300046543 Ga0495645_0001229 Ga0495645_0001229_16184_17419 401
728 3300046678 Ga0495599_0062909 Ga0495599_0062909_502_1737 401
729 3300046680 Ga0495646_0123258 Ga0495646_0123258_43_1278 401
730 3300047317 Ga0495604_0046043 Ga0495604_0046043_1678_2913 401
731 3300048088 Ga0495602_0053771 Ga0495602_0053771_2284_3519 401
732 3300050509 nmdc:mga0qj67_27113_c1 nmdc:mga0qj67_27113_c1_2871_4115 401
733 3300005329 Ga0070683_100000103 Ga0070683_10000010325 402
734 3300005329 Ga0070683_100088584 Ga0070683_1000885842 402
735 3300005331 Ga0070670_100000283 Ga0070670_10000028338 402
736 3300005458 Ga0070681_10012592 Ga0070681_100125922 402
737 3300005530 Ga0070679_100124827 Ga0070679_1001248272 402
738 3300005617 Ga0068859_100003061 Ga0068859_1000030616 402
739 3300006178 Ga0075367_10022410 Ga0075367_100224102 402
740 3300006844 Ga0075428_100029279 Ga0075428_1000292792 402
741 3300006844 Ga0075428_100087618 Ga0075428_1000876182 402
742 3300006931 Ga0097620_100003061 Ga0097620_10000306116 402
743 3300025925 Ga0207650_10000166 Ga0207650_1000016677 402
744 3300046473 Ga0495582_0004948 Ga0495582_0004948_671_1912 402
745 3300046531 Ga0495665_0088991 Ga0495665_0088991_37_1278 402
746 3300046536 Ga0495587_0094489 Ga0495587_0094489_173_1411 402
747 3300046663 Ga0495635_0038890 Ga0495635_0038890_1729_2967 402
748 3300049569 Ga0501032_0083000 Ga0501032_0083000_859_2091 402
749 3300050494 nmdc:mga06z11_13036_c1 nmdc:mga06z11_13036_c1_2224_3456 402
750 3300005295 Ga0065707_10097496 Ga0065707_100974961 403
751 3300005329 Ga0070683_100018047 Ga0070683_1000180473 403
752 3300005329 Ga0070683_100024947 Ga0070683_1000249472 403
753 3300005329 Ga0070683_100036529 Ga0070683_1000365292 403
754 3300005331 Ga0070670_100001217 Ga0070670_10000121715 403
755 3300005331 Ga0070670_100036041 Ga0070670_1000360414 403
756 3300005334 Ga0068869_100036265 Ga0068869_1000362652 403
757 3300005335 Ga0070666_10104842 Ga0070666_101048422 403
758 3300005335 Ga0070666_10169627 Ga0070666_101696272 403
759 3300005338 Ga0068868_100031650 Ga0068868_1000316503 403
760 3300005338 Ga0068868_100142119 Ga0068868_1001421192 403
761 3300005339 Ga0070660_100009324 Ga0070660_1000093241 403
762 3300005340 Ga0070689_100075796 Ga0070689_1000757962 403
763 3300005343 Ga0070687_100023796 Ga0070687_1000237962 403
764 3300005344 Ga0070661_100096196 Ga0070661_1000961962 403
765 3300005345 Ga0070692_10072056 Ga0070692_100720562 403
766 3300005347 Ga0070668_100021454 Ga0070668_1000214542 403
767 3300005353 Ga0070669_100004260 Ga0070669_1000042606 403
768 3300005353 Ga0070669_100066385 Ga0070669_1000663852 403
769 3300005354 Ga0070675_100155466 Ga0070675_1001554662 403
770 3300005355 Ga0070671_100078846 Ga0070671_1000788462 403
771 3300005365 Ga0070688_100077491 Ga0070688_1000774912 403
772 3300005366 Ga0070659_100088224 Ga0070659_1000882242 403
773 3300005367 Ga0070667_100016885 Ga0070667_1000168855 403
774 3300005434 Ga0070709_10134789 Ga0070709_101347891 403
775 3300005435 Ga0070714_100008040 Ga0070714_1000080402 403
776 3300005435 Ga0070714_100065269 Ga0070714_1000652691 403
777 3300005444 Ga0070694_100124556 Ga0070694_1001245561 403
778 3300005445 Ga0070708_100001856 Ga0070708_10000185610 403
779 3300005445 Ga0070708_100017262 Ga0070708_1000172623 403
780 3300005457 Ga0070662_100018852 Ga0070662_1000188522 403
781 3300005458 Ga0070681_10000703 Ga0070681_100007035 403
782 3300005467 Ga0070706_100001124 Ga0070706_10000112414 403
783 3300005468 Ga0070707_100001430 Ga0070707_1000014302 403
784 3300005518 Ga0070699_100005861 Ga0070699_1000058616 403
785 3300005535 Ga0070684_100008670 Ga0070684_1000086702 403
786 3300005535 Ga0070684_100072968 Ga0070684_1000729682 403
787 3300005535 Ga0070684_100232289 Ga0070684_1002322892 403
788 3300005536 Ga0070697_100003003 Ga0070697_1000030038 403
789 3300005539 Ga0068853_100054808 Ga0068853_1000548081 403
790 3300005543 Ga0070672_100009058 Ga0070672_1000090583 403
791 3300005548 Ga0070665_100412747 Ga0070665_1004127471 403
792 3300005549 Ga0070704_100239569 Ga0070704_1002395691 403
793 3300005564 Ga0070664_100004607 Ga0070664_1000046077 403
794 3300005564 Ga0070664_100005179 Ga0070664_1000051798 403
795 3300005577 Ga0068857_100000874 Ga0068857_1000008749 403
796 3300005577 Ga0068857_100008545 Ga0068857_1000085453 403
797 3300005577 Ga0068857_100070274 Ga0068857_1000702742 403
798 3300005616 Ga0068852_100117250 Ga0068852_1001172501 403
799 3300005616 Ga0068852_100156356 Ga0068852_1001563562 403
800 3300005618 Ga0068864_100026483 Ga0068864_1000264832 403
801 3300005719 Ga0068861_100003603 Ga0068861_1000036036 403
802 3300005840 Ga0068870_10001642 Ga0068870_100016424 403
803 3300005841 Ga0068863_100054312 Ga0068863_1000543122 403
804 3300005841 Ga0068863_100072423 Ga0068863_1000724232 403
805 3300005841 Ga0068863_100311620 Ga0068863_1003116201 403
806 3300005843 Ga0068860_100016080 Ga0068860_1000160802 403
807 3300005844 Ga0068862_100009649 Ga0068862_1000096492 403
808 3300006028 Ga0070717_10073285 Ga0070717_100732854 403
809 3300006175 Ga0070712_100058102 Ga0070712_1000581022 403
810 3300006844 Ga0075428_100013549 Ga0075428_1000135494 403
811 3300006844 Ga0075428_100073559 Ga0075428_1000735592 403
812 3300006847 Ga0075431_100027715 Ga0075431_1000277152 403
813 3300006847 Ga0075431_100234064 Ga0075431_1002340641 403
814 3300006871 Ga0075434_100027873 Ga0075434_1000278732 403
815 3300006871 Ga0075434_100040878 Ga0075434_1000408782 403
816 3300007076 Ga0075435_100196560 Ga0075435_1001965601 403
817 3300007265 Ga0099794_10000014 Ga0099794_1000001443 403
818 3300009094 Ga0111539_10020790 Ga0111539_100207904 403
819 3300009094 Ga0111539_10052075 Ga0111539_100520754 403
820 3300009094 Ga0111539_10140648 Ga0111539_101406482 403
821 3300009098 Ga0105245_10090414 Ga0105245_100904141 403
822 3300009098 Ga0105245_10129616 Ga0105245_101296162 403
823 3300009147 Ga0114129_10053472 Ga0114129_100534723 403
824 3300009147 Ga0114129_10067956 Ga0114129_100679561 403
825 3300009147 Ga0114129_10478444 Ga0114129_104784441 403
826 3300009148 Ga0105243_10034360 Ga0105243_100343602 403
827 3300009177 Ga0105248_10010068 Ga0105248_100100689 403
828 3300009177 Ga0105248_10023548 Ga0105248_100235486 403
829 3300009177 Ga0105248_10199822 Ga0105248_101998222 403
830 3300009545 Ga0105237_10156143 Ga0105237_101561432 403
831 3300009553 Ga0105249_10000075 Ga0105249_10000075102 403
832 3300009553 Ga0105249_10034138 Ga0105249_100341382 403
833 3300010375 Ga0105239_10056610 Ga0105239_100566103 403
834 3300013102 Ga0157371_10004090 Ga0157371_100040903 403
835 3300013296 Ga0157374_10056881 Ga0157374_100568812 403
836 3300013297 Ga0157378_10100285 Ga0157378_101002852 403
837 3300013306 Ga0163162_10003659 Ga0163162_100036598 403
838 3300013306 Ga0163162_10022021 Ga0163162_100220213 403
839 3300013307 Ga0157372_10255797 Ga0157372_102557972 403
840 3300013308 Ga0157375_10080765 Ga0157375_100807652 403
841 3300013308 Ga0157375_10098741 Ga0157375_100987412 403
842 3300014326 Ga0157380_10008545 Ga0157380_100085453 403
843 3300014326 Ga0157380_10121555 Ga0157380_101215552 403
844 3300014745 Ga0157377_10078073 Ga0157377_100780732 403
845 3300014968 Ga0157379_10147437 Ga0157379_101474372 403
846 3300017792 Ga0163161_10084471 Ga0163161_100844712 403
847 3300020078 Ga0206352_10516205 Ga0206352_105162052 403
848 3300025315 Ga0207697_10029305 Ga0207697_100293052 403
849 3300025903 Ga0207680_10089527 Ga0207680_100895272 403
850 3300025904 Ga0207647_10055167 Ga0207647_100551671 403
851 3300025907 Ga0207645_10001334 Ga0207645_100013347 403
852 3300025908 Ga0207643_10004154 Ga0207643_100041541 403
853 3300025909 Ga0207705_10002267 Ga0207705_100022677 403
854 3300025910 Ga0207684_10000068 Ga0207684_1000006842 403
855 3300025910 Ga0207684_10013312 Ga0207684_100133122 403
856 3300025912 Ga0207707_10006423 Ga0207707_100064236 403
857 3300025913 Ga0207695_10012969 Ga0207695_100129696 403
858 3300025918 Ga0207662_10024587 Ga0207662_100245871 403
859 3300025919 Ga0207657_10053908 Ga0207657_100539082 403
860 3300025923 Ga0207681_10004636 Ga0207681_100046363 403
861 3300025923 Ga0207681_10054627 Ga0207681_100546272 403
862 3300025925 Ga0207650_10001328 Ga0207650_1000132810 403
863 3300025925 Ga0207650_10014914 Ga0207650_100149143 403
864 3300025927 Ga0207687_10031440 Ga0207687_100314402 403
865 3300025928 Ga0207700_10000907 Ga0207700_100009073 403
866 3300025929 Ga0207664_10029522 Ga0207664_100295222 403
867 3300025931 Ga0207644_10201302 Ga0207644_102013021 403
868 3300025933 Ga0207706_10001101 Ga0207706_1000110121 403
869 3300025933 Ga0207706_10023544 Ga0207706_100235442 403
870 3300025940 Ga0207691_10001262 Ga0207691_1000126212 403
871 3300025940 Ga0207691_10002830 Ga0207691_100028304 403
872 3300025940 Ga0207691_10148951 Ga0207691_101489511 403
873 3300025941 Ga0207711_10062796 Ga0207711_100627962 403
874 3300025941 Ga0207711_10134828 Ga0207711_101348282 403
875 3300025942 Ga0207689_10089416 Ga0207689_100894161 403
876 3300025944 Ga0207661_10045431 Ga0207661_100454312 403
877 3300025944 Ga0207661_10254832 Ga0207661_102548321 403
878 3300025945 Ga0207679_10007360 Ga0207679_100073604 403
879 3300025949 Ga0207667_10091344 Ga0207667_100913441 403
880 3300025961 Ga0207712_10052101 Ga0207712_100521012 403
881 3300025972 Ga0207668_10031672 Ga0207668_100316722 403
882 3300025972 Ga0207668_10047992 Ga0207668_100479922 403
883 3300025972 Ga0207668_10055705 Ga0207668_100557051 403
884 3300025986 Ga0207658_10054427 Ga0207658_100544272 403
885 3300026023 Ga0207677_10020067 Ga0207677_100200673 403
886 3300026041 Ga0207639_10029501 Ga0207639_100295012 403
887 3300026088 Ga0207641_10017239 Ga0207641_100172393 403
888 3300026089 Ga0207648_10080918 Ga0207648_100809181 403
889 3300026089 Ga0207648_10082359 Ga0207648_100823593 403
890 3300026116 Ga0207674_10003815 Ga0207674_1000381511 403
891 3300026116 Ga0207674_10013763 Ga0207674_100137634 403
892 3300026116 Ga0207674_10024450 Ga0207674_100244506 403
893 3300026118 Ga0207675_100000677 Ga0207675_1000006777 403
894 3300026118 Ga0207675_100005466 Ga0207675_1000054666 403
895 3300026121 Ga0207683_10141309 Ga0207683_101413092 403
896 3300026142 Ga0207698_10072804 Ga0207698_100728042 403
897 3300027671 Ga0209588_1000001 Ga0209588_1000001460 403
898 3300027907 Ga0207428_10064208 Ga0207428_100642082 403
899 3300027907 Ga0207428_10074523 Ga0207428_100745232 403
900 3300028380 Ga0268265_10001615 Ga0268265_100016151 403
901 3300028380 Ga0268265_10107753 Ga0268265_101077532 403
902 3300028381 Ga0268264_10110161 Ga0268264_101101612 403
903 3300031548 Ga0307408_100055597 Ga0307408_1000555972 403
904 3300031901 Ga0307406_10005334 Ga0307406_100053343 403
905 3300032002 Ga0307416_100265881 Ga0307416_1002658812 403
906 3300037068 Ga0373925_0043556 Ga0373925_0043556_106_1371 403
907 3300037853 Ga0436364_1022479 Ga0436364_1022479_66_1301 403
908 3300039450 Ga0436363_1199725 Ga0436363_1199725_4774_6009 403
909 3300042876 Ga0451577_0028624 Ga0451577_0028624_3772_5004 403
910 3300042876 Ga0451577_0056925 Ga0451577_0056925_2055_3305 403
911 3300044673 Ga0453683_0109745 Ga0453683_0109745_137_1369 403
912 3300044712 Ga0453684_0025158 Ga0453684_0025158_5298_6548 403
913 3300044712 Ga0453684_0225287 Ga0453684_0225287_105_1355 403
914 3300044719 Ga0466971_0093319 Ga0466971_0093319_118_1353 403
915 3300045051 Ga0451576_0273914 Ga0451576_0273914_252_1484 403
916 3300045836 Ga0466958_0070085 Ga0466958_0070085_350_1585 403
917 3300046472 Ga0495580_0050567 Ga0495580_0050567_249_1493 403
918 3300046663 Ga0495635_0089680 Ga0495635_0089680_237_1472 403
919 3300046675 Ga0495657_0076675 Ga0495657_0076675_485_1720 403
920 3300046683 Ga0495658_0103487 Ga0495658_0103487_384_1628 403
921 3300046689 Ga0495613_0143650 Ga0495613_0143650_327_1562 403
922 3300048088 Ga0495602_0195142 Ga0495602_0195142_167_1402 403
923 3300048905 Ga0496102_0236417 Ga0496102_0236417_471_1706 403
924 3300049569 Ga0501032_0011884 Ga0501032_0011884_3112_4347 403
925 3300049571 Ga0501034_0003709 Ga0501034_0003709_6220_7455 403
926 3300049571 Ga0501034_0021007 Ga0501034_0021007_5249_6484 403
927 3300049572 Ga0501036_0064694 Ga0501036_0064694_88_1323 403
928 3300049572 Ga0501036_0090331 Ga0501036_0090331_154_1389 403
929 3300049574 Ga0501038_0014130 Ga0501038_0014130_5966_7201 403
930 3300049575 Ga0501039_0183209 Ga0501039_0183209_201_1436 403
931 3300049575 Ga0501039_0189296 Ga0501039_0189296_197_1432 403
932 3300049576 Ga0501040_0023222 Ga0501040_0023222_2875_4110 403
933 3300049578 Ga0501042_0090692 Ga0501042_0090692_496_1731 403
934 3300049578 Ga0501042_0112110 Ga0501042_0112110_169_1404 403
935 3300049579 Ga0501043_0000810 Ga0501043_0000810_15797_17032 403
936 3300049579 Ga0501043_0021831 Ga0501043_0021831_1050_2285 403
937 3300049580 Ga0501046_0014576 Ga0501046_0014576_2302_3537 403
938 3300049580 Ga0501046_0055292 Ga0501046_0055292_1634_2869 403
939 3300049581 Ga0501047_0008562 Ga0501047_0008562_5167_6402 403
940 3300049581 Ga0501047_0013452 Ga0501047_0013452_2518_3753 403
941 3300049581 Ga0501047_0073930 Ga0501047_0073930_1911_3146 403
942 3300049582 Ga0501048_0094118 Ga0501048_0094118_294_1529 403
943 3300049583 Ga0501067_0100538 Ga0501067_0100538_193_1428 403
944 3300049585 Ga0501069_0059825 Ga0501069_0059825_565_1800 403
945 3300049589 Ga0501073_0009275 Ga0501073_0009275_3252_4487 403
946 3300049591 Ga0501075_0030221 Ga0501075_0030221_94_1329 403
947 3300049742 Ga0501080_0021798 Ga0501080_0021798_184_1419 403
948 3300049743 Ga0501081_0003292 Ga0501081_0003292_7783_9018 403
949 3300049744 Ga0501083_0001501 Ga0501083_0001501_12357_13592 403
950 3300049744 Ga0501083_0044174 Ga0501083_0044174_1653_2888 403
951 3300049823 Ga0501044_0113532 Ga0501044_0113532_1409_2644 403
952 3300049824 Ga0501045_0036679 Ga0501045_0036679_1548_2783 403
953 3300050507 nmdc:mga05p37_38593_c1 nmdc:mga05p37_38593_c1_3786_5054 403
954 3300050507 nmdc:mga05p37_49691_c1 nmdc:mga05p37_49691_c1_1462_2730 403
955 3300050507 nmdc:mga05p37_72082_c1 nmdc:mga05p37_72082_c1_2124_3392 403
956 3300050508 nmdc:mga09592_61231_c1 nmdc:mga09592_61231_c1_789_2057 403
957 3300050511 nmdc:mga08y16_35601_c1 nmdc:mga08y16_35601_c1_2328_3596 403
958 3300050511 nmdc:mga08y16_49126_c1 nmdc:mga08y16_49126_c1_423_1691 403
959 3300050512 nmdc:mga0n895_1265_c1 nmdc:mga0n895_1265_c1_1368_2636 403
960 3300050512 nmdc:mga0n895_53025_c1 nmdc:mga0n895_53025_c1_151_1419 403
961 3300050513 nmdc:mga0rr50_180156_c1 nmdc:mga0rr50_180156_c1_100_1368 403
962 3300050515 nmdc:mga0a205_63316_c1 nmdc:mga0a205_63316_c1_104_1372 403
963 3300053078 Ga0495612_0020115 Ga0495612_0020115_1073_2308 403
964 3300053084 Ga0495595_0004461 Ga0495595_0004461_1267_2502 403
965 3300053085 Ga0495619_0052523 Ga0495619_0052523_737_1972 403
966 3300054114 Ga0501084_0152131 Ga0501084_0152131_181_1416 403
967 3300060353 Ga0501082_0012463 Ga0501082_0012463_828_2063 403
968 3300005327 Ga0070658_10003932 Ga0070658_100039321 404
969 3300005327 Ga0070658_10006257 Ga0070658_100062573 404
970 3300005327 Ga0070658_10023069 Ga0070658_100230692 404
971 3300005327 Ga0070658_10026139 Ga0070658_100261393 404
972 3300005327 Ga0070658_10083072 Ga0070658_100830722 404
973 3300005327 Ga0070658_10175764 Ga0070658_101757642 404
974 3300005336 Ga0070680_100067553 Ga0070680_1000675532 404
975 3300005339 Ga0070660_100026529 Ga0070660_1000265292 404
976 3300005339 Ga0070660_100030828 Ga0070660_1000308283 404
977 3300005339 Ga0070660_100107399 Ga0070660_1001073991 404
978 3300005339 Ga0070660_100123693 Ga0070660_1001236931 404
979 3300005344 Ga0070661_100013020 Ga0070661_1000130203 404
980 3300005344 Ga0070661_100032546 Ga0070661_1000325462 404
981 3300005366 Ga0070659_100065536 Ga0070659_1000655363 404
982 3300005366 Ga0070659_100102636 Ga0070659_1001026362 404
983 3300005435 Ga0070714_100009429 Ga0070714_1000094293 404
984 3300005440 Ga0070705_100005865 Ga0070705_1000058652 404
985 3300005444 Ga0070694_100055145 Ga0070694_1000551452 404
986 3300005455 Ga0070663_100041478 Ga0070663_1000414782 404
987 3300005455 Ga0070663_100089266 Ga0070663_1000892662 404
988 3300005458 Ga0070681_10280816 Ga0070681_102808161 404
989 3300005459 Ga0068867_100148504 Ga0068867_1001485042 404
990 3300005471 Ga0070698_100004526 Ga0070698_1000045269 404
991 3300005539 Ga0068853_100000064 Ga0068853_1000000647 404
992 3300005539 Ga0068853_100032135 Ga0068853_1000321352 404
993 3300005548 Ga0070665_100026440 Ga0070665_1000264403 404
994 3300005563 Ga0068855_100001820 Ga0068855_1000018209 404
995 3300005563 Ga0068855_100029054 Ga0068855_1000290547 404
996 3300005563 Ga0068855_100100502 Ga0068855_1001005023 404
997 3300005563 Ga0068855_100144187 Ga0068855_1001441872 404
998 3300005563 Ga0068855_100315992 Ga0068855_1003159921 404
999 3300005564 Ga0070664_100091850 Ga0070664_1000918501 404
1000 3300005578 Ga0068854_100053516 Ga0068854_1000535163 404
1001 3300005578 Ga0068854_100065091 Ga0068854_1000650912 404
1002 3300005578 Ga0068854_100243833 Ga0068854_1002438332 404
1003 3300005614 Ga0068856_100074713 Ga0068856_1000747132 404
1004 3300005614 Ga0068856_100090996 Ga0068856_1000909962 404
1005 3300005616 Ga0068852_100015765 Ga0068852_1000157652 404
1006 3300005616 Ga0068852_100140705 Ga0068852_1001407052 404
1007 3300005841 Ga0068863_100073393 Ga0068863_1000733932 404
1008 3300006042 Ga0075368_10003224 Ga0075368_100032243 404
1009 3300006051 Ga0075364_10093980 Ga0075364_100939802 404
1010 3300006178 Ga0075367_10013141 Ga0075367_100131413 404
1011 3300006195 Ga0075366_10023898 Ga0075366_100238982 404
1012 3300006195 Ga0075366_10077741 Ga0075366_100777412 404
1013 3300006353 Ga0075370_10038647 Ga0075370_100386472 404
1014 3300006871 Ga0075434_100017967 Ga0075434_1000179676 404
1015 3300007076 Ga0075435_100230798 Ga0075435_1002307982 404
1016 3300009093 Ga0105240_10000060 Ga0105240_1000006094 404
1017 3300009093 Ga0105240_10000311 Ga0105240_1000031116 404
1018 3300009174 Ga0105241_10058008 Ga0105241_100580081 404
1019 3300009551 Ga0105238_10076972 Ga0105238_100769722 404
1020 3300009553 Ga0105249_10000101 Ga0105249_1000010153 404
1021 3300013105 Ga0157369_10094736 Ga0157369_100947362 404
1022 3300013105 Ga0157369_10109997 Ga0157369_101099972 404
1023 3300013297 Ga0157378_10214979 Ga0157378_102149792 404
1024 3300013307 Ga0157372_10012040 Ga0157372_100120403 404
1025 3300020082 Ga0206353_11181275 Ga0206353_111812752 404
1026 3300025909 Ga0207705_10019823 Ga0207705_100198232 404
1027 3300025909 Ga0207705_10052901 Ga0207705_100529013 404
1028 3300025909 Ga0207705_10058430 Ga0207705_100584301 404
1029 3300025909 Ga0207705_10061375 Ga0207705_100613753 404
1030 3300025913 Ga0207695_10000025 Ga0207695_10000025106 404
1031 3300025913 Ga0207695_10000600 Ga0207695_1000060026 404
1032 3300025913 Ga0207695_10067806 Ga0207695_100678062 404
1033 3300025919 Ga0207657_10007452 Ga0207657_100074528 404
1034 3300025919 Ga0207657_10012309 Ga0207657_100123092 404
1035 3300025919 Ga0207657_10028424 Ga0207657_100284243 404
1036 3300025919 Ga0207657_10038492 Ga0207657_100384923 404
1037 3300025919 Ga0207657_10047937 Ga0207657_100479372 404
1038 3300025919 Ga0207657_10055975 Ga0207657_100559752 404
1039 3300025920 Ga0207649_10013726 Ga0207649_100137263 404
1040 3300025921 Ga0207652_10094256 Ga0207652_100942562 404
1041 3300025924 Ga0207694_10005099 Ga0207694_100050992 404
1042 3300025924 Ga0207694_10016362 Ga0207694_100163622 404
1043 3300025932 Ga0207690_10008671 Ga0207690_100086712 404
1044 3300025932 Ga0207690_10234274 Ga0207690_102342741 404
1045 3300025944 Ga0207661_10015129 Ga0207661_100151293 404
1046 3300025949 Ga0207667_10007644 Ga0207667_100076449 404
1047 3300025949 Ga0207667_10008240 Ga0207667_100082407 404
1048 3300025949 Ga0207667_10059358 Ga0207667_100593582 404
1049 3300025949 Ga0207667_10079117 Ga0207667_100791171 404
1050 3300025961 Ga0207712_10000063 Ga0207712_1000006386 404
1051 3300025981 Ga0207640_10011839 Ga0207640_100118392 404
1052 3300025981 Ga0207640_10012365 Ga0207640_100123653 404
1053 3300026041 Ga0207639_10000384 Ga0207639_100003848 404
1054 3300026067 Ga0207678_10000331 Ga0207678_1000033124 404
1055 3300026067 Ga0207678_10001778 Ga0207678_100017788 404
1056 3300026078 Ga0207702_10056255 Ga0207702_100562552 404
1057 3300026142 Ga0207698_10010020 Ga0207698_100100203 404
1058 3300026142 Ga0207698_10212116 Ga0207698_102121162 404
1059 3300028379 Ga0268266_10038514 Ga0268266_100385142 404
1060 3300028380 Ga0268265_10036885 Ga0268265_100368853 404
1061 3300031249 Ga0265339_10000003 Ga0265339_1000000346 404
1062 3300031344 Ga0265316_10090970 Ga0265316_100909702 404
1063 3300031712 Ga0265342_10003777 Ga0265342_100037773 404
1064 3300033180 Ga0307510_10059851 Ga0307510_100598512 404
1065 3300034957 Ga0373938_0020717 Ga0373938_0020717_55_1284 404
1066 3300044684 Ga0466966_0035368 Ga0466966_0035368_457_1707 404
1067 3300044684 Ga0466966_0038261 Ga0466966_0038261_1000_2361 404
1068 3300044693 Ga0466961_0082208 Ga0466961_0082208_202_1452 404
1069 3300044694 Ga0466963_0046958 Ga0466963_0046958_1347_2735 404
1070 3300045049 Ga0466959_0069458 Ga0466959_0069458_484_1734 404
1071 3300045049 Ga0466959_0105024 Ga0466959_0105024_158_1402 404
1072 3300046472 Ga0495580_0003139 Ga0495580_0003139_12389_13618 404
1073 3300046664 Ga0495659_0048036 Ga0495659_0048036_236_1465 404
1074 3300049742 Ga0501080_0035813 Ga0501080_0035813_1320_2564 404
1075 3300050512 nmdc:mga0n895_37496_c1 nmdc:mga0n895_37496_c1_309_1538 404
1076 3300050513 nmdc:mga0rr50_1289_c1 nmdc:mga0rr50_1289_c1_11331_12563 404
1077 3300050513 nmdc:mga0rr50_34882_c1 nmdc:mga0rr50_34882_c1_1438_2667 404
1078 3300050515 nmdc:mga0a205_41819_c1 nmdc:mga0a205_41819_c1_2084_3313 404
1079 3300053119 Ga0500595_000037 Ga0500595_000037_71092_72351 404
1080 3300003203 JGI25406J46586_10019830 JGI25406J46586_100198303 405
1081 3300005366 Ga0070659_100146976 Ga0070659_1001469762 405
1082 3300005445 Ga0070708_100055393 Ga0070708_1000553933 405
1083 3300005457 Ga0070662_100137687 Ga0070662_1001376872 405
1084 3300005467 Ga0070706_100183267 Ga0070706_1001832672 405
1085 3300005536 Ga0070697_100064898 Ga0070697_1000648982 405
1086 3300005536 Ga0070697_100172832 Ga0070697_1001728321 405
1087 3300005536 Ga0070697_100289068 Ga0070697_1002890681 405
1088 3300005563 Ga0068855_100336313 Ga0068855_1003363132 405
1089 3300005577 Ga0068857_100212684 Ga0068857_1002126842 405
1090 3300005985 Ga0081539_10000702 Ga0081539_1000070238 405
1091 3300006844 Ga0075428_100175001 Ga0075428_1001750012 405
1092 3300006844 Ga0075428_100366884 Ga0075428_1003668842 405
1093 3300006846 Ga0075430_100003800 Ga0075430_1000038006 405
1094 3300006846 Ga0075430_100011349 Ga0075430_1000113495 405
1095 3300006846 Ga0075430_100157956 Ga0075430_1001579562 405
1096 3300006847 Ga0075431_100001763 Ga0075431_1000017632 405
1097 3300006847 Ga0075431_100084312 Ga0075431_1000843122 405
1098 3300006852 Ga0075433_10000177 Ga0075433_1000017735 405
1099 3300006852 Ga0075433_10005655 Ga0075433_1000565510 405
1100 3300006871 Ga0075434_100002184 Ga0075434_1000021842 405
1101 3300006880 Ga0075429_100003643 Ga0075429_1000036438 405
1102 3300006880 Ga0075429_100022461 Ga0075429_1000224614 405
1103 3300006880 Ga0075429_100098766 Ga0075429_1000987662 405
1104 3300006914 Ga0075436_100030417 Ga0075436_1000304173 405
1105 3300007076 Ga0075435_100009509 Ga0075435_1000095092 405
1106 3300007076 Ga0075435_100012415 Ga0075435_1000124153 405
1107 3300007265 Ga0099794_10030563 Ga0099794_100305632 405
1108 3300009094 Ga0111539_10004531 Ga0111539_1000453118 405
1109 3300009147 Ga0114129_10002160 Ga0114129_1000216022 405
1110 3300009147 Ga0114129_10002470 Ga0114129_1000247019 405
1111 3300009147 Ga0114129_10004064 Ga0114129_1000406413 405
1112 3300009147 Ga0114129_10122842 Ga0114129_101228422 405
1113 3300009545 Ga0105237_10002648 Ga0105237_100026484 405
1114 3300013105 Ga0157369_10000942 Ga0157369_1000094217 405
1115 3300025910 Ga0207684_10056082 Ga0207684_100560822 405
1116 3300025910 Ga0207684_10068829 Ga0207684_100688292 405
1117 3300025912 Ga0207707_10029688 Ga0207707_100296882 405
1118 3300025913 Ga0207695_10035977 Ga0207695_100359773 405
1119 3300025914 Ga0207671_10027128 Ga0207671_100271282 405
1120 3300025922 Ga0207646_10018394 Ga0207646_100183949 405
1121 3300025924 Ga0207694_10029918 Ga0207694_100299182 405
1122 3300026116 Ga0207674_10053959 Ga0207674_100539592 405
1123 3300027543 Ga0209999_1009365 Ga0209999_10093652 405
1124 3300027695 Ga0209966_1001306 Ga0209966_10013062 405
1125 3300027717 Ga0209998_10000136 Ga0209998_1000013620 405
1126 3300027907 Ga0207428_10000035 Ga0207428_10000035168 405
1127 3300031548 Ga0307408_100177200 Ga0307408_1001772002 405
1128 3300031824 Ga0307413_10076928 Ga0307413_100769282 405
1129 3300031852 Ga0307410_10005992 Ga0307410_100059923 405
1130 3300031901 Ga0307406_10009862 Ga0307406_100098622 405
1131 3300031911 Ga0307412_10015594 Ga0307412_100155942 405
1132 3300031995 Ga0307409_100079876 Ga0307409_1000798762 405
1133 3300032002 Ga0307416_100339233 Ga0307416_1003392331 405
1134 3300034817 Ga0373948_0000440 Ga0373948_0000440_2907_4151 405
1135 3300034957 Ga0373938_0018440 Ga0373938_0018440_52_1296 405
1136 3300035088 Ga0373940_0006460 Ga0373940_0006460_348_1583 405
1137 3300035207 Ga0373942_0006073 Ga0373942_0006073_1072_2316 405
1138 3300035241 Ga0373961_0002143 Ga0373961_0002143_2922_4166 405
1139 3300035242 Ga0373962_0001173 Ga0373962_0001173_817_2061 405
1140 3300037471 Ga0395905_0031057 Ga0395905_0031057_1911_3158 405
1141 3300046460 Ga0495638_0022013 Ga0495638_0022013_2382_3620 405
1142 3300049580 Ga0501046_0169556 Ga0501046_0169556_101_1351 405
1143 3300049582 Ga0501048_0179371 Ga0501048_0179371_238_1488 405
1144 3300049583 Ga0501067_0006353 Ga0501067_0006353_2576_3823 405
1145 3300049585 Ga0501069_0071601 Ga0501069_0071601_565_1812 405
1146 3300049743 Ga0501081_0089486 Ga0501081_0089486_851_2101 405
1147 3300050507 nmdc:mga05p37_18426_c1 nmdc:mga05p37_18426_c1_5721_6974 405
1148 3300050507 nmdc:mga05p37_2009_c1 nmdc:mga05p37_2009_c1_5561_6802 405
1149 3300050507 nmdc:mga05p37_26386_c1 nmdc:mga05p37_26386_c1_5228_6475 405
1150 3300050507 nmdc:mga05p37_651_c1 nmdc:mga05p37_651_c1_18016_19251 405
1151 3300050508 nmdc:mga09592_137403_c1 nmdc:mga09592_137403_c1_389_1621 405
1152 3300050508 nmdc:mga09592_40360_c1 nmdc:mga09592_40360_c1_658_1899 405
1153 3300050508 nmdc:mga09592_61539_c1 nmdc:mga09592_61539_c1_1202_2437 405
1154 3300050509 nmdc:mga0qj67_160402_c1 nmdc:mga0qj67_160402_c1_50_1297 405
1155 3300050510 nmdc:mga06r32_19986_c1 nmdc:mga06r32_19986_c1_1085_2317 405
1156 3300050510 nmdc:mga06r32_246573_c1 nmdc:mga06r32_246573_c1_524_1759 405
1157 3300050510 nmdc:mga06r32_25443_c1 nmdc:mga06r32_25443_c1_2761_4008 405
1158 3300050511 nmdc:mga08y16_1477_c1 nmdc:mga08y16_1477_c1_21795_23027 405
1159 3300050512 nmdc:mga0n895_1217_c1 nmdc:mga0n895_1217_c1_13877_15112 405
1160 3300050512 nmdc:mga0n895_2708_c1 nmdc:mga0n895_2708_c1_4514_5755 405
1161 3300050513 nmdc:mga0rr50_2234_c1 nmdc:mga0rr50_2234_c1_625_1878 405
1162 3300050514 nmdc:mga08x19_4848_c1 nmdc:mga08x19_4848_c1_6488_7723 405
1163 3300050514 nmdc:mga08x19_65939_c1 nmdc:mga08x19_65939_c1_510_1763 405
1164 3300050515 nmdc:mga0a205_1325_c1 nmdc:mga0a205_1325_c1_2172_3413 405
1165 3300050515 nmdc:mga0a205_3266_c1 nmdc:mga0a205_3266_c1_8744_9979 405
1166 3300002459 JGI24751J29686_10000008 JGI24751J29686_1000000893 406
1167 3300002459 JGI24751J29686_10000029 JGI24751J29686_1000002948 406
1168 3300005330 Ga0070690_100040500 Ga0070690_1000405002 406
1169 3300005331 Ga0070670_100003137 Ga0070670_10000313711 406
1170 3300005334 Ga0068869_100015015 Ga0068869_1000150151 406
1171 3300005336 Ga0070680_100218694 Ga0070680_1002186941 406
1172 3300005338 Ga0068868_100014160 Ga0068868_1000141603 406
1173 3300005340 Ga0070689_100109121 Ga0070689_1001091213 406
1174 3300005353 Ga0070669_100170058 Ga0070669_1001700581 406
1175 3300005354 Ga0070675_100073940 Ga0070675_1000739401 406
1176 3300005440 Ga0070705_100023860 Ga0070705_1000238603 406
1177 3300005456 Ga0070678_100094105 Ga0070678_1000941052 406
1178 3300005457 Ga0070662_100035039 Ga0070662_1000350393 406
1179 3300005459 Ga0068867_100135264 Ga0068867_1001352641 406
1180 3300005530 Ga0070679_100058748 Ga0070679_1000587482 406
1181 3300005549 Ga0070704_100061423 Ga0070704_1000614232 406
1182 3300005549 Ga0070704_100094654 Ga0070704_1000946542 406
1183 3300005617 Ga0068859_100091174 Ga0068859_1000911743 406
1184 3300005843 Ga0068860_100028626 Ga0068860_1000286261 406
1185 3300006844 Ga0075428_100061303 Ga0075428_1000613032 406
1186 3300006846 Ga0075430_100002158 Ga0075430_1000021586 406
1187 3300006847 Ga0075431_100002260 Ga0075431_10000226014 406
1188 3300006880 Ga0075429_100140853 Ga0075429_1001408532 406
1189 3300006881 Ga0068865_100245108 Ga0068865_1002451081 406
1190 3300006931 Ga0097620_100091181 Ga0097620_1000911813 406
1191 3300009094 Ga0111539_10331743 Ga0111539_103317432 406
1192 3300009098 Ga0105245_10155879 Ga0105245_101558792 406
1193 3300009147 Ga0114129_10006657 Ga0114129_100066576 406
1194 3300009177 Ga0105248_10019572 Ga0105248_100195723 406
1195 3300009553 Ga0105249_10025571 Ga0105249_100255713 406
1196 3300010375 Ga0105239_10022259 Ga0105239_100222592 406
1197 3300011119 Ga0105246_10018201 Ga0105246_100182012 406
1198 3300013306 Ga0163162_10108784 Ga0163162_101087842 406
1199 3300013306 Ga0163162_10532247 Ga0163162_105322471 406
1200 3300013307 Ga0157372_10033379 Ga0157372_100333794 406
1201 3300014325 Ga0163163_10001896 Ga0163163_100018963 406
1202 3300014326 Ga0157380_10032830 Ga0157380_100328304 406
1203 3300014968 Ga0157379_10113977 Ga0157379_101139772 406
1204 3300014969 Ga0157376_10261843 Ga0157376_102618432 406
1205 3300025912 Ga0207707_10162104 Ga0207707_101621042 406
1206 3300025917 Ga0207660_10273597 Ga0207660_102735971 406
1207 3300025921 Ga0207652_10239480 Ga0207652_102394802 406
1208 3300025925 Ga0207650_10000087 Ga0207650_1000008749 406
1209 3300025933 Ga0207706_10046376 Ga0207706_100463763 406
1210 3300025938 Ga0207704_10161873 Ga0207704_101618731 406
1211 3300025941 Ga0207711_10024542 Ga0207711_100245422 406
1212 3300025944 Ga0207661_10036847 Ga0207661_100368473 406
1213 3300025961 Ga0207712_10006484 Ga0207712_100064844 406
1214 3300025961 Ga0207712_10240486 Ga0207712_102404861 406
1215 3300026088 Ga0207641_10217573 Ga0207641_102175731 406
1216 3300035115 Ga0373941_0000682 Ga0373941_0000682_4809_6056 406
1217 3300046455 Ga0495603_0156756 Ga0495603_0156756_57_1298 406
1218 3300047472 Ga0495686_0001188 Ga0495686_0001188_4508_5779 406
1219 3300048929 Ga0496126_0000005 Ga0496126_0000005_63462_64709 406
1220 3300049568 Ga0501031_0020299 Ga0501031_0020299_1256_2512 406
1221 3300049576 Ga0501040_0064046 Ga0501040_0064046_60_1316 406
1222 3300049580 Ga0501046_0183067 Ga0501046_0183067_98_1354 406
1223 3300049582 Ga0501048_0036920 Ga0501048_0036920_1650_2906 406
1224 3300049741 Ga0501079_0168949 Ga0501079_0168949_323_1579 406
1225 3300049742 Ga0501080_0153541 Ga0501080_0153541_81_1337 406
1226 3300049822 Ga0501035_0123800 Ga0501035_0123800_870_2126 406
1227 3300050507 nmdc:mga05p37_4765_c1 nmdc:mga05p37_4765_c1_2553_3791 406
1228 3300050509 nmdc:mga0qj67_2610_c1 nmdc:mga0qj67_2610_c1_9718_10956 406
1229 3300054114 Ga0501084_0068470 Ga0501084_0068470_335_1591 406
1230 3300003322 rootL2_10196161 rootL2_101961611 407
1231 3300005616 Ga0068852_100238081 Ga0068852_1002380811 407
1232 3300006847 Ga0075431_100170006 Ga0075431_1001700062 407
1233 3300009094 Ga0111539_10025886 Ga0111539_100258866 407
1234 3300031903 Ga0307407_10096323 Ga0307407_100963232 407
1235 3300049588 Ga0501072_0058369 Ga0501072_0058369_1519_2766 407
1236 3300049741 Ga0501079_0118109 Ga0501079_0118109_50_1312 407
1237 3300049743 Ga0501081_0045671 Ga0501081_0045671_1269_2531 407
1238 3300050515 nmdc:mga0a205_181715_c1 nmdc:mga0a205_181715_c1_263_1513 407
1239 3300005329 Ga0070683_100141465 Ga0070683_1001414651 408
1240 3300005336 Ga0070680_100020016 Ga0070680_1000200163 408
1241 3300005341 Ga0070691_10042621 Ga0070691_100426212 408
1242 3300005344 Ga0070661_100041965 Ga0070661_1000419652 408
1243 3300005445 Ga0070708_100204859 Ga0070708_1002048591 408
1244 3300005458 Ga0070681_10001136 Ga0070681_100011364 408
1245 3300005468 Ga0070707_100129304 Ga0070707_1001293043 408
1246 3300005518 Ga0070699_100006267 Ga0070699_1000062672 408
1247 3300005530 Ga0070679_100005723 Ga0070679_1000057234 408
1248 3300005546 Ga0070696_100034248 Ga0070696_1000342482 408
1249 3300005563 Ga0068855_100044264 Ga0068855_1000442641 408
1250 3300005578 Ga0068854_100041332 Ga0068854_1000413322 408
1251 3300009093 Ga0105240_10008706 Ga0105240_1000870611 408
1252 3300013100 Ga0157373_10024685 Ga0157373_100246853 408
1253 3300013104 Ga0157370_10020688 Ga0157370_100206883 408
1254 3300013307 Ga0157372_10048374 Ga0157372_100483742 408
1255 3300013307 Ga0157372_10092917 Ga0157372_100929171 408
1256 3300025912 Ga0207707_10010618 Ga0207707_100106187 408
1257 3300025913 Ga0207695_10004407 Ga0207695_100044073 408
1258 3300025913 Ga0207695_10008880 Ga0207695_100088803 408
1259 3300025944 Ga0207661_10075597 Ga0207661_100755971 408
1260 3300003794 Ga0055531_10002585 Ga0055531_100025855 409
1261 3300005290 Ga0065712_10069398 Ga0065712_100693982 409
1262 3300005340 Ga0070689_100016213 Ga0070689_1000162132 409
1263 3300005563 Ga0068855_100057355 Ga0068855_1000573551 409
1264 3300005617 Ga0068859_100014767 Ga0068859_1000147674 409
1265 3300005844 Ga0068862_100055486 Ga0068862_1000554862 409
1266 3300006844 Ga0075428_100026237 Ga0075428_1000262375 409
1267 3300006844 Ga0075428_100153605 Ga0075428_1001536051 409
1268 3300006844 Ga0075428_100167853 Ga0075428_1001678532 409
1269 3300006847 Ga0075431_100054117 Ga0075431_1000541172 409
1270 3300006852 Ga0075433_10057581 Ga0075433_100575812 409
1271 3300006880 Ga0075429_100051081 Ga0075429_1000510812 409
1272 3300006880 Ga0075429_100063120 Ga0075429_1000631202 409
1273 3300006931 Ga0097620_100014768 Ga0097620_1000147685 409
1274 3300009094 Ga0111539_10090498 Ga0111539_100904983 409
1275 3300009101 Ga0105247_10001639 Ga0105247_100016392 409
1276 3300009147 Ga0114129_10010743 Ga0114129_100107437 409
1277 3300013306 Ga0163162_10420777 Ga0163162_104207771 409
1278 3300021388 Ga0213875_10000016 Ga0213875_10000016134 409
1279 3300025304 Ga0209257_1000006 Ga0209257_1000006735 409
1280 3300025900 Ga0207710_10002888 Ga0207710_100028887 409
1281 3300025936 Ga0207670_10044312 Ga0207670_100443123 409
1282 3300026089 Ga0207648_10344159 Ga0207648_103441591 409
1283 3300037853 Ga0436364_0768558 Ga0436364_0768558_120499_121857 409
1284 3300039437 Ga0436365_1684945 Ga0436365_1684945_28474_29712 409
1285 3300050507 nmdc:mga05p37_196_c1 nmdc:mga05p37_196_c1_8914_10176 409
1286 3300050510 nmdc:mga06r32_284703_c1 nmdc:mga06r32_284703_c1_243_1493 409
1287 3300050511 nmdc:mga08y16_142364_c1 nmdc:mga08y16_142364_c1_1213_2463 409
1288 3300050515 nmdc:mga0a205_58037_c1 nmdc:mga0a205_58037_c1_1096_2346 409
1289 3300002074 JGI24748J21848_1000019 JGI24748J21848_100001940 410
1290 3300002239 JGI24034J26672_10000003 JGI24034J26672_10000003256 410
1291 3300003322 rootL2_10103670 rootL2_101036705 410
1292 3300005330 Ga0070690_100026098 Ga0070690_1000260981 410
1293 3300005334 Ga0068869_100010810 Ga0068869_1000108102 410
1294 3300005355 Ga0070671_100145660 Ga0070671_1001456601 410
1295 3300005356 Ga0070674_100004725 Ga0070674_1000047256 410
1296 3300005406 Ga0070703_10000187 Ga0070703_100001872 410
1297 3300005434 Ga0070709_10000003 Ga0070709_10000003138 410
1298 3300005439 Ga0070711_100000043 Ga0070711_10000004340 410
1299 3300005440 Ga0070705_100000014 Ga0070705_10000001427 410
1300 3300005441 Ga0070700_100020428 Ga0070700_1000204282 410
1301 3300005467 Ga0070706_100001623 Ga0070706_1000016238 410
1302 3300005518 Ga0070699_100000117 Ga0070699_10000011764 410
1303 3300005518 Ga0070699_100237531 Ga0070699_1002375312 410
1304 3300005545 Ga0070695_100021982 Ga0070695_1000219824 410
1305 3300005546 Ga0070696_100000836 Ga0070696_1000008367 410
1306 3300005547 Ga0070693_100007232 Ga0070693_1000072322 410
1307 3300005617 Ga0068859_100042563 Ga0068859_1000425633 410
1308 3300005618 Ga0068864_100013630 Ga0068864_1000136306 410
1309 3300005618 Ga0068864_100062746 Ga0068864_1000627464 410
1310 3300005719 Ga0068861_100072514 Ga0068861_1000725142 410
1311 3300005719 Ga0068861_100114795 Ga0068861_1001147952 410
1312 3300005842 Ga0068858_100000145 Ga0068858_1000001458 410
1313 3300005843 Ga0068860_100145484 Ga0068860_1001454842 410
1314 3300006173 Ga0070716_100114198 Ga0070716_1001141982 410
1315 3300006844 Ga0075428_100017853 Ga0075428_1000178535 410
1316 3300006844 Ga0075428_100031934 Ga0075428_1000319342 410
1317 3300006844 Ga0075428_100273644 Ga0075428_1002736442 410
1318 3300006852 Ga0075433_10010410 Ga0075433_100104106 410
1319 3300006852 Ga0075433_10030646 Ga0075433_100306462 410
1320 3300006852 Ga0075433_10162608 Ga0075433_101626082 410
1321 3300006871 Ga0075434_100156561 Ga0075434_1001565613 410
1322 3300006914 Ga0075436_100000197 Ga0075436_10000019728 410
1323 3300006931 Ga0097620_100042560 Ga0097620_1000425603 410
1324 3300007076 Ga0075435_100016801 Ga0075435_1000168014 410
1325 3300007076 Ga0075435_100053999 Ga0075435_1000539992 410
1326 3300009098 Ga0105245_10058290 Ga0105245_100582902 410
1327 3300009101 Ga0105247_10000003 Ga0105247_10000003253 410
1328 3300009147 Ga0114129_10034177 Ga0114129_100341775 410
1329 3300009147 Ga0114129_10417895 Ga0114129_104178951 410
1330 3300009551 Ga0105238_10032960 Ga0105238_100329602 410
1331 3300010375 Ga0105239_10064049 Ga0105239_100640492 410
1332 3300013297 Ga0157378_10101717 Ga0157378_101017172 410
1333 3300013306 Ga0163162_10035805 Ga0163162_100358053 410
1334 3300014326 Ga0157380_10049180 Ga0157380_100491802 410
1335 3300025223 Ga0207672_1000071 Ga0207672_10000718 410
1336 3300025885 Ga0207653_10000013 Ga0207653_1000001356 410
1337 3300025900 Ga0207710_10000001 Ga0207710_100000011057 410
1338 3300025906 Ga0207699_10000006 Ga0207699_10000006100 410
1339 3300025910 Ga0207684_10000037 Ga0207684_10000037128 410
1340 3300025910 Ga0207684_10209398 Ga0207684_102093981 410
1341 3300025915 Ga0207693_10072882 Ga0207693_100728823 410
1342 3300025916 Ga0207663_10000039 Ga0207663_1000003937 410
1343 3300025924 Ga0207694_10009167 Ga0207694_100091676 410
1344 3300025931 Ga0207644_10003607 Ga0207644_100036076 410
1345 3300025934 Ga0207686_10042754 Ga0207686_100427542 410
1346 3300025935 Ga0207709_10086380 Ga0207709_100863802 410
1347 3300025939 Ga0207665_10011260 Ga0207665_100112604 410
1348 3300025942 Ga0207689_10014842 Ga0207689_100148424 410
1349 3300026035 Ga0207703_10000140 Ga0207703_100001408 410
1350 3300026075 Ga0207708_10007340 Ga0207708_100073404 410
1351 3300026088 Ga0207641_10121700 Ga0207641_101217002 410
1352 3300026095 Ga0207676_10025477 Ga0207676_100254774 410
1353 3300026118 Ga0207675_100117939 Ga0207675_1001179393 410
1354 3300026118 Ga0207675_100143061 Ga0207675_1001430612 410
1355 3300028381 Ga0268264_10051466 Ga0268264_100514662 410
1356 3300045051 Ga0451576_0230439 Ga0451576_0230439_506_1762 410
1357 3300050512 nmdc:mga0n895_92893_c1 nmdc:mga0n895_92893_c1_27_1283 410
1358 3300050513 nmdc:mga0rr50_35798_c1 nmdc:mga0rr50_35798_c1_11_1276 410
1359 3300050514 nmdc:mga08x19_11_c1 nmdc:mga08x19_11_c1_171237_172502 410
1360 3300005290 Ga0065712_10116106 Ga0065712_101161062 411
1361 3300005331 Ga0070670_100116462 Ga0070670_1001164622 411
1362 3300005331 Ga0070670_100169804 Ga0070670_1001698041 411
1363 3300005444 Ga0070694_100016401 Ga0070694_1000164013 411
1364 3300005518 Ga0070699_100077185 Ga0070699_1000771852 411
1365 3300005834 Ga0068851_10006720 Ga0068851_100067205 411
1366 3300006847 Ga0075431_100138747 Ga0075431_1001387472 411
1367 3300006847 Ga0075431_100140604 Ga0075431_1001406042 411
1368 3300009545 Ga0105237_10001387 Ga0105237_100013878 411
1369 3300013307 Ga0157372_10006757 Ga0157372_100067578 411
1370 3300013308 Ga0157375_10034497 Ga0157375_100344972 411
1371 3300025321 Ga0207656_10009706 Ga0207656_100097062 411
1372 3300025885 Ga0207653_10001585 Ga0207653_100015855 411
1373 3300025925 Ga0207650_10190276 Ga0207650_101902761 411
1374 3300025932 Ga0207690_10015609 Ga0207690_100156092 411
1375 3300031548 Ga0307408_100040043 Ga0307408_1000400432 411
1376 3300031852 Ga0307410_10023915 Ga0307410_100239153 411
1377 3300031901 Ga0307406_10170499 Ga0307406_101704991 411
1378 3300032005 Ga0307411_10176075 Ga0307411_101760751 411
1379 3300046616 Ga0495668_0000501 Ga0495668_0000501_18265_19530 411
1380 3300049520 Ga0501297_001083 Ga0501297_001083_429_1697 411
1381 3300049574 Ga0501038_0002334 Ga0501038_0002334_1610_2875 411
1382 3300049705 Ga0501225_0034681 Ga0501225_0034681_15_1283 411
1383 3300049779 Ga0501283_005679 Ga0501283_005679_366_1634 411
1384 3300050511 nmdc:mga08y16_149957_c1 nmdc:mga08y16_149957_c1_765_2021 411
1385 3300005331 Ga0070670_100066443 Ga0070670_1000664432 412
1386 3300005337 Ga0070682_100217165 Ga0070682_1002171651 412
1387 3300005340 Ga0070689_100000248 Ga0070689_1000002489 412
1388 3300005341 Ga0070691_10026712 Ga0070691_100267124 412
1389 3300005353 Ga0070669_100173704 Ga0070669_1001737042 412
1390 3300005440 Ga0070705_100107443 Ga0070705_1001074431 412
1391 3300005441 Ga0070700_100000043 Ga0070700_10000004369 412
1392 3300005441 Ga0070700_100073570 Ga0070700_1000735702 412
1393 3300005456 Ga0070678_100143780 Ga0070678_1001437801 412
1394 3300005458 Ga0070681_10040770 Ga0070681_100407702 412
1395 3300005467 Ga0070706_100000358 Ga0070706_10000035837 412
1396 3300005468 Ga0070707_100000464 Ga0070707_10000046415 412
1397 3300005468 Ga0070707_100181668 Ga0070707_1001816682 412
1398 3300005471 Ga0070698_100048715 Ga0070698_1000487153 412
1399 3300005544 Ga0070686_100226321 Ga0070686_1002263211 412
1400 3300005545 Ga0070695_100207507 Ga0070695_1002075071 412
1401 3300005547 Ga0070693_100019137 Ga0070693_1000191373 412
1402 3300005547 Ga0070693_100075132 Ga0070693_1000751321 412
1403 3300005549 Ga0070704_100203410 Ga0070704_1002034102 412
1404 3300005617 Ga0068859_100002628 Ga0068859_1000026287 412
1405 3300005617 Ga0068859_100009422 Ga0068859_1000094222 412
1406 3300005617 Ga0068859_100026123 Ga0068859_1000261232 412
1407 3300005617 Ga0068859_100070866 Ga0068859_1000708663 412
1408 3300005617 Ga0068859_100098305 Ga0068859_1000983052 412
1409 3300005618 Ga0068864_100070039 Ga0068864_1000700392 412
1410 3300005719 Ga0068861_100027837 Ga0068861_1000278373 412
1411 3300005843 Ga0068860_100018865 Ga0068860_1000188652 412
1412 3300005844 Ga0068862_100115134 Ga0068862_1001151342 412
1413 3300005844 Ga0068862_100122973 Ga0068862_1001229733 412
1414 3300006844 Ga0075428_100189477 Ga0075428_1001894772 412
1415 3300006881 Ga0068865_100018567 Ga0068865_1000185672 412
1416 3300006931 Ga0097620_100002629 Ga0097620_10000262912 412
1417 3300006931 Ga0097620_100009422 Ga0097620_1000094222 412
1418 3300006931 Ga0097620_100026123 Ga0097620_1000261234 412
1419 3300006931 Ga0097620_100070862 Ga0097620_1000708623 412
1420 3300006931 Ga0097620_100098309 Ga0097620_1000983093 412
1421 3300007076 Ga0075435_100015115 Ga0075435_1000151152 412
1422 3300009093 Ga0105240_10000998 Ga0105240_1000099824 412
1423 3300009094 Ga0111539_10146107 Ga0111539_101461072 412
1424 3300009147 Ga0114129_10216129 Ga0114129_102161292 412
1425 3300009174 Ga0105241_10001899 Ga0105241_100018992 412
1426 3300009545 Ga0105237_10003761 Ga0105237_1000376113 412
1427 3300009551 Ga0105238_10000790 Ga0105238_100007908 412
1428 3300010375 Ga0105239_10025660 Ga0105239_100256602 412
1429 3300013100 Ga0157373_10012920 Ga0157373_100129205 412
1430 3300013306 Ga0163162_10012750 Ga0163162_100127501 412
1431 3300013306 Ga0163162_10217971 Ga0163162_102179712 412
1432 3300013307 Ga0157372_10262483 Ga0157372_102624831 412
1433 3300013308 Ga0157375_10234070 Ga0157375_102340702 412
1434 3300017792 Ga0163161_10009570 Ga0163161_100095702 412
1435 3300025906 Ga0207699_10096903 Ga0207699_100969031 412
1436 3300025910 Ga0207684_10000168 Ga0207684_1000016889 412
1437 3300025913 Ga0207695_10001344 Ga0207695_1000134424 412
1438 3300025914 Ga0207671_10009040 Ga0207671_100090403 412
1439 3300025918 Ga0207662_10012888 Ga0207662_100128883 412
1440 3300025924 Ga0207694_10004366 Ga0207694_100043668 412
1441 3300025933 Ga0207706_10038541 Ga0207706_100385415 412
1442 3300025936 Ga0207670_10001749 Ga0207670_100017495 412
1443 3300025936 Ga0207670_10210448 Ga0207670_102104482 412
1444 3300025938 Ga0207704_10187953 Ga0207704_101879532 412
1445 3300025940 Ga0207691_10003457 Ga0207691_100034575 412
1446 3300025942 Ga0207689_10004240 Ga0207689_100042402 412
1447 3300025942 Ga0207689_10161986 Ga0207689_101619862 412
1448 3300026023 Ga0207677_10137797 Ga0207677_101377972 412
1449 3300026075 Ga0207708_10000060 Ga0207708_1000006071 412
1450 3300026075 Ga0207708_10032202 Ga0207708_100322022 412
1451 3300026075 Ga0207708_10032842 Ga0207708_100328422 412
1452 3300026088 Ga0207641_10098613 Ga0207641_100986132 412
1453 3300026095 Ga0207676_10108895 Ga0207676_101088952 412
1454 3300026118 Ga0207675_100044222 Ga0207675_1000442223 412
1455 3300026118 Ga0207675_100131297 Ga0207675_1001312971 412
1456 3300026121 Ga0207683_10145403 Ga0207683_101454032 412
1457 3300026121 Ga0207683_10177215 Ga0207683_101772152 412
1458 3300028381 Ga0268264_10003941 Ga0268264_100039412 412
1459 3300031548 Ga0307408_100084218 Ga0307408_1000842181 412
1460 3300031731 Ga0307405_10149883 Ga0307405_101498831 412
1461 3300031901 Ga0307406_10024377 Ga0307406_100243771 412
1462 3300031903 Ga0307407_10020848 Ga0307407_100208482 412
1463 3300031911 Ga0307412_10101440 Ga0307412_101014401 412
1464 3300032004 Ga0307414_10014653 Ga0307414_100146533 412
1465 3300032005 Ga0307411_10082967 Ga0307411_100829672 412
1466 3300032126 Ga0307415_100025059 Ga0307415_1000250593 412
1467 3300037466 Ga0395898_0100565 Ga0395898_0100565_1445_2704 412
1468 3300037466 Ga0395898_0193902 Ga0395898_0193902_664_1929 412
1469 3300042005 Ga0439448_0013740 Ga0439448_0013740_1075_2334 412
1470 3300049515 Ga0501292_007118 Ga0501292_007118_55_1314 412
1471 3300049649 Ga0501198_009772 Ga0501198_009772_133_1392 412
1472 3300049654 Ga0501207_001617 Ga0501207_001617_106_1365 412
1473 3300049661 Ga0501217_007205 Ga0501217_007205_961_2220 412
1474 3300049663 Ga0501223_003235 Ga0501223_003235_115_1374 412
1475 3300049665 Ga0501227_003013 Ga0501227_003013_187_1446 412
1476 3300049669 Ga0501235_007619 Ga0501235_007619_303_1562 412
1477 3300049705 Ga0501225_0006091 Ga0501225_0006091_2133_3392 412
1478 3300050507 nmdc:mga05p37_389468_c1 nmdc:mga05p37_389468_c1_329_1588 412
1479 3300050509 nmdc:mga0qj67_36989_c1 nmdc:mga0qj67_36989_c1_2182_3456 412
1480 3300050510 nmdc:mga06r32_48389_c1 nmdc:mga06r32_48389_c1_2014_3288 412
1481 3300050512 nmdc:mga0n895_315290_c1 nmdc:mga0n895_315290_c1_104_1363 412
1482 3300005295 Ga0065707_10190055 Ga0065707_101900551 413
1483 3300005343 Ga0070687_100012018 Ga0070687_1000120182 413
1484 3300005353 Ga0070669_100071221 Ga0070669_1000712212 413
1485 3300005441 Ga0070700_100005650 Ga0070700_1000056505 413
1486 3300005445 Ga0070708_100009500 Ga0070708_1000095003 413
1487 3300005458 Ga0070681_10000488 Ga0070681_1000048819 413
1488 3300005467 Ga0070706_100028071 Ga0070706_1000280713 413
1489 3300005471 Ga0070698_100067137 Ga0070698_1000671371 413
1490 3300005518 Ga0070699_100010572 Ga0070699_1000105723 413
1491 3300005530 Ga0070679_100000793 Ga0070679_1000007934 413
1492 3300005536 Ga0070697_100014521 Ga0070697_1000145213 413
1493 3300005545 Ga0070695_100113942 Ga0070695_1001139422 413
1494 3300005546 Ga0070696_100078410 Ga0070696_1000784102 413
1495 3300005546 Ga0070696_100261381 Ga0070696_1002613811 413
1496 3300005549 Ga0070704_100189581 Ga0070704_1001895811 413
1497 3300005614 Ga0068856_100064955 Ga0068856_1000649553 413
1498 3300005719 Ga0068861_100015543 Ga0068861_1000155432 413
1499 3300005844 Ga0068862_100046755 Ga0068862_1000467552 413
1500 3300005985 Ga0081539_10000165 Ga0081539_1000016541 413
1501 3300005985 Ga0081539_10001077 Ga0081539_1000107713 413
1502 3300006852 Ga0075433_10025895 Ga0075433_100258952 413
1503 3300006852 Ga0075433_10083303 Ga0075433_100833032 413
1504 3300006871 Ga0075434_100094563 Ga0075434_1000945632 413
1505 3300009094 Ga0111539_10154833 Ga0111539_101548332 413
1506 3300009147 Ga0114129_10400597 Ga0114129_104005972 413
1507 3300009177 Ga0105248_10520037 Ga0105248_105200371 413
1508 3300009553 Ga0105249_10046998 Ga0105249_100469982 413
1509 3300009553 Ga0105249_10069249 Ga0105249_100692492 413
1510 3300014326 Ga0157380_10000414 Ga0157380_100004149 413
1511 3300025918 Ga0207662_10004778 Ga0207662_100047783 413
1512 3300026075 Ga0207708_10011463 Ga0207708_100114635 413
1513 3300026118 Ga0207675_100028293 Ga0207675_1000282932 413
1514 3300026118 Ga0207675_100292137 Ga0207675_1002921371 413
1515 3300028380 Ga0268265_10013238 Ga0268265_100132382 413
1516 3300031456 Ga0307513_10005567 Ga0307513_100055679 413
1517 3300037418 Ga0395900_0026089 Ga0395900_0026089_393_1658 413
1518 3300038996 Ga0242420_013687 Ga0242420_013687_65_1333 413
1519 3300046525 Ga0495663_0000215 Ga0495663_0000215_19805_21073 413
1520 3300046537 Ga0495598_0000908 Ga0495598_0000908_1056_2324 413
1521 3300046539 Ga0495621_0000037 Ga0495621_0000037_13378_14646 413
1522 3300048910 Ga0496107_0176587 Ga0496107_0176587_20_1288 413
1523 3300050507 nmdc:mga05p37_512116_c1 nmdc:mga05p37_512116_c1_38_1306 413
1524 3300050507 nmdc:mga05p37_92835_c1 nmdc:mga05p37_92835_c1_1807_3078 413
1525 3300050512 nmdc:mga0n895_260798_c1 nmdc:mga0n895_260798_c1_116_1384 413
1526 3300050515 nmdc:mga0a205_12344_c1 nmdc:mga0a205_12344_c1_6262_7533 413
1527 iso_pu_bacteria 2898713307 2898716501 413
1528 3300003320 rootH2_10001414 rootH2_1000141429 414
1529 3300005614 Ga0068856_100079810 Ga0068856_1000798103 414
1530 3300026078 Ga0207702_10020942 Ga0207702_100209422 414
1531 3300038443 Ga0395901_0174051 Ga0395901_0174051_13_1314 414
1532 3300005262 Ga0065165_1001175 Ga0065165_10011756 415
1533 3300026067 Ga0207678_10016607 Ga0207678_100166074 415
1534 3300039437 Ga0436365_1742918 Ga0436365_1742918_12_1280 415
1535 iso_pu_bacteria 2818991444 2819589637 415
1536 iso_pu_bacteria 2890737413 2890737444 415
1537 iso_pu_bacteria 2929154850 2929159996 415
1538 3300003323 rootH1_10080102 rootH1_100801026 416
1539 3300009094 Ga0111539_10009668 Ga0111539_100096682 416
1540 3300028794 Ga0307515_10027550 Ga0307515_100275501 416
1541 3300053088 Ga0500644_0023703 Ga0500644_0023703_81_1343 416
1542 3300053156 Ga0500622_0006845 Ga0500622_0006845_5125_6387 416
1543 iso_pu_bacteria 2599185184 2599479835 417
1544 iso_pu_bacteria 2738541284 2738761892 417
1545 iso_pu_bacteria 2738543023 2739302178 417
1546 iso_pu_bacteria 2775506987 2776615463 417
1547 iso_pu_bacteria 2852627209 2852630822 417
1548 iso_pu_bacteria 2902048731 2902049389 417
1549 iso_pu_bacteria 2919186247 2919188799 417
1550 iso_pu_bacteria 2919437846 2919442143 417
1551 iso_pu_bacteria 2928078545 2928080966 417
1552 iso_pu_bacteria 2928147474 2928152617 417
1553 iso_pu_bacteria 2932082852 2932086944 417
1554 iso_pu_bacteria 2939664404 2939667046 417
1555 3300003322 rootL2_10009645 rootL2_100096453 418
1556 3300003323 rootH1_10070385 rootH1_100703852 418
1557 3300031456 Ga0307513_10104959 Ga0307513_101049592 418
1558 3300046616 Ga0495668_0005629 Ga0495668_0005629_728_1987 418
1559 3300005328 Ga0070676_10069703 Ga0070676_100697032 419
1560 3300006237 Ga0097621_100001961 Ga0097621_1000019614 419
1561 3300006358 Ga0068871_100006604 Ga0068871_1000066043 419
1562 3300013297 Ga0157378_10011255 Ga0157378_100112555 419
1563 3300013306 Ga0163162_10144992 Ga0163162_101449922 419
1564 3300048927 Ga0496124_0041289 Ga0496124_0041289_1693_2958 419
1565 3300053090 Ga0500646_0010346 Ga0500646_0010346_138_1400 419
1566 3300053108 Ga0500562_000005 Ga0500562_000005_191285_192550 419
1567 3300053156 Ga0500622_0000113 Ga0500622_0000113_29214_30482 419
1568 3300053156 Ga0500622_0000133 Ga0500622_0000133_30642_31910 419
1569 3300053156 Ga0500622_0010075 Ga0500622_0010075_2519_3784 419
1570 3300053158 Ga0500627_0042370 Ga0500627_0042370_276_1544 419
1571 3300025913 Ga0207695_10000133 Ga0207695_10000133132 420
1572 3300050493 nmdc:mga0k408_86021_c1 nmdc:mga0k408_86021_c1_138_1412 420
1573 2162886007 SwRhRL2b_contig_1948121 SwRhRL2b_0659.00008740 421
1574 3300001990 JGI24737J22298_10005684 JGI24737J22298_100056842 421
1575 3300002067 JGI24735J21928_10000007 JGI24735J21928_10000007125 421
1576 3300003316 rootH1_10041472 rootH1_100414728 421
1577 3300003316 rootH1_10084070 rootH1_100840702 421
1578 3300003320 rootH2_10054802 rootH2_100548022 421
1579 3300003322 rootL2_10059364 rootL2_100593642 421
1580 3300005288 Ga0065714_10002398 Ga0065714_1000239819 421
1581 3300005288 Ga0065714_10009168 Ga0065714_100091681 421
1582 3300005288 Ga0065714_10064528 Ga0065714_1006452818 421
1583 3300005288 Ga0065714_10064745 Ga0065714_100647456 421
1584 3300005289 Ga0065704_10070196 Ga0065704_1007019627 421
1585 3300005329 Ga0070683_100080784 Ga0070683_1000807842 421
1586 3300005335 Ga0070666_10004655 Ga0070666_100046557 421
1587 3300005366 Ga0070659_100000100 Ga0070659_10000010038 421
1588 3300005548 Ga0070665_100000041 Ga0070665_10000004181 421
1589 3300005563 Ga0068855_100159420 Ga0068855_1001594202 421
1590 3300005577 Ga0068857_100003443 Ga0068857_1000034437 421
1591 3300005843 Ga0068860_100000447 Ga0068860_10000044733 421
1592 3300005843 Ga0068860_100006039 Ga0068860_1000060392 421
1593 3300006195 Ga0075366_10000031 Ga0075366_1000003144 421
1594 3300006353 Ga0075370_10076558 Ga0075370_100765582 421
1595 3300009093 Ga0105240_10021747 Ga0105240_100217475 421
1596 3300009093 Ga0105240_10062469 Ga0105240_100624694 421
1597 3300009545 Ga0105237_10001134 Ga0105237_1000113420 421
1598 3300009545 Ga0105237_10001507 Ga0105237_1000150715 421
1599 3300009545 Ga0105237_10003022 Ga0105237_1000302211 421
1600 3300009545 Ga0105237_10004821 Ga0105237_1000482110 421
1601 3300009545 Ga0105237_10015193 Ga0105237_100151932 421
1602 3300009551 Ga0105238_10007423 Ga0105238_100074234 421
1603 3300009551 Ga0105238_10181732 Ga0105238_101817322 421
1604 3300010375 Ga0105239_10000126 Ga0105239_1000012639 421
1605 3300010375 Ga0105239_10004450 Ga0105239_100044503 421
1606 3300013100 Ga0157373_10000125 Ga0157373_1000012533 421
1607 3300013100 Ga0157373_10043098 Ga0157373_100430983 421
1608 3300013102 Ga0157371_10000575 Ga0157371_1000057517 421
1609 3300013102 Ga0157371_10001519 Ga0157371_100015197 421
1610 3300013102 Ga0157371_10008186 Ga0157371_100081863 421
1611 3300013102 Ga0157371_10030794 Ga0157371_100307942 421
1612 3300013104 Ga0157370_10036893 Ga0157370_100368932 421
1613 3300013104 Ga0157370_10090709 Ga0157370_100907092 421
1614 3300013104 Ga0157370_10091843 Ga0157370_100918432 421
1615 3300013104 Ga0157370_10139041 Ga0157370_101390412 421
1616 3300013105 Ga0157369_10008102 Ga0157369_100081029 421
1617 3300013105 Ga0157369_10142773 Ga0157369_101427732 421
1618 3300013105 Ga0157369_10325368 Ga0157369_103253682 421
1619 3300013306 Ga0163162_10002051 Ga0163162_100020517 421
1620 3300013307 Ga0157372_10000042 Ga0157372_100000427 421
1621 3300013307 Ga0157372_10000894 Ga0157372_100008943 421
1622 3300013307 Ga0157372_10002344 Ga0157372_100023442 421
1623 3300013307 Ga0157372_10040102 Ga0157372_100401023 421
1624 3300014497 Ga0182008_10000002 Ga0182008_10000002218 421
1625 3300017792 Ga0163161_10005601 Ga0163161_100056013 421
1626 3300020069 Ga0197907_10588602 Ga0197907_105886022 421
1627 3300020069 Ga0197907_11491861 Ga0197907_114918612 421
1628 3300020076 Ga0206355_1325351 Ga0206355_13253512 421
1629 3300020077 Ga0206351_10222719 Ga0206351_102227192 421
1630 3300020077 Ga0206351_10424610 Ga0206351_104246102 421
1631 3300020080 Ga0206350_10041322 Ga0206350_100413222 421
1632 3300020080 Ga0206350_10906291 Ga0206350_109062911 421
1633 3300020081 Ga0206354_10863603 Ga0206354_108636031 421
1634 3300020610 Ga0154015_1394578 Ga0154015_13945782 421
1635 3300020610 Ga0154015_1619016 Ga0154015_16190162 421
1636 3300022467 Ga0224712_10004269 Ga0224712_100042692 421
1637 3300025233 Ga0209437_100024 Ga0209437_100024460 421
1638 3300025250 Ga0209026_1000762 Ga0209026_10007629 421
1639 3300025250 Ga0209026_1003945 Ga0209026_10039453 421
1640 3300025258 Ga0209129_1004267 Ga0209129_10042673 421
1641 3300025903 Ga0207680_10002452 Ga0207680_100024527 421
1642 3300025904 Ga0207647_10015561 Ga0207647_100155614 421
1643 3300025913 Ga0207695_10064801 Ga0207695_100648014 421
1644 3300025913 Ga0207695_10124192 Ga0207695_101241921 421
1645 3300025914 Ga0207671_10000969 Ga0207671_1000096926 421
1646 3300025914 Ga0207671_10001393 Ga0207671_1000139324 421
1647 3300025914 Ga0207671_10005220 Ga0207671_100052207 421
1648 3300025914 Ga0207671_10025532 Ga0207671_100255321 421
1649 3300025949 Ga0207667_10002398 Ga0207667_100023987 421
1650 3300026078 Ga0207702_10014935 Ga0207702_100149353 421
1651 3300026116 Ga0207674_10011509 Ga0207674_100115099 421
1652 3300026142 Ga0207698_10084518 Ga0207698_100845182 421
1653 3300028379 Ga0268266_10000014 Ga0268266_10000014114 421
1654 3300028381 Ga0268264_10000327 Ga0268264_1000032732 421
1655 3300028381 Ga0268264_10004249 Ga0268264_100042492 421
1656 3300028794 Ga0307515_10000290 Ga0307515_1000029084 421
1657 3300028794 Ga0307515_10006021 Ga0307515_100060212 421
1658 3300028794 Ga0307515_10026277 Ga0307515_100262774 421
1659 3300031548 Ga0307408_100001060 Ga0307408_1000010607 421
1660 3300031911 Ga0307412_10000038 Ga0307412_10000038139 421
1661 3300032004 Ga0307414_10000281 Ga0307414_100002813 421
1662 3300032004 Ga0307414_10028981 Ga0307414_100289812 421
1663 3300032004 Ga0307414_10048720 Ga0307414_100487202 421
1664 3300032004 Ga0307414_10152589 Ga0307414_101525892 421
1665 3300033179 Ga0307507_10000032 Ga0307507_1000003286 421
1666 3300037312 Ga0395899_0000401 Ga0395899_0000401_6382_7653 421
1667 3300044684 Ga0466966_0054484 Ga0466966_0054484_986_2257 421
1668 3300044693 Ga0466961_0076058 Ga0466961_0076058_775_2046 421
1669 3300046460 Ga0495638_0027684 Ga0495638_0027684_822_2090 421
1670 3300046471 Ga0495650_0000050 Ga0495650_0000050_67582_68853 421
1671 3300046492 Ga0495585_0000459 Ga0495585_0000459_774_2045 421
1672 3300046492 Ga0495585_0004027 Ga0495585_0004027_7632_8909 421
1673 3300046507 Ga0495606_0000213 Ga0495606_0000213_89705_90976 421
1674 3300046507 Ga0495606_0070322 Ga0495606_0070322_93_1364 421
1675 3300046507 Ga0495606_0104178 Ga0495606_0104178_76_1347 421
1676 3300046512 Ga0495610_0001134 Ga0495610_0001134_3320_4591 421
1677 3300046512 Ga0495610_0040691 Ga0495610_0040691_988_2259 421
1678 3300046513 Ga0495616_0002990 Ga0495616_0002990_7934_9205 421
1679 3300046513 Ga0495616_0010318 Ga0495616_0010318_1177_2448 421
1680 3300046524 Ga0495648_0006903 Ga0495648_0006903_3562_4836 421
1681 3300046530 Ga0495654_0043936 Ga0495654_0043936_290_1564 421
1682 3300046538 Ga0495609_0032276 Ga0495609_0032276_161_1435 421
1683 3300046557 Ga0495622_0029122 Ga0495622_0029122_83_1360 421
1684 3300046558 Ga0495633_0000067 Ga0495633_0000067_73946_75232 421
1685 3300046558 Ga0495633_0006717 Ga0495633_0006717_2803_4074 421
1686 3300046616 Ga0495668_0000009 Ga0495668_0000009_155732_157006 421
1687 3300046648 Ga0495611_0002930 Ga0495611_0002930_3096_4397 421
1688 3300046660 Ga0495625_0000110 Ga0495625_0000110_66736_68007 421
1689 3300046660 Ga0495625_0000534 Ga0495625_0000534_33445_34719 421
1690 3300046660 Ga0495625_0002020 Ga0495625_0002020_5638_6915 421
1691 3300046660 Ga0495625_0139851 Ga0495625_0139851_68_1342 421
1692 3300046665 Ga0495661_0004162 Ga0495661_0004162_5150_6421 421
1693 3300046665 Ga0495661_0012725 Ga0495661_0012725_4048_5319 421
1694 3300046692 Ga0495671_0045286 Ga0495671_0045286_372_1643 421
1695 3300046694 Ga0495649_0000011 Ga0495649_0000011_315584_316855 421
1696 3300047323 Ga0495683_0077258 Ga0495683_0077258_206_1477 421
1697 3300047443 Ga0495687_000144 Ga0495687_000144_48180_49448 421
1698 3300047443 Ga0495687_000249 Ga0495687_000249_7525_8796 421
1699 3300047472 Ga0495686_0000097 Ga0495686_0000097_30545_31816 421
1700 3300047472 Ga0495686_0029880 Ga0495686_0029880_2209_3480 421
1701 3300048918 Ga0496115_0032604 Ga0496115_0032604_1265_2533 421
1702 3300049459 Ga0495678_016717 Ga0495678_016717_1790_3061 421
1703 3300049663 Ga0501223_004188 Ga0501223_004188_75_1343 421
1704 3300049776 Ga0501280_007993 Ga0501280_007993_165_1439 421
1705 3300050493 nmdc:mga0k408_85_c1 nmdc:mga0k408_85_c1_37742_39016 421
1706 3300050496 nmdc:mga07m45_74978_c1 nmdc:mga07m45_74978_c1_208_1479 421
1707 3300053093 Ga0500651_0001128 Ga0500651_0001128_3879_5144 421
1708 3300053125 Ga0500618_000029 Ga0500618_000029_125991_127271 421
1709 3300053125 Ga0500618_016788 Ga0500618_016788_374_1645 421
1710 3300053156 Ga0500622_0004137 Ga0500622_0004137_2973_4241 421
1711 3300053157 Ga0500624_000557 Ga0500624_000557_6009_7280 421

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07394

DUF1501

Protein of unknown function (DUF1501)

44

391

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wew-assembly2.cif.gz_BaB crystal structures of human e-npp 1: bound to n-{4-[(7-methoxyquinolin-4-yl)oxy]phenyl}sulfuric diamide 0.7218 250 334
6wet-assembly1.cif.gz_AaA crystal structures of human e-npp 1: apo 0.7025 250 334
6f33-assembly2.cif.gz_B crystal structure of ectonucleotide phosphodiesterase/pyrophosphatase-3 (npp3) in complex with ampnpp 0.6836 244 334
4gtz-assembly2.cif.gz_B crystal structure of mouse enpp1 in complex with cmp 0.644 246 334
4gtz-assembly1.cif.gz_A crystal structure of mouse enpp1 in complex with cmp 0.639 246 334
ID Description Score Start End Superfamily
af_Q54U95_87_375_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.6213 258 320 3.40.720.10
1ei6B01 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.5889 258 354 3.40.720.10
af_P40367_51_359_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.5672 44 357 3.40.720.10
5kglB01 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.5563 44 417 3.40.720.10
af_A1ZB84_62_350_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.5438 33 356 3.40.720.10
ID Description Score Start End GO Terms
AF-A0A4Q3D5C6-F1-model_v4 DUF1501 domain-containing protein 0.9808 261 421
AF-A0A1F2QV88-F1-model_v4 DUF1501 domain-containing protein 0.9705 265 413
AF-A0A4Q3D5C6-F1-model_v4 DUF1501 domain-containing protein 0.9689 261 421
AF-A0A3M1JBJ8-F1-model_v4 DUF1501 domain-containing protein 0.9687 257 421
AF-A0A4Q5YQY1-F1-model_v4 DUF1501 domain-containing protein 0.9676 55 385

Feature Viewer

pLDDT pTM Quality
85.54 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map