F495335

General Info

Members Datasets Scaffolds Average Seq Length
1687 482 1687 110

Family's Representative Sequence

Representative Sequence 3300005535|Ga0070684_100387243|Ga0070684_1003872433
Length 111
Sequence MAFTQSRQQNGVLVVRSDGQLIVGNRHELKELVQGALAAGDRRFVLDFSHTGYIDSSGLGALVTVARQVRELGGEMRLAGLNDDLRSLFELTKLDTLFAIADSPAQALAGF

Samples

Sample ID Description Type Environment
1 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
9 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
58 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
59 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
60 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
67 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
68 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
69 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
70 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
71 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
81 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
82 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
83 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
84 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
85 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
86 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
89 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
90 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
91 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
92 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
93 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
94 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
98 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
99 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
100 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
101 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
102 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
103 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
104 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
105 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
111 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
113 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
114 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
115 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
116 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
117 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
121 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
122 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
123 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
124 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
128 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
129 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
130 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
131 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
132 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
133 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
134 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
135 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
136 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
137 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
138 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
139 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
140 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
143 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
146 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
149 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
216 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
220 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
221 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
222 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
223 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
224 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
225 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
226 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
227 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
228 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
229 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
230 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
231 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
232 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
233 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
234 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
235 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
236 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
237 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
238 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
240 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
241 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
242 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
243 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
244 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
245 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
246 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
247 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
248 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
249 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
250 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
251 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
252 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
253 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
254 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
255 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
256 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
257 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
258 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
259 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
260 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
261 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
262 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
263 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
264 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
265 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
266 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
267 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
268 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
269 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
270 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
271 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
272 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
273 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
274 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
275 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
276 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
277 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
278 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
279 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
280 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
281 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
282 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
283 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
284 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
285 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
286 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
287 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
288 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
289 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
290 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
291 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
292 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
293 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
294 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
295 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
296 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
297 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
298 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
299 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
300 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
301 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
302 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
303 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
304 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
305 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
306 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
307 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
308 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
309 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
310 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
311 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
312 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
313 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
314 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
315 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
316 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
317 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
318 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
319 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
320 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
321 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
322 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
323 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
324 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
325 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
326 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
327 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
328 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
329 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
330 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
331 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
332 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
333 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
334 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
335 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
336 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
337 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
338 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
339 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
340 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
341 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
342 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
343 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
344 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
345 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
346 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
347 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
348 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
349 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
350 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
351 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
352 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
353 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
354 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
355 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
356 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
357 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
358 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
359 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
360 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
361 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
362 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
363 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
364 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
365 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
366 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
367 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
368 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
369 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
370 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
371 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
375 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
376 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
377 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
378 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
379 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
380 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
391 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
392 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
393 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
394 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
395 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
396 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
397 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
398 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
399 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
400 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
401 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
403 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
404 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
405 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
406 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
407 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
408 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
409 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
410 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
411 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
412 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
413 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
414 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
415 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
416 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
417 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
418 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
419 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
420 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
421 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
422 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
423 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
424 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
425 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
426 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
427 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
428 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
429 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
430 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
431 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
432 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
433 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
434 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
435 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
436 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
437 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
438 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
439 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
440 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
441 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
442 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
443 3300049852 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control Metagenome Rhizosphere
444 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
445 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
446 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
447 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
448 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
449 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
450 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
451 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
452 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
453 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
454 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
455 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
456 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
457 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
458 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
459 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
460 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
461 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
462 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
463 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
464 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
465 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
466 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
467 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
468 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
469 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
470 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
471 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
472 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
473 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
474 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
475 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
476 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
477 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
478 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
479 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
480 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
481 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
482 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.72
Metatranscriptomes 5.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.9
Rhizosphere 96.32
Stem 0
Stem Tuber 0
Unclassified 0.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24750J21931_1019297 3300002070 Bacteria 944
2 JGI25406J46586_10052517 3300003203 Bacteria 1357
3 rootL2_10101677 3300003322 Bacteria 1969
4 Ga0032354_1121886 3300003693 Bacteria 633
5 Ga0058859_11814094 3300004798 Bacteria 531
6 Ga0058863_10023017 3300004799 Bacteria 973
7 Ga0058863_11749219 3300004799 Bacteria 515
8 Ga0058863_11766029 3300004799 Bacteria 957
9 Ga0058863_11873702 3300004799 Bacteria 1002
10 Ga0058863_11972071 3300004799 Bacteria 655
11 Ga0058861_11621628 3300004800 Unclassified 686
12 Ga0058861_11623768 3300004800 Bacteria 655
13 Ga0058861_11793331 3300004800 Bacteria 1332
14 Ga0058861_11819252 3300004800 Unclassified 612
15 Ga0058861_11862569 3300004800 Bacteria 1133
16 Ga0058861_11977672 3300004800 Bacteria 1094
17 Ga0058860_12016274 3300004801 Bacteria 548
18 Ga0058862_10007717 3300004803 Bacteria 705
19 Ga0058862_10139180 3300004803 Bacteria 889
20 Ga0058862_11895783 3300004803 Unclassified 575
21 Ga0058862_12536806 3300004803 Bacteria 589
22 Ga0058862_12551672 3300004803 Bacteria 568
23 Ga0058862_12614112 3300004803 Bacteria 793
24 Ga0058862_12730940 3300004803 Unclassified 831
25 Ga0058862_12733296 3300004803 Unclassified 560
26 Ga0058862_12860400 3300004803 Bacteria 1470
27 Ga0058862_12875333 3300004803 Bacteria 669
28 Ga0065704_10156196 3300005289 Bacteria 1382
29 Ga0065712_10002894 3300005290 Bacteria 4082
30 Ga0065715_10162401 3300005293 Bacteria 1617
31 Ga0065707_10113306 3300005295 Bacteria 2332
32 Ga0070658_10009701 3300005327 Bacteria 7729
33 Ga0070658_10035917 3300005327 Bacteria 3993
34 Ga0070658_10091002 3300005327 Bacteria 2514
35 Ga0070658_10188744 3300005327 Bacteria 1737
36 Ga0070658_10265771 3300005327 Bacteria 1458
37 Ga0070658_10295648 3300005327 Bacteria 1380
38 Ga0070658_10569624 3300005327 Bacteria 980
39 Ga0070658_10586066 3300005327 Bacteria 966
40 Ga0070676_10004346 3300005328 Bacteria 7442
41 Ga0070676_10830801 3300005328 Bacteria 684
42 Ga0070676_10948230 3300005328 Bacteria 643
43 Ga0070683_100000233 3300005329 Bacteria 38043
44 Ga0070683_100007640 3300005329 Bacteria 9148
45 Ga0070683_100021811 3300005329 Bacteria 5717
46 Ga0070683_100050905 3300005329 Bacteria 3836
47 Ga0070683_100088898 3300005329 Bacteria 2899
48 Ga0070683_100104030 3300005329 Bacteria 2676
49 Ga0070683_100141480 3300005329 Bacteria 2279
50 Ga0070683_100153583 3300005329 Bacteria 2183
51 Ga0070683_100225934 3300005329 Bacteria 1779
52 Ga0070683_100318464 3300005329 Bacteria 1480
53 Ga0070683_100567773 3300005329 Bacteria 1085
54 Ga0070683_100697499 3300005329 Bacteria 972
55 Ga0070683_100729882 3300005329 Bacteria 949
56 Ga0070683_101339638 3300005329 Bacteria 688
57 Ga0070690_100045286 3300005330 Bacteria 2794
58 Ga0070690_100430372 3300005330 Unclassified 975
59 Ga0070690_100568538 3300005330 Bacteria 857
60 Ga0070690_101566059 3300005330 Bacteria 533
61 Ga0070670_100007272 3300005331 Bacteria 9388
62 Ga0070670_100965521 3300005331 Bacteria 774
63 Ga0070670_101308577 3300005331 Bacteria 663
64 Ga0070677_10119039 3300005333 Bacteria 1190
65 Ga0070677_10445234 3300005333 Unclassified 692
66 Ga0068869_100010103 3300005334 Bacteria 6142
67 Ga0068869_100057602 3300005334 Bacteria 2837
68 Ga0068869_100895419 3300005334 Bacteria 768
69 Ga0070666_10117395 3300005335 Bacteria 1843
70 Ga0070666_10127916 3300005335 Bacteria 1764
71 Ga0070680_100027511 3300005336 Bacteria 4553
72 Ga0070680_100028065 3300005336 Bacteria 4513
73 Ga0070680_100043156 3300005336 Bacteria 3662
74 Ga0070680_100050348 3300005336 Bacteria 3397
75 Ga0070680_100069042 3300005336 Bacteria 2901
76 Ga0070680_100087628 3300005336 Bacteria 2575
77 Ga0070680_100314700 3300005336 Bacteria 1328
78 Ga0070680_100373251 3300005336 Bacteria 1214
79 Ga0070680_100378701 3300005336 Bacteria 1205
80 Ga0070680_100442334 3300005336 Bacteria 1110
81 Ga0070680_100471466 3300005336 Bacteria 1073
82 Ga0070682_100125509 3300005337 Bacteria 1729
83 Ga0070682_100229953 3300005337 Bacteria 1325
84 Ga0070682_100382888 3300005337 Bacteria 1058
85 Ga0070682_100556699 3300005337 Unclassified 898
86 Ga0070682_101686893 3300005337 Unclassified 550
87 Ga0070682_101724306 3300005337 Unclassified 545
88 Ga0068868_101341298 3300005338 Unclassified 665
89 Ga0070660_100012909 3300005339 Bacteria 5977
90 Ga0070660_100125019 3300005339 Bacteria 2055
91 Ga0070660_100666225 3300005339 Bacteria 872
92 Ga0070660_100741289 3300005339 Bacteria 825
93 Ga0070660_100785146 3300005339 Bacteria 801
94 Ga0070660_100945336 3300005339 Bacteria 728
95 Ga0070689_100125500 3300005340 Bacteria 2053
96 Ga0070691_10021952 3300005341 Bacteria 2958
97 Ga0070691_10178744 3300005341 Bacteria 1103
98 Ga0070691_10353471 3300005341 Bacteria 817
99 Ga0070691_10856079 3300005341 Unclassified 558
100 Ga0070687_100014103 3300005343 Bacteria 3582
101 Ga0070687_100275992 3300005343 Bacteria 1056
102 Ga0070687_100301426 3300005343 Bacteria 1017
103 Ga0070661_100002985 3300005344 Bacteria 11659
104 Ga0070661_100003411 3300005344 Bacteria 10978
105 Ga0070661_100003797 3300005344 Bacteria 10410
106 Ga0070661_100015035 3300005344 Bacteria 5460
107 Ga0070661_100035622 3300005344 Bacteria 3615
108 Ga0070661_100065843 3300005344 Bacteria 2662
109 Ga0070661_100092097 3300005344 Bacteria 2245
110 Ga0070661_100978447 3300005344 Bacteria 701
111 Ga0070692_10104273 3300005345 Bacteria 1559
112 Ga0070692_10452886 3300005345 Bacteria 822
113 Ga0070692_10455385 3300005345 Bacteria 820
114 Ga0070692_10543731 3300005345 Bacteria 760
115 Ga0070692_10798877 3300005345 Bacteria 644
116 Ga0070668_100003043 3300005347 Bacteria 12405
117 Ga0070668_100110467 3300005347 Bacteria 2188
118 Ga0070669_100003079 3300005353 Bacteria 12001
119 Ga0070669_100006567 3300005353 Bacteria 8369
120 Ga0070669_100017058 3300005353 Bacteria 5181
121 Ga0070669_100628490 3300005353 Bacteria 902
122 Ga0070669_101526970 3300005353 Bacteria 581
123 Ga0070675_100002631 3300005354 Bacteria 13492
124 Ga0070675_100002663 3300005354 Bacteria 13424
125 Ga0070675_100129213 3300005354 Bacteria 2152
126 Ga0070675_100443798 3300005354 Bacteria 1163
127 Ga0070675_100538919 3300005354 Bacteria 1054
128 Ga0070675_100628948 3300005354 Bacteria 975
129 Ga0070671_100023147 3300005355 Bacteria 5080
130 Ga0070671_100119992 3300005355 Bacteria 2212
131 Ga0070671_100306722 3300005355 Bacteria 1352
132 Ga0070671_100948637 3300005355 Bacteria 752
133 Ga0070674_100002673 3300005356 Bacteria 9876
134 Ga0070674_100005627 3300005356 Bacteria 7257
135 Ga0070674_100090184 3300005356 Bacteria 2211
136 Ga0070674_100716610 3300005356 Bacteria 857
137 Ga0070674_101373216 3300005356 Bacteria 632
138 Ga0070673_100071202 3300005364 Bacteria 2793
139 Ga0070673_100174961 3300005364 Bacteria 1834
140 Ga0070673_100423788 3300005364 Unclassified 1193
141 Ga0070688_100002319 3300005365 Bacteria 9618
142 Ga0070688_100210072 3300005365 Bacteria 1366
143 Ga0070659_100008807 3300005366 Bacteria 7392
144 Ga0070659_100045001 3300005366 Bacteria 3457
145 Ga0070659_100098927 3300005366 Bacteria 2346
146 Ga0070659_100125537 3300005366 Bacteria 2082
147 Ga0070659_100182606 3300005366 Bacteria 1722
148 Ga0070659_100372354 3300005366 Bacteria 1202
149 Ga0070659_101093415 3300005366 Bacteria 702
150 Ga0070659_101305541 3300005366 Bacteria 644
151 Ga0070667_100078670 3300005367 Unclassified 2817
152 Ga0070703_10045433 3300005406 Bacteria 1385
153 Ga0070709_10004387 3300005434 Bacteria 7607
154 Ga0070709_10127383 3300005434 Bacteria 1734
155 Ga0070709_10250300 3300005434 Unclassified 1276
156 Ga0070714_100017298 3300005435 Bacteria 5839
157 Ga0070714_100059789 3300005435 Bacteria 3268
158 Ga0070714_101233724 3300005435 Unclassified 729
159 Ga0070713_100007166 3300005436 Bacteria 7803
160 Ga0070713_100044534 3300005436 Bacteria 3633
161 Ga0070713_100116823 3300005436 Bacteria 2334
162 Ga0070713_100460388 3300005436 Unclassified 1196
163 Ga0070713_100497774 3300005436 Bacteria 1150
164 Ga0070713_102030405 3300005436 Unclassified 558
165 Ga0070710_10184315 3300005437 Unclassified 1309
166 Ga0070710_10208052 3300005437 Bacteria 1239
167 Ga0070701_10066722 3300005438 Bacteria 1913
168 Ga0070701_10081963 3300005438 Unclassified 1748
169 Ga0070701_10197945 3300005438 Bacteria 1186
170 Ga0070711_100032354 3300005439 Bacteria 3477
171 Ga0070711_100093604 3300005439 Bacteria 2170
172 Ga0070711_100197012 3300005439 Bacteria 1552
173 Ga0070711_100551202 3300005439 Bacteria 956
174 Ga0070711_101492201 3300005439 Bacteria 590
175 Ga0070705_100008002 3300005440 Bacteria 5226
176 Ga0070705_100260434 3300005440 Bacteria 1223
177 Ga0070700_100084227 3300005441 Bacteria 2060
178 Ga0070700_100273692 3300005441 Bacteria 1221
179 Ga0070700_100426352 3300005441 Bacteria 1003
180 Ga0070694_100026031 3300005444 Unclassified 3789
181 Ga0070694_100071018 3300005444 Bacteria 2399
182 Ga0070694_100389417 3300005444 Bacteria 1089
183 Ga0070708_100000198 3300005445 Bacteria 44012
184 Ga0070708_100319285 3300005445 Bacteria 1463
185 Ga0070708_100319362 3300005445 Bacteria 1463
186 Ga0070708_100335521 3300005445 Unclassified 1425
187 Ga0070708_102155434 3300005445 Unclassified 515
188 Ga0070663_100006553 3300005455 Bacteria 7017
189 Ga0070663_100026569 3300005455 Bacteria 3923
190 Ga0070663_100426316 3300005455 Unclassified 1089
191 Ga0070663_100462429 3300005455 Bacteria 1048
192 Ga0070663_100628698 3300005455 Bacteria 906
193 Ga0070663_100846071 3300005455 Unclassified 787
194 Ga0070663_100969771 3300005455 Bacteria 738
195 Ga0070678_100216556 3300005456 Bacteria 1589
196 Ga0070678_100318911 3300005456 Bacteria 1326
197 Ga0070678_100941283 3300005456 Unclassified 791
198 Ga0070678_101712329 3300005456 Unclassified 592
199 Ga0070662_100005643 3300005457 Bacteria 8003
200 Ga0070662_100008788 3300005457 Bacteria 6588
201 Ga0070662_100317522 3300005457 Bacteria 1269
202 Ga0070662_101025354 3300005457 Bacteria 707
203 Ga0070662_101027303 3300005457 Bacteria 706
204 Ga0070662_101457880 3300005457 Bacteria 590
205 Ga0070681_10000404 3300005458 Bacteria 35078
206 Ga0070681_10002832 3300005458 Bacteria 16029
207 Ga0070681_10003332 3300005458 Bacteria 15018
208 Ga0070681_10003955 3300005458 Bacteria 13970
209 Ga0070681_10010307 3300005458 Bacteria 9226
210 Ga0070681_10039341 3300005458 Bacteria 4741
211 Ga0070681_10044751 3300005458 Bacteria 4431
212 Ga0070681_10061350 3300005458 Bacteria 3735
213 Ga0070681_10169614 3300005458 Unclassified 2104
214 Ga0070681_10330035 3300005458 Bacteria 1435
215 Ga0070681_10363900 3300005458 Bacteria 1357
216 Ga0070681_10543348 3300005458 Bacteria 1076
217 Ga0070681_10586316 3300005458 Bacteria 1029
218 Ga0070681_11039480 3300005458 Bacteria 739
219 Ga0070681_11206837 3300005458 Bacteria 678
220 Ga0070681_11206838 3300005458 Bacteria 678
221 Ga0070681_12049106 3300005458 Unclassified 500
222 Ga0068867_100005117 3300005459 Bacteria 9266
223 Ga0068867_100010994 3300005459 Bacteria 6381
224 Ga0068867_100080320 3300005459 Bacteria 2455
225 Ga0068867_100937268 3300005459 Unclassified 781
226 Ga0068867_101231203 3300005459 Bacteria 689
227 Ga0068867_101566659 3300005459 Unclassified 615
228 Ga0070685_10237064 3300005466 Bacteria 1203
229 Ga0070706_100180612 3300005467 Bacteria 1970
230 Ga0070706_100638097 3300005467 Bacteria 989
231 Ga0070706_101174498 3300005467 Bacteria 706
232 Ga0070707_100172133 3300005468 Bacteria 2110
233 Ga0070707_100253278 3300005468 Bacteria 1713
234 Ga0070707_100338019 3300005468 Bacteria 1463
235 Ga0070707_100748109 3300005468 Unclassified 941
236 Ga0070698_100012821 3300005471 Bacteria 8876
237 Ga0070698_100033083 3300005471 Bacteria 5356
238 Ga0070698_100060582 3300005471 Bacteria 3820
239 Ga0070698_100245585 3300005471 Bacteria 1723
240 Ga0070698_100297994 3300005471 Unclassified 1543
241 Ga0070699_100075909 3300005518 Bacteria 2925
242 Ga0070699_100142767 3300005518 Bacteria 2115
243 Ga0070699_100269595 3300005518 Bacteria 1523
244 Ga0070699_100762451 3300005518 Unclassified 885
245 Ga0070679_100000919 3300005530 Bacteria 25597
246 Ga0070679_100001084 3300005530 Bacteria 23776
247 Ga0070679_100006169 3300005530 Bacteria 11157
248 Ga0070679_100043081 3300005530 Bacteria 4496
249 Ga0070679_100043325 3300005530 Bacteria 4482
250 Ga0070679_100095100 3300005530 Bacteria 2967
251 Ga0070679_100245133 3300005530 Bacteria 1749
252 Ga0070679_100359492 3300005530 Unclassified 1403
253 Ga0070679_100408428 3300005530 Bacteria 1303
254 Ga0070679_100670594 3300005530 Bacteria 980
255 Ga0070679_100702985 3300005530 Bacteria 954
256 Ga0070679_101279873 3300005530 Bacteria 679
257 Ga0070679_101506731 3300005530 Unclassified 619
258 Ga0070684_100006699 3300005535 Bacteria 8930
259 Ga0070684_100024585 3300005535 Bacteria 5055
260 Ga0070684_100038174 3300005535 Bacteria 4124
261 Ga0070684_100043865 3300005535 Bacteria 3864
262 Ga0070684_100076836 3300005535 Unclassified 2948
263 Ga0070684_100297248 3300005535 Bacteria 1481
264 Ga0070684_100301427 3300005535 Bacteria 1470
265 Ga0070684_100365457 3300005535 Bacteria 1328
266 Ga0070684_100387243 3300005535 Bacteria 1288
267 Ga0070684_100390698 3300005535 Bacteria 1282
268 Ga0070684_100725714 3300005535 Bacteria 927
269 Ga0070697_100659546 3300005536 Bacteria 922
270 Ga0068853_100013646 3300005539 Bacteria 6638
271 Ga0068853_100016074 3300005539 Bacteria 6155
272 Ga0068853_100487555 3300005539 Bacteria 1162
273 Ga0068853_100531253 3300005539 Bacteria 1113
274 Ga0068853_100600016 3300005539 Bacteria 1045
275 Ga0068853_101020938 3300005539 Unclassified 796
276 Ga0070672_100004984 3300005543 Bacteria 8750
277 Ga0070672_100005766 3300005543 Bacteria 8256
278 Ga0070672_100206844 3300005543 Bacteria 1643
279 Ga0070672_102093168 3300005543 Bacteria 510
280 Ga0070686_100256050 3300005544 Bacteria 1281
281 Ga0070686_100505251 3300005544 Bacteria 939
282 Ga0070695_100001483 3300005545 Bacteria 13033
283 Ga0070695_100246326 3300005545 Bacteria 1299
284 Ga0070695_100441644 3300005545 Bacteria 995
285 Ga0070695_100461616 3300005545 Bacteria 975
286 Ga0070695_101161069 3300005545 Bacteria 634
287 Ga0070696_100001375 3300005546 Bacteria 15888
288 Ga0070696_100007637 3300005546 Bacteria 7228
289 Ga0070696_100077827 3300005546 Bacteria 2344
290 Ga0070696_100091579 3300005546 Unclassified 2165
291 Ga0070696_101883053 3300005546 Bacteria 518
292 Ga0070693_100008533 3300005547 Bacteria 5058
293 Ga0070693_100013713 3300005547 Bacteria 4136
294 Ga0070693_100057558 3300005547 Bacteria 2247
295 Ga0070693_100503499 3300005547 Bacteria 859
296 Ga0070693_100912568 3300005547 Unclassified 659
297 Ga0070665_100042538 3300005548 Bacteria 4567
298 Ga0070665_100052068 3300005548 Unclassified 4107
299 Ga0070665_102600001 3300005548 Bacteria 507
300 Ga0070704_100227659 3300005549 Bacteria 1519
301 Ga0070704_100285705 3300005549 Bacteria 1369
302 Ga0070704_101093287 3300005549 Bacteria 724
303 Ga0068855_100002169 3300005563 Bacteria 24243
304 Ga0068855_100005082 3300005563 Bacteria 16038
305 Ga0068855_100008571 3300005563 Bacteria 12363
306 Ga0068855_100043978 3300005563 Bacteria 5288
307 Ga0068855_100366932 3300005563 Bacteria 1583
308 Ga0068855_100381898 3300005563 Unclassified 1547
309 Ga0068855_100646997 3300005563 Bacteria 1136
310 Ga0068855_100990687 3300005563 Bacteria 883
311 Ga0068855_101054914 3300005563 Unclassified 851
312 Ga0068855_101547206 3300005563 Bacteria 680
313 Ga0070664_100013154 3300005564 Bacteria 6738
314 Ga0070664_100024766 3300005564 Bacteria 4968
315 Ga0070664_100051722 3300005564 Bacteria 3478
316 Ga0070664_100485014 3300005564 Bacteria 1138
317 Ga0070664_101004731 3300005564 Bacteria 784
318 Ga0070664_101389984 3300005564 Unclassified 663
319 Ga0068857_100012151 3300005577 Bacteria 7490
320 Ga0068857_100012440 3300005577 Bacteria 7408
321 Ga0068857_100015739 3300005577 Bacteria 6617
322 Ga0068857_100020862 3300005577 Bacteria 5764
323 Ga0068857_100087176 3300005577 Bacteria 2792
324 Ga0068857_100736577 3300005577 Bacteria 938
325 Ga0068854_100000340 3300005578 Bacteria 30112
326 Ga0068854_100034276 3300005578 Bacteria 3545
327 Ga0068854_100053241 3300005578 Bacteria 2905
328 Ga0068854_100420152 3300005578 Bacteria 1110
329 Ga0068854_100745723 3300005578 Bacteria 849
330 Ga0068854_100790047 3300005578 Unclassified 826
331 Ga0068854_101739925 3300005578 Unclassified 571
332 Ga0068856_100364022 3300005614 Bacteria 1465
333 Ga0068856_100457035 3300005614 Bacteria 1298
334 Ga0068856_100648460 3300005614 Bacteria 1076
335 Ga0068856_100680175 3300005614 Unclassified 1049
336 Ga0068856_100941185 3300005614 Unclassified 883
337 Ga0068856_101002356 3300005614 Unclassified 853
338 Ga0070702_100015870 3300005615 Bacteria 3854
339 Ga0070702_100518545 3300005615 Bacteria 879
340 Ga0068852_100014974 3300005616 Bacteria 5995
341 Ga0068852_100018984 3300005616 Bacteria 5431
342 Ga0068852_100069165 3300005616 Bacteria 3093
343 Ga0068852_100192890 3300005616 Bacteria 1923
344 Ga0068852_100202237 3300005616 Bacteria 1880
345 Ga0068852_100546103 3300005616 Unclassified 1159
346 Ga0068852_101079483 3300005616 Bacteria 823
347 Ga0068852_101434378 3300005616 Bacteria 712
348 Ga0068859_100056150 3300005617 Bacteria 3962
349 Ga0068859_100897660 3300005617 Unclassified 971
350 Ga0068864_100005386 3300005618 Bacteria 10484
351 Ga0068864_100038902 3300005618 Bacteria 4064
352 Ga0068864_100318803 3300005618 Bacteria 1459
353 Ga0068864_100369234 3300005618 Bacteria 1357
354 Ga0068864_101236591 3300005618 Bacteria 746
355 Ga0068866_10000524 3300005718 Bacteria 17645
356 Ga0068866_10116924 3300005718 Bacteria 1496
357 Ga0068866_10376060 3300005718 Unclassified 910
358 Ga0068866_10812860 3300005718 Bacteria 651
359 Ga0068861_100001019 3300005719 Bacteria 17119
360 Ga0068861_100049474 3300005719 Bacteria 3183
361 Ga0068861_100289917 3300005719 Bacteria 1413
362 Ga0068861_100944581 3300005719 Unclassified 820
363 Ga0068851_10015465 3300005834 Bacteria 3636
364 Ga0068851_10071393 3300005834 Unclassified 1797
365 Ga0068851_10269088 3300005834 Bacteria 971
366 Ga0068870_10002079 3300005840 Bacteria 8295
367 Ga0068870_10304076 3300005840 Bacteria 1008
368 Ga0068870_10408049 3300005840 Bacteria 886
369 Ga0068870_10428249 3300005840 Bacteria 867
370 Ga0068870_10492048 3300005840 Bacteria 816
371 Ga0068863_100041206 3300005841 Bacteria 4390
372 Ga0068863_100160660 3300005841 Bacteria 2153
373 Ga0068863_100319991 3300005841 Unclassified 1507
374 Ga0068858_100022826 3300005842 Bacteria 5836
375 Ga0068858_100321105 3300005842 Bacteria 1480
376 Ga0068860_100040126 3300005843 Bacteria 4476
377 Ga0068860_100227646 3300005843 Bacteria 1811
378 Ga0068860_100535547 3300005843 Bacteria 1172
379 Ga0068862_100000376 3300005844 Bacteria 48418
380 Ga0068862_100030151 3300005844 Bacteria 4570
381 Ga0068862_100126281 3300005844 Bacteria 2258
382 Ga0081455_10038603 3300005937 Bacteria 4227
383 Ga0081455_10050687 3300005937 Bacteria 3566
384 Ga0081539_10000104 3300005985 Bacteria 197478
385 Ga0081539_10043960 3300005985 Unclassified 2583
386 Ga0081539_10230857 3300005985 Bacteria 835
387 Ga0070717_10016213 3300006028 Bacteria 5773
388 Ga0070717_10418219 3300006028 Unclassified 1206
389 Ga0070717_10918133 3300006028 Unclassified 797
390 Ga0075432_10382237 3300006058 Unclassified 604
391 Ga0070716_100172719 3300006173 Bacteria 1412
392 Ga0070716_100338785 3300006173 Unclassified 1060
393 Ga0070716_100489729 3300006173 Bacteria 905
394 Ga0070716_100573872 3300006173 Bacteria 844
395 Ga0070716_100851716 3300006173 Bacteria 710
396 Ga0070712_100012458 3300006175 Bacteria 5407
397 Ga0070712_100028870 3300006175 Bacteria 3714
398 Ga0070712_100062454 3300006175 Bacteria 2634
399 Ga0070712_100347417 3300006175 Unclassified 1213
400 Ga0070712_100413145 3300006175 Unclassified 1117
401 Ga0070712_100488267 3300006175 Unclassified 1031
402 Ga0097621_100208928 3300006237 Bacteria 1697
403 Ga0068871_100139055 3300006358 Bacteria 2064
404 Ga0068871_100407653 3300006358 Bacteria 1211
405 Ga0075428_100235434 3300006844 Bacteria 1976
406 Ga0075428_100397778 3300006844 Bacteria 1477
407 Ga0075428_101094780 3300006844 Bacteria 842
408 Ga0075428_101376680 3300006844 Bacteria 741
409 Ga0075428_101708408 3300006844 Bacteria 657
410 Ga0075430_100003192 3300006846 Bacteria 13741
411 Ga0075430_100013015 3300006846 Bacteria 7091
412 Ga0075430_100019170 3300006846 Bacteria 5816
413 Ga0075430_100029938 3300006846 Bacteria 4622
414 Ga0075430_100194674 3300006846 Bacteria 1684
415 Ga0075430_100269583 3300006846 Bacteria 1409
416 Ga0075431_100024864 3300006847 Bacteria 6141
417 Ga0075431_100037185 3300006847 Bacteria 5017
418 Ga0075431_100053473 3300006847 Unclassified 4164
419 Ga0075431_100065457 3300006847 Bacteria 3753
420 Ga0075431_100076205 3300006847 Bacteria 3461
421 Ga0075431_100135269 3300006847 Bacteria 2541
422 Ga0075431_100186854 3300006847 Bacteria 2125
423 Ga0075431_100236239 3300006847 Bacteria 1861
424 Ga0075431_100247272 3300006847 Bacteria 1813
425 Ga0075431_100373540 3300006847 Unclassified 1431
426 Ga0075433_10005348 3300006852 Bacteria 10079
427 Ga0075433_10718897 3300006852 Bacteria 874
428 Ga0075434_100001804 3300006871 Bacteria 18514
429 Ga0075434_100035507 3300006871 Bacteria 4929
430 Ga0075434_100244634 3300006871 Bacteria 1814
431 Ga0075434_100261801 3300006871 Bacteria 1749
432 Ga0075434_100873154 3300006871 Bacteria 915
433 Ga0075434_100881508 3300006871 Bacteria 910
434 Ga0075429_100067642 3300006880 Bacteria 3108
435 Ga0075429_100208196 3300006880 Bacteria 1713
436 Ga0075429_100453510 3300006880 Bacteria 1124
437 Ga0075429_100470855 3300006880 Bacteria 1101
438 Ga0068865_100001514 3300006881 Bacteria 13558
439 Ga0068865_100117526 3300006881 Bacteria 1971
440 Ga0068865_100628234 3300006881 Unclassified 910
441 Ga0075436_100114952 3300006914 Bacteria 1879
442 Ga0075436_100194376 3300006914 Bacteria 1436
443 Ga0075436_100209048 3300006914 Bacteria 1383
444 Ga0097620_100056151 3300006931 Bacteria 3962
445 Ga0097620_100897771 3300006931 Unclassified 971
446 Ga0075435_100694998 3300007076 Bacteria 884
447 Ga0075435_100980540 3300007076 Unclassified 738
448 Ga0075435_101112837 3300007076 Bacteria 690
449 Ga0075435_101766042 3300007076 Unclassified 543
450 Ga0105240_10009204 3300009093 Bacteria 14007
451 Ga0105240_10011015 3300009093 Bacteria 12657
452 Ga0105240_10016684 3300009093 Bacteria 9932
453 Ga0105240_10037426 3300009093 Bacteria 6236
454 Ga0105240_10046608 3300009093 Bacteria 5492
455 Ga0105240_10070716 3300009093 Bacteria 4316
456 Ga0105240_10074073 3300009093 Bacteria 4204
457 Ga0105240_10090200 3300009093 Bacteria 3747
458 Ga0105240_10705779 3300009093 Bacteria 1101
459 Ga0105240_10890443 3300009093 Bacteria 958
460 Ga0105240_11048922 3300009093 Unclassified 870
461 Ga0111539_10042342 3300009094 Bacteria 5469
462 Ga0111539_10088891 3300009094 Bacteria 3629
463 Ga0111539_10150269 3300009094 Bacteria 2726
464 Ga0111539_10251608 3300009094 Bacteria 2057
465 Ga0111539_10920564 3300009094 Bacteria 1017
466 Ga0105245_10025521 3300009098 Bacteria 5198
467 Ga0105245_10036543 3300009098 Bacteria 4364
468 Ga0105245_12730105 3300009098 Bacteria 547
469 Ga0105247_10439480 3300009101 Bacteria 938
470 Ga0114129_10017266 3300009147 Bacteria 10277
471 Ga0114129_10068560 3300009147 Bacteria 4946
472 Ga0114129_10230022 3300009147 Bacteria 2497
473 Ga0114129_10273868 3300009147 Bacteria 2257
474 Ga0114129_10299783 3300009147 Bacteria 2143
475 Ga0114129_10477216 3300009147 Archaea 1632
476 Ga0114129_10941962 3300009147 Bacteria 1091
477 Ga0114129_11407312 3300009147 Bacteria 860
478 Ga0105243_10042543 3300009148 Bacteria 3556
479 Ga0105243_10242951 3300009148 Bacteria 1603
480 Ga0105243_10590746 3300009148 Bacteria 1067
481 Ga0105241_10000729 3300009174 Bacteria 24921
482 Ga0105241_10024142 3300009174 Bacteria 4515
483 Ga0105241_10116790 3300009174 Bacteria 2143
484 Ga0105241_10169367 3300009174 Bacteria 1803
485 Ga0105241_10525033 3300009174 Bacteria 1059
486 Ga0105241_10717479 3300009174 Bacteria 914
487 Ga0105241_11098168 3300009174 Unclassified 749
488 Ga0105242_10006526 3300009176 Bacteria 8978
489 Ga0105242_10015995 3300009176 Bacteria 5830
490 Ga0105242_10181321 3300009176 Unclassified 1858
491 Ga0105242_10993453 3300009176 Unclassified 846
492 Ga0105242_11994438 3300009176 Bacteria 622
493 Ga0105248_10009365 3300009177 Bacteria 10781
494 Ga0105248_10011120 3300009177 Bacteria 9932
495 Ga0105248_10104035 3300009177 Bacteria 3200
496 Ga0105248_10916580 3300009177 Bacteria 990
497 Ga0105248_12078802 3300009177 Bacteria 646
498 Ga0105237_10079939 3300009545 Bacteria 3259
499 Ga0105237_10149201 3300009545 Bacteria 2334
500 Ga0105237_10431669 3300009545 Bacteria 1323
501 Ga0105237_10472521 3300009545 Bacteria 1260
502 Ga0105237_11009553 3300009545 Bacteria 839
503 Ga0105237_11127262 3300009545 Unclassified 791
504 Ga0105238_10024368 3300009551 Bacteria 6168
505 Ga0105238_10066363 3300009551 Bacteria 3610
506 Ga0105238_10073038 3300009551 Bacteria 3425
507 Ga0105238_10087946 3300009551 Bacteria 3094
508 Ga0105238_10325721 3300009551 Bacteria 1523
509 Ga0105238_10816832 3300009551 Bacteria 948
510 Ga0105238_11465449 3300009551 Bacteria 711
511 Ga0105238_12277478 3300009551 Unclassified 577
512 Ga0105249_10000454 3300009553 Bacteria 38498
513 Ga0105249_10069734 3300009553 Bacteria 3245
514 Ga0105249_10190726 3300009553 Bacteria 2000
515 Ga0105249_10325281 3300009553 Bacteria 1550
516 Ga0105249_10809129 3300009553 Bacteria 1001
517 Ga0105239_10147980 3300010375 Bacteria 2620
518 Ga0105239_10231952 3300010375 Unclassified 2071
519 Ga0105239_10259676 3300010375 Bacteria 1952
520 Ga0105239_10382025 3300010375 Bacteria 1592
521 Ga0105239_11245419 3300010375 Unclassified 858
522 Ga0105239_12469307 3300010375 Unclassified 606
523 Ga0105246_10055844 3300011119 Bacteria 2727
524 Ga0105246_10471626 3300011119 Bacteria 1060
525 Ga0157342_1073673 3300012507 Unclassified 524
526 Ga0157373_10001473 3300013100 Bacteria 17949
527 Ga0157373_10027655 3300013100 Bacteria 4092
528 Ga0157373_10091952 3300013100 Bacteria 2136
529 Ga0157373_10152454 3300013100 Bacteria 1626
530 Ga0157373_10201626 3300013100 Bacteria 1403
531 Ga0157373_10237167 3300013100 Unclassified 1289
532 Ga0157373_11331309 3300013100 Bacteria 544
533 Ga0157371_10007275 3300013102 Bacteria 8992
534 Ga0157371_10714457 3300013102 Bacteria 751
535 Ga0157371_10743094 3300013102 Unclassified 736
536 Ga0157371_11534102 3300013102 Bacteria 520
537 Ga0157370_10003508 3300013104 Bacteria 18392
538 Ga0157370_10008754 3300013104 Bacteria 10881
539 Ga0157370_10041763 3300013104 Bacteria 4422
540 Ga0157370_10136189 3300013104 Bacteria 2289
541 Ga0157370_10165029 3300013104 Bacteria 2060
542 Ga0157370_10166493 3300013104 Bacteria 2050
543 Ga0157370_10282223 3300013104 Bacteria 1534
544 Ga0157370_10861985 3300013104 Unclassified 823
545 Ga0157370_11117989 3300013104 Bacteria 712
546 Ga0157370_11609613 3300013104 Unclassified 583
547 Ga0157369_10009705 3300013105 Bacteria 11007
548 Ga0157369_10017338 3300013105 Bacteria 8095
549 Ga0157369_10073925 3300013105 Bacteria 3656
550 Ga0157369_10115485 3300013105 Bacteria 2851
551 Ga0157369_10117595 3300013105 Bacteria 2822
552 Ga0157369_10119385 3300013105 Bacteria 2798
553 Ga0157369_10232225 3300013105 Bacteria 1928
554 Ga0157369_10232838 3300013105 Bacteria 1925
555 Ga0157369_10739412 3300013105 Bacteria 1012
556 Ga0157369_10743766 3300013105 Bacteria 1009
557 Ga0157369_11755948 3300013105 Unclassified 630
558 Ga0157374_10433589 3300013296 Bacteria 1314
559 Ga0157374_10990234 3300013296 Bacteria 860
560 Ga0157374_11098074 3300013296 Bacteria 816
561 Ga0157374_11385070 3300013296 Bacteria 726
562 Ga0157374_12425697 3300013296 Bacteria 552
563 Ga0157378_10005002 3300013297 Bacteria 11631
564 Ga0157378_10016080 3300013297 Bacteria 6553
565 Ga0157378_10429050 3300013297 Bacteria 1308
566 Ga0163162_10001492 3300013306 Bacteria 21813
567 Ga0163162_10013828 3300013306 Bacteria 7885
568 Ga0163162_10075056 3300013306 Bacteria 3441
569 Ga0163162_12869838 3300013306 Unclassified 555
570 Ga0163162_13441632 3300013306 Unclassified 504
571 Ga0157372_10010171 3300013307 Bacteria 9988
572 Ga0157372_10013087 3300013307 Bacteria 8852
573 Ga0157372_10015470 3300013307 Bacteria 8178
574 Ga0157372_10025540 3300013307 Bacteria 6425
575 Ga0157372_10068103 3300013307 Bacteria 4002
576 Ga0157372_10118363 3300013307 Bacteria 3039
577 Ga0157372_10124994 3300013307 Bacteria 2957
578 Ga0157372_10252248 3300013307 Bacteria 2048
579 Ga0157372_10317512 3300013307 Bacteria 1814
580 Ga0157372_10367523 3300013307 Bacteria 1676
581 Ga0157372_10382231 3300013307 Bacteria 1640
582 Ga0157372_10509511 3300013307 Bacteria 1403
583 Ga0157372_10519876 3300013307 Unclassified 1388
584 Ga0157372_10617092 3300013307 Bacteria 1264
585 Ga0157372_10636435 3300013307 Unclassified 1242
586 Ga0157372_10659924 3300013307 Bacteria 1218
587 Ga0157372_10696387 3300013307 Bacteria 1182
588 Ga0157372_11287462 3300013307 Bacteria 844
589 Ga0157372_11664064 3300013307 Bacteria 734
590 Ga0157372_11736237 3300013307 Bacteria 718
591 Ga0157372_11902482 3300013307 Bacteria 684
592 Ga0157372_12279322 3300013307 Bacteria 622
593 Ga0157372_12346199 3300013307 Bacteria 613
594 Ga0157372_12369999 3300013307 Unclassified 609
595 Ga0157372_12614981 3300013307 Bacteria 579
596 Ga0157375_10091745 3300013308 Bacteria 3100
597 Ga0157375_10100651 3300013308 Bacteria 2971
598 Ga0157375_10294846 3300013308 Bacteria 1785
599 Ga0157375_10840832 3300013308 Bacteria 1065
600 Ga0163163_10070485 3300014325 Bacteria 3481
601 Ga0163163_10660291 3300014325 Bacteria 1109
602 Ga0157380_10007646 3300014326 Bacteria 7684
603 Ga0157380_10033634 3300014326 Bacteria 3949
604 Ga0157380_10148905 3300014326 Bacteria 2021
605 Ga0157380_10278831 3300014326 Bacteria 1528
606 Ga0157380_12670253 3300014326 Bacteria 566
607 Ga0182008_10009299 3300014497 Bacteria 5312
608 Ga0182008_10081193 3300014497 Bacteria 1596
609 Ga0157377_10031866 3300014745 Bacteria 2867
610 Ga0157379_10015608 3300014968 Bacteria 6670
611 Ga0157379_10064796 3300014968 Bacteria 3265
612 Ga0157376_10093515 3300014969 Bacteria 2610
613 Ga0157376_10225367 3300014969 Unclassified 1739
614 Ga0157376_11130927 3300014969 Bacteria 810
615 Ga0157376_11883363 3300014969 Bacteria 635
616 Ga0182007_10042612 3300015262 Unclassified 1510
617 Ga0182007_10073079 3300015262 Unclassified 1123
618 Ga0182007_10210130 3300015262 Bacteria 684
619 Ga0182007_10215945 3300015262 Unclassified 676
620 Ga0182007_10254854 3300015262 Bacteria 631
621 Ga0182005_1079726 3300015265 Unclassified 903
622 Ga0163161_10150679 3300017792 Bacteria 1767
623 Ga0163161_11802713 3300017792 Unclassified 544
624 Ga0197907_11166881 3300020069 Bacteria 793
625 Ga0197907_11314107 3300020069 Bacteria 1027
626 Ga0206356_10116592 3300020070 Unclassified 681
627 Ga0206356_10125692 3300020070 Bacteria 1524
628 Ga0206356_10416445 3300020070 Bacteria 748
629 Ga0206356_10483138 3300020070 Bacteria 644
630 Ga0206356_10839536 3300020070 Unclassified 730
631 Ga0206356_11361504 3300020070 Bacteria 842
632 Ga0206356_11525656 3300020070 Bacteria 806
633 Ga0206356_11642972 3300020070 Bacteria 627
634 Ga0206356_11798847 3300020070 Bacteria 567
635 Ga0206355_1012074 3300020076 Bacteria 594
636 Ga0206355_1360271 3300020076 Bacteria 773
637 Ga0206352_10641371 3300020078 Bacteria 625
638 Ga0206352_10860556 3300020078 Bacteria 760
639 Ga0206352_10936146 3300020078 Bacteria 1046
640 Ga0206352_11130402 3300020078 Unclassified 791
641 Ga0206352_11362427 3300020078 Bacteria 1025
642 Ga0206350_10135957 3300020080 Bacteria 835
643 Ga0213876_10040236 3300021384 Bacteria 2469
644 Ga0224712_10152424 3300022467 Bacteria 1025
645 Ga0224712_10316866 3300022467 Unclassified 732
646 Ga0224712_10352983 3300022467 Bacteria 695
647 Ga0224712_10681828 3300022467 Bacteria 505
648 Ga0207666_1047325 3300025271 Unclassified 678
649 Ga0207673_1009498 3300025290 Bacteria 1243
650 Ga0207697_10005445 3300025315 Bacteria 5918
651 Ga0207697_10112113 3300025315 Bacteria 1169
652 Ga0207656_10006385 3300025321 Bacteria 4232
653 Ga0207656_10172199 3300025321 Bacteria 1035
654 Ga0207653_10092535 3300025885 Bacteria 1061
655 Ga0207682_10168826 3300025893 Bacteria 994
656 Ga0207692_10101751 3300025898 Bacteria 1579
657 Ga0207692_10231793 3300025898 Unclassified 1099
658 Ga0207642_10069746 3300025899 Bacteria 1668
659 Ga0207642_10150415 3300025899 Bacteria 1238
660 Ga0207688_10023241 3300025901 Bacteria 3394
661 Ga0207688_10186830 3300025901 Bacteria 1238
662 Ga0207680_10113171 3300025903 Bacteria 1764
663 Ga0207680_10213827 3300025903 Bacteria 1319
664 Ga0207680_10821322 3300025903 Unclassified 666
665 Ga0207647_10195587 3300025904 Bacteria 1171
666 Ga0207685_10513020 3300025905 Bacteria 632
667 Ga0207699_10008459 3300025906 Bacteria 5081
668 Ga0207699_10045530 3300025906 Bacteria 2561
669 Ga0207699_10106448 3300025906 Bacteria 1790
670 Ga0207699_10106541 3300025906 Bacteria 1789
671 Ga0207645_10000246 3300025907 Bacteria 44995
672 Ga0207645_10000971 3300025907 Bacteria 23712
673 Ga0207645_10067632 3300025907 Bacteria 2284
674 Ga0207643_10001951 3300025908 Bacteria 11403
675 Ga0207643_10076653 3300025908 Unclassified 1932
676 Ga0207643_10131229 3300025908 Bacteria 1491
677 Ga0207643_10266169 3300025908 Unclassified 1059
678 Ga0207705_10007986 3300025909 Bacteria 7763
679 Ga0207705_10085948 3300025909 Bacteria 2298
680 Ga0207705_10089643 3300025909 Bacteria 2251
681 Ga0207705_10092825 3300025909 Bacteria 2212
682 Ga0207705_10104101 3300025909 Bacteria 2091
683 Ga0207705_10568143 3300025909 Bacteria 882
684 Ga0207684_10135612 3300025910 Bacteria 2114
685 Ga0207684_10299794 3300025910 Bacteria 1386
686 Ga0207684_11538460 3300025910 Unclassified 540
687 Ga0207684_11568418 3300025910 Bacteria 534
688 Ga0207654_10000860 3300025911 Bacteria 16810
689 Ga0207654_10222487 3300025911 Bacteria 1253
690 Ga0207654_10324081 3300025911 Bacteria 1054
691 Ga0207654_10756775 3300025911 Bacteria 700
692 Ga0207654_10955665 3300025911 Bacteria 622
693 Ga0207654_11030082 3300025911 Bacteria 599
694 Ga0207707_10000929 3300025912 Bacteria 28400
695 Ga0207707_10002146 3300025912 Bacteria 17846
696 Ga0207707_10002891 3300025912 Bacteria 15329
697 Ga0207707_10007791 3300025912 Bacteria 9323
698 Ga0207707_10013410 3300025912 Bacteria 7146
699 Ga0207707_10018294 3300025912 Bacteria 6109
700 Ga0207707_10021378 3300025912 Bacteria 5656
701 Ga0207707_10029197 3300025912 Bacteria 4820
702 Ga0207707_10075721 3300025912 Bacteria 2937
703 Ga0207707_10138032 3300025912 Unclassified 2132
704 Ga0207707_10629028 3300025912 Bacteria 906
705 Ga0207707_10649450 3300025912 Bacteria 889
706 Ga0207707_11269747 3300025912 Bacteria 593
707 Ga0207695_10001441 3300025913 Bacteria 39845
708 Ga0207695_10004676 3300025913 Bacteria 18554
709 Ga0207695_10008984 3300025913 Bacteria 12435
710 Ga0207695_10014206 3300025913 Bacteria 9447
711 Ga0207695_10020766 3300025913 Bacteria 7513
712 Ga0207695_10044422 3300025913 Bacteria 4726
713 Ga0207695_10064710 3300025913 Bacteria 3763
714 Ga0207695_10081615 3300025913 Bacteria 3272
715 Ga0207695_10084488 3300025913 Bacteria 3205
716 Ga0207671_10019018 3300025914 Bacteria 5262
717 Ga0207671_10131053 3300025914 Bacteria 1924
718 Ga0207671_10390182 3300025914 Bacteria 1107
719 Ga0207693_10019839 3300025915 Bacteria 5346
720 Ga0207693_10041127 3300025915 Bacteria 3640
721 Ga0207693_10361743 3300025915 Bacteria 1135
722 Ga0207693_10406055 3300025915 Unclassified 1065
723 Ga0207693_10410453 3300025915 Unclassified 1058
724 Ga0207693_10421808 3300025915 Bacteria 1043
725 Ga0207693_10613331 3300025915 Bacteria 846
726 Ga0207663_10001490 3300025916 Bacteria 10915
727 Ga0207663_10080650 3300025916 Bacteria 2128
728 Ga0207663_10172527 3300025916 Bacteria 1537
729 Ga0207663_10243302 3300025916 Bacteria 1320
730 Ga0207663_10898578 3300025916 Bacteria 708
731 Ga0207663_11205783 3300025916 Bacteria 609
732 Ga0207660_10001809 3300025917 Bacteria 14242
733 Ga0207660_10017662 3300025917 Bacteria 4744
734 Ga0207660_10032222 3300025917 Bacteria 3616
735 Ga0207660_10065650 3300025917 Bacteria 2623
736 Ga0207660_10087746 3300025917 Bacteria 2299
737 Ga0207660_10090306 3300025917 Bacteria 2269
738 Ga0207660_10101186 3300025917 Bacteria 2152
739 Ga0207660_10141654 3300025917 Bacteria 1839
740 Ga0207660_10218233 3300025917 Bacteria 1496
741 Ga0207660_10239322 3300025917 Unclassified 1429
742 Ga0207660_10918590 3300025917 Bacteria 714
743 Ga0207660_11133214 3300025917 Bacteria 637
744 Ga0207662_10003841 3300025918 Bacteria 7805
745 Ga0207662_10105844 3300025918 Bacteria 1749
746 Ga0207662_10244175 3300025918 Unclassified 1176
747 Ga0207657_10005262 3300025919 Bacteria 13552
748 Ga0207657_10021232 3300025919 Bacteria 6115
749 Ga0207657_10237526 3300025919 Bacteria 1456
750 Ga0207657_10250158 3300025919 Bacteria 1413
751 Ga0207657_10541662 3300025919 Bacteria 910
752 Ga0207657_10685639 3300025919 Bacteria 796
753 Ga0207657_11469464 3300025919 Unclassified 510
754 Ga0207649_10029427 3300025920 Bacteria 3243
755 Ga0207649_10050337 3300025920 Bacteria 2576
756 Ga0207649_10096437 3300025920 Bacteria 1948
757 Ga0207649_10165257 3300025920 Bacteria 1537
758 Ga0207649_10174948 3300025920 Bacteria 1498
759 Ga0207649_10852542 3300025920 Bacteria 713
760 Ga0207652_10000470 3300025921 Bacteria 41380
761 Ga0207652_10003423 3300025921 Bacteria 13091
762 Ga0207652_10007324 3300025921 Bacteria 8892
763 Ga0207652_10020285 3300025921 Bacteria 5472
764 Ga0207652_10022221 3300025921 Bacteria 5244
765 Ga0207652_10024204 3300025921 Bacteria 5036
766 Ga0207652_10031148 3300025921 Bacteria 4476
767 Ga0207652_10086061 3300025921 Bacteria 2755
768 Ga0207652_10088832 3300025921 Bacteria 2712
769 Ga0207652_10267542 3300025921 Bacteria 1542
770 Ga0207652_10564050 3300025921 Bacteria 1023
771 Ga0207652_11525639 3300025921 Bacteria 572
772 Ga0207646_10123227 3300025922 Bacteria 2330
773 Ga0207646_10142024 3300025922 Bacteria 2163
774 Ga0207646_10424101 3300025922 Bacteria 1201
775 Ga0207681_10009785 3300025923 Bacteria 5864
776 Ga0207681_10054383 3300025923 Bacteria 2722
777 Ga0207681_10066558 3300025923 Bacteria 2494
778 Ga0207681_10221702 3300025923 Bacteria 1463
779 Ga0207694_10023333 3300025924 Bacteria 4696
780 Ga0207694_10137479 3300025924 Bacteria 1963
781 Ga0207694_10209118 3300025924 Bacteria 1589
782 Ga0207694_10360180 3300025924 Bacteria 1205
783 Ga0207694_10664094 3300025924 Bacteria 878
784 Ga0207694_11230706 3300025924 Unclassified 633
785 Ga0207650_10004487 3300025925 Bacteria 9540
786 Ga0207650_10101704 3300025925 Unclassified 2213
787 Ga0207650_10104656 3300025925 Bacteria 2184
788 Ga0207659_10003254 3300025926 Bacteria 9727
789 Ga0207659_10009170 3300025926 Bacteria 6179
790 Ga0207659_10555758 3300025926 Bacteria 976
791 Ga0207659_10642311 3300025926 Bacteria 907
792 Ga0207659_11039265 3300025926 Bacteria 705
793 Ga0207659_11089345 3300025926 Bacteria 687
794 Ga0207687_10039639 3300025927 Bacteria 3226
795 Ga0207687_10073181 3300025927 Bacteria 2453
796 Ga0207700_10038793 3300025928 Bacteria 3461
797 Ga0207700_10054883 3300025928 Bacteria 2993
798 Ga0207700_10089999 3300025928 Bacteria 2420
799 Ga0207700_10123261 3300025928 Bacteria 2105
800 Ga0207700_10243155 3300025928 Bacteria 1535
801 Ga0207700_10337740 3300025928 Bacteria 1309
802 Ga0207700_10819651 3300025928 Bacteria 832
803 Ga0207664_10025601 3300025929 Bacteria 4449
804 Ga0207664_10039577 3300025929 Bacteria 3661
805 Ga0207664_10119297 3300025929 Unclassified 2205
806 Ga0207664_10167885 3300025929 Unclassified 1876
807 Ga0207664_10572851 3300025929 Bacteria 1013
808 Ga0207644_10035451 3300025931 Bacteria 3496
809 Ga0207644_10257273 3300025931 Unclassified 1395
810 Ga0207644_10686395 3300025931 Bacteria 853
811 Ga0207644_10722079 3300025931 Bacteria 831
812 Ga0207690_10012598 3300025932 Bacteria 5063
813 Ga0207690_10037581 3300025932 Bacteria 3145
814 Ga0207690_10042611 3300025932 Bacteria 2982
815 Ga0207690_10044207 3300025932 Bacteria 2935
816 Ga0207690_10068413 3300025932 Bacteria 2440
817 Ga0207690_10278896 3300025932 Bacteria 1301
818 Ga0207690_10747510 3300025932 Unclassified 806
819 Ga0207690_11017212 3300025932 Bacteria 690
820 Ga0207690_11587498 3300025932 Bacteria 547
821 Ga0207706_10000065 3300025933 Bacteria 109080
822 Ga0207706_10000357 3300025933 Bacteria 49369
823 Ga0207706_10297873 3300025933 Bacteria 1406
824 Ga0207706_11025855 3300025933 Bacteria 692
825 Ga0207706_11312440 3300025933 Bacteria 597
826 Ga0207686_10001117 3300025934 Bacteria 15528
827 Ga0207686_10171259 3300025934 Unclassified 1531
828 Ga0207709_10004346 3300025935 Bacteria 8201
829 Ga0207709_10567253 3300025935 Bacteria 895
830 Ga0207709_10740090 3300025935 Bacteria 790
831 Ga0207670_10120778 3300025936 Bacteria 1904
832 Ga0207670_11386390 3300025936 Unclassified 597
833 Ga0207669_10001479 3300025937 Bacteria 10039
834 Ga0207669_10015931 3300025937 Bacteria 3805
835 Ga0207669_10077102 3300025937 Bacteria 2118
836 Ga0207669_10215008 3300025937 Bacteria 1406
837 Ga0207704_10058637 3300025938 Bacteria 2371
838 Ga0207704_10414369 3300025938 Bacteria 1066
839 Ga0207665_10157887 3300025939 Bacteria 1629
840 Ga0207665_10226418 3300025939 Bacteria 1373
841 Ga0207665_10407598 3300025939 Bacteria 1036
842 Ga0207665_11088389 3300025939 Bacteria 637
843 Ga0207665_11404281 3300025939 Bacteria 556
844 Ga0207691_10001355 3300025940 Bacteria 24425
845 Ga0207691_10001550 3300025940 Bacteria 22813
846 Ga0207691_10022438 3300025940 Bacteria 5953
847 Ga0207691_10131502 3300025940 Bacteria 2210
848 Ga0207711_10028892 3300025941 Bacteria 4671
849 Ga0207711_10222614 3300025941 Unclassified 1726
850 Ga0207711_10908831 3300025941 Bacteria 818
851 Ga0207689_10001360 3300025942 Bacteria 23476
852 Ga0207689_10007750 3300025942 Bacteria 9398
853 Ga0207689_10665749 3300025942 Bacteria 877
854 Ga0207689_11505011 3300025942 Bacteria 562
855 Ga0207661_10011833 3300025944 Bacteria 6336
856 Ga0207661_10019670 3300025944 Bacteria 5040
857 Ga0207661_10022228 3300025944 Bacteria 4771
858 Ga0207661_10032021 3300025944 Bacteria 4070
859 Ga0207661_10037459 3300025944 Bacteria 3793
860 Ga0207661_10068735 3300025944 Bacteria 2885
861 Ga0207661_10323213 3300025944 Bacteria 1387
862 Ga0207661_10716921 3300025944 Bacteria 920
863 Ga0207661_11987297 3300025944 Unclassified 527
864 Ga0207661_12145826 3300025944 Bacteria 505
865 Ga0207679_10000484 3300025945 Bacteria 27676
866 Ga0207679_10006509 3300025945 Bacteria 7385
867 Ga0207679_10024777 3300025945 Bacteria 4117
868 Ga0207679_10271920 3300025945 Bacteria 1449
869 Ga0207679_10276220 3300025945 Bacteria 1439
870 Ga0207679_10602183 3300025945 Bacteria 990
871 Ga0207667_10011137 3300025949 Bacteria 10468
872 Ga0207667_10019276 3300025949 Bacteria 7622
873 Ga0207667_10081585 3300025949 Bacteria 3350
874 Ga0207667_10187587 3300025949 Bacteria 2122
875 Ga0207667_10950863 3300025949 Bacteria 849
876 Ga0207651_10058551 3300025960 Bacteria 2663
877 Ga0207651_10150000 3300025960 Bacteria 1813
878 Ga0207651_10452791 3300025960 Bacteria 1101
879 Ga0207712_10001176 3300025961 Bacteria 18145
880 Ga0207712_10044891 3300025961 Bacteria 3058
881 Ga0207712_10130934 3300025961 Bacteria 1912
882 Ga0207712_10481269 3300025961 Bacteria 1058
883 Ga0207712_11682783 3300025961 Unclassified 569
884 Ga0207668_10021247 3300025972 Bacteria 4137
885 Ga0207668_10053139 3300025972 Bacteria 2806
886 Ga0207668_10730561 3300025972 Archaea 872
887 Ga0207640_10001456 3300025981 Bacteria 12799
888 Ga0207640_10050446 3300025981 Bacteria 2700
889 Ga0207640_10104663 3300025981 Bacteria 1993
890 Ga0207640_10110876 3300025981 Bacteria 1945
891 Ga0207640_10286487 3300025981 Bacteria 1297
892 Ga0207640_10370752 3300025981 Bacteria 1157
893 Ga0207640_10501830 3300025981 Unclassified 1010
894 Ga0207658_10060833 3300025986 Bacteria 2820
895 Ga0207658_10178304 3300025986 Bacteria 1756
896 Ga0207658_11525645 3300025986 Unclassified 611
897 Ga0207703_10156270 3300026035 Bacteria 1993
898 Ga0207639_10004358 3300026041 Bacteria 9545
899 Ga0207639_10116510 3300026041 Bacteria 2187
900 Ga0207639_10150381 3300026041 Bacteria 1949
901 Ga0207639_10331802 3300026041 Bacteria 1354
902 Ga0207639_10517425 3300026041 Bacteria 1092
903 Ga0207639_11916862 3300026041 Bacteria 553
904 Ga0207678_10041333 3300026067 Bacteria 3998
905 Ga0207678_10041868 3300026067 Bacteria 3970
906 Ga0207678_10068814 3300026067 Bacteria 3036
907 Ga0207678_10423890 3300026067 Unclassified 1154
908 Ga0207678_12011429 3300026067 Unclassified 503
909 Ga0207708_10098662 3300026075 Bacteria 2258
910 Ga0207708_10104714 3300026075 Bacteria 2192
911 Ga0207708_10154233 3300026075 Bacteria 1810
912 Ga0207708_10751038 3300026075 Bacteria 837
913 Ga0207702_10057844 3300026078 Bacteria 3297
914 Ga0207702_10071273 3300026078 Bacteria 2992
915 Ga0207702_10745631 3300026078 Unclassified 967
916 Ga0207702_10915538 3300026078 Bacteria 869
917 Ga0207702_10990133 3300026078 Bacteria 834
918 Ga0207702_11682985 3300026078 Bacteria 627
919 Ga0207641_10107617 3300026088 Bacteria 2466
920 Ga0207641_10345441 3300026088 Unclassified 1417
921 Ga0207648_10001169 3300026089 Bacteria 29362
922 Ga0207648_10005220 3300026089 Bacteria 13139
923 Ga0207648_10023923 3300026089 Bacteria 5460
924 Ga0207648_10046448 3300026089 Bacteria 3807
925 Ga0207648_12191754 3300026089 Unclassified 513
926 Ga0207676_10048851 3300026095 Bacteria 3287
927 Ga0207676_10093952 3300026095 Bacteria 2470
928 Ga0207676_10142837 3300026095 Bacteria 2051
929 Ga0207676_10163981 3300026095 Bacteria 1929
930 Ga0207676_10343365 3300026095 Bacteria 1378
931 Ga0207676_11694275 3300026095 Bacteria 630
932 Ga0207674_10003135 3300026116 Bacteria 20383
933 Ga0207674_10015526 3300026116 Bacteria 8364
934 Ga0207674_10018565 3300026116 Bacteria 7555
935 Ga0207674_10059142 3300026116 Bacteria 3880
936 Ga0207674_10140302 3300026116 Bacteria 2376
937 Ga0207674_10296301 3300026116 Unclassified 1566
938 Ga0207674_10677573 3300026116 Bacteria 995
939 Ga0207674_11584205 3300026116 Unclassified 624
940 Ga0207675_100000320 3300026118 Bacteria 45668
941 Ga0207675_100032261 3300026118 Bacteria 4879
942 Ga0207675_100059762 3300026118 Bacteria 3558
943 Ga0207675_100314828 3300026118 Bacteria 1527
944 Ga0207675_100341058 3300026118 Bacteria 1467
945 Ga0207683_10033546 3300026121 Bacteria 4459
946 Ga0207683_10041068 3300026121 Bacteria 4038
947 Ga0207683_10059100 3300026121 Bacteria 3367
948 Ga0207683_10295458 3300026121 Bacteria 1482
949 Ga0207698_10007055 3300026142 Bacteria 7036
950 Ga0207698_10013973 3300026142 Bacteria 5318
951 Ga0207698_10256188 3300026142 Bacteria 1604
952 Ga0207698_11013550 3300026142 Bacteria 841
953 Ga0207698_11089470 3300026142 Bacteria 811
954 Ga0207698_11123693 3300026142 Bacteria 799
955 Ga0207698_11183172 3300026142 Bacteria 778
956 Ga0207698_11211289 3300026142 Bacteria 769
957 Ga0207428_10075404 3300027907 Bacteria 2643
958 Ga0207428_10258988 3300027907 Bacteria 1296
959 Ga0268266_10083429 3300028379 Bacteria 2790
960 Ga0268266_10102533 3300028379 Bacteria 2524
961 Ga0268266_11123594 3300028379 Bacteria 760
962 Ga0268265_10002121 3300028380 Bacteria 15384
963 Ga0268265_10037895 3300028380 Bacteria 3541
964 Ga0268265_10266956 3300028380 Bacteria 1524
965 Ga0268265_10715986 3300028380 Unclassified 968
966 Ga0268265_10802452 3300028380 Bacteria 918
967 Ga0268264_10022106 3300028381 Bacteria 5192
968 Ga0268264_10480925 3300028381 Bacteria 1208
969 Ga0268264_10488128 3300028381 Bacteria 1199
970 Ga0316178_1053326 3300030735 Bacteria 540
971 Ga0307408_100008337 3300031548 Bacteria 6844
972 Ga0307408_100187150 3300031548 Bacteria 1665
973 Ga0307408_100297064 3300031548 Bacteria 1351
974 Ga0307408_100368413 3300031548 Bacteria 1224
975 Ga0307408_100559101 3300031548 Bacteria 1011
976 Ga0307408_100875500 3300031548 Bacteria 820
977 Ga0307408_102494544 3300031548 Bacteria 503
978 Ga0316579_10111135 3300031691 Bacteria 1315
979 Ga0316576_10002948 3300031727 Bacteria 9864
980 Ga0316578_10013404 3300031728 Bacteria 4349
981 Ga0316578_10015348 3300031728 Bacteria 4117
982 Ga0307405_10000187 3300031731 Bacteria 22922
983 Ga0307405_10014127 3300031731 Bacteria 4283
984 Ga0307405_10036009 3300031731 Bacteria 2962
985 Ga0307405_10092885 3300031731 Bacteria 2003
986 Ga0307405_10144722 3300031731 Bacteria 1663
987 Ga0307405_10154782 3300031731 Unclassified 1616
988 Ga0307405_10173627 3300031731 Bacteria 1540
989 Ga0307405_10258162 3300031731 Bacteria 1300
990 Ga0307405_10406577 3300031731 Bacteria 1067
991 Ga0307405_10487220 3300031731 Bacteria 985
992 Ga0307405_10986256 3300031731 Bacteria 718
993 Ga0307405_11102917 3300031731 Bacteria 682
994 Ga0307405_11372694 3300031731 Bacteria 617
995 Ga0307405_12113955 3300031731 Bacteria 505
996 Ga0307405_12137608 3300031731 Bacteria 503
997 Ga0316577_10002399 3300031733 Bacteria 9273
998 Ga0316577_10025102 3300031733 Bacteria 3315
999 Ga0307413_10000837 3300031824 Bacteria 10804
1000 Ga0307413_10002229 3300031824 Bacteria 7809
1001 Ga0307413_10030411 3300031824 Bacteria 3033
1002 Ga0307413_10042391 3300031824 Bacteria 2674
1003 Ga0307413_10055375 3300031824 Bacteria 2413
1004 Ga0307413_10073618 3300031824 Bacteria 2160
1005 Ga0307413_10140859 3300031824 Bacteria 1666
1006 Ga0307413_10171588 3300031824 Bacteria 1536
1007 Ga0307413_10284805 3300031824 Bacteria 1245
1008 Ga0307413_10457015 3300031824 Bacteria 1015
1009 Ga0307413_10640847 3300031824 Bacteria 875
1010 Ga0307413_10817679 3300031824 Unclassified 784
1011 Ga0307413_11214826 3300031824 Bacteria 656
1012 Ga0307410_10002520 3300031852 Bacteria 8857
1013 Ga0307410_10012076 3300031852 Bacteria 4972
1014 Ga0307410_10015315 3300031852 Bacteria 4545
1015 Ga0307410_10022976 3300031852 Bacteria 3867
1016 Ga0307410_10027658 3300031852 Bacteria 3587
1017 Ga0307410_10070059 3300031852 Bacteria 2427
1018 Ga0307410_10127016 3300031852 Bacteria 1868
1019 Ga0307410_10249681 3300031852 Bacteria 1379
1020 Ga0307410_10272665 3300031852 Bacteria 1324
1021 Ga0307410_10314703 3300031852 Bacteria 1240
1022 Ga0307410_10337316 3300031852 Bacteria 1200
1023 Ga0307410_10344968 3300031852 Bacteria 1188
1024 Ga0307410_10345358 3300031852 Bacteria 1187
1025 Ga0307410_10498068 3300031852 Bacteria 1002
1026 Ga0307410_10549744 3300031852 Bacteria 957
1027 Ga0307410_11023698 3300031852 Bacteria 713
1028 Ga0307410_11691523 3300031852 Unclassified 560
1029 Ga0307406_10001688 3300031901 Bacteria 12133
1030 Ga0307406_10002595 3300031901 Bacteria 9848
1031 Ga0307406_10014718 3300031901 Bacteria 4506
1032 Ga0307406_10023424 3300031901 Bacteria 3673
1033 Ga0307406_10028708 3300031901 Bacteria 3363
1034 Ga0307406_10043279 3300031901 Bacteria 2815
1035 Ga0307406_10085068 3300031901 Bacteria 2114
1036 Ga0307406_10108565 3300031901 Bacteria 1905
1037 Ga0307406_10146070 3300031901 Unclassified 1681
1038 Ga0307406_10230915 3300031901 Bacteria 1382
1039 Ga0307406_10260498 3300031901 Bacteria 1312
1040 Ga0307406_10362133 3300031901 Bacteria 1137
1041 Ga0307406_11611758 3300031901 Bacteria 573
1042 Ga0307407_10000201 3300031903 Bacteria 18078
1043 Ga0307407_10004682 3300031903 Bacteria 5843
1044 Ga0307407_10008899 3300031903 Bacteria 4640
1045 Ga0307407_10024361 3300031903 Bacteria 3173
1046 Ga0307407_10027368 3300031903 Bacteria 3033
1047 Ga0307407_10085331 3300031903 Bacteria 1921
1048 Ga0307407_10091391 3300031903 Bacteria 1866
1049 Ga0307407_10116337 3300031903 Bacteria 1687
1050 Ga0307407_10124907 3300031903 Bacteria 1637
1051 Ga0307407_10333724 3300031903 Bacteria 1068
1052 Ga0307407_10342090 3300031903 Bacteria 1057
1053 Ga0307407_10379864 3300031903 Bacteria 1008
1054 Ga0307407_10441069 3300031903 Bacteria 943
1055 Ga0307407_10525226 3300031903 Bacteria 871
1056 Ga0307407_10962072 3300031903 Unclassified 658
1057 Ga0307412_10012476 3300031911 Bacteria 4956
1058 Ga0307412_10028271 3300031911 Bacteria 3506
1059 Ga0307412_10129946 3300031911 Bacteria 1828
1060 Ga0307412_10193021 3300031911 Bacteria 1541
1061 Ga0307412_10234054 3300031911 Bacteria 1416
1062 Ga0307412_10398104 3300031911 Bacteria 1120
1063 Ga0307412_11261340 3300031911 Bacteria 664
1064 Ga0307409_100000144 3300031995 Bacteria 26764
1065 Ga0307409_100003493 3300031995 Bacteria 8552
1066 Ga0307409_100009411 3300031995 Bacteria 6000
1067 Ga0307409_100009792 3300031995 Bacteria 5910
1068 Ga0307409_100023234 3300031995 Bacteria 4291
1069 Ga0307409_100026152 3300031995 Bacteria 4111
1070 Ga0307409_100027599 3300031995 Bacteria 4027
1071 Ga0307409_100033448 3300031995 Bacteria 3742
1072 Ga0307409_100048332 3300031995 Bacteria 3236
1073 Ga0307409_100118546 3300031995 Bacteria 2236
1074 Ga0307409_100126080 3300031995 Unclassified 2178
1075 Ga0307409_100186505 3300031995 Bacteria 1842
1076 Ga0307409_100254667 3300031995 Unclassified 1607
1077 Ga0307409_100383328 3300031995 Bacteria 1337
1078 Ga0307409_100556156 3300031995 Bacteria 1127
1079 Ga0307409_100717738 3300031995 Bacteria 1000
1080 Ga0307409_100867596 3300031995 Bacteria 914
1081 Ga0307409_101141677 3300031995 Bacteria 801
1082 Ga0307416_100000828 3300032002 Bacteria 16247
1083 Ga0307416_100004156 3300032002 Bacteria 8675
1084 Ga0307416_100007355 3300032002 Bacteria 6994
1085 Ga0307416_100012718 3300032002 Bacteria 5685
1086 Ga0307416_100014248 3300032002 Bacteria 5438
1087 Ga0307416_100024844 3300032002 Bacteria 4381
1088 Ga0307416_100049239 3300032002 Bacteria 3349
1089 Ga0307416_100073566 3300032002 Bacteria 2850
1090 Ga0307416_100073588 3300032002 Bacteria 2850
1091 Ga0307416_100120247 3300032002 Bacteria 2338
1092 Ga0307416_100247873 3300032002 Bacteria 1731
1093 Ga0307416_100356860 3300032002 Bacteria 1482
1094 Ga0307416_100450307 3300032002 Bacteria 1340
1095 Ga0307416_100477679 3300032002 Bacteria 1306
1096 Ga0307416_100511350 3300032002 Bacteria 1267
1097 Ga0307416_100735010 3300032002 Bacteria 1078
1098 Ga0307416_101424102 3300032002 Bacteria 799
1099 Ga0307416_102811952 3300032002 Unclassified 582
1100 Ga0307416_103058978 3300032002 Bacteria 560
1101 Ga0307416_103753912 3300032002 Bacteria 508
1102 Ga0307414_10002383 3300032004 Bacteria 9831
1103 Ga0307414_10006027 3300032004 Bacteria 6721
1104 Ga0307414_10030309 3300032004 Bacteria 3532
1105 Ga0307414_10043031 3300032004 Bacteria 3073
1106 Ga0307414_10090810 3300032004 Bacteria 2268
1107 Ga0307414_10345745 3300032004 Bacteria 1275
1108 Ga0307414_10408267 3300032004 Bacteria 1181
1109 Ga0307414_10426642 3300032004 Bacteria 1157
1110 Ga0307414_10465715 3300032004 Bacteria 1112
1111 Ga0307414_11271125 3300032004 Bacteria 682
1112 Ga0307411_10001066 3300032005 Bacteria 10635
1113 Ga0307411_10006929 3300032005 Bacteria 5717
1114 Ga0307411_10007270 3300032005 Bacteria 5620
1115 Ga0307411_10017609 3300032005 Bacteria 4077
1116 Ga0307411_10028273 3300032005 Bacteria 3407
1117 Ga0307411_10045742 3300032005 Bacteria 2817
1118 Ga0307411_10062970 3300032005 Bacteria 2476
1119 Ga0307411_10141185 3300032005 Bacteria 1776
1120 Ga0307411_10147865 3300032005 Bacteria 1742
1121 Ga0307411_10166152 3300032005 Bacteria 1659
1122 Ga0307411_10208308 3300032005 Bacteria 1508
1123 Ga0307411_10276620 3300032005 Unclassified 1334
1124 Ga0307411_10282820 3300032005 Bacteria 1321
1125 Ga0307411_10531822 3300032005 Bacteria 1000
1126 Ga0307411_10645798 3300032005 Bacteria 915
1127 Ga0307411_10663386 3300032005 Bacteria 904
1128 Ga0307411_10672848 3300032005 Bacteria 898
1129 Ga0307411_10773159 3300032005 Bacteria 843
1130 Ga0307411_10858996 3300032005 Bacteria 803
1131 Ga0307411_11345317 3300032005 Unclassified 652
1132 Ga0307411_11551779 3300032005 Bacteria 610
1133 Ga0307411_11809007 3300032005 Bacteria 567
1134 Ga0307411_11845197 3300032005 Bacteria 562
1135 Ga0307415_100000419 3300032126 Bacteria 18192
1136 Ga0307415_100002432 3300032126 Bacteria 9294
1137 Ga0307415_100021813 3300032126 Bacteria 3944
1138 Ga0307415_100036475 3300032126 Bacteria 3222
1139 Ga0307415_100041599 3300032126 Bacteria 3052
1140 Ga0307415_100051781 3300032126 Bacteria 2788
1141 Ga0307415_100125154 3300032126 Bacteria 1936
1142 Ga0307415_100143241 3300032126 Bacteria 1829
1143 Ga0307415_100459811 3300032126 Bacteria 1102
1144 Ga0307415_100490786 3300032126 Bacteria 1071
1145 Ga0307415_100970217 3300032126 Bacteria 788
1146 Ga0307415_102463500 3300032126 Bacteria 512
1147 Ga0316583_10003563 3300032133 Bacteria 5495
1148 Ga0316585_10006893 3300032137 Bacteria 3261
1149 Ga0316596_1143350 3300033541 Unclassified 655
1150 Ga0373950_0167964 3300034818 Bacteria 510
1151 Ga0373938_0040184 3300034957 Unclassified 1037
1152 Ga0373926_0004167 3300035083 Bacteria 4716
1153 Ga0373928_0048895 3300035084 Bacteria 993
1154 Ga0373934_0005211 3300035086 Bacteria 4809
1155 Ga0373934_0037374 3300035086 Bacteria 1912
1156 Ga0373934_0040553 3300035086 Bacteria 1837
1157 Ga0373940_0070749 3300035088 Bacteria 1015
1158 Ga0373944_0396028 3300035089 Bacteria 532
1159 Ga0373951_0051655 3300035091 Bacteria 1012
1160 Ga0373952_0095406 3300035092 Bacteria 778
1161 Ga0373923_0007123 3300035111 Bacteria 3916
1162 Ga0373932_0198412 3300035112 Bacteria 712
1163 Ga0373936_0011918 3300035113 Bacteria 3299
1164 Ga0373936_0128849 3300035113 Bacteria 1086
1165 Ga0373941_0333309 3300035115 Unclassified 613
1166 Ga0373945_0258114 3300035116 Unclassified 738
1167 Ga0373953_0002759 3300035117 Bacteria 5334
1168 Ga0373953_0009331 3300035117 Bacteria 3370
1169 Ga0373953_0568949 3300035117 Bacteria 504
1170 Ga0373954_0057621 3300035118 Bacteria 1830
1171 Ga0373954_0066241 3300035118 Bacteria 1710
1172 Ga0373954_0440984 3300035118 Bacteria 644
1173 Ga0373956_0000678 3300035119 Bacteria 13976
1174 Ga0373956_0113697 3300035119 Bacteria 1261
1175 Ga0373956_0548048 3300035119 Unclassified 552
1176 Ga0373957_0099398 3300035120 Bacteria 1163
1177 Ga0373957_0165776 3300035120 Bacteria 911
1178 Ga0373960_0139748 3300035121 Unclassified 819
1179 Ga0373943_0016857 3300035170 Bacteria 3338
1180 Ga0373943_0028594 3300035170 Unclassified 2628
1181 Ga0373946_0009275 3300035171 Bacteria 3620
1182 Ga0373942_0342387 3300035207 Unclassified 527
1183 Ga0373961_0059628 3300035241 Bacteria 1154
1184 Ga0316574_0204529 3300035398 Bacteria 1268
1185 Ga0316574_0695716 3300035398 Bacteria 624
1186 Ga0373924_0002127 3300035410 Bacteria 6622
1187 Ga0373924_0285833 3300035410 Unclassified 732
1188 Ga0373931_0018182 3300035691 Bacteria 3492
1189 Ga0373931_0018416 3300035691 Bacteria 3474
1190 Ga0373935_0018031 3300035692 Bacteria 4290
1191 Ga0373935_0063447 3300035692 Bacteria 2368
1192 Ga0373935_0124591 3300035692 Unclassified 1725
1193 Ga0373935_0378071 3300035692 Bacteria 1014
1194 Ga0373927_0026060 3300035695 Bacteria 3821
1195 Ga0373927_1094838 3300035695 Bacteria 525
1196 Ga0373933_0001111 3300035724 Bacteria 16018
1197 Ga0373933_0013654 3300035724 Bacteria 4504
1198 Ga0373947_0002126 3300035725 Bacteria 12064
1199 Ga0373947_0048812 3300035725 Unclassified 2540
1200 Ga0373947_0115326 3300035725 Unclassified 1702
1201 Ga0373937_0002914 3300036401 Bacteria 14299
1202 Ga0373937_0065385 3300036401 Bacteria 3347
1203 Ga0373937_0096592 3300036401 Bacteria 2740
1204 Ga0316582_0026818 3300036647 Bacteria 3472
1205 Ga0316582_0075578 3300036647 Bacteria 2189
1206 Ga0316584_0009015 3300036712 Bacteria 6902
1207 Ga0373925_0034016 3300037068 Bacteria 3756
1208 Ga0373925_0216655 3300037068 Bacteria 1527
1209 Ga0373925_0592715 3300037068 Archaea 913
1210 Ga0395899_0038329 3300037312 Bacteria 3590
1211 Ga0395900_0005143 3300037418 Bacteria 13738
1212 Ga0395898_0365364 3300037466 Bacteria 1376
1213 Ga0395905_0049760 3300037471 Bacteria 3928
1214 Ga0395905_0117856 3300037471 Bacteria 2495
1215 Ga0395905_0624983 3300037471 Bacteria 979
1216 Ga0395905_1377214 3300037471 Bacteria 609
1217 Ga0316581_0052652 3300037588 Bacteria 1247
1218 Ga0436364_0287855 3300037853 Bacteria 1071
1219 Ga0395901_0003407 3300038443 Bacteria 16018
1220 Ga0395901_0694213 3300038443 Bacteria 1016
1221 Ga0395901_1490842 3300038443 Unclassified 632
1222 Ga0242420_024104 3300038996 Bacteria 1101
1223 Ga0242420_054477 3300038996 Bacteria 787
1224 Ga0436365_0290864 3300039437 Bacteria 776
1225 Ga0436365_0304609 3300039437 Bacteria 856
1226 Ga0436365_1159467 3300039437 Unclassified 506
1227 Ga0436365_1602166 3300039437 Bacteria 18827
1228 Ga0436363_0390436 3300039450 Bacteria 674
1229 Ga0436363_0732405 3300039450 Bacteria 543
1230 Ga0439439_0021339 3300041406 Bacteria 1614
1231 Ga0451839_1205934 3300041496 Bacteria 701
1232 Ga0451853_1987835 3300041512 Bacteria 543
1233 Ga0439448_0040558 3300042005 Bacteria 1504
1234 Ga0439457_103357 3300042014 Bacteria 665
1235 Ga0439462_0132713 3300042015 Unclassified 696
1236 Ga0439446_0184978 3300042156 Unclassified 698
1237 Ga0451577_0003975 3300042876 Bacteria 15941
1238 Ga0451577_0076398 3300042876 Bacteria 2986
1239 Ga0451577_0233619 3300042876 Bacteria 1663
1240 Ga0451577_0278304 3300042876 Unclassified 1516
1241 Ga0453683_0083881 3300044673 Bacteria 1997
1242 Ga0453683_1216232 3300044673 Bacteria 505
1243 Ga0466965_0319755 3300044683 Bacteria 845
1244 Ga0466966_0310517 3300044684 Bacteria 948
1245 Ga0466966_0984788 3300044684 Bacteria 509
1246 Ga0466961_0148652 3300044693 Bacteria 1464
1247 Ga0466964_0177363 3300044706 Bacteria 1008
1248 Ga0466964_0240783 3300044706 Bacteria 887
1249 Ga0466964_0355081 3300044706 Bacteria 754
1250 Ga0453684_1058605 3300044712 Bacteria 859
1251 Ga0466971_0083762 3300044719 Bacteria 1456
1252 Ga0466971_0634884 3300044719 Bacteria 534
1253 Ga0466970_0236236 3300044765 Bacteria 1022
1254 Ga0466957_1006802 3300044842 Unclassified 599
1255 Ga0466957_1282518 3300044842 Bacteria 531
1256 Ga0451576_0042077 3300045051 Bacteria 4824
1257 Ga0451576_0116352 3300045051 Bacteria 2784
1258 Ga0451576_0321037 3300045051 Bacteria 1620
1259 Ga0451576_0781793 3300045051 Bacteria 1003
1260 Ga0451576_1522734 3300045051 Unclassified 695
1261 Ga0466958_0130129 3300045836 Bacteria 1580
1262 Ga0466958_0334514 3300045836 Bacteria 974
1263 Ga0466967_0250970 3300045976 Bacteria 1690
1264 Ga0466967_0533636 3300045976 Bacteria 1154
1265 Ga0466967_0777573 3300045976 Unclassified 950
1266 Ga0466967_2175858 3300045976 Unclassified 551
1267 Ga0495592_0002525 3300046454 Bacteria 12917
1268 Ga0495592_0365590 3300046454 Bacteria 921
1269 Ga0495592_0902943 3300046454 Bacteria 519
1270 Ga0495603_0015387 3300046455 Bacteria 4628
1271 Ga0495603_0046197 3300046455 Bacteria 2595
1272 Ga0495603_0238765 3300046455 Unclassified 1047
1273 Ga0495629_0003115 3300046459 Bacteria 12567
1274 Ga0495629_0025075 3300046459 Bacteria 4241
1275 Ga0495629_0040407 3300046459 Bacteria 3281
1276 Ga0495629_0303378 3300046459 Bacteria 1093
1277 Ga0495629_0618441 3300046459 Bacteria 723
1278 Ga0495629_1112862 3300046459 Bacteria 510
1279 Ga0495651_0009970 3300046462 Bacteria 7304
1280 Ga0495651_0017083 3300046462 Bacteria 5622
1281 Ga0495651_0124418 3300046462 Bacteria 1890
1282 Ga0495651_0644771 3300046462 Bacteria 664
1283 Ga0495653_0000547 3300046463 Bacteria 28742
1284 Ga0495653_0006042 3300046463 Bacteria 9914
1285 Ga0495653_0636764 3300046463 Bacteria 652
1286 Ga0495580_0001189 3300046472 Bacteria 22911
1287 Ga0495580_0005504 3300046472 Bacteria 10461
1288 Ga0495580_0109372 3300046472 Bacteria 1919
1289 Ga0495580_0614116 3300046472 Unclassified 718
1290 Ga0495580_1020227 3300046472 Unclassified 526
1291 Ga0495582_0013598 3300046473 Bacteria 4481
1292 Ga0495582_0039450 3300046473 Bacteria 2600
1293 Ga0495582_0088607 3300046473 Bacteria 1724
1294 Ga0495582_0151791 3300046473 Bacteria 1315
1295 Ga0495582_0762531 3300046473 Unclassified 560
1296 Ga0495639_0000549 3300046475 Bacteria 17446
1297 Ga0495639_0011675 3300046475 Bacteria 3790
1298 Ga0495639_0316237 3300046475 Unclassified 780
1299 Ga0495662_0417003 3300046476 Unclassified 659
1300 Ga0495664_0281001 3300046477 Bacteria 1006
1301 Ga0495664_0714430 3300046477 Bacteria 592
1302 Ga0495585_0160087 3300046492 Unclassified 1169
1303 Ga0495594_0011878 3300046499 Bacteria 4531
1304 Ga0495594_0145232 3300046499 Bacteria 1346
1305 Ga0495607_0370303 3300046501 Unclassified 657
1306 Ga0495608_0000405 3300046511 Bacteria 30184
1307 Ga0495608_0028611 3300046511 Unclassified 3787
1308 Ga0495618_0153235 3300046514 Bacteria 1472
1309 Ga0495628_0000494 3300046516 Bacteria 36135
1310 Ga0495628_0040700 3300046516 Bacteria 3712
1311 Ga0495628_0122008 3300046516 Unclassified 1998
1312 Ga0495630_0002236 3300046517 Bacteria 13469
1313 Ga0495630_0003849 3300046517 Bacteria 10477
1314 Ga0495630_0015750 3300046517 Bacteria 5524
1315 Ga0495630_0085082 3300046517 Bacteria 2387
1316 Ga0495663_0099594 3300046525 Bacteria 956
1317 Ga0495666_0050611 3300046526 Bacteria 1997
1318 Ga0495652_0008315 3300046529 Bacteria 9480
1319 Ga0495652_0042274 3300046529 Bacteria 3930
1320 Ga0495665_0000358 3300046531 Bacteria 23104
1321 Ga0495665_0003130 3300046531 Bacteria 8950
1322 Ga0495665_0075851 3300046531 Bacteria 1770
1323 Ga0495665_0593238 3300046531 Bacteria 554
1324 Ga0495640_0359579 3300046533 Bacteria 898
1325 Ga0495586_0004190 3300046535 Bacteria 7724
1326 Ga0495587_0000269 3300046536 Bacteria 37262
1327 Ga0495587_0000334 3300046536 Bacteria 33589
1328 Ga0495587_0001945 3300046536 Bacteria 13762
1329 Ga0495587_0124263 3300046536 Unclassified 1477
1330 Ga0495621_0210913 3300046539 Bacteria 784
1331 Ga0495621_0343511 3300046539 Bacteria 625
1332 Ga0495645_0005088 3300046543 Bacteria 9010
1333 Ga0495645_0087646 3300046543 Bacteria 2227
1334 Ga0495622_0022950 3300046557 Bacteria 2908
1335 Ga0495622_0225599 3300046557 Bacteria 829
1336 Ga0495633_0152348 3300046558 Bacteria 1068
1337 Ga0495667_0000504 3300046559 Bacteria 24895
1338 Ga0495667_0001705 3300046559 Bacteria 14587
1339 Ga0495667_0005981 3300046559 Bacteria 8228
1340 Ga0495634_0830558 3300046642 Bacteria 526
1341 Ga0495635_0000200 3300046663 Bacteria 37911
1342 Ga0495635_0354627 3300046663 Unclassified 978
1343 Ga0495659_0150507 3300046664 Bacteria 934
1344 Ga0495659_0328021 3300046664 Unclassified 651
1345 Ga0495659_0379927 3300046664 Bacteria 607
1346 Ga0495588_0012498 3300046674 Bacteria 4015
1347 Ga0495588_0023908 3300046674 Bacteria 3031
1348 Ga0495657_0011939 3300046675 Bacteria 6471
1349 Ga0495657_0464029 3300046675 Unclassified 741
1350 Ga0495657_0876098 3300046675 Unclassified 511
1351 Ga0495599_0002011 3300046678 Bacteria 11757
1352 Ga0495599_0021680 3300046678 Bacteria 4008
1353 Ga0495599_0082661 3300046678 Bacteria 2006
1354 Ga0495623_0000156 3300046679 Bacteria 42279
1355 Ga0495623_0003024 3300046679 Bacteria 11067
1356 Ga0495623_0052162 3300046679 Bacteria 2585
1357 Ga0495646_0038350 3300046680 Bacteria 2959
1358 Ga0495658_0001403 3300046683 Bacteria 12652
1359 Ga0495658_0048011 3300046683 Bacteria 2406
1360 Ga0495658_0251892 3300046683 Bacteria 1111
1361 Ga0495658_0357189 3300046683 Unclassified 929
1362 Ga0495658_0662063 3300046683 Bacteria 669
1363 Ga0495613_0102611 3300046689 Bacteria 2065
1364 Ga0495613_0168100 3300046689 Bacteria 1557
1365 Ga0495613_0312533 3300046689 Bacteria 1086
1366 Ga0495613_0387039 3300046689 Unclassified 955
1367 Ga0495613_0510664 3300046689 Unclassified 808
1368 Ga0495670_0290462 3300046691 Bacteria 875
1369 Ga0495600_0003971 3300046809 Bacteria 8786
1370 Ga0495581_0000659 3300047315 Bacteria 18109
1371 Ga0495581_0016943 3300047315 Bacteria 4234
1372 Ga0495581_0051860 3300047315 Bacteria 2369
1373 Ga0495581_0564619 3300047315 Unclassified 660
1374 Ga0495581_0636522 3300047315 Bacteria 617
1375 Ga0495604_0004192 3300047317 Bacteria 11427
1376 Ga0495604_0025411 3300047317 Bacteria 4720
1377 Ga0495604_0939967 3300047317 Unclassified 538
1378 Ga0495636_0095234 3300047318 Unclassified 1297
1379 Ga0495674_0007567 3300047319 Bacteria 10378
1380 Ga0495674_0032263 3300047319 Bacteria 4752
1381 Ga0495674_0043600 3300047319 Bacteria 3993
1382 Ga0495674_0894607 3300047319 Bacteria 686
1383 Ga0495680_0004788 3300047322 Bacteria 12847
1384 Ga0495680_0791030 3300047322 Bacteria 620
1385 Ga0495675_0002012 3300047444 Bacteria 12138
1386 Ga0495675_0057891 3300047444 Bacteria 2458
1387 Ga0495675_0070071 3300047444 Bacteria 2213
1388 Ga0495675_0075070 3300047444 Bacteria 2130
1389 Ga0495675_0402624 3300047444 Unclassified 798
1390 Ga0495675_0837854 3300047444 Unclassified 507
1391 Ga0495684_0001442 3300047471 Bacteria 19043
1392 Ga0495684_0024474 3300047471 Bacteria 4647
1393 Ga0495684_0063191 3300047471 Bacteria 2815
1394 Ga0495593_0000356 3300047673 Bacteria 25268
1395 Ga0495593_0111707 3300047673 Bacteria 1395
1396 Ga0495593_0133358 3300047673 Bacteria 1260
1397 Ga0495593_0509573 3300047673 Bacteria 603
1398 Ga0495602_0003996 3300048088 Bacteria 15368
1399 Ga0495602_0039288 3300048088 Bacteria 4360
1400 Ga0495602_0133381 3300048088 Bacteria 1977
1401 Ga0495614_0000638 3300048089 Bacteria 14664
1402 Ga0495614_0279277 3300048089 Unclassified 769
1403 Ga0495615_0073472 3300048090 Bacteria 926
1404 Ga0496100_0073025 3300048903 Bacteria 2295
1405 Ga0496100_0171604 3300048903 Bacteria 1562
1406 Ga0496100_0202865 3300048903 Bacteria 1446
1407 Ga0496100_0835443 3300048903 Unclassified 722
1408 Ga0496100_0848128 3300048903 Bacteria 717
1409 Ga0496100_1059323 3300048903 Unclassified 639
1410 Ga0496101_0038807 3300048904 Bacteria 3384
1411 Ga0496101_0077774 3300048904 Bacteria 2446
1412 Ga0496101_1050509 3300048904 Bacteria 640
1413 Ga0496102_0067085 3300048905 Bacteria 3290
1414 Ga0496102_0134419 3300048905 Bacteria 2317
1415 Ga0496102_0451550 3300048905 Unclassified 1206
1416 Ga0496102_0749520 3300048905 Bacteria 899
1417 Ga0496102_1123092 3300048905 Bacteria 706
1418 Ga0496103_0181794 3300048906 Unclassified 1351
1419 Ga0496103_0431769 3300048906 Bacteria 845
1420 Ga0496104_0004744 3300048907 Bacteria 11832
1421 Ga0496104_0183124 3300048907 Unclassified 2005
1422 Ga0496104_0623643 3300048907 Bacteria 988
1423 Ga0496105_0572812 3300048908 Bacteria 879
1424 Ga0496106_0012262 3300048909 Bacteria 6328
1425 Ga0496106_0053593 3300048909 Bacteria 3047
1426 Ga0496106_0467735 3300048909 Bacteria 1013
1427 Ga0496106_0644154 3300048909 Bacteria 847
1428 Ga0496106_0649088 3300048909 Bacteria 843
1429 Ga0496107_0177846 3300048910 Bacteria 1580
1430 Ga0496107_0294105 3300048910 Bacteria 1209
1431 Ga0496108_0005237 3300048911 Bacteria 10474
1432 Ga0496108_0017435 3300048911 Bacteria 5876
1433 Ga0496108_0180869 3300048911 Bacteria 1826
1434 Ga0496108_0820892 3300048911 Unclassified 801
1435 Ga0496109_0007523 3300048912 Bacteria 9228
1436 Ga0496109_0071352 3300048912 Bacteria 3188
1437 Ga0496109_0382259 3300048912 Bacteria 1330
1438 Ga0496109_2049924 3300048912 Bacteria 504
1439 Ga0496110_0029147 3300048913 Bacteria 4747
1440 Ga0496110_0080168 3300048913 Bacteria 2908
1441 Ga0496111_0032614 3300048914 Bacteria 3714
1442 Ga0496111_0115469 3300048914 Bacteria 1979
1443 Ga0496112_0001950 3300048915 Bacteria 16300
1444 Ga0496112_0022068 3300048915 Bacteria 6062
1445 Ga0496112_0889592 3300048915 Bacteria 813
1446 Ga0496113_0000769 3300048916 Bacteria 16520
1447 Ga0496113_0068922 3300048916 Bacteria 2685
1448 Ga0496113_0116662 3300048916 Bacteria 2084
1449 Ga0496114_0134245 3300048917 Bacteria 2139
1450 Ga0496114_0384593 3300048917 Bacteria 1242
1451 Ga0496115_0004680 3300048918 Bacteria 9915
1452 Ga0496115_0215545 3300048918 Unclassified 1585
1453 Ga0501306_036833 3300049127 Unclassified 747
1454 Ga0501309_062896 3300049129 Bacteria 600
1455 Ga0501304_027104 3300049160 Bacteria 594
1456 Ga0501290_016941 3300049513 Bacteria 974
1457 Ga0501291_039674 3300049514 Unclassified 824
1458 Ga0501294_011442 3300049517 Bacteria 883
1459 Ga0501297_044363 3300049520 Bacteria 636
1460 Ga0501298_059127 3300049521 Bacteria 809
1461 Ga0501298_113859 3300049521 Bacteria 630
1462 Ga0501299_123283 3300049522 Bacteria 627
1463 Ga0501299_157296 3300049522 Bacteria 578
1464 Ga0501311_048452 3300049527 Bacteria 661
1465 Ga0501311_058505 3300049527 Bacteria 618
1466 Ga0501313_027753 3300049529 Bacteria 724
1467 Ga0501314_036812 3300049530 Bacteria 560
1468 Ga0501315_102951 3300049531 Unclassified 506
1469 Ga0501316_045992 3300049532 Bacteria 619
1470 Ga0501317_080926 3300049533 Bacteria 562
1471 Ga0501323_043397 3300049539 Bacteria 665
1472 Ga0501323_065499 3300049539 Bacteria 574
1473 Ga0501325_027581 3300049541 Bacteria 634
1474 Ga0501340_016227 3300049556 Bacteria 593
1475 Ga0501340_026915 3300049556 Bacteria 507
1476 Ga0501032_0043085 3300049569 Bacteria 3059
1477 Ga0501032_0160958 3300049569 Bacteria 1474
1478 Ga0501033_0031074 3300049570 Bacteria 4015
1479 Ga0501034_1216412 3300049571 Bacteria 632
1480 Ga0501036_0038635 3300049572 Bacteria 4040
1481 Ga0501036_0200401 3300049572 Bacteria 1679
1482 Ga0501037_0241493 3300049573 Bacteria 1266
1483 Ga0501038_0108158 3300049574 Bacteria 2306
1484 Ga0501038_0581194 3300049574 Bacteria 849
1485 Ga0501039_0160910 3300049575 Bacteria 1765
1486 Ga0501040_1191822 3300049576 Bacteria 553
1487 Ga0501041_0073333 3300049577 Bacteria 2104
1488 Ga0501041_0134378 3300049577 Bacteria 1541
1489 Ga0501041_0668060 3300049577 Unclassified 664
1490 Ga0501042_0144495 3300049578 Bacteria 1715
1491 Ga0501042_0244581 3300049578 Bacteria 1294
1492 Ga0501043_0048272 3300049579 Bacteria 3347
1493 Ga0501043_0108258 3300049579 Bacteria 2183
1494 Ga0501046_0133310 3300049580 Bacteria 1883
1495 Ga0501046_0945160 3300049580 Bacteria 600
1496 Ga0501047_0216687 3300049581 Bacteria 1771
1497 Ga0501047_0243318 3300049581 Bacteria 1649
1498 Ga0501067_0000353 3300049583 Bacteria 25052
1499 Ga0501067_0044515 3300049583 Bacteria 2465
1500 Ga0501067_0257517 3300049583 Unclassified 971
1501 Ga0501067_0334725 3300049583 Bacteria 843
1502 Ga0501068_0001339 3300049584 Bacteria 13056
1503 Ga0501068_0084626 3300049584 Unclassified 1951
1504 Ga0501068_0831386 3300049584 Bacteria 606
1505 Ga0501069_0026566 3300049585 Bacteria 3170
1506 Ga0501069_0032090 3300049585 Unclassified 2891
1507 Ga0501069_0032461 3300049585 Unclassified 2874
1508 Ga0501069_0166828 3300049585 Bacteria 1269
1509 Ga0501070_0000192 3300049586 Bacteria 57359
1510 Ga0501070_0123099 3300049586 Bacteria 2143
1511 Ga0501070_0137205 3300049586 Unclassified 2020
1512 Ga0501070_0168786 3300049586 Bacteria 1803
1513 Ga0501070_0369431 3300049586 Bacteria 1163
1514 Ga0501070_0726126 3300049586 Bacteria 784
1515 Ga0501071_0000678 3300049587 Bacteria 17791
1516 Ga0501071_0325048 3300049587 Bacteria 1168
1517 Ga0501071_0591982 3300049587 Bacteria 853
1518 Ga0501071_0796005 3300049587 Unclassified 729
1519 Ga0501072_0009721 3300049588 Bacteria 7315
1520 Ga0501072_0078699 3300049588 Bacteria 2611
1521 Ga0501072_0409368 3300049588 Bacteria 1076
1522 Ga0501072_0962943 3300049588 Bacteria 666
1523 Ga0501072_1102293 3300049588 Bacteria 618
1524 Ga0501072_1230604 3300049588 Bacteria 581
1525 Ga0501073_0000949 3300049589 Bacteria 20906
1526 Ga0501073_0631350 3300049589 Bacteria 739
1527 Ga0501073_0790902 3300049589 Bacteria 654
1528 Ga0501074_0000171 3300049590 Bacteria 34937
1529 Ga0501074_0368537 3300049590 Bacteria 1019
1530 Ga0501076_0149239 3300049592 Bacteria 1901
1531 Ga0501076_0194593 3300049592 Bacteria 1655
1532 Ga0501202_079250 3300049652 Bacteria 769
1533 Ga0501206_044105 3300049653 Unclassified 695
1534 Ga0501211_051127 3300049658 Bacteria 513
1535 Ga0501216_079627 3300049660 Bacteria 691
1536 Ga0501216_133714 3300049660 Unclassified 577
1537 Ga0501217_042743 3300049661 Unclassified 1158
1538 Ga0501217_066451 3300049661 Bacteria 973
1539 Ga0501217_090548 3300049661 Bacteria 858
1540 Ga0501217_201734 3300049661 Bacteria 620
1541 Ga0501223_050772 3300049663 Bacteria 805
1542 Ga0501227_041230 3300049665 Bacteria 1141
1543 Ga0501230_029252 3300049667 Bacteria 1017
1544 Ga0501239_036423 3300049672 Bacteria 665
1545 Ga0501242_003701 3300049674 Bacteria 1666
1546 Ga0501243_014106 3300049675 Bacteria 1274
1547 Ga0501243_072468 3300049675 Bacteria 657
1548 Ga0501248_012725 3300049678 Bacteria 778
1549 Ga0501249_006910 3300049679 Bacteria 2339
1550 Ga0501249_014954 3300049679 Bacteria 1657
1551 Ga0501256_002047 3300049685 Bacteria 1571
1552 Ga0501257_025964 3300049686 Bacteria 1396
1553 Ga0501257_034172 3300049686 Unclassified 1234
1554 Ga0501261_097815 3300049690 Unclassified 554
1555 Ga0501225_0104002 3300049705 Bacteria 832
1556 Ga0501245_027410 3300049708 Bacteria 924
1557 Ga0501079_0076548 3300049741 Bacteria 2588
1558 Ga0501079_0142055 3300049741 Bacteria 1870
1559 Ga0501079_0218931 3300049741 Bacteria 1487
1560 Ga0501080_0000060 3300049742 Bacteria 71292
1561 Ga0501080_0005735 3300049742 Bacteria 11107
1562 Ga0501080_0111578 3300049742 Bacteria 2535
1563 Ga0501080_0247391 3300049742 Bacteria 1626
1564 Ga0501081_0337820 3300049743 Bacteria 1109
1565 Ga0501081_0376070 3300049743 Bacteria 1049
1566 Ga0501081_0931676 3300049743 Bacteria 655
1567 Ga0501083_0008037 3300049744 Bacteria 7464
1568 Ga0501083_0529860 3300049744 Bacteria 767
1569 Ga0501264_006568 3300049761 Bacteria 1073
1570 Ga0501268_001006 3300049765 Bacteria 3352
1571 Ga0501268_045841 3300049765 Bacteria 835
1572 Ga0501272_005087 3300049769 Bacteria 1377
1573 Ga0501273_005428 3300049770 Bacteria 1439
1574 Ga0501273_045094 3300049770 Bacteria 662
1575 Ga0501275_011114 3300049772 Bacteria 972
1576 Ga0501275_042240 3300049772 Bacteria 643
1577 Ga0501276_019420 3300049773 Bacteria 640
1578 Ga0501283_085767 3300049779 Bacteria 598
1579 Ga0501044_0006673 3300049823 Bacteria 12723
1580 Ga0501044_0384435 3300049823 Bacteria 1318
1581 Ga0501045_0059366 3300049824 Bacteria 2802
1582 Ga0501045_0457465 3300049824 Bacteria 948
1583 Ga0501204_040726 3300049850 Bacteria 680
1584 Ga0501220_08404 3300049852 Bacteria 543
1585 nmdc:mga05p37_1158346_c1 3300050507 Bacteria 803
1586 nmdc:mga05p37_2129497_c1 3300050507 Unclassified 524
1587 nmdc:mga05p37_24458_c1 3300050507 Bacteria 2422
1588 nmdc:mga05p37_259528_c1 3300050507 Bacteria 2080
1589 nmdc:mga05p37_313439_c1 3300050507 Bacteria 1859
1590 nmdc:mga05p37_328502_c1 3300050507 Bacteria 1807
1591 nmdc:mga05p37_372223_c1 3300050507 Bacteria 1676
1592 nmdc:mga05p37_81382_c1 3300050507 Bacteria 3989
1593 nmdc:mga05p37_82134_c1 3300050507 Bacteria 3970
1594 nmdc:mga05p37_830499_c1 3300050507 Bacteria 1006
1595 nmdc:mga09592_132413_c1 3300050508 Bacteria 2146
1596 nmdc:mga09592_132896_c1 3300050508 Unclassified 2142
1597 nmdc:mga09592_216657_c1 3300050508 Bacteria 1659
1598 nmdc:mga09592_72535_c1 3300050508 Bacteria 2923
1599 nmdc:mga0qj67_10094_c1 3300050509 Bacteria 7046
1600 nmdc:mga0qj67_1478095_c1 3300050509 Unclassified 523
1601 nmdc:mga0qj67_18195_c1 3300050509 Bacteria 5353
1602 nmdc:mga0qj67_3022_c1 3300050509 Bacteria 12093
1603 nmdc:mga0qj67_3465_c1 3300050509 Bacteria 11369
1604 nmdc:mga0qj67_37040_c1 3300050509 Unclassified 3819
1605 nmdc:mga0qj67_505202_c1 3300050509 Unclassified 972
1606 nmdc:mga0qj67_52160_c1 3300050509 Bacteria 3236
1607 nmdc:mga06r32_139003_c1 3300050510 Bacteria 2404
1608 nmdc:mga06r32_1637814_c1 3300050510 Bacteria 581
1609 nmdc:mga06r32_186579_c1 3300050510 Bacteria 2061
1610 nmdc:mga06r32_363451_c1 3300050510 Bacteria 1431
1611 nmdc:mga06r32_406801_c1 3300050510 Bacteria 1343
1612 nmdc:mga06r32_533345_c1 3300050510 Bacteria 1149
1613 nmdc:mga06r32_712109_c1 3300050510 Unclassified 969
1614 nmdc:mga06r32_73470_c1 3300050510 Bacteria 3313
1615 nmdc:mga06r32_77166_c1 3300050510 Bacteria 3236
1616 nmdc:mga06r32_812426_c1 3300050510 Unclassified 895
1617 nmdc:mga08y16_1335218_c1 3300050511 Bacteria 682
1618 nmdc:mga08y16_345174_c1 3300050511 Bacteria 1530
1619 nmdc:mga08y16_479660_c1 3300050511 Bacteria 1266
1620 nmdc:mga08y16_560798_c1 3300050511 Bacteria 1155
1621 nmdc:mga08y16_9037_c1 3300050511 Bacteria 10459
1622 nmdc:mga0n895_1454242_c1 3300050512 Bacteria 653
1623 nmdc:mga0n895_1552889_c1 3300050512 Bacteria 627
1624 nmdc:mga0n895_24093_c1 3300050512 Bacteria 5731
1625 nmdc:mga0n895_40283_c1 3300050512 Bacteria 4537
1626 nmdc:mga0n895_42112_c1 3300050512 Bacteria 4442
1627 nmdc:mga0n895_753427_c1 3300050512 Bacteria 967
1628 nmdc:mga0n895_770868_c1 3300050512 Bacteria 954
1629 nmdc:mga0rr50_196370_c1 3300050513 Bacteria 1656
1630 nmdc:mga0rr50_545513_c1 3300050513 Bacteria 987
1631 nmdc:mga0rr50_820594_c1 3300050513 Bacteria 793
1632 nmdc:mga08x19_12152_c1 3300050514 Bacteria 5183
1633 nmdc:mga08x19_425860_c1 3300050514 Unclassified 932
1634 nmdc:mga0a205_32863_c1 3300050515 Bacteria 4975
1635 nmdc:mga0a205_37088_c1 3300050515 Bacteria 4687
1636 nmdc:mga0a205_605389_c1 3300050515 Unclassified 949
1637 nmdc:mga0a205_646225_c1 3300050515 Bacteria 909
1638 Ga0495601_0003937 3300053077 Bacteria 8549
1639 Ga0495601_0081254 3300053077 Bacteria 2080
1640 Ga0495601_0084821 3300053077 Bacteria 2035
1641 Ga0495601_0840966 3300053077 Bacteria 581
1642 Ga0495612_0000490 3300053078 Bacteria 15773
1643 Ga0495595_0024258 3300053084 Bacteria 2678
1644 Ga0495619_0002629 3300053085 Bacteria 11736
1645 Ga0495619_0062774 3300053085 Bacteria 2474
1646 Ga0495619_0414562 3300053085 Unclassified 929
1647 Ga0501084_0081149 3300054114 Bacteria 2720
1648 Ga0501084_0095051 3300054114 Bacteria 2503
1649 Ga0501084_0170156 3300054114 Bacteria 1839
1650 Ga0501084_0184919 3300054114 Bacteria 1759
1651 Ga0590071_031312 3300059421 Bacteria 1268
1652 Ga0590071_043838 3300059421 Bacteria 1078
1653 Ga0590075_026983 3300059424 Bacteria 1447
1654 Ga0590075_045298 3300059424 Bacteria 1127
1655 Ga0590077_022697 3300059426 Unclassified 1340
1656 Ga0587066_078833 3300059490 Bacteria 709
1657 Ga0587070_143242 3300059491 Bacteria 592
1658 Ga0587073_0057828 3300059492 Bacteria 900
1659 Ga0587073_0117544 3300059492 Bacteria 713
1660 Ga0587077_128672 3300059493 Bacteria 640
1661 Ga0587083_0108493 3300059505 Unclassified 702
1662 Ga0587083_0153285 3300059505 Bacteria 624
1663 Ga0587083_0260290 3300059505 Bacteria 520
1664 Ga0587085_026550 3300059506 Unclassified 923
1665 Ga0587088_101991 3300059508 Bacteria 642
1666 Ga0587088_104734 3300059508 Bacteria 636
1667 Ga0587089_057672 3300059509 Unclassified 636
1668 Ga0587091_071005 3300059511 Bacteria 762
1669 Ga0587092_118003 3300059512 Bacteria 564
1670 Ga0587094_083647 3300059513 Unclassified 594
1671 Ga0587101_077787 3300059623 Unclassified 623
1672 Ga0587117_093637 3300059627 Unclassified 564
1673 Ga0587128_084766 3300059630 Bacteria 640
1674 Ga0587062_056317 3300059639 Unclassified 679
1675 Ga0587067_156622 3300059640 Bacteria 576
1676 Ga0587067_189136 3300059640 Bacteria 541
1677 Ga0587072_083036 3300059643 Bacteria 695
1678 Ga0587072_091123 3300059643 Bacteria 672
1679 Ga0587075_107383 3300059644 Unclassified 564
1680 Ga0587076_078824 3300059645 Bacteria 699
1681 Ga0587076_103535 3300059645 Bacteria 639
1682 Ga0501082_0036435 3300060353 Bacteria 4238
1683 Ga0501082_0160735 3300060353 Bacteria 1952
1684 Ga0501082_0206675 3300060353 Unclassified 1708
1685 Ga0466962_0514034 3300061719 Bacteria 607
1686 Ga0530510_0335764 3300061734 Bacteria 1134
1687 Ga0530510_1264863 3300061734 Bacteria 566

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005330 Ga0070690_100045286 Ga0070690_1000452864 109
2 3300005333 Ga0070677_10119039 Ga0070677_101190393 109
3 3300005334 Ga0068869_100010103 Ga0068869_1000101034 109
4 3300005335 Ga0070666_10117395 Ga0070666_101173952 109
5 3300005336 Ga0070680_100471466 Ga0070680_1004714662 109
6 3300005339 Ga0070660_100666225 Ga0070660_1006662252 109
7 3300005341 Ga0070691_10021952 Ga0070691_100219524 109
8 3300005343 Ga0070687_100301426 Ga0070687_1003014262 109
9 3300005347 Ga0070668_100110467 Ga0070668_1001104673 109
10 3300005353 Ga0070669_100628490 Ga0070669_1006284902 109
11 3300005354 Ga0070675_100129213 Ga0070675_1001292132 109
12 3300005355 Ga0070671_100119992 Ga0070671_1001199922 109
13 3300005356 Ga0070674_100002673 Ga0070674_1000026738 109
14 3300005364 Ga0070673_100174961 Ga0070673_1001749612 109
15 3300005366 Ga0070659_100182606 Ga0070659_1001826062 109
16 3300005406 Ga0070703_10045433 Ga0070703_100454332 109
17 3300005438 Ga0070701_10081963 Ga0070701_100819631 109
18 3300005440 Ga0070705_100008002 Ga0070705_1000080023 109
19 3300005444 Ga0070694_100389417 Ga0070694_1003894173 109
20 3300005445 Ga0070708_102155434 Ga0070708_1021554341 109
21 3300005455 Ga0070663_100462429 Ga0070663_1004624292 109
22 3300005456 Ga0070678_100216556 Ga0070678_1002165562 109
23 3300005457 Ga0070662_100005643 Ga0070662_1000056432 109
24 3300005458 Ga0070681_11039480 Ga0070681_110394802 109
25 3300005459 Ga0068867_100005117 Ga0068867_1000051173 109
26 3300005467 Ga0070706_100638097 Ga0070706_1006380972 109
27 3300005468 Ga0070707_100253278 Ga0070707_1002532783 109
28 3300005518 Ga0070699_100762451 Ga0070699_1007624512 109
29 3300005536 Ga0070697_100659546 Ga0070697_1006595462 109
30 3300005543 Ga0070672_100206844 Ga0070672_1002068443 109
31 3300005545 Ga0070695_100001483 Ga0070695_1000014838 109
32 3300005546 Ga0070696_100007637 Ga0070696_1000076373 109
33 3300005547 Ga0070693_100013713 Ga0070693_1000137133 109
34 3300005549 Ga0070704_100285705 Ga0070704_1002857052 109
35 3300005563 Ga0068855_100646997 Ga0068855_1006469972 109
36 3300005577 Ga0068857_100012440 Ga0068857_1000124404 109
37 3300005578 Ga0068854_100000340 Ga0068854_10000034021 109
38 3300005615 Ga0070702_100015870 Ga0070702_1000158705 109
39 3300005616 Ga0068852_101079483 Ga0068852_1010794832 109
40 3300005618 Ga0068864_100005386 Ga0068864_1000053868 109
41 3300005718 Ga0068866_10000524 Ga0068866_100005244 109
42 3300005719 Ga0068861_100289917 Ga0068861_1002899172 109
43 3300005840 Ga0068870_10408049 Ga0068870_104080492 109
44 3300005842 Ga0068858_100321105 Ga0068858_1003211052 109
45 3300005843 Ga0068860_100040126 Ga0068860_1000401262 109
46 3300006237 Ga0097621_100208928 Ga0097621_1002089283 109
47 3300006358 Ga0068871_100139055 Ga0068871_1001390553 109
48 3300006847 Ga0075431_100135269 Ga0075431_1001352695 109
49 3300006871 Ga0075434_100261801 Ga0075434_1002618011 109
50 3300006871 Ga0075434_100873154 Ga0075434_1008731542 109
51 3300006881 Ga0068865_100117526 Ga0068865_1001175263 109
52 3300006914 Ga0075436_100194376 Ga0075436_1001943763 109
53 3300007076 Ga0075435_101766042 Ga0075435_1017660421 109
54 3300009093 Ga0105240_10046608 Ga0105240_100466083 109
55 3300009098 Ga0105245_10036543 Ga0105245_100365433 109
56 3300009101 Ga0105247_10439480 Ga0105247_104394801 109
57 3300009148 Ga0105243_10042543 Ga0105243_100425435 109
58 3300009174 Ga0105241_10024142 Ga0105241_100241425 109
59 3300009176 Ga0105242_10006526 Ga0105242_100065268 109
60 3300009177 Ga0105248_10011120 Ga0105248_100111202 109
61 3300009545 Ga0105237_11009553 Ga0105237_110095531 109
62 3300009551 Ga0105238_10325721 Ga0105238_103257212 109
63 3300009553 Ga0105249_10190726 Ga0105249_101907262 109
64 3300010375 Ga0105239_10147980 Ga0105239_101479802 109
65 3300010375 Ga0105239_12469307 Ga0105239_124693072 109
66 3300011119 Ga0105246_10055844 Ga0105246_100558443 109
67 3300013297 Ga0157378_10016080 Ga0157378_100160807 109
68 3300013306 Ga0163162_10075056 Ga0163162_100750563 109
69 3300013306 Ga0163162_13441632 Ga0163162_134416322 109
70 3300013307 Ga0157372_10696387 Ga0157372_106963873 109
71 3300014326 Ga0157380_10278831 Ga0157380_102788312 109
72 3300014968 Ga0157379_10064796 Ga0157379_100647964 109
73 3300014969 Ga0157376_10093515 Ga0157376_100935153 109
74 3300014969 Ga0157376_11130927 Ga0157376_111309272 109
75 3300017792 Ga0163161_10150679 Ga0163161_101506792 109
76 3300025315 Ga0207697_10112113 Ga0207697_101121133 109
77 3300025899 Ga0207642_10069746 Ga0207642_100697463 109
78 3300025901 Ga0207688_10186830 Ga0207688_101868302 109
79 3300025903 Ga0207680_10113171 Ga0207680_101131713 109
80 3300025907 Ga0207645_10000971 Ga0207645_100009715 109
81 3300025908 Ga0207643_10076653 Ga0207643_100766533 109
82 3300025910 Ga0207684_11538460 Ga0207684_115384601 109
83 3300025911 Ga0207654_11030082 Ga0207654_110300822 109
84 3300025913 Ga0207695_10044422 Ga0207695_100444225 109
85 3300025917 Ga0207660_10090306 Ga0207660_100903062 109
86 3300025918 Ga0207662_10105844 Ga0207662_101058442 109
87 3300025919 Ga0207657_10237526 Ga0207657_102375263 109
88 3300025922 Ga0207646_10123227 Ga0207646_101232272 109
89 3300025923 Ga0207681_10221702 Ga0207681_102217022 109
90 3300025924 Ga0207694_10664094 Ga0207694_106640942 109
91 3300025926 Ga0207659_10642311 Ga0207659_106423112 109
92 3300025927 Ga0207687_10073181 Ga0207687_100731813 109
93 3300025931 Ga0207644_10722079 Ga0207644_107220791 109
94 3300025933 Ga0207706_10000065 Ga0207706_1000006515 109
95 3300025934 Ga0207686_10001117 Ga0207686_100011176 109
96 3300025935 Ga0207709_10004346 Ga0207709_100043463 109
97 3300025936 Ga0207670_11386390 Ga0207670_113863902 109
98 3300025937 Ga0207669_10001479 Ga0207669_100014797 109
99 3300025938 Ga0207704_10058637 Ga0207704_100586373 109
100 3300025940 Ga0207691_10131502 Ga0207691_101315023 109
101 3300025941 Ga0207711_10028892 Ga0207711_100288925 109
102 3300025942 Ga0207689_10007750 Ga0207689_100077504 109
103 3300025949 Ga0207667_10950863 Ga0207667_109508632 109
104 3300025960 Ga0207651_10150000 Ga0207651_101500003 109
105 3300025961 Ga0207712_10044891 Ga0207712_100448914 109
106 3300025961 Ga0207712_10481269 Ga0207712_104812692 109
107 3300025972 Ga0207668_10053139 Ga0207668_100531393 109
108 3300025981 Ga0207640_10110876 Ga0207640_101108762 109
109 3300026075 Ga0207708_10104714 Ga0207708_101047142 109
110 3300026089 Ga0207648_10001169 Ga0207648_100011697 109
111 3300026095 Ga0207676_10048851 Ga0207676_100488513 109
112 3300026116 Ga0207674_10059142 Ga0207674_100591424 109
113 3300026118 Ga0207675_100032261 Ga0207675_1000322614 109
114 3300026121 Ga0207683_10041068 Ga0207683_100410682 109
115 3300026142 Ga0207698_11013550 Ga0207698_110135502 109
116 3300028380 Ga0268265_10037895 Ga0268265_100378954 109
117 3300028381 Ga0268264_10022106 Ga0268264_100221065 109
118 3300031548 Ga0307408_100559101 Ga0307408_1005591013 109
119 3300031548 Ga0307408_100875500 Ga0307408_1008755002 109
120 3300031731 Ga0307405_10154782 Ga0307405_101547822 109
121 3300031824 Ga0307413_10002229 Ga0307413_100022293 109
122 3300031824 Ga0307413_10640847 Ga0307413_106408472 109
123 3300031852 Ga0307410_10015315 Ga0307410_100153153 109
124 3300031901 Ga0307406_10085068 Ga0307406_100850683 109
125 3300031903 Ga0307407_10024361 Ga0307407_100243612 109
126 3300031903 Ga0307407_10379864 Ga0307407_103798642 109
127 3300031911 Ga0307412_10129946 Ga0307412_101299463 109
128 3300031995 Ga0307409_100023234 Ga0307409_1000232344 109
129 3300031995 Ga0307409_100867596 Ga0307409_1008675962 109
130 3300032002 Ga0307416_100073588 Ga0307416_1000735883 109
131 3300032002 Ga0307416_100247873 Ga0307416_1002478733 109
132 3300032004 Ga0307414_10090810 Ga0307414_100908103 109
133 3300032005 Ga0307411_10028273 Ga0307411_100282733 109
134 3300032005 Ga0307411_10858996 Ga0307411_108589962 109
135 3300032126 Ga0307415_100125154 Ga0307415_1001251542 109
136 3300039437 Ga0436365_1159467 Ga0436365_1159467_20_352 109
137 3300042876 Ga0451577_0076398 Ga0451577_0076398_520_852 109
138 3300044673 Ga0453683_0083881 Ga0453683_0083881_1635_1967 109
139 3300045051 Ga0451576_0042077 Ga0451576_0042077_1968_2300 109
140 3300045051 Ga0451576_0781793 Ga0451576_0781793_368_700 109
141 3300046455 Ga0495603_0015387 Ga0495603_0015387_2675_3007 109
142 3300046472 Ga0495580_0614116 Ga0495580_0614116_358_690 109
143 3300046492 Ga0495585_0160087 Ga0495585_0160087_611_943 109
144 3300046501 Ga0495607_0370303 Ga0495607_0370303_132_464 109
145 3300046539 Ga0495621_0210913 Ga0495621_0210913_13_345 109
146 3300046557 Ga0495622_0022950 Ga0495622_0022950_883_1215 109
147 3300046558 Ga0495633_0152348 Ga0495633_0152348_575_907 109
148 3300046691 Ga0495670_0290462 Ga0495670_0290462_413_745 109
149 3300048903 Ga0496100_0202865 Ga0496100_0202865_287_619 109
150 3300048906 Ga0496103_0431769 Ga0496103_0431769_486_818 109
151 3300048909 Ga0496106_0012262 Ga0496106_0012262_668_1000 109
152 3300049772 Ga0501275_011114 Ga0501275_011114_50_382 109
153 3300050508 nmdc:mga09592_132413_c1 nmdc:mga09592_132413_c1_1207_1539 109
154 3300050512 nmdc:mga0n895_1552889_c1 nmdc:mga0n895_1552889_c1_271_603 109
155 3300050512 nmdc:mga0n895_40283_c1 nmdc:mga0n895_40283_c1_16_348 109
156 3300050513 nmdc:mga0rr50_820594_c1 nmdc:mga0rr50_820594_c1_85_417 109
157 3300002070 JGI24750J21931_1019297 JGI24750J21931_10192972 110
158 3300003203 JGI25406J46586_10052517 JGI25406J46586_100525172 110
159 3300003322 rootL2_10101677 rootL2_101016773 110
160 3300003693 Ga0032354_1121886 Ga0032354_11218862 110
161 3300004798 Ga0058859_11814094 Ga0058859_118140941 110
162 3300004799 Ga0058863_10023017 Ga0058863_100230172 110
163 3300004799 Ga0058863_11749219 Ga0058863_117492191 110
164 3300004799 Ga0058863_11766029 Ga0058863_117660292 110
165 3300004799 Ga0058863_11873702 Ga0058863_118737022 110
166 3300004799 Ga0058863_11972071 Ga0058863_119720711 110
167 3300004800 Ga0058861_11621628 Ga0058861_116216281 110
168 3300004800 Ga0058861_11623768 Ga0058861_116237682 110
169 3300004800 Ga0058861_11793331 Ga0058861_117933312 110
170 3300004800 Ga0058861_11819252 Ga0058861_118192521 110
171 3300004800 Ga0058861_11862569 Ga0058861_118625692 110
172 3300004800 Ga0058861_11977672 Ga0058861_119776722 110
173 3300004801 Ga0058860_12016274 Ga0058860_120162741 110
174 3300004803 Ga0058862_10007717 Ga0058862_100077171 110
175 3300004803 Ga0058862_10139180 Ga0058862_101391802 110
176 3300004803 Ga0058862_11895783 Ga0058862_118957831 110
177 3300004803 Ga0058862_12536806 Ga0058862_125368061 110
178 3300004803 Ga0058862_12551672 Ga0058862_125516721 110
179 3300004803 Ga0058862_12614112 Ga0058862_126141122 110
180 3300004803 Ga0058862_12730940 Ga0058862_127309402 110
181 3300004803 Ga0058862_12733296 Ga0058862_127332961 110
182 3300004803 Ga0058862_12860400 Ga0058862_128604002 110
183 3300004803 Ga0058862_12875333 Ga0058862_128753332 110
184 3300005289 Ga0065704_10156196 Ga0065704_101561962 110
185 3300005290 Ga0065712_10002894 Ga0065712_100028945 110
186 3300005293 Ga0065715_10162401 Ga0065715_101624012 110
187 3300005295 Ga0065707_10113306 Ga0065707_101133063 110
188 3300005327 Ga0070658_10009701 Ga0070658_100097013 110
189 3300005327 Ga0070658_10035917 Ga0070658_100359173 110
190 3300005327 Ga0070658_10091002 Ga0070658_100910022 110
191 3300005327 Ga0070658_10188744 Ga0070658_101887441 110
192 3300005327 Ga0070658_10265771 Ga0070658_102657712 110
193 3300005327 Ga0070658_10295648 Ga0070658_102956483 110
194 3300005327 Ga0070658_10569624 Ga0070658_105696242 110
195 3300005327 Ga0070658_10586066 Ga0070658_105860661 110
196 3300005328 Ga0070676_10004346 Ga0070676_100043468 110
197 3300005328 Ga0070676_10830801 Ga0070676_108308012 110
198 3300005328 Ga0070676_10948230 Ga0070676_109482302 110
199 3300005329 Ga0070683_100000233 Ga0070683_1000002333 110
200 3300005329 Ga0070683_100007640 Ga0070683_10000764011 110
201 3300005329 Ga0070683_100021811 Ga0070683_1000218111 110
202 3300005329 Ga0070683_100050905 Ga0070683_1000509053 110
203 3300005329 Ga0070683_100088898 Ga0070683_1000888984 110
204 3300005329 Ga0070683_100104030 Ga0070683_1001040303 110
205 3300005329 Ga0070683_100141480 Ga0070683_1001414801 110
206 3300005329 Ga0070683_100153583 Ga0070683_1001535832 110
207 3300005329 Ga0070683_100225934 Ga0070683_1002259343 110
208 3300005329 Ga0070683_100318464 Ga0070683_1003184642 110
209 3300005329 Ga0070683_100567773 Ga0070683_1005677733 110
210 3300005329 Ga0070683_100697499 Ga0070683_1006974992 110
211 3300005329 Ga0070683_100729882 Ga0070683_1007298822 110
212 3300005329 Ga0070683_101339638 Ga0070683_1013396381 110
213 3300005330 Ga0070690_100430372 Ga0070690_1004303722 110
214 3300005330 Ga0070690_100568538 Ga0070690_1005685381 110
215 3300005330 Ga0070690_101566059 Ga0070690_1015660591 110
216 3300005331 Ga0070670_100007272 Ga0070670_10000727210 110
217 3300005331 Ga0070670_100965521 Ga0070670_1009655211 110
218 3300005331 Ga0070670_101308577 Ga0070670_1013085772 110
219 3300005333 Ga0070677_10445234 Ga0070677_104452342 110
220 3300005334 Ga0068869_100057602 Ga0068869_1000576024 110
221 3300005334 Ga0068869_100895419 Ga0068869_1008954192 110
222 3300005335 Ga0070666_10127916 Ga0070666_101279162 110
223 3300005336 Ga0070680_100027511 Ga0070680_1000275113 110
224 3300005336 Ga0070680_100028065 Ga0070680_1000280654 110
225 3300005336 Ga0070680_100043156 Ga0070680_1000431562 110
226 3300005336 Ga0070680_100050348 Ga0070680_1000503484 110
227 3300005336 Ga0070680_100069042 Ga0070680_1000690423 110
228 3300005336 Ga0070680_100087628 Ga0070680_1000876283 110
229 3300005336 Ga0070680_100314700 Ga0070680_1003147002 110
230 3300005336 Ga0070680_100373251 Ga0070680_1003732512 110
231 3300005336 Ga0070680_100378701 Ga0070680_1003787012 110
232 3300005336 Ga0070680_100442334 Ga0070680_1004423341 110
233 3300005337 Ga0070682_100125509 Ga0070682_1001255093 110
234 3300005337 Ga0070682_100229953 Ga0070682_1002299532 110
235 3300005337 Ga0070682_100382888 Ga0070682_1003828882 110
236 3300005337 Ga0070682_100556699 Ga0070682_1005566993 110
237 3300005337 Ga0070682_101686893 Ga0070682_1016868931 110
238 3300005337 Ga0070682_101724306 Ga0070682_1017243062 110
239 3300005338 Ga0068868_101341298 Ga0068868_1013412982 110
240 3300005339 Ga0070660_100012909 Ga0070660_1000129092 110
241 3300005339 Ga0070660_100125019 Ga0070660_1001250193 110
242 3300005339 Ga0070660_100741289 Ga0070660_1007412891 110
243 3300005339 Ga0070660_100785146 Ga0070660_1007851462 110
244 3300005339 Ga0070660_100945336 Ga0070660_1009453361 110
245 3300005340 Ga0070689_100125500 Ga0070689_1001255003 110
246 3300005341 Ga0070691_10178744 Ga0070691_101787443 110
247 3300005341 Ga0070691_10353471 Ga0070691_103534712 110
248 3300005341 Ga0070691_10856079 Ga0070691_108560791 110
249 3300005343 Ga0070687_100014103 Ga0070687_1000141034 110
250 3300005343 Ga0070687_100275992 Ga0070687_1002759921 110
251 3300005344 Ga0070661_100002985 Ga0070661_10000298513 110
252 3300005344 Ga0070661_100003411 Ga0070661_10000341111 110
253 3300005344 Ga0070661_100003797 Ga0070661_1000037977 110
254 3300005344 Ga0070661_100015035 Ga0070661_1000150356 110
255 3300005344 Ga0070661_100035622 Ga0070661_1000356222 110
256 3300005344 Ga0070661_100065843 Ga0070661_1000658432 110
257 3300005344 Ga0070661_100092097 Ga0070661_1000920973 110
258 3300005344 Ga0070661_100978447 Ga0070661_1009784472 110
259 3300005345 Ga0070692_10104273 Ga0070692_101042732 110
260 3300005345 Ga0070692_10452886 Ga0070692_104528861 110
261 3300005345 Ga0070692_10455385 Ga0070692_104553852 110
262 3300005345 Ga0070692_10543731 Ga0070692_105437312 110
263 3300005345 Ga0070692_10798877 Ga0070692_107988772 110
264 3300005347 Ga0070668_100003043 Ga0070668_1000030438 110
265 3300005353 Ga0070669_100003079 Ga0070669_1000030796 110
266 3300005353 Ga0070669_100006567 Ga0070669_1000065677 110
267 3300005353 Ga0070669_100017058 Ga0070669_1000170586 110
268 3300005353 Ga0070669_101526970 Ga0070669_1015269701 110
269 3300005354 Ga0070675_100002631 Ga0070675_10000263110 110
270 3300005354 Ga0070675_100002663 Ga0070675_10000266312 110
271 3300005354 Ga0070675_100443798 Ga0070675_1004437982 110
272 3300005354 Ga0070675_100538919 Ga0070675_1005389191 110
273 3300005354 Ga0070675_100628948 Ga0070675_1006289482 110
274 3300005355 Ga0070671_100023147 Ga0070671_1000231475 110
275 3300005355 Ga0070671_100306722 Ga0070671_1003067222 110
276 3300005355 Ga0070671_100948637 Ga0070671_1009486372 110
277 3300005356 Ga0070674_100005627 Ga0070674_1000056273 110
278 3300005356 Ga0070674_100090184 Ga0070674_1000901842 110
279 3300005356 Ga0070674_100716610 Ga0070674_1007166101 110
280 3300005356 Ga0070674_101373216 Ga0070674_1013732162 110
281 3300005364 Ga0070673_100071202 Ga0070673_1000712023 110
282 3300005364 Ga0070673_100423788 Ga0070673_1004237882 110
283 3300005365 Ga0070688_100002319 Ga0070688_1000023193 110
284 3300005365 Ga0070688_100210072 Ga0070688_1002100723 110
285 3300005366 Ga0070659_100008807 Ga0070659_1000088075 110
286 3300005366 Ga0070659_100045001 Ga0070659_1000450013 110
287 3300005366 Ga0070659_100098927 Ga0070659_1000989273 110
288 3300005366 Ga0070659_100125537 Ga0070659_1001255373 110
289 3300005366 Ga0070659_100372354 Ga0070659_1003723542 110
290 3300005366 Ga0070659_101093415 Ga0070659_1010934151 110
291 3300005366 Ga0070659_101305541 Ga0070659_1013055412 110
292 3300005367 Ga0070667_100078670 Ga0070667_1000786702 110
293 3300005434 Ga0070709_10004387 Ga0070709_100043875 110
294 3300005434 Ga0070709_10127383 Ga0070709_101273833 110
295 3300005434 Ga0070709_10250300 Ga0070709_102503003 110
296 3300005435 Ga0070714_100017298 Ga0070714_1000172985 110
297 3300005435 Ga0070714_100059789 Ga0070714_1000597891 110
298 3300005435 Ga0070714_101233724 Ga0070714_1012337242 110
299 3300005436 Ga0070713_100007166 Ga0070713_1000071667 110
300 3300005436 Ga0070713_100044534 Ga0070713_1000445344 110
301 3300005436 Ga0070713_100116823 Ga0070713_1001168233 110
302 3300005436 Ga0070713_100460388 Ga0070713_1004603881 110
303 3300005436 Ga0070713_100497774 Ga0070713_1004977742 110
304 3300005436 Ga0070713_102030405 Ga0070713_1020304051 110
305 3300005437 Ga0070710_10184315 Ga0070710_101843152 110
306 3300005437 Ga0070710_10208052 Ga0070710_102080522 110
307 3300005438 Ga0070701_10066722 Ga0070701_100667223 110
308 3300005438 Ga0070701_10197945 Ga0070701_101979452 110
309 3300005439 Ga0070711_100032354 Ga0070711_1000323544 110
310 3300005439 Ga0070711_100093604 Ga0070711_1000936042 110
311 3300005439 Ga0070711_100197012 Ga0070711_1001970122 110
312 3300005439 Ga0070711_100551202 Ga0070711_1005512021 110
313 3300005439 Ga0070711_101492201 Ga0070711_1014922011 110
314 3300005440 Ga0070705_100260434 Ga0070705_1002604342 110
315 3300005441 Ga0070700_100084227 Ga0070700_1000842272 110
316 3300005441 Ga0070700_100273692 Ga0070700_1002736922 110
317 3300005441 Ga0070700_100426352 Ga0070700_1004263522 110
318 3300005444 Ga0070694_100026031 Ga0070694_1000260314 110
319 3300005444 Ga0070694_100071018 Ga0070694_1000710183 110
320 3300005445 Ga0070708_100000198 Ga0070708_10000019819 110
321 3300005445 Ga0070708_100319285 Ga0070708_1003192853 110
322 3300005445 Ga0070708_100319362 Ga0070708_1003193622 110
323 3300005445 Ga0070708_100335521 Ga0070708_1003355212 110
324 3300005455 Ga0070663_100006553 Ga0070663_1000065536 110
325 3300005455 Ga0070663_100026569 Ga0070663_1000265693 110
326 3300005455 Ga0070663_100426316 Ga0070663_1004263162 110
327 3300005455 Ga0070663_100628698 Ga0070663_1006286982 110
328 3300005455 Ga0070663_100846071 Ga0070663_1008460711 110
329 3300005455 Ga0070663_100969771 Ga0070663_1009697711 110
330 3300005456 Ga0070678_100318911 Ga0070678_1003189111 110
331 3300005456 Ga0070678_100941283 Ga0070678_1009412832 110
332 3300005456 Ga0070678_101712329 Ga0070678_1017123292 110
333 3300005457 Ga0070662_100008788 Ga0070662_1000087883 110
334 3300005457 Ga0070662_100317522 Ga0070662_1003175221 110
335 3300005457 Ga0070662_101025354 Ga0070662_1010253542 110
336 3300005457 Ga0070662_101027303 Ga0070662_1010273031 110
337 3300005457 Ga0070662_101457880 Ga0070662_1014578802 110
338 3300005458 Ga0070681_10000404 Ga0070681_1000040436 110
339 3300005458 Ga0070681_10002832 Ga0070681_100028323 110
340 3300005458 Ga0070681_10003332 Ga0070681_100033323 110
341 3300005458 Ga0070681_10003955 Ga0070681_1000395512 110
342 3300005458 Ga0070681_10010307 Ga0070681_100103077 110
343 3300005458 Ga0070681_10039341 Ga0070681_100393416 110
344 3300005458 Ga0070681_10044751 Ga0070681_100447514 110
345 3300005458 Ga0070681_10061350 Ga0070681_100613502 110
346 3300005458 Ga0070681_10169614 Ga0070681_101696143 110
347 3300005458 Ga0070681_10330035 Ga0070681_103300353 110
348 3300005458 Ga0070681_10363900 Ga0070681_103639001 110
349 3300005458 Ga0070681_10543348 Ga0070681_105433481 110
350 3300005458 Ga0070681_10586316 Ga0070681_105863161 110
351 3300005458 Ga0070681_11206837 Ga0070681_112068372 110
352 3300005458 Ga0070681_11206838 Ga0070681_112068382 110
353 3300005458 Ga0070681_12049106 Ga0070681_120491061 110
354 3300005459 Ga0068867_100010994 Ga0068867_1000109945 110
355 3300005459 Ga0068867_100080320 Ga0068867_1000803202 110
356 3300005459 Ga0068867_100937268 Ga0068867_1009372681 110
357 3300005459 Ga0068867_101231203 Ga0068867_1012312032 110
358 3300005459 Ga0068867_101566659 Ga0068867_1015666591 110
359 3300005466 Ga0070685_10237064 Ga0070685_102370642 110
360 3300005467 Ga0070706_100180612 Ga0070706_1001806123 110
361 3300005467 Ga0070706_101174498 Ga0070706_1011744982 110
362 3300005468 Ga0070707_100172133 Ga0070707_1001721333 110
363 3300005468 Ga0070707_100338019 Ga0070707_1003380192 110
364 3300005468 Ga0070707_100748109 Ga0070707_1007481092 110
365 3300005471 Ga0070698_100012821 Ga0070698_1000128218 110
366 3300005471 Ga0070698_100033083 Ga0070698_1000330835 110
367 3300005471 Ga0070698_100060582 Ga0070698_1000605824 110
368 3300005471 Ga0070698_100245585 Ga0070698_1002455853 110
369 3300005471 Ga0070698_100297994 Ga0070698_1002979942 110
370 3300005518 Ga0070699_100075909 Ga0070699_1000759093 110
371 3300005518 Ga0070699_100142767 Ga0070699_1001427671 110
372 3300005518 Ga0070699_100269595 Ga0070699_1002695951 110
373 3300005530 Ga0070679_100000919 Ga0070679_10000091910 110
374 3300005530 Ga0070679_100001084 Ga0070679_10000108425 110
375 3300005530 Ga0070679_100006169 Ga0070679_1000061696 110
376 3300005530 Ga0070679_100043081 Ga0070679_1000430811 110
377 3300005530 Ga0070679_100043325 Ga0070679_1000433255 110
378 3300005530 Ga0070679_100095100 Ga0070679_1000951003 110
379 3300005530 Ga0070679_100245133 Ga0070679_1002451333 110
380 3300005530 Ga0070679_100359492 Ga0070679_1003594922 110
381 3300005530 Ga0070679_100408428 Ga0070679_1004084282 110
382 3300005530 Ga0070679_100670594 Ga0070679_1006705942 110
383 3300005530 Ga0070679_100702985 Ga0070679_1007029852 110
384 3300005530 Ga0070679_101279873 Ga0070679_1012798732 110
385 3300005530 Ga0070679_101506731 Ga0070679_1015067311 110
386 3300005535 Ga0070684_100006699 Ga0070684_1000066995 110
387 3300005535 Ga0070684_100024585 Ga0070684_1000245853 110
388 3300005535 Ga0070684_100038174 Ga0070684_1000381744 110
389 3300005535 Ga0070684_100043865 Ga0070684_1000438654 110
390 3300005535 Ga0070684_100076836 Ga0070684_1000768363 110
391 3300005535 Ga0070684_100297248 Ga0070684_1002972482 110
392 3300005535 Ga0070684_100301427 Ga0070684_1003014273 110
393 3300005535 Ga0070684_100365457 Ga0070684_1003654572 110
394 3300005535 Ga0070684_100387243 Ga0070684_1003872433 110
395 3300005535 Ga0070684_100390698 Ga0070684_1003906982 110
396 3300005535 Ga0070684_100725714 Ga0070684_1007257142 110
397 3300005539 Ga0068853_100013646 Ga0068853_1000136463 110
398 3300005539 Ga0068853_100016074 Ga0068853_1000160747 110
399 3300005539 Ga0068853_100487555 Ga0068853_1004875552 110
400 3300005539 Ga0068853_100531253 Ga0068853_1005312532 110
401 3300005539 Ga0068853_100600016 Ga0068853_1006000162 110
402 3300005539 Ga0068853_101020938 Ga0068853_1010209382 110
403 3300005543 Ga0070672_100004984 Ga0070672_1000049842 110
404 3300005543 Ga0070672_100005766 Ga0070672_1000057667 110
405 3300005543 Ga0070672_102093168 Ga0070672_1020931682 110
406 3300005544 Ga0070686_100256050 Ga0070686_1002560501 110
407 3300005544 Ga0070686_100505251 Ga0070686_1005052512 110
408 3300005545 Ga0070695_100246326 Ga0070695_1002463263 110
409 3300005545 Ga0070695_100441644 Ga0070695_1004416442 110
410 3300005545 Ga0070695_100461616 Ga0070695_1004616162 110
411 3300005545 Ga0070695_101161069 Ga0070695_1011610691 110
412 3300005546 Ga0070696_100001375 Ga0070696_1000013758 110
413 3300005546 Ga0070696_100077827 Ga0070696_1000778273 110
414 3300005546 Ga0070696_100091579 Ga0070696_1000915793 110
415 3300005546 Ga0070696_101883053 Ga0070696_1018830531 110
416 3300005547 Ga0070693_100008533 Ga0070693_1000085333 110
417 3300005547 Ga0070693_100057558 Ga0070693_1000575581 110
418 3300005547 Ga0070693_100503499 Ga0070693_1005034992 110
419 3300005547 Ga0070693_100912568 Ga0070693_1009125681 110
420 3300005548 Ga0070665_100042538 Ga0070665_1000425383 110
421 3300005548 Ga0070665_100052068 Ga0070665_1000520685 110
422 3300005548 Ga0070665_102600001 Ga0070665_1026000012 110
423 3300005549 Ga0070704_100227659 Ga0070704_1002276592 110
424 3300005549 Ga0070704_101093287 Ga0070704_1010932871 110
425 3300005563 Ga0068855_100002169 Ga0068855_10000216922 110
426 3300005563 Ga0068855_100005082 Ga0068855_10000508213 110
427 3300005563 Ga0068855_100008571 Ga0068855_1000085717 110
428 3300005563 Ga0068855_100043978 Ga0068855_1000439785 110
429 3300005563 Ga0068855_100366932 Ga0068855_1003669323 110
430 3300005563 Ga0068855_100381898 Ga0068855_1003818982 110
431 3300005563 Ga0068855_100990687 Ga0068855_1009906871 110
432 3300005563 Ga0068855_101054914 Ga0068855_1010549142 110
433 3300005563 Ga0068855_101547206 Ga0068855_1015472061 110
434 3300005564 Ga0070664_100013154 Ga0070664_1000131542 110
435 3300005564 Ga0070664_100024766 Ga0070664_1000247663 110
436 3300005564 Ga0070664_100051722 Ga0070664_1000517224 110
437 3300005564 Ga0070664_100485014 Ga0070664_1004850142 110
438 3300005564 Ga0070664_101004731 Ga0070664_1010047311 110
439 3300005564 Ga0070664_101389984 Ga0070664_1013899842 110
440 3300005577 Ga0068857_100012151 Ga0068857_1000121512 110
441 3300005577 Ga0068857_100015739 Ga0068857_1000157398 110
442 3300005577 Ga0068857_100020862 Ga0068857_1000208624 110
443 3300005577 Ga0068857_100087176 Ga0068857_1000871763 110
444 3300005577 Ga0068857_100736577 Ga0068857_1007365772 110
445 3300005578 Ga0068854_100034276 Ga0068854_1000342764 110
446 3300005578 Ga0068854_100053241 Ga0068854_1000532414 110
447 3300005578 Ga0068854_100420152 Ga0068854_1004201522 110
448 3300005578 Ga0068854_100745723 Ga0068854_1007457232 110
449 3300005578 Ga0068854_100790047 Ga0068854_1007900472 110
450 3300005578 Ga0068854_101739925 Ga0068854_1017399252 110
451 3300005614 Ga0068856_100364022 Ga0068856_1003640222 110
452 3300005614 Ga0068856_100457035 Ga0068856_1004570351 110
453 3300005614 Ga0068856_100648460 Ga0068856_1006484602 110
454 3300005614 Ga0068856_100680175 Ga0068856_1006801751 110
455 3300005614 Ga0068856_100941185 Ga0068856_1009411852 110
456 3300005614 Ga0068856_101002356 Ga0068856_1010023562 110
457 3300005615 Ga0070702_100518545 Ga0070702_1005185451 110
458 3300005616 Ga0068852_100014974 Ga0068852_1000149742 110
459 3300005616 Ga0068852_100018984 Ga0068852_1000189843 110
460 3300005616 Ga0068852_100069165 Ga0068852_1000691652 110
461 3300005616 Ga0068852_100192890 Ga0068852_1001928902 110
462 3300005616 Ga0068852_100202237 Ga0068852_1002022371 110
463 3300005616 Ga0068852_100546103 Ga0068852_1005461032 110
464 3300005616 Ga0068852_101434378 Ga0068852_1014343782 110
465 3300005617 Ga0068859_100056150 Ga0068859_1000561503 110
466 3300005617 Ga0068859_100897660 Ga0068859_1008976601 110
467 3300005618 Ga0068864_100038902 Ga0068864_1000389023 110
468 3300005618 Ga0068864_100318803 Ga0068864_1003188032 110
469 3300005618 Ga0068864_100369234 Ga0068864_1003692342 110
470 3300005618 Ga0068864_101236591 Ga0068864_1012365912 110
471 3300005718 Ga0068866_10116924 Ga0068866_101169243 110
472 3300005718 Ga0068866_10376060 Ga0068866_103760602 110
473 3300005718 Ga0068866_10812860 Ga0068866_108128601 110
474 3300005719 Ga0068861_100001019 Ga0068861_10000101911 110
475 3300005719 Ga0068861_100049474 Ga0068861_1000494743 110
476 3300005719 Ga0068861_100944581 Ga0068861_1009445812 110
477 3300005834 Ga0068851_10015465 Ga0068851_100154652 110
478 3300005834 Ga0068851_10071393 Ga0068851_100713933 110
479 3300005834 Ga0068851_10269088 Ga0068851_102690882 110
480 3300005840 Ga0068870_10002079 Ga0068870_100020798 110
481 3300005840 Ga0068870_10304076 Ga0068870_103040762 110
482 3300005840 Ga0068870_10428249 Ga0068870_104282492 110
483 3300005840 Ga0068870_10492048 Ga0068870_104920482 110
484 3300005841 Ga0068863_100041206 Ga0068863_1000412064 110
485 3300005841 Ga0068863_100160660 Ga0068863_1001606602 110
486 3300005841 Ga0068863_100319991 Ga0068863_1003199912 110
487 3300005842 Ga0068858_100022826 Ga0068858_1000228262 110
488 3300005843 Ga0068860_100227646 Ga0068860_1002276463 110
489 3300005843 Ga0068860_100535547 Ga0068860_1005355472 110
490 3300005844 Ga0068862_100000376 Ga0068862_10000037611 110
491 3300005844 Ga0068862_100030151 Ga0068862_1000301515 110
492 3300005844 Ga0068862_100126281 Ga0068862_1001262813 110
493 3300005937 Ga0081455_10038603 Ga0081455_100386033 110
494 3300005937 Ga0081455_10050687 Ga0081455_100506873 110
495 3300005985 Ga0081539_10000104 Ga0081539_10000104179 110
496 3300005985 Ga0081539_10043960 Ga0081539_100439603 110
497 3300005985 Ga0081539_10230857 Ga0081539_102308571 110
498 3300006028 Ga0070717_10016213 Ga0070717_100162136 110
499 3300006028 Ga0070717_10418219 Ga0070717_104182193 110
500 3300006028 Ga0070717_10918133 Ga0070717_109181331 110
501 3300006058 Ga0075432_10382237 Ga0075432_103822372 110
502 3300006173 Ga0070716_100172719 Ga0070716_1001727192 110
503 3300006173 Ga0070716_100338785 Ga0070716_1003387852 110
504 3300006173 Ga0070716_100489729 Ga0070716_1004897292 110
505 3300006173 Ga0070716_100573872 Ga0070716_1005738722 110
506 3300006173 Ga0070716_100851716 Ga0070716_1008517162 110
507 3300006175 Ga0070712_100012458 Ga0070712_1000124585 110
508 3300006175 Ga0070712_100028870 Ga0070712_1000288702 110
509 3300006175 Ga0070712_100062454 Ga0070712_1000624544 110
510 3300006175 Ga0070712_100347417 Ga0070712_1003474172 110
511 3300006175 Ga0070712_100413145 Ga0070712_1004131452 110
512 3300006175 Ga0070712_100488267 Ga0070712_1004882671 110
513 3300006358 Ga0068871_100407653 Ga0068871_1004076532 110
514 3300006844 Ga0075428_100235434 Ga0075428_1002354343 110
515 3300006844 Ga0075428_100397778 Ga0075428_1003977782 110
516 3300006844 Ga0075428_101094780 Ga0075428_1010947801 110
517 3300006844 Ga0075428_101376680 Ga0075428_1013766802 110
518 3300006844 Ga0075428_101708408 Ga0075428_1017084081 110
519 3300006846 Ga0075430_100003192 Ga0075430_1000031923 110
520 3300006846 Ga0075430_100013015 Ga0075430_1000130154 110
521 3300006846 Ga0075430_100019170 Ga0075430_1000191704 110
522 3300006846 Ga0075430_100029938 Ga0075430_1000299385 110
523 3300006846 Ga0075430_100194674 Ga0075430_1001946741 110
524 3300006846 Ga0075430_100269583 Ga0075430_1002695833 110
525 3300006847 Ga0075431_100024864 Ga0075431_1000248645 110
526 3300006847 Ga0075431_100037185 Ga0075431_1000371853 110
527 3300006847 Ga0075431_100053473 Ga0075431_1000534732 110
528 3300006847 Ga0075431_100065457 Ga0075431_1000654573 110
529 3300006847 Ga0075431_100076205 Ga0075431_1000762053 110
530 3300006847 Ga0075431_100186854 Ga0075431_1001868543 110
531 3300006847 Ga0075431_100236239 Ga0075431_1002362392 110
532 3300006847 Ga0075431_100247272 Ga0075431_1002472722 110
533 3300006847 Ga0075431_100373540 Ga0075431_1003735402 110
534 3300006852 Ga0075433_10005348 Ga0075433_100053488 110
535 3300006852 Ga0075433_10718897 Ga0075433_107188972 110
536 3300006871 Ga0075434_100001804 Ga0075434_10000180421 110
537 3300006871 Ga0075434_100035507 Ga0075434_1000355074 110
538 3300006871 Ga0075434_100244634 Ga0075434_1002446341 110
539 3300006871 Ga0075434_100881508 Ga0075434_1008815082 110
540 3300006880 Ga0075429_100067642 Ga0075429_1000676423 110
541 3300006880 Ga0075429_100208196 Ga0075429_1002081963 110
542 3300006880 Ga0075429_100453510 Ga0075429_1004535102 110
543 3300006880 Ga0075429_100470855 Ga0075429_1004708552 110
544 3300006881 Ga0068865_100001514 Ga0068865_1000015148 110
545 3300006881 Ga0068865_100628234 Ga0068865_1006282342 110
546 3300006914 Ga0075436_100114952 Ga0075436_1001149523 110
547 3300006914 Ga0075436_100209048 Ga0075436_1002090481 110
548 3300006931 Ga0097620_100056151 Ga0097620_1000561513 110
549 3300006931 Ga0097620_100897771 Ga0097620_1008977711 110
550 3300007076 Ga0075435_100694998 Ga0075435_1006949981 110
551 3300007076 Ga0075435_100980540 Ga0075435_1009805402 110
552 3300007076 Ga0075435_101112837 Ga0075435_1011128372 110
553 3300009093 Ga0105240_10009204 Ga0105240_100092048 110
554 3300009093 Ga0105240_10011015 Ga0105240_100110156 110
555 3300009093 Ga0105240_10016684 Ga0105240_100166843 110
556 3300009093 Ga0105240_10037426 Ga0105240_100374262 110
557 3300009093 Ga0105240_10070716 Ga0105240_100707163 110
558 3300009093 Ga0105240_10074073 Ga0105240_100740734 110
559 3300009093 Ga0105240_10090200 Ga0105240_100902004 110
560 3300009093 Ga0105240_10705779 Ga0105240_107057792 110
561 3300009093 Ga0105240_10890443 Ga0105240_108904432 110
562 3300009093 Ga0105240_11048922 Ga0105240_110489221 110
563 3300009094 Ga0111539_10042342 Ga0111539_100423425 110
564 3300009094 Ga0111539_10088891 Ga0111539_100888913 110
565 3300009094 Ga0111539_10150269 Ga0111539_101502693 110
566 3300009094 Ga0111539_10251608 Ga0111539_102516083 110
567 3300009094 Ga0111539_10920564 Ga0111539_109205642 110
568 3300009098 Ga0105245_10025521 Ga0105245_100255213 110
569 3300009098 Ga0105245_12730105 Ga0105245_127301052 110
570 3300009147 Ga0114129_10017266 Ga0114129_100172668 110
571 3300009147 Ga0114129_10068560 Ga0114129_100685606 110
572 3300009147 Ga0114129_10230022 Ga0114129_102300223 110
573 3300009147 Ga0114129_10273868 Ga0114129_102738683 110
574 3300009147 Ga0114129_10299783 Ga0114129_102997833 110
575 3300009147 Ga0114129_10477216 Ga0114129_104772162 110
576 3300009147 Ga0114129_10941962 Ga0114129_109419622 110
577 3300009147 Ga0114129_11407312 Ga0114129_114073122 110
578 3300009148 Ga0105243_10242951 Ga0105243_102429512 110
579 3300009148 Ga0105243_10590746 Ga0105243_105907462 110
580 3300009174 Ga0105241_10000729 Ga0105241_1000072912 110
581 3300009174 Ga0105241_10116790 Ga0105241_101167903 110
582 3300009174 Ga0105241_10169367 Ga0105241_101693673 110
583 3300009174 Ga0105241_10525033 Ga0105241_105250332 110
584 3300009174 Ga0105241_10717479 Ga0105241_107174792 110
585 3300009174 Ga0105241_11098168 Ga0105241_110981682 110
586 3300009176 Ga0105242_10015995 Ga0105242_100159955 110
587 3300009176 Ga0105242_10181321 Ga0105242_101813213 110
588 3300009176 Ga0105242_10993453 Ga0105242_109934532 110
589 3300009176 Ga0105242_11994438 Ga0105242_119944381 110
590 3300009177 Ga0105248_10009365 Ga0105248_100093656 110
591 3300009177 Ga0105248_10104035 Ga0105248_101040354 110
592 3300009177 Ga0105248_10916580 Ga0105248_109165801 110
593 3300009177 Ga0105248_12078802 Ga0105248_120788021 110
594 3300009545 Ga0105237_10079939 Ga0105237_100799392 110
595 3300009545 Ga0105237_10149201 Ga0105237_101492013 110
596 3300009545 Ga0105237_10431669 Ga0105237_104316692 110
597 3300009545 Ga0105237_10472521 Ga0105237_104725212 110
598 3300009545 Ga0105237_11127262 Ga0105237_111272622 110
599 3300009551 Ga0105238_10024368 Ga0105238_100243683 110
600 3300009551 Ga0105238_10066363 Ga0105238_100663633 110
601 3300009551 Ga0105238_10073038 Ga0105238_100730383 110
602 3300009551 Ga0105238_10087946 Ga0105238_100879463 110
603 3300009551 Ga0105238_10816832 Ga0105238_108168322 110
604 3300009551 Ga0105238_11465449 Ga0105238_114654492 110
605 3300009551 Ga0105238_12277478 Ga0105238_122774781 110
606 3300009553 Ga0105249_10000454 Ga0105249_1000045429 110
607 3300009553 Ga0105249_10069734 Ga0105249_100697343 110
608 3300009553 Ga0105249_10325281 Ga0105249_103252813 110
609 3300009553 Ga0105249_10809129 Ga0105249_108091292 110
610 3300010375 Ga0105239_10231952 Ga0105239_102319523 110
611 3300010375 Ga0105239_10259676 Ga0105239_102596762 110
612 3300010375 Ga0105239_10382025 Ga0105239_103820252 110
613 3300010375 Ga0105239_11245419 Ga0105239_112454192 110
614 3300011119 Ga0105246_10471626 Ga0105246_104716262 110
615 3300012507 Ga0157342_1073673 Ga0157342_10736731 110
616 3300013100 Ga0157373_10001473 Ga0157373_1000147313 110
617 3300013100 Ga0157373_10027655 Ga0157373_100276554 110
618 3300013100 Ga0157373_10091952 Ga0157373_100919521 110
619 3300013100 Ga0157373_10152454 Ga0157373_101524543 110
620 3300013100 Ga0157373_10201626 Ga0157373_102016261 110
621 3300013100 Ga0157373_10237167 Ga0157373_102371671 110
622 3300013100 Ga0157373_11331309 Ga0157373_113313092 110
623 3300013102 Ga0157371_10007275 Ga0157371_1000727510 110
624 3300013102 Ga0157371_10714457 Ga0157371_107144571 110
625 3300013102 Ga0157371_10743094 Ga0157371_107430942 110
626 3300013102 Ga0157371_11534102 Ga0157371_115341022 110
627 3300013104 Ga0157370_10003508 Ga0157370_100035088 110
628 3300013104 Ga0157370_10008754 Ga0157370_100087543 110
629 3300013104 Ga0157370_10041763 Ga0157370_100417634 110
630 3300013104 Ga0157370_10136189 Ga0157370_101361891 110
631 3300013104 Ga0157370_10165029 Ga0157370_101650291 110
632 3300013104 Ga0157370_10166493 Ga0157370_101664932 110
633 3300013104 Ga0157370_10282223 Ga0157370_102822233 110
634 3300013104 Ga0157370_10861985 Ga0157370_108619852 110
635 3300013104 Ga0157370_11117989 Ga0157370_111179891 110
636 3300013104 Ga0157370_11609613 Ga0157370_116096132 110
637 3300013105 Ga0157369_10009705 Ga0157369_100097055 110
638 3300013105 Ga0157369_10017338 Ga0157369_100173384 110
639 3300013105 Ga0157369_10073925 Ga0157369_100739254 110
640 3300013105 Ga0157369_10115485 Ga0157369_101154852 110
641 3300013105 Ga0157369_10117595 Ga0157369_101175954 110
642 3300013105 Ga0157369_10119385 Ga0157369_101193853 110
643 3300013105 Ga0157369_10232225 Ga0157369_102322253 110
644 3300013105 Ga0157369_10232838 Ga0157369_102328381 110
645 3300013105 Ga0157369_10739412 Ga0157369_107394121 110
646 3300013105 Ga0157369_10743766 Ga0157369_107437662 110
647 3300013105 Ga0157369_11755948 Ga0157369_117559481 110
648 3300013296 Ga0157374_10433589 Ga0157374_104335891 110
649 3300013296 Ga0157374_10990234 Ga0157374_109902342 110
650 3300013296 Ga0157374_11098074 Ga0157374_110980742 110
651 3300013296 Ga0157374_11385070 Ga0157374_113850702 110
652 3300013296 Ga0157374_12425697 Ga0157374_124256972 110
653 3300013297 Ga0157378_10005002 Ga0157378_1000500210 110
654 3300013297 Ga0157378_10429050 Ga0157378_104290502 110
655 3300013306 Ga0163162_10001492 Ga0163162_1000149222 110
656 3300013306 Ga0163162_10013828 Ga0163162_100138282 110
657 3300013306 Ga0163162_12869838 Ga0163162_128698381 110
658 3300013307 Ga0157372_10010171 Ga0157372_100101714 110
659 3300013307 Ga0157372_10013087 Ga0157372_100130871 110
660 3300013307 Ga0157372_10015470 Ga0157372_100154708 110
661 3300013307 Ga0157372_10025540 Ga0157372_100255408 110
662 3300013307 Ga0157372_10068103 Ga0157372_100681033 110
663 3300013307 Ga0157372_10118363 Ga0157372_101183633 110
664 3300013307 Ga0157372_10124994 Ga0157372_101249944 110
665 3300013307 Ga0157372_10252248 Ga0157372_102522483 110
666 3300013307 Ga0157372_10317512 Ga0157372_103175121 110
667 3300013307 Ga0157372_10367523 Ga0157372_103675232 110
668 3300013307 Ga0157372_10382231 Ga0157372_103822313 110
669 3300013307 Ga0157372_10509511 Ga0157372_105095112 110
670 3300013307 Ga0157372_10519876 Ga0157372_105198762 110
671 3300013307 Ga0157372_10617092 Ga0157372_106170922 110
672 3300013307 Ga0157372_10636435 Ga0157372_106364353 110
673 3300013307 Ga0157372_10659924 Ga0157372_106599241 110
674 3300013307 Ga0157372_11287462 Ga0157372_112874621 110
675 3300013307 Ga0157372_11664064 Ga0157372_116640642 110
676 3300013307 Ga0157372_11736237 Ga0157372_117362372 110
677 3300013307 Ga0157372_11902482 Ga0157372_119024822 110
678 3300013307 Ga0157372_12279322 Ga0157372_122793221 110
679 3300013307 Ga0157372_12346199 Ga0157372_123461992 110
680 3300013307 Ga0157372_12369999 Ga0157372_123699991 110
681 3300013307 Ga0157372_12614981 Ga0157372_126149811 110
682 3300013308 Ga0157375_10091745 Ga0157375_100917452 110
683 3300013308 Ga0157375_10100651 Ga0157375_101006512 110
684 3300013308 Ga0157375_10294846 Ga0157375_102948462 110
685 3300013308 Ga0157375_10840832 Ga0157375_108408322 110
686 3300014325 Ga0163163_10070485 Ga0163163_100704852 110
687 3300014325 Ga0163163_10660291 Ga0163163_106602912 110
688 3300014326 Ga0157380_10007646 Ga0157380_100076467 110
689 3300014326 Ga0157380_10033634 Ga0157380_100336342 110
690 3300014326 Ga0157380_10148905 Ga0157380_101489052 110
691 3300014326 Ga0157380_12670253 Ga0157380_126702531 110
692 3300014497 Ga0182008_10009299 Ga0182008_100092993 110
693 3300014497 Ga0182008_10081193 Ga0182008_100811933 110
694 3300014745 Ga0157377_10031866 Ga0157377_100318663 110
695 3300014968 Ga0157379_10015608 Ga0157379_100156082 110
696 3300014969 Ga0157376_10225367 Ga0157376_102253673 110
697 3300014969 Ga0157376_11883363 Ga0157376_118833631 110
698 3300015262 Ga0182007_10042612 Ga0182007_100426122 110
699 3300015262 Ga0182007_10073079 Ga0182007_100730792 110
700 3300015262 Ga0182007_10210130 Ga0182007_102101302 110
701 3300015262 Ga0182007_10215945 Ga0182007_102159452 110
702 3300015262 Ga0182007_10254854 Ga0182007_102548542 110
703 3300015265 Ga0182005_1079726 Ga0182005_10797263 110
704 3300017792 Ga0163161_11802713 Ga0163161_118027131 110
705 3300020069 Ga0197907_11166881 Ga0197907_111668812 110
706 3300020069 Ga0197907_11314107 Ga0197907_113141071 110
707 3300020070 Ga0206356_10116592 Ga0206356_101165922 110
708 3300020070 Ga0206356_10125692 Ga0206356_101256922 110
709 3300020070 Ga0206356_10416445 Ga0206356_104164452 110
710 3300020070 Ga0206356_10483138 Ga0206356_104831381 110
711 3300020070 Ga0206356_10839536 Ga0206356_108395362 110
712 3300020070 Ga0206356_11361504 Ga0206356_113615041 110
713 3300020070 Ga0206356_11525656 Ga0206356_115256562 110
714 3300020070 Ga0206356_11642972 Ga0206356_116429721 110
715 3300020070 Ga0206356_11798847 Ga0206356_117988471 110
716 3300020076 Ga0206355_1012074 Ga0206355_10120741 110
717 3300020076 Ga0206355_1360271 Ga0206355_13602712 110
718 3300020078 Ga0206352_10641371 Ga0206352_106413711 110
719 3300020078 Ga0206352_10860556 Ga0206352_108605562 110
720 3300020078 Ga0206352_10936146 Ga0206352_109361462 110
721 3300020078 Ga0206352_11130402 Ga0206352_111304022 110
722 3300020078 Ga0206352_11362427 Ga0206352_113624272 110
723 3300020080 Ga0206350_10135957 Ga0206350_101359572 110
724 3300021384 Ga0213876_10040236 Ga0213876_100402362 110
725 3300022467 Ga0224712_10152424 Ga0224712_101524242 110
726 3300022467 Ga0224712_10316866 Ga0224712_103168662 110
727 3300022467 Ga0224712_10352983 Ga0224712_103529831 110
728 3300022467 Ga0224712_10681828 Ga0224712_106818281 110
729 3300025271 Ga0207666_1047325 Ga0207666_10473252 110
730 3300025290 Ga0207673_1009498 Ga0207673_10094982 110
731 3300025315 Ga0207697_10005445 Ga0207697_100054454 110
732 3300025321 Ga0207656_10006385 Ga0207656_100063855 110
733 3300025321 Ga0207656_10172199 Ga0207656_101721992 110
734 3300025885 Ga0207653_10092535 Ga0207653_100925351 110
735 3300025893 Ga0207682_10168826 Ga0207682_101688262 110
736 3300025898 Ga0207692_10101751 Ga0207692_101017513 110
737 3300025898 Ga0207692_10231793 Ga0207692_102317932 110
738 3300025899 Ga0207642_10150415 Ga0207642_101504153 110
739 3300025901 Ga0207688_10023241 Ga0207688_100232412 110
740 3300025903 Ga0207680_10213827 Ga0207680_102138271 110
741 3300025903 Ga0207680_10821322 Ga0207680_108213222 110
742 3300025904 Ga0207647_10195587 Ga0207647_101955872 110
743 3300025905 Ga0207685_10513020 Ga0207685_105130202 110
744 3300025906 Ga0207699_10008459 Ga0207699_100084593 110
745 3300025906 Ga0207699_10045530 Ga0207699_100455302 110
746 3300025906 Ga0207699_10106448 Ga0207699_101064483 110
747 3300025906 Ga0207699_10106541 Ga0207699_101065413 110
748 3300025907 Ga0207645_10000246 Ga0207645_1000024621 110
749 3300025907 Ga0207645_10067632 Ga0207645_100676324 110
750 3300025908 Ga0207643_10001951 Ga0207643_100019512 110
751 3300025908 Ga0207643_10131229 Ga0207643_101312292 110
752 3300025908 Ga0207643_10266169 Ga0207643_102661691 110
753 3300025909 Ga0207705_10007986 Ga0207705_100079868 110
754 3300025909 Ga0207705_10085948 Ga0207705_100859484 110
755 3300025909 Ga0207705_10089643 Ga0207705_100896434 110
756 3300025909 Ga0207705_10092825 Ga0207705_100928253 110
757 3300025909 Ga0207705_10104101 Ga0207705_101041013 110
758 3300025909 Ga0207705_10568143 Ga0207705_105681432 110
759 3300025910 Ga0207684_10135612 Ga0207684_101356123 110
760 3300025910 Ga0207684_10299794 Ga0207684_102997943 110
761 3300025910 Ga0207684_11568418 Ga0207684_115684181 110
762 3300025911 Ga0207654_10000860 Ga0207654_1000086012 110
763 3300025911 Ga0207654_10222487 Ga0207654_102224871 110
764 3300025911 Ga0207654_10324081 Ga0207654_103240811 110
765 3300025911 Ga0207654_10756775 Ga0207654_107567752 110
766 3300025911 Ga0207654_10955665 Ga0207654_109556652 110
767 3300025912 Ga0207707_10000929 Ga0207707_100009298 110
768 3300025912 Ga0207707_10002146 Ga0207707_1000214616 110
769 3300025912 Ga0207707_10002891 Ga0207707_100028916 110
770 3300025912 Ga0207707_10007791 Ga0207707_100077917 110
771 3300025912 Ga0207707_10013410 Ga0207707_100134105 110
772 3300025912 Ga0207707_10018294 Ga0207707_100182943 110
773 3300025912 Ga0207707_10021378 Ga0207707_100213785 110
774 3300025912 Ga0207707_10029197 Ga0207707_100291973 110
775 3300025912 Ga0207707_10075721 Ga0207707_100757215 110
776 3300025912 Ga0207707_10138032 Ga0207707_101380323 110
777 3300025912 Ga0207707_10629028 Ga0207707_106290282 110
778 3300025912 Ga0207707_10649450 Ga0207707_106494501 110
779 3300025912 Ga0207707_11269747 Ga0207707_112697472 110
780 3300025913 Ga0207695_10001441 Ga0207695_1000144123 110
781 3300025913 Ga0207695_10004676 Ga0207695_1000467613 110
782 3300025913 Ga0207695_10008984 Ga0207695_100089847 110
783 3300025913 Ga0207695_10014206 Ga0207695_100142065 110
784 3300025913 Ga0207695_10020766 Ga0207695_100207662 110
785 3300025913 Ga0207695_10064710 Ga0207695_100647103 110
786 3300025913 Ga0207695_10081615 Ga0207695_100816152 110
787 3300025913 Ga0207695_10084488 Ga0207695_100844881 110
788 3300025914 Ga0207671_10019018 Ga0207671_100190182 110
789 3300025914 Ga0207671_10131053 Ga0207671_101310533 110
790 3300025914 Ga0207671_10390182 Ga0207671_103901822 110
791 3300025915 Ga0207693_10019839 Ga0207693_100198395 110
792 3300025915 Ga0207693_10041127 Ga0207693_100411275 110
793 3300025915 Ga0207693_10361743 Ga0207693_103617432 110
794 3300025915 Ga0207693_10406055 Ga0207693_104060553 110
795 3300025915 Ga0207693_10410453 Ga0207693_104104532 110
796 3300025915 Ga0207693_10421808 Ga0207693_104218081 110
797 3300025915 Ga0207693_10613331 Ga0207693_106133312 110
798 3300025916 Ga0207663_10001490 Ga0207663_1000149012 110
799 3300025916 Ga0207663_10080650 Ga0207663_100806503 110
800 3300025916 Ga0207663_10172527 Ga0207663_101725272 110
801 3300025916 Ga0207663_10243302 Ga0207663_102433022 110
802 3300025916 Ga0207663_10898578 Ga0207663_108985782 110
803 3300025916 Ga0207663_11205783 Ga0207663_112057831 110
804 3300025917 Ga0207660_10001809 Ga0207660_100018099 110
805 3300025917 Ga0207660_10017662 Ga0207660_100176625 110
806 3300025917 Ga0207660_10032222 Ga0207660_100322223 110
807 3300025917 Ga0207660_10065650 Ga0207660_100656503 110
808 3300025917 Ga0207660_10087746 Ga0207660_100877463 110
809 3300025917 Ga0207660_10101186 Ga0207660_101011863 110
810 3300025917 Ga0207660_10141654 Ga0207660_101416542 110
811 3300025917 Ga0207660_10218233 Ga0207660_102182332 110
812 3300025917 Ga0207660_10239322 Ga0207660_102393222 110
813 3300025917 Ga0207660_10918590 Ga0207660_109185901 110
814 3300025917 Ga0207660_11133214 Ga0207660_111332141 110
815 3300025918 Ga0207662_10003841 Ga0207662_100038413 110
816 3300025918 Ga0207662_10244175 Ga0207662_102441753 110
817 3300025919 Ga0207657_10005262 Ga0207657_1000526213 110
818 3300025919 Ga0207657_10021232 Ga0207657_100212322 110
819 3300025919 Ga0207657_10250158 Ga0207657_102501582 110
820 3300025919 Ga0207657_10541662 Ga0207657_105416622 110
821 3300025919 Ga0207657_10685639 Ga0207657_106856392 110
822 3300025919 Ga0207657_11469464 Ga0207657_114694641 110
823 3300025920 Ga0207649_10029427 Ga0207649_100294274 110
824 3300025920 Ga0207649_10050337 Ga0207649_100503372 110
825 3300025920 Ga0207649_10096437 Ga0207649_100964373 110
826 3300025920 Ga0207649_10165257 Ga0207649_101652572 110
827 3300025920 Ga0207649_10174948 Ga0207649_101749482 110
828 3300025920 Ga0207649_10852542 Ga0207649_108525422 110
829 3300025921 Ga0207652_10000470 Ga0207652_1000047020 110
830 3300025921 Ga0207652_10003423 Ga0207652_1000342311 110
831 3300025921 Ga0207652_10007324 Ga0207652_100073243 110
832 3300025921 Ga0207652_10020285 Ga0207652_100202855 110
833 3300025921 Ga0207652_10022221 Ga0207652_100222213 110
834 3300025921 Ga0207652_10024204 Ga0207652_100242044 110
835 3300025921 Ga0207652_10031148 Ga0207652_100311484 110
836 3300025921 Ga0207652_10086061 Ga0207652_100860612 110
837 3300025921 Ga0207652_10088832 Ga0207652_100888321 110
838 3300025921 Ga0207652_10267542 Ga0207652_102675422 110
839 3300025921 Ga0207652_10564050 Ga0207652_105640501 110
840 3300025921 Ga0207652_11525639 Ga0207652_115256391 110
841 3300025922 Ga0207646_10142024 Ga0207646_101420242 110
842 3300025922 Ga0207646_10424101 Ga0207646_104241011 110
843 3300025923 Ga0207681_10009785 Ga0207681_100097857 110
844 3300025923 Ga0207681_10054383 Ga0207681_100543832 110
845 3300025923 Ga0207681_10066558 Ga0207681_100665583 110
846 3300025924 Ga0207694_10023333 Ga0207694_100233333 110
847 3300025924 Ga0207694_10137479 Ga0207694_101374792 110
848 3300025924 Ga0207694_10209118 Ga0207694_102091182 110
849 3300025924 Ga0207694_10360180 Ga0207694_103601802 110
850 3300025924 Ga0207694_11230706 Ga0207694_112307062 110
851 3300025925 Ga0207650_10004487 Ga0207650_100044874 110
852 3300025925 Ga0207650_10101704 Ga0207650_101017042 110
853 3300025925 Ga0207650_10104656 Ga0207650_101046563 110
854 3300025926 Ga0207659_10003254 Ga0207659_100032548 110
855 3300025926 Ga0207659_10009170 Ga0207659_100091703 110
856 3300025926 Ga0207659_10555758 Ga0207659_105557582 110
857 3300025926 Ga0207659_11039265 Ga0207659_110392651 110
858 3300025926 Ga0207659_11089345 Ga0207659_110893452 110
859 3300025927 Ga0207687_10039639 Ga0207687_100396393 110
860 3300025928 Ga0207700_10038793 Ga0207700_100387934 110
861 3300025928 Ga0207700_10054883 Ga0207700_100548833 110
862 3300025928 Ga0207700_10089999 Ga0207700_100899993 110
863 3300025928 Ga0207700_10123261 Ga0207700_101232613 110
864 3300025928 Ga0207700_10243155 Ga0207700_102431552 110
865 3300025928 Ga0207700_10337740 Ga0207700_103377402 110
866 3300025928 Ga0207700_10819651 Ga0207700_108196512 110
867 3300025929 Ga0207664_10025601 Ga0207664_100256012 110
868 3300025929 Ga0207664_10039577 Ga0207664_100395773 110
869 3300025929 Ga0207664_10119297 Ga0207664_101192971 110
870 3300025929 Ga0207664_10167885 Ga0207664_101678852 110
871 3300025929 Ga0207664_10572851 Ga0207664_105728512 110
872 3300025931 Ga0207644_10035451 Ga0207644_100354513 110
873 3300025931 Ga0207644_10257273 Ga0207644_102572732 110
874 3300025931 Ga0207644_10686395 Ga0207644_106863952 110
875 3300025932 Ga0207690_10012598 Ga0207690_100125986 110
876 3300025932 Ga0207690_10037581 Ga0207690_100375812 110
877 3300025932 Ga0207690_10042611 Ga0207690_100426112 110
878 3300025932 Ga0207690_10044207 Ga0207690_100442073 110
879 3300025932 Ga0207690_10068413 Ga0207690_100684133 110
880 3300025932 Ga0207690_10278896 Ga0207690_102788963 110
881 3300025932 Ga0207690_10747510 Ga0207690_107475102 110
882 3300025932 Ga0207690_11017212 Ga0207690_110172122 110
883 3300025932 Ga0207690_11587498 Ga0207690_115874981 110
884 3300025933 Ga0207706_10000357 Ga0207706_1000035721 110
885 3300025933 Ga0207706_10297873 Ga0207706_102978732 110
886 3300025933 Ga0207706_11025855 Ga0207706_110258551 110
887 3300025933 Ga0207706_11312440 Ga0207706_113124401 110
888 3300025934 Ga0207686_10171259 Ga0207686_101712591 110
889 3300025935 Ga0207709_10567253 Ga0207709_105672532 110
890 3300025935 Ga0207709_10740090 Ga0207709_107400902 110
891 3300025936 Ga0207670_10120778 Ga0207670_101207783 110
892 3300025937 Ga0207669_10015931 Ga0207669_100159313 110
893 3300025937 Ga0207669_10077102 Ga0207669_100771022 110
894 3300025937 Ga0207669_10215008 Ga0207669_102150082 110
895 3300025938 Ga0207704_10414369 Ga0207704_104143692 110
896 3300025939 Ga0207665_10157887 Ga0207665_101578873 110
897 3300025939 Ga0207665_10226418 Ga0207665_102264182 110
898 3300025939 Ga0207665_10407598 Ga0207665_104075982 110
899 3300025939 Ga0207665_11088389 Ga0207665_110883892 110
900 3300025939 Ga0207665_11404281 Ga0207665_114042811 110
901 3300025940 Ga0207691_10001355 Ga0207691_100013554 110
902 3300025940 Ga0207691_10001550 Ga0207691_100015508 110
903 3300025940 Ga0207691_10022438 Ga0207691_100224386 110
904 3300025941 Ga0207711_10222614 Ga0207711_102226142 110
905 3300025941 Ga0207711_10908831 Ga0207711_109088312 110
906 3300025942 Ga0207689_10001360 Ga0207689_1000136023 110
907 3300025942 Ga0207689_10665749 Ga0207689_106657492 110
908 3300025942 Ga0207689_11505011 Ga0207689_115050111 110
909 3300025944 Ga0207661_10011833 Ga0207661_100118332 110
910 3300025944 Ga0207661_10019670 Ga0207661_100196705 110
911 3300025944 Ga0207661_10022228 Ga0207661_100222282 110
912 3300025944 Ga0207661_10032021 Ga0207661_100320215 110
913 3300025944 Ga0207661_10037459 Ga0207661_100374591 110
914 3300025944 Ga0207661_10068735 Ga0207661_100687353 110
915 3300025944 Ga0207661_10323213 Ga0207661_103232132 110
916 3300025944 Ga0207661_10716921 Ga0207661_107169212 110
917 3300025944 Ga0207661_11987297 Ga0207661_119872972 110
918 3300025944 Ga0207661_12145826 Ga0207661_121458261 110
919 3300025945 Ga0207679_10000484 Ga0207679_1000048415 110
920 3300025945 Ga0207679_10006509 Ga0207679_100065094 110
921 3300025945 Ga0207679_10024777 Ga0207679_100247775 110
922 3300025945 Ga0207679_10271920 Ga0207679_102719203 110
923 3300025945 Ga0207679_10276220 Ga0207679_102762203 110
924 3300025945 Ga0207679_10602183 Ga0207679_106021832 110
925 3300025949 Ga0207667_10011137 Ga0207667_1001113712 110
926 3300025949 Ga0207667_10019276 Ga0207667_100192767 110
927 3300025949 Ga0207667_10081585 Ga0207667_100815854 110
928 3300025949 Ga0207667_10187587 Ga0207667_101875873 110
929 3300025960 Ga0207651_10058551 Ga0207651_100585512 110
930 3300025960 Ga0207651_10452791 Ga0207651_104527912 110
931 3300025961 Ga0207712_10001176 Ga0207712_1000117611 110
932 3300025961 Ga0207712_10130934 Ga0207712_101309343 110
933 3300025961 Ga0207712_11682783 Ga0207712_116827832 110
934 3300025972 Ga0207668_10021247 Ga0207668_100212474 110
935 3300025972 Ga0207668_10730561 Ga0207668_107305612 110
936 3300025981 Ga0207640_10001456 Ga0207640_100014568 110
937 3300025981 Ga0207640_10050446 Ga0207640_100504463 110
938 3300025981 Ga0207640_10104663 Ga0207640_101046633 110
939 3300025981 Ga0207640_10286487 Ga0207640_102864872 110
940 3300025981 Ga0207640_10370752 Ga0207640_103707522 110
941 3300025981 Ga0207640_10501830 Ga0207640_105018303 110
942 3300025986 Ga0207658_10060833 Ga0207658_100608333 110
943 3300025986 Ga0207658_10178304 Ga0207658_101783042 110
944 3300025986 Ga0207658_11525645 Ga0207658_115256452 110
945 3300026035 Ga0207703_10156270 Ga0207703_101562702 110
946 3300026041 Ga0207639_10004358 Ga0207639_1000435811 110
947 3300026041 Ga0207639_10116510 Ga0207639_101165102 110
948 3300026041 Ga0207639_10150381 Ga0207639_101503813 110
949 3300026041 Ga0207639_10331802 Ga0207639_103318023 110
950 3300026041 Ga0207639_10517425 Ga0207639_105174251 110
951 3300026041 Ga0207639_11916862 Ga0207639_119168622 110
952 3300026067 Ga0207678_10041333 Ga0207678_100413332 110
953 3300026067 Ga0207678_10041868 Ga0207678_100418683 110
954 3300026067 Ga0207678_10068814 Ga0207678_100688142 110
955 3300026067 Ga0207678_10423890 Ga0207678_104238902 110
956 3300026067 Ga0207678_12011429 Ga0207678_120114292 110
957 3300026075 Ga0207708_10098662 Ga0207708_100986623 110
958 3300026075 Ga0207708_10154233 Ga0207708_101542333 110
959 3300026075 Ga0207708_10751038 Ga0207708_107510382 110
960 3300026078 Ga0207702_10057844 Ga0207702_100578443 110
961 3300026078 Ga0207702_10071273 Ga0207702_100712732 110
962 3300026078 Ga0207702_10745631 Ga0207702_107456313 110
963 3300026078 Ga0207702_10915538 Ga0207702_109155382 110
964 3300026078 Ga0207702_10990133 Ga0207702_109901332 110
965 3300026078 Ga0207702_11682985 Ga0207702_116829851 110
966 3300026088 Ga0207641_10107617 Ga0207641_101076172 110
967 3300026088 Ga0207641_10345441 Ga0207641_103454412 110
968 3300026089 Ga0207648_10005220 Ga0207648_1000522012 110
969 3300026089 Ga0207648_10023923 Ga0207648_100239235 110
970 3300026089 Ga0207648_10046448 Ga0207648_100464485 110
971 3300026089 Ga0207648_12191754 Ga0207648_121917542 110
972 3300026095 Ga0207676_10093952 Ga0207676_100939522 110
973 3300026095 Ga0207676_10142837 Ga0207676_101428373 110
974 3300026095 Ga0207676_10163981 Ga0207676_101639812 110
975 3300026095 Ga0207676_10343365 Ga0207676_103433652 110
976 3300026095 Ga0207676_11694275 Ga0207676_116942752 110
977 3300026116 Ga0207674_10003135 Ga0207674_1000313515 110
978 3300026116 Ga0207674_10015526 Ga0207674_100155268 110
979 3300026116 Ga0207674_10018565 Ga0207674_100185658 110
980 3300026116 Ga0207674_10140302 Ga0207674_101403024 110
981 3300026116 Ga0207674_10296301 Ga0207674_102963011 110
982 3300026116 Ga0207674_10677573 Ga0207674_106775732 110
983 3300026116 Ga0207674_11584205 Ga0207674_115842051 110
984 3300026118 Ga0207675_100000320 Ga0207675_10000032025 110
985 3300026118 Ga0207675_100059762 Ga0207675_1000597624 110
986 3300026118 Ga0207675_100314828 Ga0207675_1003148281 110
987 3300026118 Ga0207675_100341058 Ga0207675_1003410583 110
988 3300026121 Ga0207683_10033546 Ga0207683_100335462 110
989 3300026121 Ga0207683_10059100 Ga0207683_100591004 110
990 3300026121 Ga0207683_10295458 Ga0207683_102954582 110
991 3300026142 Ga0207698_10007055 Ga0207698_100070554 110
992 3300026142 Ga0207698_10013973 Ga0207698_100139736 110
993 3300026142 Ga0207698_10256188 Ga0207698_102561882 110
994 3300026142 Ga0207698_11089470 Ga0207698_110894702 110
995 3300026142 Ga0207698_11123693 Ga0207698_111236931 110
996 3300026142 Ga0207698_11183172 Ga0207698_111831721 110
997 3300026142 Ga0207698_11211289 Ga0207698_112112892 110
998 3300027907 Ga0207428_10075404 Ga0207428_100754043 110
999 3300027907 Ga0207428_10258988 Ga0207428_102589882 110
1000 3300028379 Ga0268266_10083429 Ga0268266_100834292 110
1001 3300028379 Ga0268266_10102533 Ga0268266_101025333 110
1002 3300028379 Ga0268266_11123594 Ga0268266_111235942 110
1003 3300028380 Ga0268265_10002121 Ga0268265_100021217 110
1004 3300028380 Ga0268265_10266956 Ga0268265_102669561 110
1005 3300028380 Ga0268265_10715986 Ga0268265_107159862 110
1006 3300028380 Ga0268265_10802452 Ga0268265_108024522 110
1007 3300028381 Ga0268264_10480925 Ga0268264_104809252 110
1008 3300028381 Ga0268264_10488128 Ga0268264_104881281 110
1009 3300030735 Ga0316178_1053326 Ga0316178_10533261 110
1010 3300031548 Ga0307408_100008337 Ga0307408_1000083373 110
1011 3300031548 Ga0307408_100187150 Ga0307408_1001871502 110
1012 3300031548 Ga0307408_100297064 Ga0307408_1002970643 110
1013 3300031548 Ga0307408_100368413 Ga0307408_1003684131 110
1014 3300031548 Ga0307408_102494544 Ga0307408_1024945441 110
1015 3300031691 Ga0316579_10111135 Ga0316579_101111352 110
1016 3300031727 Ga0316576_10002948 Ga0316576_100029489 110
1017 3300031728 Ga0316578_10013404 Ga0316578_100134044 110
1018 3300031728 Ga0316578_10015348 Ga0316578_100153485 110
1019 3300031731 Ga0307405_10000187 Ga0307405_1000018721 110
1020 3300031731 Ga0307405_10014127 Ga0307405_100141272 110
1021 3300031731 Ga0307405_10036009 Ga0307405_100360094 110
1022 3300031731 Ga0307405_10092885 Ga0307405_100928853 110
1023 3300031731 Ga0307405_10144722 Ga0307405_101447223 110
1024 3300031731 Ga0307405_10173627 Ga0307405_101736272 110
1025 3300031731 Ga0307405_10258162 Ga0307405_102581622 110
1026 3300031731 Ga0307405_10406577 Ga0307405_104065772 110
1027 3300031731 Ga0307405_10487220 Ga0307405_104872201 110
1028 3300031731 Ga0307405_10986256 Ga0307405_109862561 110
1029 3300031731 Ga0307405_11102917 Ga0307405_111029172 110
1030 3300031731 Ga0307405_11372694 Ga0307405_113726941 110
1031 3300031731 Ga0307405_12113955 Ga0307405_121139551 110
1032 3300031731 Ga0307405_12137608 Ga0307405_121376082 110
1033 3300031733 Ga0316577_10002399 Ga0316577_100023991 110
1034 3300031733 Ga0316577_10025102 Ga0316577_100251024 110
1035 3300031824 Ga0307413_10000837 Ga0307413_100008375 110
1036 3300031824 Ga0307413_10030411 Ga0307413_100304113 110
1037 3300031824 Ga0307413_10042391 Ga0307413_100423913 110
1038 3300031824 Ga0307413_10055375 Ga0307413_100553753 110
1039 3300031824 Ga0307413_10073618 Ga0307413_100736184 110
1040 3300031824 Ga0307413_10140859 Ga0307413_101408592 110
1041 3300031824 Ga0307413_10171588 Ga0307413_101715883 110
1042 3300031824 Ga0307413_10284805 Ga0307413_102848052 110
1043 3300031824 Ga0307413_10457015 Ga0307413_104570151 110
1044 3300031824 Ga0307413_10817679 Ga0307413_108176792 110
1045 3300031824 Ga0307413_11214826 Ga0307413_112148262 110
1046 3300031852 Ga0307410_10002520 Ga0307410_100025206 110
1047 3300031852 Ga0307410_10012076 Ga0307410_100120765 110
1048 3300031852 Ga0307410_10022976 Ga0307410_100229764 110
1049 3300031852 Ga0307410_10027658 Ga0307410_100276583 110
1050 3300031852 Ga0307410_10070059 Ga0307410_100700593 110
1051 3300031852 Ga0307410_10127016 Ga0307410_101270163 110
1052 3300031852 Ga0307410_10249681 Ga0307410_102496811 110
1053 3300031852 Ga0307410_10272665 Ga0307410_102726651 110
1054 3300031852 Ga0307410_10314703 Ga0307410_103147032 110
1055 3300031852 Ga0307410_10337316 Ga0307410_103373162 110
1056 3300031852 Ga0307410_10344968 Ga0307410_103449682 110
1057 3300031852 Ga0307410_10345358 Ga0307410_103453582 110
1058 3300031852 Ga0307410_10498068 Ga0307410_104980682 110
1059 3300031852 Ga0307410_10549744 Ga0307410_105497442 110
1060 3300031852 Ga0307410_11023698 Ga0307410_110236982 110
1061 3300031852 Ga0307410_11691523 Ga0307410_116915232 110
1062 3300031901 Ga0307406_10001688 Ga0307406_100016884 110
1063 3300031901 Ga0307406_10002595 Ga0307406_100025958 110
1064 3300031901 Ga0307406_10014718 Ga0307406_100147183 110
1065 3300031901 Ga0307406_10023424 Ga0307406_100234242 110
1066 3300031901 Ga0307406_10028708 Ga0307406_100287082 110
1067 3300031901 Ga0307406_10043279 Ga0307406_100432795 110
1068 3300031901 Ga0307406_10108565 Ga0307406_101085653 110
1069 3300031901 Ga0307406_10146070 Ga0307406_101460702 110
1070 3300031901 Ga0307406_10230915 Ga0307406_102309153 110
1071 3300031901 Ga0307406_10260498 Ga0307406_102604982 110
1072 3300031901 Ga0307406_10362133 Ga0307406_103621332 110
1073 3300031901 Ga0307406_11611758 Ga0307406_116117582 110
1074 3300031903 Ga0307407_10000201 Ga0307407_1000020117 110
1075 3300031903 Ga0307407_10004682 Ga0307407_100046825 110
1076 3300031903 Ga0307407_10008899 Ga0307407_100088995 110
1077 3300031903 Ga0307407_10027368 Ga0307407_100273681 110
1078 3300031903 Ga0307407_10085331 Ga0307407_100853312 110
1079 3300031903 Ga0307407_10091391 Ga0307407_100913913 110
1080 3300031903 Ga0307407_10116337 Ga0307407_101163372 110
1081 3300031903 Ga0307407_10124907 Ga0307407_101249072 110
1082 3300031903 Ga0307407_10333724 Ga0307407_103337242 110
1083 3300031903 Ga0307407_10342090 Ga0307407_103420902 110
1084 3300031903 Ga0307407_10441069 Ga0307407_104410692 110
1085 3300031903 Ga0307407_10525226 Ga0307407_105252261 110
1086 3300031903 Ga0307407_10962072 Ga0307407_109620721 110
1087 3300031911 Ga0307412_10012476 Ga0307412_100124765 110
1088 3300031911 Ga0307412_10028271 Ga0307412_100282712 110
1089 3300031911 Ga0307412_10193021 Ga0307412_101930212 110
1090 3300031911 Ga0307412_10234054 Ga0307412_102340543 110
1091 3300031911 Ga0307412_10398104 Ga0307412_103981042 110
1092 3300031911 Ga0307412_11261340 Ga0307412_112613402 110
1093 3300031995 Ga0307409_100000144 Ga0307409_1000001446 110
1094 3300031995 Ga0307409_100003493 Ga0307409_1000034936 110
1095 3300031995 Ga0307409_100009411 Ga0307409_1000094112 110
1096 3300031995 Ga0307409_100009792 Ga0307409_1000097924 110
1097 3300031995 Ga0307409_100026152 Ga0307409_1000261523 110
1098 3300031995 Ga0307409_100027599 Ga0307409_1000275994 110
1099 3300031995 Ga0307409_100033448 Ga0307409_1000334482 110
1100 3300031995 Ga0307409_100048332 Ga0307409_1000483322 110
1101 3300031995 Ga0307409_100118546 Ga0307409_1001185463 110
1102 3300031995 Ga0307409_100126080 Ga0307409_1001260803 110
1103 3300031995 Ga0307409_100186505 Ga0307409_1001865051 110
1104 3300031995 Ga0307409_100254667 Ga0307409_1002546672 110
1105 3300031995 Ga0307409_100383328 Ga0307409_1003833282 110
1106 3300031995 Ga0307409_100556156 Ga0307409_1005561562 110
1107 3300031995 Ga0307409_100717738 Ga0307409_1007177382 110
1108 3300031995 Ga0307409_101141677 Ga0307409_1011416772 110
1109 3300032002 Ga0307416_100000828 Ga0307416_10000082812 110
1110 3300032002 Ga0307416_100004156 Ga0307416_1000041561 110
1111 3300032002 Ga0307416_100007355 Ga0307416_1000073557 110
1112 3300032002 Ga0307416_100012718 Ga0307416_1000127186 110
1113 3300032002 Ga0307416_100014248 Ga0307416_1000142483 110
1114 3300032002 Ga0307416_100024844 Ga0307416_1000248445 110
1115 3300032002 Ga0307416_100049239 Ga0307416_1000492394 110
1116 3300032002 Ga0307416_100073566 Ga0307416_1000735662 110
1117 3300032002 Ga0307416_100120247 Ga0307416_1001202472 110
1118 3300032002 Ga0307416_100356860 Ga0307416_1003568602 110
1119 3300032002 Ga0307416_100450307 Ga0307416_1004503072 110
1120 3300032002 Ga0307416_100477679 Ga0307416_1004776792 110
1121 3300032002 Ga0307416_100511350 Ga0307416_1005113502 110
1122 3300032002 Ga0307416_100735010 Ga0307416_1007350102 110
1123 3300032002 Ga0307416_101424102 Ga0307416_1014241022 110
1124 3300032002 Ga0307416_102811952 Ga0307416_1028119521 110
1125 3300032002 Ga0307416_103058978 Ga0307416_1030589781 110
1126 3300032002 Ga0307416_103753912 Ga0307416_1037539121 110
1127 3300032004 Ga0307414_10002383 Ga0307414_100023835 110
1128 3300032004 Ga0307414_10006027 Ga0307414_100060275 110
1129 3300032004 Ga0307414_10030309 Ga0307414_100303092 110
1130 3300032004 Ga0307414_10043031 Ga0307414_100430313 110
1131 3300032004 Ga0307414_10345745 Ga0307414_103457452 110
1132 3300032004 Ga0307414_10408267 Ga0307414_104082672 110
1133 3300032004 Ga0307414_10426642 Ga0307414_104266422 110
1134 3300032004 Ga0307414_10465715 Ga0307414_104657152 110
1135 3300032004 Ga0307414_11271125 Ga0307414_112711251 110
1136 3300032005 Ga0307411_10001066 Ga0307411_100010665 110
1137 3300032005 Ga0307411_10006929 Ga0307411_100069295 110
1138 3300032005 Ga0307411_10007270 Ga0307411_100072703 110
1139 3300032005 Ga0307411_10017609 Ga0307411_100176094 110
1140 3300032005 Ga0307411_10045742 Ga0307411_100457423 110
1141 3300032005 Ga0307411_10062970 Ga0307411_100629702 110
1142 3300032005 Ga0307411_10141185 Ga0307411_101411851 110
1143 3300032005 Ga0307411_10147865 Ga0307411_101478651 110
1144 3300032005 Ga0307411_10166152 Ga0307411_101661523 110
1145 3300032005 Ga0307411_10208308 Ga0307411_102083083 110
1146 3300032005 Ga0307411_10276620 Ga0307411_102766202 110
1147 3300032005 Ga0307411_10282820 Ga0307411_102828202 110
1148 3300032005 Ga0307411_10531822 Ga0307411_105318222 110
1149 3300032005 Ga0307411_10645798 Ga0307411_106457982 110
1150 3300032005 Ga0307411_10663386 Ga0307411_106633862 110
1151 3300032005 Ga0307411_10672848 Ga0307411_106728482 110
1152 3300032005 Ga0307411_10773159 Ga0307411_107731592 110
1153 3300032005 Ga0307411_11345317 Ga0307411_113453172 110
1154 3300032005 Ga0307411_11551779 Ga0307411_115517791 110
1155 3300032005 Ga0307411_11809007 Ga0307411_118090071 110
1156 3300032005 Ga0307411_11845197 Ga0307411_118451972 110
1157 3300032126 Ga0307415_100000419 Ga0307415_10000041917 110
1158 3300032126 Ga0307415_100002432 Ga0307415_1000024325 110
1159 3300032126 Ga0307415_100021813 Ga0307415_1000218134 110
1160 3300032126 Ga0307415_100036475 Ga0307415_1000364755 110
1161 3300032126 Ga0307415_100041599 Ga0307415_1000415992 110
1162 3300032126 Ga0307415_100051781 Ga0307415_1000517815 110
1163 3300032126 Ga0307415_100143241 Ga0307415_1001432413 110
1164 3300032126 Ga0307415_100459811 Ga0307415_1004598112 110
1165 3300032126 Ga0307415_100490786 Ga0307415_1004907862 110
1166 3300032126 Ga0307415_100970217 Ga0307415_1009702171 110
1167 3300032126 Ga0307415_102463500 Ga0307415_1024635001 110
1168 3300032133 Ga0316583_10003563 Ga0316583_100035634 110
1169 3300032137 Ga0316585_10006893 Ga0316585_100068933 110
1170 3300033541 Ga0316596_1143350 Ga0316596_11433502 110
1171 3300034818 Ga0373950_0167964 Ga0373950_0167964_50_385 110
1172 3300034957 Ga0373938_0040184 Ga0373938_0040184_565_900 110
1173 3300035083 Ga0373926_0004167 Ga0373926_0004167_2330_2662 110
1174 3300035084 Ga0373928_0048895 Ga0373928_0048895_139_474 110
1175 3300035086 Ga0373934_0005211 Ga0373934_0005211_1970_2302 110
1176 3300035086 Ga0373934_0037374 Ga0373934_0037374_1564_1896 110
1177 3300035086 Ga0373934_0040553 Ga0373934_0040553_64_396 110
1178 3300035088 Ga0373940_0070749 Ga0373940_0070749_214_549 110
1179 3300035089 Ga0373944_0396028 Ga0373944_0396028_175_507 110
1180 3300035091 Ga0373951_0051655 Ga0373951_0051655_394_729 110
1181 3300035092 Ga0373952_0095406 Ga0373952_0095406_132_467 110
1182 3300035111 Ga0373923_0007123 Ga0373923_0007123_2308_2640 110
1183 3300035112 Ga0373932_0198412 Ga0373932_0198412_63_398 110
1184 3300035113 Ga0373936_0011918 Ga0373936_0011918_704_1036 110
1185 3300035113 Ga0373936_0128849 Ga0373936_0128849_218_550 110
1186 3300035115 Ga0373941_0333309 Ga0373941_0333309_21_356 110
1187 3300035116 Ga0373945_0258114 Ga0373945_0258114_54_386 110
1188 3300035117 Ga0373953_0002759 Ga0373953_0002759_3576_3908 110
1189 3300035117 Ga0373953_0009331 Ga0373953_0009331_2288_2620 110
1190 3300035117 Ga0373953_0568949 Ga0373953_0568949_17_349 110
1191 3300035118 Ga0373954_0057621 Ga0373954_0057621_1026_1358 110
1192 3300035118 Ga0373954_0066241 Ga0373954_0066241_632_964 110
1193 3300035118 Ga0373954_0440984 Ga0373954_0440984_294_626 110
1194 3300035119 Ga0373956_0000678 Ga0373956_0000678_4458_4790 110
1195 3300035119 Ga0373956_0113697 Ga0373956_0113697_894_1226 110
1196 3300035119 Ga0373956_0548048 Ga0373956_0548048_92_424 110
1197 3300035120 Ga0373957_0099398 Ga0373957_0099398_776_1108 110
1198 3300035120 Ga0373957_0165776 Ga0373957_0165776_179_511 110
1199 3300035121 Ga0373960_0139748 Ga0373960_0139748_303_638 110
1200 3300035170 Ga0373943_0016857 Ga0373943_0016857_1318_1650 110
1201 3300035170 Ga0373943_0028594 Ga0373943_0028594_1615_1947 110
1202 3300035171 Ga0373946_0009275 Ga0373946_0009275_1495_1827 110
1203 3300035207 Ga0373942_0342387 Ga0373942_0342387_86_421 110
1204 3300035241 Ga0373961_0059628 Ga0373961_0059628_321_656 110
1205 3300035398 Ga0316574_0204529 Ga0316574_0204529_245_577 110
1206 3300035398 Ga0316574_0695716 Ga0316574_0695716_52_384 110
1207 3300035410 Ga0373924_0002127 Ga0373924_0002127_4363_4695 110
1208 3300035410 Ga0373924_0285833 Ga0373924_0285833_92_424 110
1209 3300035691 Ga0373931_0018182 Ga0373931_0018182_1155_1490 110
1210 3300035691 Ga0373931_0018416 Ga0373931_0018416_1619_1954 110
1211 3300035692 Ga0373935_0018031 Ga0373935_0018031_1605_1937 110
1212 3300035692 Ga0373935_0063447 Ga0373935_0063447_934_1266 110
1213 3300035692 Ga0373935_0124591 Ga0373935_0124591_342_674 110
1214 3300035692 Ga0373935_0378071 Ga0373935_0378071_396_728 110
1215 3300035695 Ga0373927_0026060 Ga0373927_0026060_1543_1875 110
1216 3300035695 Ga0373927_1094838 Ga0373927_1094838_37_369 110
1217 3300035724 Ga0373933_0001111 Ga0373933_0001111_9347_9679 110
1218 3300035724 Ga0373933_0013654 Ga0373933_0013654_3405_3737 110
1219 3300035725 Ga0373947_0002126 Ga0373947_0002126_1834_2166 110
1220 3300035725 Ga0373947_0048812 Ga0373947_0048812_586_918 110
1221 3300035725 Ga0373947_0115326 Ga0373947_0115326_341_673 110
1222 3300036401 Ga0373937_0002914 Ga0373937_0002914_78_410 110
1223 3300036401 Ga0373937_0065385 Ga0373937_0065385_2510_2842 110
1224 3300036401 Ga0373937_0096592 Ga0373937_0096592_617_949 110
1225 3300036647 Ga0316582_0026818 Ga0316582_0026818_3103_3435 110
1226 3300036647 Ga0316582_0075578 Ga0316582_0075578_663_995 110
1227 3300036712 Ga0316584_0009015 Ga0316584_0009015_2589_2921 110
1228 3300037068 Ga0373925_0034016 Ga0373925_0034016_2996_3328 110
1229 3300037068 Ga0373925_0216655 Ga0373925_0216655_36_368 110
1230 3300037068 Ga0373925_0592715 Ga0373925_0592715_214_546 110
1231 3300037312 Ga0395899_0038329 Ga0395899_0038329_596_928 110
1232 3300037418 Ga0395900_0005143 Ga0395900_0005143_6341_6673 110
1233 3300037466 Ga0395898_0365364 Ga0395898_0365364_270_602 110
1234 3300037471 Ga0395905_0049760 Ga0395905_0049760_696_1028 110
1235 3300037471 Ga0395905_0117856 Ga0395905_0117856_2009_2341 110
1236 3300037471 Ga0395905_0624983 Ga0395905_0624983_63_398 110
1237 3300037471 Ga0395905_1377214 Ga0395905_1377214_125_457 110
1238 3300037588 Ga0316581_0052652 Ga0316581_0052652_884_1216 110
1239 3300037853 Ga0436364_0287855 Ga0436364_0287855_684_1016 110
1240 3300038443 Ga0395901_0003407 Ga0395901_0003407_15283_15615 110
1241 3300038443 Ga0395901_0694213 Ga0395901_0694213_251_583 110
1242 3300038443 Ga0395901_1490842 Ga0395901_1490842_268_600 110
1243 3300038996 Ga0242420_024104 Ga0242420_024104_652_987 110
1244 3300038996 Ga0242420_054477 Ga0242420_054477_136_471 110
1245 3300039437 Ga0436365_0290864 Ga0436365_0290864_328_660 110
1246 3300039437 Ga0436365_0304609 Ga0436365_0304609_273_605 110
1247 3300039437 Ga0436365_1602166 Ga0436365_1602166_3369_3701 110
1248 3300039450 Ga0436363_0390436 Ga0436363_0390436_172_504 110
1249 3300039450 Ga0436363_0732405 Ga0436363_0732405_69_401 110
1250 3300041406 Ga0439439_0021339 Ga0439439_0021339_529_861 110
1251 3300041496 Ga0451839_1205934 Ga0451839_1205934_91_423 110
1252 3300041512 Ga0451853_1987835 Ga0451853_1987835_164_496 110
1253 3300042005 Ga0439448_0040558 Ga0439448_0040558_112_444 110
1254 3300042014 Ga0439457_103357 Ga0439457_103357_189_521 110
1255 3300042015 Ga0439462_0132713 Ga0439462_0132713_140_472 110
1256 3300042156 Ga0439446_0184978 Ga0439446_0184978_227_559 110
1257 3300042876 Ga0451577_0003975 Ga0451577_0003975_3793_4125 110
1258 3300042876 Ga0451577_0233619 Ga0451577_0233619_98_433 110
1259 3300042876 Ga0451577_0278304 Ga0451577_0278304_148_480 110
1260 3300044673 Ga0453683_1216232 Ga0453683_1216232_100_480 110
1261 3300044683 Ga0466965_0319755 Ga0466965_0319755_294_626 110
1262 3300044684 Ga0466966_0310517 Ga0466966_0310517_110_442 110
1263 3300044684 Ga0466966_0984788 Ga0466966_0984788_138_470 110
1264 3300044693 Ga0466961_0148652 Ga0466961_0148652_652_984 110
1265 3300044706 Ga0466964_0177363 Ga0466964_0177363_21_353 110
1266 3300044706 Ga0466964_0240783 Ga0466964_0240783_150_482 110
1267 3300044706 Ga0466964_0355081 Ga0466964_0355081_358_693 110
1268 3300044712 Ga0453684_1058605 Ga0453684_1058605_73_405 110
1269 3300044719 Ga0466971_0083762 Ga0466971_0083762_777_1109 110
1270 3300044719 Ga0466971_0634884 Ga0466971_0634884_143_475 110
1271 3300044765 Ga0466970_0236236 Ga0466970_0236236_539_871 110
1272 3300044842 Ga0466957_1006802 Ga0466957_1006802_135_467 110
1273 3300044842 Ga0466957_1282518 Ga0466957_1282518_28_360 110
1274 3300045051 Ga0451576_0116352 Ga0451576_0116352_1669_2001 110
1275 3300045051 Ga0451576_0321037 Ga0451576_0321037_984_1316 110
1276 3300045051 Ga0451576_1522734 Ga0451576_1522734_114_449 110
1277 3300045836 Ga0466958_0130129 Ga0466958_0130129_325_657 110
1278 3300045836 Ga0466958_0334514 Ga0466958_0334514_152_484 110
1279 3300045976 Ga0466967_0250970 Ga0466967_0250970_575_907 110
1280 3300045976 Ga0466967_0533636 Ga0466967_0533636_574_906 110
1281 3300045976 Ga0466967_0777573 Ga0466967_0777573_490_822 110
1282 3300045976 Ga0466967_2175858 Ga0466967_2175858_177_512 110
1283 3300046454 Ga0495592_0002525 Ga0495592_0002525_9391_9723 110
1284 3300046454 Ga0495592_0365590 Ga0495592_0365590_295_627 110
1285 3300046454 Ga0495592_0902943 Ga0495592_0902943_162_494 110
1286 3300046455 Ga0495603_0046197 Ga0495603_0046197_866_1198 110
1287 3300046455 Ga0495603_0238765 Ga0495603_0238765_117_449 110
1288 3300046459 Ga0495629_0003115 Ga0495629_0003115_3500_3832 110
1289 3300046459 Ga0495629_0025075 Ga0495629_0025075_1653_1985 110
1290 3300046459 Ga0495629_0040407 Ga0495629_0040407_64_396 110
1291 3300046459 Ga0495629_0303378 Ga0495629_0303378_748_1080 110
1292 3300046459 Ga0495629_0618441 Ga0495629_0618441_249_581 110
1293 3300046459 Ga0495629_1112862 Ga0495629_1112862_64_396 110
1294 3300046462 Ga0495651_0009970 Ga0495651_0009970_6484_6816 110
1295 3300046462 Ga0495651_0017083 Ga0495651_0017083_2876_3208 110
1296 3300046462 Ga0495651_0124418 Ga0495651_0124418_424_756 110
1297 3300046462 Ga0495651_0644771 Ga0495651_0644771_134_466 110
1298 3300046463 Ga0495653_0000547 Ga0495653_0000547_5451_5783 110
1299 3300046463 Ga0495653_0006042 Ga0495653_0006042_7175_7507 110
1300 3300046463 Ga0495653_0636764 Ga0495653_0636764_56_388 110
1301 3300046472 Ga0495580_0001189 Ga0495580_0001189_9052_9384 110
1302 3300046472 Ga0495580_0005504 Ga0495580_0005504_8831_9163 110
1303 3300046472 Ga0495580_0109372 Ga0495580_0109372_918_1250 110
1304 3300046472 Ga0495580_1020227 Ga0495580_1020227_51_383 110
1305 3300046473 Ga0495582_0013598 Ga0495582_0013598_2293_2625 110
1306 3300046473 Ga0495582_0039450 Ga0495582_0039450_900_1232 110
1307 3300046473 Ga0495582_0088607 Ga0495582_0088607_365_697 110
1308 3300046473 Ga0495582_0151791 Ga0495582_0151791_537_869 110
1309 3300046473 Ga0495582_0762531 Ga0495582_0762531_170_502 110
1310 3300046475 Ga0495639_0000549 Ga0495639_0000549_7396_7728 110
1311 3300046475 Ga0495639_0011675 Ga0495639_0011675_1904_2236 110
1312 3300046475 Ga0495639_0316237 Ga0495639_0316237_13_345 110
1313 3300046476 Ga0495662_0417003 Ga0495662_0417003_217_549 110
1314 3300046477 Ga0495664_0281001 Ga0495664_0281001_616_948 110
1315 3300046477 Ga0495664_0714430 Ga0495664_0714430_37_390 110
1316 3300046499 Ga0495594_0011878 Ga0495594_0011878_3522_3854 110
1317 3300046499 Ga0495594_0145232 Ga0495594_0145232_693_1025 110
1318 3300046511 Ga0495608_0000405 Ga0495608_0000405_8473_8805 110
1319 3300046511 Ga0495608_0028611 Ga0495608_0028611_2066_2398 110
1320 3300046514 Ga0495618_0153235 Ga0495618_0153235_229_561 110
1321 3300046516 Ga0495628_0000494 Ga0495628_0000494_22130_22462 110
1322 3300046516 Ga0495628_0040700 Ga0495628_0040700_3362_3694 110
1323 3300046516 Ga0495628_0122008 Ga0495628_0122008_790_1122 110
1324 3300046517 Ga0495630_0002236 Ga0495630_0002236_1684_2016 110
1325 3300046517 Ga0495630_0003849 Ga0495630_0003849_5288_5620 110
1326 3300046517 Ga0495630_0015750 Ga0495630_0015750_4034_4366 110
1327 3300046517 Ga0495630_0085082 Ga0495630_0085082_1795_2127 110
1328 3300046525 Ga0495663_0099594 Ga0495663_0099594_384_716 110
1329 3300046526 Ga0495666_0050611 Ga0495666_0050611_1340_1672 110
1330 3300046529 Ga0495652_0008315 Ga0495652_0008315_1574_1906 110
1331 3300046529 Ga0495652_0042274 Ga0495652_0042274_2018_2350 110
1332 3300046531 Ga0495665_0000358 Ga0495665_0000358_13315_13647 110
1333 3300046531 Ga0495665_0003130 Ga0495665_0003130_5929_6261 110
1334 3300046531 Ga0495665_0075851 Ga0495665_0075851_990_1322 110
1335 3300046531 Ga0495665_0593238 Ga0495665_0593238_31_363 110
1336 3300046533 Ga0495640_0359579 Ga0495640_0359579_478_810 110
1337 3300046535 Ga0495586_0004190 Ga0495586_0004190_2859_3191 110
1338 3300046536 Ga0495587_0000269 Ga0495587_0000269_24083_24415 110
1339 3300046536 Ga0495587_0000334 Ga0495587_0000334_24838_25170 110
1340 3300046536 Ga0495587_0001945 Ga0495587_0001945_2998_3330 110
1341 3300046536 Ga0495587_0124263 Ga0495587_0124263_38_391 110
1342 3300046539 Ga0495621_0343511 Ga0495621_0343511_35_367 110
1343 3300046543 Ga0495645_0005088 Ga0495645_0005088_2710_3042 110
1344 3300046543 Ga0495645_0087646 Ga0495645_0087646_49_381 110
1345 3300046557 Ga0495622_0225599 Ga0495622_0225599_94_426 110
1346 3300046559 Ga0495667_0000504 Ga0495667_0000504_17627_17959 110
1347 3300046559 Ga0495667_0001705 Ga0495667_0001705_11873_12205 110
1348 3300046559 Ga0495667_0005981 Ga0495667_0005981_2765_3097 110
1349 3300046642 Ga0495634_0830558 Ga0495634_0830558_141_473 110
1350 3300046663 Ga0495635_0000200 Ga0495635_0000200_24732_25064 110
1351 3300046663 Ga0495635_0354627 Ga0495635_0354627_619_951 110
1352 3300046664 Ga0495659_0150507 Ga0495659_0150507_323_655 110
1353 3300046664 Ga0495659_0328021 Ga0495659_0328021_158_490 110
1354 3300046664 Ga0495659_0379927 Ga0495659_0379927_16_348 110
1355 3300046674 Ga0495588_0012498 Ga0495588_0012498_1964_2296 110
1356 3300046674 Ga0495588_0023908 Ga0495588_0023908_1069_1401 110
1357 3300046675 Ga0495657_0011939 Ga0495657_0011939_4509_4841 110
1358 3300046675 Ga0495657_0464029 Ga0495657_0464029_116_448 110
1359 3300046675 Ga0495657_0876098 Ga0495657_0876098_97_429 110
1360 3300046678 Ga0495599_0002011 Ga0495599_0002011_4881_5213 110
1361 3300046678 Ga0495599_0021680 Ga0495599_0021680_839_1171 110
1362 3300046678 Ga0495599_0082661 Ga0495599_0082661_75_407 110
1363 3300046679 Ga0495623_0000156 Ga0495623_0000156_18164_18496 110
1364 3300046679 Ga0495623_0003024 Ga0495623_0003024_3035_3367 110
1365 3300046679 Ga0495623_0052162 Ga0495623_0052162_2165_2497 110
1366 3300046680 Ga0495646_0038350 Ga0495646_0038350_369_701 110
1367 3300046683 Ga0495658_0001403 Ga0495658_0001403_10061_10393 110
1368 3300046683 Ga0495658_0048011 Ga0495658_0048011_1032_1364 110
1369 3300046683 Ga0495658_0251892 Ga0495658_0251892_452_787 110
1370 3300046683 Ga0495658_0357189 Ga0495658_0357189_463_795 110
1371 3300046683 Ga0495658_0662063 Ga0495658_0662063_298_630 110
1372 3300046689 Ga0495613_0102611 Ga0495613_0102611_1695_2027 110
1373 3300046689 Ga0495613_0168100 Ga0495613_0168100_680_1012 110
1374 3300046689 Ga0495613_0312533 Ga0495613_0312533_585_917 110
1375 3300046689 Ga0495613_0387039 Ga0495613_0387039_548_901 110
1376 3300046689 Ga0495613_0510664 Ga0495613_0510664_252_584 110
1377 3300046809 Ga0495600_0003971 Ga0495600_0003971_424_756 110
1378 3300047315 Ga0495581_0000659 Ga0495581_0000659_6539_6871 110
1379 3300047315 Ga0495581_0016943 Ga0495581_0016943_1294_1626 110
1380 3300047315 Ga0495581_0051860 Ga0495581_0051860_411_743 110
1381 3300047315 Ga0495581_0564619 Ga0495581_0564619_237_590 110
1382 3300047315 Ga0495581_0636522 Ga0495581_0636522_220_552 110
1383 3300047317 Ga0495604_0004192 Ga0495604_0004192_7505_7837 110
1384 3300047317 Ga0495604_0025411 Ga0495604_0025411_1233_1565 110
1385 3300047317 Ga0495604_0939967 Ga0495604_0939967_70_402 110
1386 3300047318 Ga0495636_0095234 Ga0495636_0095234_834_1166 110
1387 3300047319 Ga0495674_0007567 Ga0495674_0007567_2134_2466 110
1388 3300047319 Ga0495674_0032263 Ga0495674_0032263_3670_4002 110
1389 3300047319 Ga0495674_0043600 Ga0495674_0043600_2432_2764 110
1390 3300047319 Ga0495674_0894607 Ga0495674_0894607_65_397 110
1391 3300047322 Ga0495680_0004788 Ga0495680_0004788_7475_7807 110
1392 3300047322 Ga0495680_0791030 Ga0495680_0791030_189_521 110
1393 3300047444 Ga0495675_0002012 Ga0495675_0002012_4208_4540 110
1394 3300047444 Ga0495675_0057891 Ga0495675_0057891_2026_2358 110
1395 3300047444 Ga0495675_0070071 Ga0495675_0070071_794_1126 110
1396 3300047444 Ga0495675_0075070 Ga0495675_0075070_71_403 110
1397 3300047444 Ga0495675_0402624 Ga0495675_0402624_379_732 110
1398 3300047444 Ga0495675_0837854 Ga0495675_0837854_53_385 110
1399 3300047471 Ga0495684_0001442 Ga0495684_0001442_3805_4137 110
1400 3300047471 Ga0495684_0024474 Ga0495684_0024474_3159_3491 110
1401 3300047471 Ga0495684_0063191 Ga0495684_0063191_432_764 110
1402 3300047673 Ga0495593_0000356 Ga0495593_0000356_19753_20085 110
1403 3300047673 Ga0495593_0111707 Ga0495593_0111707_433_765 110
1404 3300047673 Ga0495593_0133358 Ga0495593_0133358_381_713 110
1405 3300047673 Ga0495593_0509573 Ga0495593_0509573_202_534 110
1406 3300048088 Ga0495602_0003996 Ga0495602_0003996_7683_8015 110
1407 3300048088 Ga0495602_0039288 Ga0495602_0039288_1950_2282 110
1408 3300048088 Ga0495602_0133381 Ga0495602_0133381_1606_1938 110
1409 3300048089 Ga0495614_0000638 Ga0495614_0000638_8715_9047 110
1410 3300048089 Ga0495614_0279277 Ga0495614_0279277_398_751 110
1411 3300048090 Ga0495615_0073472 Ga0495615_0073472_457_789 110
1412 3300048903 Ga0496100_0073025 Ga0496100_0073025_941_1276 110
1413 3300048903 Ga0496100_0171604 Ga0496100_0171604_464_796 110
1414 3300048903 Ga0496100_0835443 Ga0496100_0835443_56_391 110
1415 3300048903 Ga0496100_0848128 Ga0496100_0848128_96_428 110
1416 3300048903 Ga0496100_1059323 Ga0496100_1059323_29_364 110
1417 3300048904 Ga0496101_0038807 Ga0496101_0038807_1606_1941 110
1418 3300048904 Ga0496101_0077774 Ga0496101_0077774_482_814 110
1419 3300048904 Ga0496101_1050509 Ga0496101_1050509_195_530 110
1420 3300048905 Ga0496102_0067085 Ga0496102_0067085_2224_2559 110
1421 3300048905 Ga0496102_0134419 Ga0496102_0134419_1105_1440 110
1422 3300048905 Ga0496102_0451550 Ga0496102_0451550_750_1085 110
1423 3300048905 Ga0496102_0749520 Ga0496102_0749520_509_844 110
1424 3300048905 Ga0496102_1123092 Ga0496102_1123092_44_379 110
1425 3300048906 Ga0496103_0181794 Ga0496103_0181794_29_364 110
1426 3300048907 Ga0496104_0004744 Ga0496104_0004744_3020_3355 110
1427 3300048907 Ga0496104_0183124 Ga0496104_0183124_1196_1531 110
1428 3300048907 Ga0496104_0623643 Ga0496104_0623643_111_446 110
1429 3300048908 Ga0496105_0572812 Ga0496105_0572812_40_372 110
1430 3300048909 Ga0496106_0053593 Ga0496106_0053593_1718_2053 110
1431 3300048909 Ga0496106_0467735 Ga0496106_0467735_127_462 110
1432 3300048909 Ga0496106_0644154 Ga0496106_0644154_39_374 110
1433 3300048909 Ga0496106_0649088 Ga0496106_0649088_207_542 110
1434 3300048910 Ga0496107_0177846 Ga0496107_0177846_1157_1492 110
1435 3300048910 Ga0496107_0294105 Ga0496107_0294105_581_916 110
1436 3300048911 Ga0496108_0005237 Ga0496108_0005237_2130_2465 110
1437 3300048911 Ga0496108_0017435 Ga0496108_0017435_2020_2355 110
1438 3300048911 Ga0496108_0180869 Ga0496108_0180869_84_419 110
1439 3300048911 Ga0496108_0820892 Ga0496108_0820892_265_597 110
1440 3300048912 Ga0496109_0007523 Ga0496109_0007523_3177_3512 110
1441 3300048912 Ga0496109_0071352 Ga0496109_0071352_1605_1940 110
1442 3300048912 Ga0496109_0382259 Ga0496109_0382259_494_826 110
1443 3300048912 Ga0496109_2049924 Ga0496109_2049924_104_436 110
1444 3300048913 Ga0496110_0029147 Ga0496110_0029147_1453_1788 110
1445 3300048913 Ga0496110_0080168 Ga0496110_0080168_2143_2478 110
1446 3300048914 Ga0496111_0032614 Ga0496111_0032614_1653_1988 110
1447 3300048914 Ga0496111_0115469 Ga0496111_0115469_1167_1502 110
1448 3300048915 Ga0496112_0001950 Ga0496112_0001950_10526_10861 110
1449 3300048915 Ga0496112_0022068 Ga0496112_0022068_3598_3933 110
1450 3300048915 Ga0496112_0889592 Ga0496112_0889592_383_718 110
1451 3300048916 Ga0496113_0000769 Ga0496113_0000769_9062_9397 110
1452 3300048916 Ga0496113_0068922 Ga0496113_0068922_1695_2030 110
1453 3300048916 Ga0496113_0116662 Ga0496113_0116662_791_1123 110
1454 3300048917 Ga0496114_0134245 Ga0496114_0134245_1475_1810 110
1455 3300048917 Ga0496114_0384593 Ga0496114_0384593_617_949 110
1456 3300048918 Ga0496115_0004680 Ga0496115_0004680_615_947 110
1457 3300048918 Ga0496115_0215545 Ga0496115_0215545_43_396 110
1458 3300049127 Ga0501306_036833 Ga0501306_036833_389_721 110
1459 3300049129 Ga0501309_062896 Ga0501309_062896_246_578 110
1460 3300049160 Ga0501304_027104 Ga0501304_027104_164_496 110
1461 3300049513 Ga0501290_016941 Ga0501290_016941_75_407 110
1462 3300049514 Ga0501291_039674 Ga0501291_039674_430_762 110
1463 3300049517 Ga0501294_011442 Ga0501294_011442_235_570 110
1464 3300049520 Ga0501297_044363 Ga0501297_044363_156_488 110
1465 3300049521 Ga0501298_059127 Ga0501298_059127_355_690 110
1466 3300049521 Ga0501298_113859 Ga0501298_113859_68_400 110
1467 3300049522 Ga0501299_123283 Ga0501299_123283_274_606 110
1468 3300049522 Ga0501299_157296 Ga0501299_157296_139_471 110
1469 3300049527 Ga0501311_048452 Ga0501311_048452_202_534 110
1470 3300049527 Ga0501311_058505 Ga0501311_058505_55_387 110
1471 3300049529 Ga0501313_027753 Ga0501313_027753_242_574 110
1472 3300049530 Ga0501314_036812 Ga0501314_036812_162_494 110
1473 3300049531 Ga0501315_102951 Ga0501315_102951_90_422 110
1474 3300049532 Ga0501316_045992 Ga0501316_045992_253_585 110
1475 3300049533 Ga0501317_080926 Ga0501317_080926_160_492 110
1476 3300049539 Ga0501323_043397 Ga0501323_043397_95_427 110
1477 3300049539 Ga0501323_065499 Ga0501323_065499_12_344 110
1478 3300049541 Ga0501325_027581 Ga0501325_027581_240_572 110
1479 3300049556 Ga0501340_016227 Ga0501340_016227_20_352 110
1480 3300049556 Ga0501340_026915 Ga0501340_026915_135_467 110
1481 3300049569 Ga0501032_0043085 Ga0501032_0043085_673_1005 110
1482 3300049569 Ga0501032_0160958 Ga0501032_0160958_196_528 110
1483 3300049570 Ga0501033_0031074 Ga0501033_0031074_1451_1783 110
1484 3300049571 Ga0501034_1216412 Ga0501034_1216412_271_603 110
1485 3300049572 Ga0501036_0038635 Ga0501036_0038635_2200_2532 110
1486 3300049572 Ga0501036_0200401 Ga0501036_0200401_876_1208 110
1487 3300049573 Ga0501037_0241493 Ga0501037_0241493_728_1060 110
1488 3300049574 Ga0501038_0108158 Ga0501038_0108158_1285_1617 110
1489 3300049574 Ga0501038_0581194 Ga0501038_0581194_472_804 110
1490 3300049575 Ga0501039_0160910 Ga0501039_0160910_355_687 110
1491 3300049576 Ga0501040_1191822 Ga0501040_1191822_165_497 110
1492 3300049577 Ga0501041_0073333 Ga0501041_0073333_309_641 110
1493 3300049577 Ga0501041_0134378 Ga0501041_0134378_411_743 110
1494 3300049577 Ga0501041_0668060 Ga0501041_0668060_236_571 110
1495 3300049578 Ga0501042_0144495 Ga0501042_0144495_1180_1512 110
1496 3300049578 Ga0501042_0244581 Ga0501042_0244581_31_363 110
1497 3300049579 Ga0501043_0048272 Ga0501043_0048272_63_395 110
1498 3300049579 Ga0501043_0108258 Ga0501043_0108258_889_1221 110
1499 3300049580 Ga0501046_0133310 Ga0501046_0133310_1185_1517 110
1500 3300049580 Ga0501046_0945160 Ga0501046_0945160_35_367 110
1501 3300049581 Ga0501047_0216687 Ga0501047_0216687_1063_1395 110
1502 3300049581 Ga0501047_0243318 Ga0501047_0243318_768_1100 110
1503 3300049583 Ga0501067_0000353 Ga0501067_0000353_22690_23022 110
1504 3300049583 Ga0501067_0044515 Ga0501067_0044515_493_828 110
1505 3300049583 Ga0501067_0257517 Ga0501067_0257517_375_707 110
1506 3300049583 Ga0501067_0334725 Ga0501067_0334725_91_426 110
1507 3300049584 Ga0501068_0001339 Ga0501068_0001339_4658_4990 110
1508 3300049584 Ga0501068_0084626 Ga0501068_0084626_890_1225 110
1509 3300049584 Ga0501068_0831386 Ga0501068_0831386_20_355 110
1510 3300049585 Ga0501069_0026566 Ga0501069_0026566_927_1259 110
1511 3300049585 Ga0501069_0032090 Ga0501069_0032090_614_946 110
1512 3300049585 Ga0501069_0032461 Ga0501069_0032461_1626_1961 110
1513 3300049585 Ga0501069_0166828 Ga0501069_0166828_589_924 110
1514 3300049586 Ga0501070_0000192 Ga0501070_0000192_14988_15320 110
1515 3300049586 Ga0501070_0123099 Ga0501070_0123099_280_612 110
1516 3300049586 Ga0501070_0137205 Ga0501070_0137205_805_1137 110
1517 3300049586 Ga0501070_0168786 Ga0501070_0168786_979_1311 110
1518 3300049586 Ga0501070_0369431 Ga0501070_0369431_148_480 110
1519 3300049586 Ga0501070_0726126 Ga0501070_0726126_331_666 110
1520 3300049587 Ga0501071_0000678 Ga0501071_0000678_13553_13885 110
1521 3300049587 Ga0501071_0325048 Ga0501071_0325048_250_582 110
1522 3300049587 Ga0501071_0591982 Ga0501071_0591982_154_489 110
1523 3300049587 Ga0501071_0796005 Ga0501071_0796005_291_626 110
1524 3300049588 Ga0501072_0009721 Ga0501072_0009721_2893_3225 110
1525 3300049588 Ga0501072_0078699 Ga0501072_0078699_1612_1944 110
1526 3300049588 Ga0501072_0409368 Ga0501072_0409368_180_512 110
1527 3300049588 Ga0501072_0962943 Ga0501072_0962943_147_479 110
1528 3300049588 Ga0501072_1102293 Ga0501072_1102293_49_381 110
1529 3300049588 Ga0501072_1230604 Ga0501072_1230604_86_418 110
1530 3300049589 Ga0501073_0000949 Ga0501073_0000949_3734_4066 110
1531 3300049589 Ga0501073_0631350 Ga0501073_0631350_327_662 110
1532 3300049589 Ga0501073_0790902 Ga0501073_0790902_143_475 110
1533 3300049590 Ga0501074_0000171 Ga0501074_0000171_4532_4864 110
1534 3300049590 Ga0501074_0368537 Ga0501074_0368537_38_370 110
1535 3300049592 Ga0501076_0149239 Ga0501076_0149239_552_884 110
1536 3300049592 Ga0501076_0194593 Ga0501076_0194593_609_941 110
1537 3300049652 Ga0501202_079250 Ga0501202_079250_316_651 110
1538 3300049653 Ga0501206_044105 Ga0501206_044105_132_467 110
1539 3300049658 Ga0501211_051127 Ga0501211_051127_16_348 110
1540 3300049660 Ga0501216_079627 Ga0501216_079627_283_615 110
1541 3300049660 Ga0501216_133714 Ga0501216_133714_118_453 110
1542 3300049661 Ga0501217_042743 Ga0501217_042743_591_923 110
1543 3300049661 Ga0501217_066451 Ga0501217_066451_210_545 110
1544 3300049661 Ga0501217_090548 Ga0501217_090548_188_523 110
1545 3300049661 Ga0501217_201734 Ga0501217_201734_245_577 110
1546 3300049663 Ga0501223_050772 Ga0501223_050772_180_512 110
1547 3300049665 Ga0501227_041230 Ga0501227_041230_180_512 110
1548 3300049667 Ga0501230_029252 Ga0501230_029252_182_517 110
1549 3300049672 Ga0501239_036423 Ga0501239_036423_21_356 110
1550 3300049674 Ga0501242_003701 Ga0501242_003701_1319_1654 110
1551 3300049675 Ga0501243_014106 Ga0501243_014106_548_883 110
1552 3300049675 Ga0501243_072468 Ga0501243_072468_77_409 110
1553 3300049678 Ga0501248_012725 Ga0501248_012725_215_550 110
1554 3300049679 Ga0501249_006910 Ga0501249_006910_33_365 110
1555 3300049679 Ga0501249_014954 Ga0501249_014954_631_966 110
1556 3300049685 Ga0501256_002047 Ga0501256_002047_1137_1472 110
1557 3300049686 Ga0501257_025964 Ga0501257_025964_434_769 110
1558 3300049686 Ga0501257_034172 Ga0501257_034172_685_1017 110
1559 3300049690 Ga0501261_097815 Ga0501261_097815_171_503 110
1560 3300049705 Ga0501225_0104002 Ga0501225_0104002_104_439 110
1561 3300049708 Ga0501245_027410 Ga0501245_027410_215_547 110
1562 3300049741 Ga0501079_0076548 Ga0501079_0076548_232_567 110
1563 3300049741 Ga0501079_0142055 Ga0501079_0142055_600_932 110
1564 3300049741 Ga0501079_0218931 Ga0501079_0218931_392_724 110
1565 3300049742 Ga0501080_0000060 Ga0501080_0000060_13544_13876 110
1566 3300049742 Ga0501080_0005735 Ga0501080_0005735_2991_3323 110
1567 3300049742 Ga0501080_0111578 Ga0501080_0111578_563_898 110
1568 3300049742 Ga0501080_0247391 Ga0501080_0247391_862_1194 110
1569 3300049743 Ga0501081_0337820 Ga0501081_0337820_348_683 110
1570 3300049743 Ga0501081_0376070 Ga0501081_0376070_323_655 110
1571 3300049743 Ga0501081_0931676 Ga0501081_0931676_248_580 110
1572 3300049744 Ga0501083_0008037 Ga0501083_0008037_2153_2485 110
1573 3300049744 Ga0501083_0529860 Ga0501083_0529860_298_630 110
1574 3300049761 Ga0501264_006568 Ga0501264_006568_421_753 110
1575 3300049765 Ga0501268_001006 Ga0501268_001006_480_815 110
1576 3300049765 Ga0501268_045841 Ga0501268_045841_334_666 110
1577 3300049769 Ga0501272_005087 Ga0501272_005087_551_886 110
1578 3300049770 Ga0501273_005428 Ga0501273_005428_388_723 110
1579 3300049770 Ga0501273_045094 Ga0501273_045094_97_429 110
1580 3300049772 Ga0501275_042240 Ga0501275_042240_84_419 110
1581 3300049773 Ga0501276_019420 Ga0501276_019420_231_563 110
1582 3300049779 Ga0501283_085767 Ga0501283_085767_82_414 110
1583 3300049823 Ga0501044_0006673 Ga0501044_0006673_6191_6523 110
1584 3300049823 Ga0501044_0384435 Ga0501044_0384435_44_376 110
1585 3300049824 Ga0501045_0059366 Ga0501045_0059366_1571_1903 110
1586 3300049824 Ga0501045_0457465 Ga0501045_0457465_279_611 110
1587 3300049850 Ga0501204_040726 Ga0501204_040726_317_652 110
1588 3300049852 Ga0501220_08404 Ga0501220_08404_194_526 110
1589 3300050507 nmdc:mga05p37_1158346_c1 nmdc:mga05p37_1158346_c1_103_435 110
1590 3300050507 nmdc:mga05p37_2129497_c1 nmdc:mga05p37_2129497_c1_160_495 110
1591 3300050507 nmdc:mga05p37_24458_c1 nmdc:mga05p37_24458_c1_527_859 110
1592 3300050507 nmdc:mga05p37_259528_c1 nmdc:mga05p37_259528_c1_340_672 110
1593 3300050507 nmdc:mga05p37_313439_c1 nmdc:mga05p37_313439_c1_328_663 110
1594 3300050507 nmdc:mga05p37_328502_c1 nmdc:mga05p37_328502_c1_177_557 110
1595 3300050507 nmdc:mga05p37_372223_c1 nmdc:mga05p37_372223_c1_442_774 110
1596 3300050507 nmdc:mga05p37_81382_c1 nmdc:mga05p37_81382_c1_1630_1962 110
1597 3300050507 nmdc:mga05p37_82134_c1 nmdc:mga05p37_82134_c1_771_1106 110
1598 3300050507 nmdc:mga05p37_830499_c1 nmdc:mga05p37_830499_c1_420_752 110
1599 3300050508 nmdc:mga09592_132896_c1 nmdc:mga09592_132896_c1_243_575 110
1600 3300050508 nmdc:mga09592_216657_c1 nmdc:mga09592_216657_c1_288_620 110
1601 3300050508 nmdc:mga09592_72535_c1 nmdc:mga09592_72535_c1_986_1318 110
1602 3300050509 nmdc:mga0qj67_10094_c1 nmdc:mga0qj67_10094_c1_1081_1413 110
1603 3300050509 nmdc:mga0qj67_1478095_c1 nmdc:mga0qj67_1478095_c1_94_429 110
1604 3300050509 nmdc:mga0qj67_18195_c1 nmdc:mga0qj67_18195_c1_1123_1455 110
1605 3300050509 nmdc:mga0qj67_3022_c1 nmdc:mga0qj67_3022_c1_4300_4632 110
1606 3300050509 nmdc:mga0qj67_3465_c1 nmdc:mga0qj67_3465_c1_9542_9874 110
1607 3300050509 nmdc:mga0qj67_37040_c1 nmdc:mga0qj67_37040_c1_3317_3652 110
1608 3300050509 nmdc:mga0qj67_505202_c1 nmdc:mga0qj67_505202_c1_32_364 110
1609 3300050509 nmdc:mga0qj67_52160_c1 nmdc:mga0qj67_52160_c1_906_1238 110
1610 3300050510 nmdc:mga06r32_139003_c1 nmdc:mga06r32_139003_c1_307_639 110
1611 3300050510 nmdc:mga06r32_1637814_c1 nmdc:mga06r32_1637814_c1_233_565 110
1612 3300050510 nmdc:mga06r32_186579_c1 nmdc:mga06r32_186579_c1_678_1010 110
1613 3300050510 nmdc:mga06r32_363451_c1 nmdc:mga06r32_363451_c1_440_772 110
1614 3300050510 nmdc:mga06r32_406801_c1 nmdc:mga06r32_406801_c1_853_1185 110
1615 3300050510 nmdc:mga06r32_533345_c1 nmdc:mga06r32_533345_c1_404_736 110
1616 3300050510 nmdc:mga06r32_712109_c1 nmdc:mga06r32_712109_c1_233_565 110
1617 3300050510 nmdc:mga06r32_73470_c1 nmdc:mga06r32_73470_c1_1430_1762 110
1618 3300050510 nmdc:mga06r32_77166_c1 nmdc:mga06r32_77166_c1_35_370 110
1619 3300050510 nmdc:mga06r32_812426_c1 nmdc:mga06r32_812426_c1_523_855 110
1620 3300050511 nmdc:mga08y16_1335218_c1 nmdc:mga08y16_1335218_c1_77_412 110
1621 3300050511 nmdc:mga08y16_345174_c1 nmdc:mga08y16_345174_c1_209_544 110
1622 3300050511 nmdc:mga08y16_479660_c1 nmdc:mga08y16_479660_c1_876_1208 110
1623 3300050511 nmdc:mga08y16_560798_c1 nmdc:mga08y16_560798_c1_688_1020 110
1624 3300050511 nmdc:mga08y16_9037_c1 nmdc:mga08y16_9037_c1_3771_4103 110
1625 3300050512 nmdc:mga0n895_1454242_c1 nmdc:mga0n895_1454242_c1_191_523 110
1626 3300050512 nmdc:mga0n895_24093_c1 nmdc:mga0n895_24093_c1_2455_2787 110
1627 3300050512 nmdc:mga0n895_42112_c1 nmdc:mga0n895_42112_c1_2234_2566 110
1628 3300050512 nmdc:mga0n895_753427_c1 nmdc:mga0n895_753427_c1_361_693 110
1629 3300050512 nmdc:mga0n895_770868_c1 nmdc:mga0n895_770868_c1_261_593 110
1630 3300050513 nmdc:mga0rr50_196370_c1 nmdc:mga0rr50_196370_c1_745_1077 110
1631 3300050513 nmdc:mga0rr50_545513_c1 nmdc:mga0rr50_545513_c1_322_657 110
1632 3300050514 nmdc:mga08x19_12152_c1 nmdc:mga08x19_12152_c1_708_1040 110
1633 3300050514 nmdc:mga08x19_425860_c1 nmdc:mga08x19_425860_c1_421_753 110
1634 3300050515 nmdc:mga0a205_32863_c1 nmdc:mga0a205_32863_c1_2902_3234 110
1635 3300050515 nmdc:mga0a205_37088_c1 nmdc:mga0a205_37088_c1_686_1018 110
1636 3300050515 nmdc:mga0a205_605389_c1 nmdc:mga0a205_605389_c1_318_650 110
1637 3300050515 nmdc:mga0a205_646225_c1 nmdc:mga0a205_646225_c1_210_542 110
1638 3300053077 Ga0495601_0003937 Ga0495601_0003937_5175_5507 110
1639 3300053077 Ga0495601_0081254 Ga0495601_0081254_1443_1775 110
1640 3300053077 Ga0495601_0084821 Ga0495601_0084821_353_685 110
1641 3300053077 Ga0495601_0840966 Ga0495601_0840966_59_391 110
1642 3300053078 Ga0495612_0000490 Ga0495612_0000490_8554_8886 110
1643 3300053084 Ga0495595_0024258 Ga0495595_0024258_473_805 110
1644 3300053085 Ga0495619_0002629 Ga0495619_0002629_4116_4448 110
1645 3300053085 Ga0495619_0062774 Ga0495619_0062774_645_977 110
1646 3300053085 Ga0495619_0414562 Ga0495619_0414562_486_818 110
1647 3300054114 Ga0501084_0081149 Ga0501084_0081149_2071_2403 110
1648 3300054114 Ga0501084_0095051 Ga0501084_0095051_1856_2188 110
1649 3300054114 Ga0501084_0170156 Ga0501084_0170156_1494_1829 110
1650 3300054114 Ga0501084_0184919 Ga0501084_0184919_838_1170 110
1651 3300059421 Ga0590071_031312 Ga0590071_031312_301_633 110
1652 3300059421 Ga0590071_043838 Ga0590071_043838_387_719 110
1653 3300059424 Ga0590075_026983 Ga0590075_026983_783_1115 110
1654 3300059424 Ga0590075_045298 Ga0590075_045298_30_362 110
1655 3300059426 Ga0590077_022697 Ga0590077_022697_545_880 110
1656 3300059490 Ga0587066_078833 Ga0587066_078833_110_442 110
1657 3300059491 Ga0587070_143242 Ga0587070_143242_226_558 110
1658 3300059492 Ga0587073_0057828 Ga0587073_0057828_256_588 110
1659 3300059492 Ga0587073_0117544 Ga0587073_0117544_107_439 110
1660 3300059493 Ga0587077_128672 Ga0587077_128672_34_366 110
1661 3300059505 Ga0587083_0108493 Ga0587083_0108493_277_609 110
1662 3300059505 Ga0587083_0153285 Ga0587083_0153285_258_590 110
1663 3300059505 Ga0587083_0260290 Ga0587083_0260290_50_382 110
1664 3300059506 Ga0587085_026550 Ga0587085_026550_277_609 110
1665 3300059508 Ga0587088_101991 Ga0587088_101991_217_549 110
1666 3300059508 Ga0587088_104734 Ga0587088_104734_33_365 110
1667 3300059509 Ga0587089_057672 Ga0587089_057672_109_441 110
1668 3300059511 Ga0587091_071005 Ga0587091_071005_156_488 110
1669 3300059512 Ga0587092_118003 Ga0587092_118003_51_386 110
1670 3300059513 Ga0587094_083647 Ga0587094_083647_159_491 110
1671 3300059623 Ga0587101_077787 Ga0587101_077787_260_592 110
1672 3300059627 Ga0587117_093637 Ga0587117_093637_30_362 110
1673 3300059630 Ga0587128_084766 Ga0587128_084766_277_609 110
1674 3300059639 Ga0587062_056317 Ga0587062_056317_80_454 110
1675 3300059640 Ga0587067_156622 Ga0587067_156622_53_385 110
1676 3300059640 Ga0587067_189136 Ga0587067_189136_122_466 110
1677 3300059643 Ga0587072_083036 Ga0587072_083036_100_432 110
1678 3300059643 Ga0587072_091123 Ga0587072_091123_277_609 110
1679 3300059644 Ga0587075_107383 Ga0587075_107383_139_471 110
1680 3300059645 Ga0587076_078824 Ga0587076_078824_274_606 110
1681 3300059645 Ga0587076_103535 Ga0587076_103535_33_365 110
1682 3300060353 Ga0501082_0036435 Ga0501082_0036435_1138_1470 110
1683 3300060353 Ga0501082_0160735 Ga0501082_0160735_1330_1662 110
1684 3300060353 Ga0501082_0206675 Ga0501082_0206675_545_877 110
1685 3300061719 Ga0466962_0514034 Ga0466962_0514034_44_376 110
1686 3300061734 Ga0530510_0335764 Ga0530510_0335764_636_977 110
1687 3300061734 Ga0530510_1264863 Ga0530510_1264863_144_476 110

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01740

STAS

STAS domain

4

107

0.96

PF13466

STAS_2

STAS domain

15

95

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f43-assembly1.cif.gz_A-2 crystal structure of a putative anti-sigma factor antagonist (tm1081) from thermotoga maritima at 1.59 a resolution 0.9495 3 109
1vc1-assembly1.cif.gz_B crystal structure of the tm1442 protein from thermotoga maritima, a homolog of the bacillus subtilis general stress response anti-anti-sigma factor rsbv 0.9366 2 105
1th8-assembly1.cif.gz_B crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form ii 0.934 2 109
1til-assembly1.cif.gz_B crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa:poised for phosphorylation complex with atp, crystal form ii 0.9295 2 109
6m36-assembly1.cif.gz_F the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.9268 2 98
ID Description Score Start End Superfamily
3f43A01 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9293 6 108 3.30.750.24
af_A0A0N7KGR6_2_88_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9241 44 109 3.30.750.24
af_A0A0R0KL09_2_75_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.92 52 109 3.30.750.24
1tidD00 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9176 2 109 3.30.750.24
4qtpB00 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9138 2 109 3.30.750.24
ID Description Score Start End GO Terms
AF-A0A7W1H9L1-F1-model_v4 Anti-sigma factor antagonist 1.006 1 110 GO:0043856
AF-A0A7X5WEP3-F1-model_v4 deleted 1.005 1 110
AF-A0A2G4IH21-F1-model_v4 Anti-sigma factor antagonist 1.005 1 110 GO:0043856
AF-A0A7X4BDD0-F1-model_v4 Anti-sigma factor antagonist 1.001 1 107 GO:0043856
AF-A0A6B1FRW9-F1-model_v4 deleted 1.001 3 107

Feature Viewer

pLDDT pTM Quality
94.84 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map