F495335
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1687 | 482 | 1687 | 110 |
Family's Representative Sequence
| Representative Sequence | 3300005535|Ga0070684_100387243|Ga0070684_1003872433 |
| Length | 111 |
| Sequence | MAFTQSRQQNGVLVVRSDGQLIVGNRHELKELVQGALAAGDRRFVLDFSHTGYIDSSGLGALVTVARQVRELGGEMRLAGLNDDLRSLFELTKLDTLFAIADSPAQALAGF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 6 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 9 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 56 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 65 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 73 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 75 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 76 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 77 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 79 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 80 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 81 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 82 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 83 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 84 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 85 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 86 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 87 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 88 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 89 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 90 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 91 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 93 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 97 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 98 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 99 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 100 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 101 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 102 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 103 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 104 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 105 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 107 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 122 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 134 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 138 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 139 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 143 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 146 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 216 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 220 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 221 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 222 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 223 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 224 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 225 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 226 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 227 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 228 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 229 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 230 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 231 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 232 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 233 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 234 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 235 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 236 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 237 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 238 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 239 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 240 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 241 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 242 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 243 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 244 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 245 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 246 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 247 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 248 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 249 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 250 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 251 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 252 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 253 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 254 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 255 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 256 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 257 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 258 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 259 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 260 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 261 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 262 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 263 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 264 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 265 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 266 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 267 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 268 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 269 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 270 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 271 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 272 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 273 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 274 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 275 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 276 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 277 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 278 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 279 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 280 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 281 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 282 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 283 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 284 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 285 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 286 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 287 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 288 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 289 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 290 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 291 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 292 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 293 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 294 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 295 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 296 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 297 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 298 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 299 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 300 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 301 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 302 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 303 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 356 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 357 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 358 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 359 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 360 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 361 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 362 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 363 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 364 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 365 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 366 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 367 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 368 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 369 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 370 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 371 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 372 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 373 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 374 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 375 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 376 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 377 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 378 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 379 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 380 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 400 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 408 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 409 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 410 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 412 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 413 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 414 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 415 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 416 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 417 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 418 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 419 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 420 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 421 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 422 | 3300049678 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought | Metagenome | Rhizosphere |
| 423 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 424 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 425 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 426 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 427 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 428 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 429 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 434 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 435 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 436 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 437 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 438 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 439 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 440 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 443 | 3300049852 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control | Metagenome | Rhizosphere |
| 444 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 445 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 446 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 447 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 448 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 449 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 450 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 451 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 452 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 453 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 458 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 459 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 460 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 461 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 462 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 463 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 464 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 465 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 466 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 467 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 468 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 469 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 470 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 471 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 472 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 473 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 474 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 475 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 476 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 477 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 478 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 479 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 480 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 481 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 482 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.72 |
| Metatranscriptomes | 5.28 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.9 |
| Rhizosphere | 96.32 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.77 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24750J21931_1019297 | 3300002070 | Bacteria | 944 |
| 2 | JGI25406J46586_10052517 | 3300003203 | Bacteria | 1357 |
| 3 | rootL2_10101677 | 3300003322 | Bacteria | 1969 |
| 4 | Ga0032354_1121886 | 3300003693 | Bacteria | 633 |
| 5 | Ga0058859_11814094 | 3300004798 | Bacteria | 531 |
| 6 | Ga0058863_10023017 | 3300004799 | Bacteria | 973 |
| 7 | Ga0058863_11749219 | 3300004799 | Bacteria | 515 |
| 8 | Ga0058863_11766029 | 3300004799 | Bacteria | 957 |
| 9 | Ga0058863_11873702 | 3300004799 | Bacteria | 1002 |
| 10 | Ga0058863_11972071 | 3300004799 | Bacteria | 655 |
| 11 | Ga0058861_11621628 | 3300004800 | Unclassified | 686 |
| 12 | Ga0058861_11623768 | 3300004800 | Bacteria | 655 |
| 13 | Ga0058861_11793331 | 3300004800 | Bacteria | 1332 |
| 14 | Ga0058861_11819252 | 3300004800 | Unclassified | 612 |
| 15 | Ga0058861_11862569 | 3300004800 | Bacteria | 1133 |
| 16 | Ga0058861_11977672 | 3300004800 | Bacteria | 1094 |
| 17 | Ga0058860_12016274 | 3300004801 | Bacteria | 548 |
| 18 | Ga0058862_10007717 | 3300004803 | Bacteria | 705 |
| 19 | Ga0058862_10139180 | 3300004803 | Bacteria | 889 |
| 20 | Ga0058862_11895783 | 3300004803 | Unclassified | 575 |
| 21 | Ga0058862_12536806 | 3300004803 | Bacteria | 589 |
| 22 | Ga0058862_12551672 | 3300004803 | Bacteria | 568 |
| 23 | Ga0058862_12614112 | 3300004803 | Bacteria | 793 |
| 24 | Ga0058862_12730940 | 3300004803 | Unclassified | 831 |
| 25 | Ga0058862_12733296 | 3300004803 | Unclassified | 560 |
| 26 | Ga0058862_12860400 | 3300004803 | Bacteria | 1470 |
| 27 | Ga0058862_12875333 | 3300004803 | Bacteria | 669 |
| 28 | Ga0065704_10156196 | 3300005289 | Bacteria | 1382 |
| 29 | Ga0065712_10002894 | 3300005290 | Bacteria | 4082 |
| 30 | Ga0065715_10162401 | 3300005293 | Bacteria | 1617 |
| 31 | Ga0065707_10113306 | 3300005295 | Bacteria | 2332 |
| 32 | Ga0070658_10009701 | 3300005327 | Bacteria | 7729 |
| 33 | Ga0070658_10035917 | 3300005327 | Bacteria | 3993 |
| 34 | Ga0070658_10091002 | 3300005327 | Bacteria | 2514 |
| 35 | Ga0070658_10188744 | 3300005327 | Bacteria | 1737 |
| 36 | Ga0070658_10265771 | 3300005327 | Bacteria | 1458 |
| 37 | Ga0070658_10295648 | 3300005327 | Bacteria | 1380 |
| 38 | Ga0070658_10569624 | 3300005327 | Bacteria | 980 |
| 39 | Ga0070658_10586066 | 3300005327 | Bacteria | 966 |
| 40 | Ga0070676_10004346 | 3300005328 | Bacteria | 7442 |
| 41 | Ga0070676_10830801 | 3300005328 | Bacteria | 684 |
| 42 | Ga0070676_10948230 | 3300005328 | Bacteria | 643 |
| 43 | Ga0070683_100000233 | 3300005329 | Bacteria | 38043 |
| 44 | Ga0070683_100007640 | 3300005329 | Bacteria | 9148 |
| 45 | Ga0070683_100021811 | 3300005329 | Bacteria | 5717 |
| 46 | Ga0070683_100050905 | 3300005329 | Bacteria | 3836 |
| 47 | Ga0070683_100088898 | 3300005329 | Bacteria | 2899 |
| 48 | Ga0070683_100104030 | 3300005329 | Bacteria | 2676 |
| 49 | Ga0070683_100141480 | 3300005329 | Bacteria | 2279 |
| 50 | Ga0070683_100153583 | 3300005329 | Bacteria | 2183 |
| 51 | Ga0070683_100225934 | 3300005329 | Bacteria | 1779 |
| 52 | Ga0070683_100318464 | 3300005329 | Bacteria | 1480 |
| 53 | Ga0070683_100567773 | 3300005329 | Bacteria | 1085 |
| 54 | Ga0070683_100697499 | 3300005329 | Bacteria | 972 |
| 55 | Ga0070683_100729882 | 3300005329 | Bacteria | 949 |
| 56 | Ga0070683_101339638 | 3300005329 | Bacteria | 688 |
| 57 | Ga0070690_100045286 | 3300005330 | Bacteria | 2794 |
| 58 | Ga0070690_100430372 | 3300005330 | Unclassified | 975 |
| 59 | Ga0070690_100568538 | 3300005330 | Bacteria | 857 |
| 60 | Ga0070690_101566059 | 3300005330 | Bacteria | 533 |
| 61 | Ga0070670_100007272 | 3300005331 | Bacteria | 9388 |
| 62 | Ga0070670_100965521 | 3300005331 | Bacteria | 774 |
| 63 | Ga0070670_101308577 | 3300005331 | Bacteria | 663 |
| 64 | Ga0070677_10119039 | 3300005333 | Bacteria | 1190 |
| 65 | Ga0070677_10445234 | 3300005333 | Unclassified | 692 |
| 66 | Ga0068869_100010103 | 3300005334 | Bacteria | 6142 |
| 67 | Ga0068869_100057602 | 3300005334 | Bacteria | 2837 |
| 68 | Ga0068869_100895419 | 3300005334 | Bacteria | 768 |
| 69 | Ga0070666_10117395 | 3300005335 | Bacteria | 1843 |
| 70 | Ga0070666_10127916 | 3300005335 | Bacteria | 1764 |
| 71 | Ga0070680_100027511 | 3300005336 | Bacteria | 4553 |
| 72 | Ga0070680_100028065 | 3300005336 | Bacteria | 4513 |
| 73 | Ga0070680_100043156 | 3300005336 | Bacteria | 3662 |
| 74 | Ga0070680_100050348 | 3300005336 | Bacteria | 3397 |
| 75 | Ga0070680_100069042 | 3300005336 | Bacteria | 2901 |
| 76 | Ga0070680_100087628 | 3300005336 | Bacteria | 2575 |
| 77 | Ga0070680_100314700 | 3300005336 | Bacteria | 1328 |
| 78 | Ga0070680_100373251 | 3300005336 | Bacteria | 1214 |
| 79 | Ga0070680_100378701 | 3300005336 | Bacteria | 1205 |
| 80 | Ga0070680_100442334 | 3300005336 | Bacteria | 1110 |
| 81 | Ga0070680_100471466 | 3300005336 | Bacteria | 1073 |
| 82 | Ga0070682_100125509 | 3300005337 | Bacteria | 1729 |
| 83 | Ga0070682_100229953 | 3300005337 | Bacteria | 1325 |
| 84 | Ga0070682_100382888 | 3300005337 | Bacteria | 1058 |
| 85 | Ga0070682_100556699 | 3300005337 | Unclassified | 898 |
| 86 | Ga0070682_101686893 | 3300005337 | Unclassified | 550 |
| 87 | Ga0070682_101724306 | 3300005337 | Unclassified | 545 |
| 88 | Ga0068868_101341298 | 3300005338 | Unclassified | 665 |
| 89 | Ga0070660_100012909 | 3300005339 | Bacteria | 5977 |
| 90 | Ga0070660_100125019 | 3300005339 | Bacteria | 2055 |
| 91 | Ga0070660_100666225 | 3300005339 | Bacteria | 872 |
| 92 | Ga0070660_100741289 | 3300005339 | Bacteria | 825 |
| 93 | Ga0070660_100785146 | 3300005339 | Bacteria | 801 |
| 94 | Ga0070660_100945336 | 3300005339 | Bacteria | 728 |
| 95 | Ga0070689_100125500 | 3300005340 | Bacteria | 2053 |
| 96 | Ga0070691_10021952 | 3300005341 | Bacteria | 2958 |
| 97 | Ga0070691_10178744 | 3300005341 | Bacteria | 1103 |
| 98 | Ga0070691_10353471 | 3300005341 | Bacteria | 817 |
| 99 | Ga0070691_10856079 | 3300005341 | Unclassified | 558 |
| 100 | Ga0070687_100014103 | 3300005343 | Bacteria | 3582 |
| 101 | Ga0070687_100275992 | 3300005343 | Bacteria | 1056 |
| 102 | Ga0070687_100301426 | 3300005343 | Bacteria | 1017 |
| 103 | Ga0070661_100002985 | 3300005344 | Bacteria | 11659 |
| 104 | Ga0070661_100003411 | 3300005344 | Bacteria | 10978 |
| 105 | Ga0070661_100003797 | 3300005344 | Bacteria | 10410 |
| 106 | Ga0070661_100015035 | 3300005344 | Bacteria | 5460 |
| 107 | Ga0070661_100035622 | 3300005344 | Bacteria | 3615 |
| 108 | Ga0070661_100065843 | 3300005344 | Bacteria | 2662 |
| 109 | Ga0070661_100092097 | 3300005344 | Bacteria | 2245 |
| 110 | Ga0070661_100978447 | 3300005344 | Bacteria | 701 |
| 111 | Ga0070692_10104273 | 3300005345 | Bacteria | 1559 |
| 112 | Ga0070692_10452886 | 3300005345 | Bacteria | 822 |
| 113 | Ga0070692_10455385 | 3300005345 | Bacteria | 820 |
| 114 | Ga0070692_10543731 | 3300005345 | Bacteria | 760 |
| 115 | Ga0070692_10798877 | 3300005345 | Bacteria | 644 |
| 116 | Ga0070668_100003043 | 3300005347 | Bacteria | 12405 |
| 117 | Ga0070668_100110467 | 3300005347 | Bacteria | 2188 |
| 118 | Ga0070669_100003079 | 3300005353 | Bacteria | 12001 |
| 119 | Ga0070669_100006567 | 3300005353 | Bacteria | 8369 |
| 120 | Ga0070669_100017058 | 3300005353 | Bacteria | 5181 |
| 121 | Ga0070669_100628490 | 3300005353 | Bacteria | 902 |
| 122 | Ga0070669_101526970 | 3300005353 | Bacteria | 581 |
| 123 | Ga0070675_100002631 | 3300005354 | Bacteria | 13492 |
| 124 | Ga0070675_100002663 | 3300005354 | Bacteria | 13424 |
| 125 | Ga0070675_100129213 | 3300005354 | Bacteria | 2152 |
| 126 | Ga0070675_100443798 | 3300005354 | Bacteria | 1163 |
| 127 | Ga0070675_100538919 | 3300005354 | Bacteria | 1054 |
| 128 | Ga0070675_100628948 | 3300005354 | Bacteria | 975 |
| 129 | Ga0070671_100023147 | 3300005355 | Bacteria | 5080 |
| 130 | Ga0070671_100119992 | 3300005355 | Bacteria | 2212 |
| 131 | Ga0070671_100306722 | 3300005355 | Bacteria | 1352 |
| 132 | Ga0070671_100948637 | 3300005355 | Bacteria | 752 |
| 133 | Ga0070674_100002673 | 3300005356 | Bacteria | 9876 |
| 134 | Ga0070674_100005627 | 3300005356 | Bacteria | 7257 |
| 135 | Ga0070674_100090184 | 3300005356 | Bacteria | 2211 |
| 136 | Ga0070674_100716610 | 3300005356 | Bacteria | 857 |
| 137 | Ga0070674_101373216 | 3300005356 | Bacteria | 632 |
| 138 | Ga0070673_100071202 | 3300005364 | Bacteria | 2793 |
| 139 | Ga0070673_100174961 | 3300005364 | Bacteria | 1834 |
| 140 | Ga0070673_100423788 | 3300005364 | Unclassified | 1193 |
| 141 | Ga0070688_100002319 | 3300005365 | Bacteria | 9618 |
| 142 | Ga0070688_100210072 | 3300005365 | Bacteria | 1366 |
| 143 | Ga0070659_100008807 | 3300005366 | Bacteria | 7392 |
| 144 | Ga0070659_100045001 | 3300005366 | Bacteria | 3457 |
| 145 | Ga0070659_100098927 | 3300005366 | Bacteria | 2346 |
| 146 | Ga0070659_100125537 | 3300005366 | Bacteria | 2082 |
| 147 | Ga0070659_100182606 | 3300005366 | Bacteria | 1722 |
| 148 | Ga0070659_100372354 | 3300005366 | Bacteria | 1202 |
| 149 | Ga0070659_101093415 | 3300005366 | Bacteria | 702 |
| 150 | Ga0070659_101305541 | 3300005366 | Bacteria | 644 |
| 151 | Ga0070667_100078670 | 3300005367 | Unclassified | 2817 |
| 152 | Ga0070703_10045433 | 3300005406 | Bacteria | 1385 |
| 153 | Ga0070709_10004387 | 3300005434 | Bacteria | 7607 |
| 154 | Ga0070709_10127383 | 3300005434 | Bacteria | 1734 |
| 155 | Ga0070709_10250300 | 3300005434 | Unclassified | 1276 |
| 156 | Ga0070714_100017298 | 3300005435 | Bacteria | 5839 |
| 157 | Ga0070714_100059789 | 3300005435 | Bacteria | 3268 |
| 158 | Ga0070714_101233724 | 3300005435 | Unclassified | 729 |
| 159 | Ga0070713_100007166 | 3300005436 | Bacteria | 7803 |
| 160 | Ga0070713_100044534 | 3300005436 | Bacteria | 3633 |
| 161 | Ga0070713_100116823 | 3300005436 | Bacteria | 2334 |
| 162 | Ga0070713_100460388 | 3300005436 | Unclassified | 1196 |
| 163 | Ga0070713_100497774 | 3300005436 | Bacteria | 1150 |
| 164 | Ga0070713_102030405 | 3300005436 | Unclassified | 558 |
| 165 | Ga0070710_10184315 | 3300005437 | Unclassified | 1309 |
| 166 | Ga0070710_10208052 | 3300005437 | Bacteria | 1239 |
| 167 | Ga0070701_10066722 | 3300005438 | Bacteria | 1913 |
| 168 | Ga0070701_10081963 | 3300005438 | Unclassified | 1748 |
| 169 | Ga0070701_10197945 | 3300005438 | Bacteria | 1186 |
| 170 | Ga0070711_100032354 | 3300005439 | Bacteria | 3477 |
| 171 | Ga0070711_100093604 | 3300005439 | Bacteria | 2170 |
| 172 | Ga0070711_100197012 | 3300005439 | Bacteria | 1552 |
| 173 | Ga0070711_100551202 | 3300005439 | Bacteria | 956 |
| 174 | Ga0070711_101492201 | 3300005439 | Bacteria | 590 |
| 175 | Ga0070705_100008002 | 3300005440 | Bacteria | 5226 |
| 176 | Ga0070705_100260434 | 3300005440 | Bacteria | 1223 |
| 177 | Ga0070700_100084227 | 3300005441 | Bacteria | 2060 |
| 178 | Ga0070700_100273692 | 3300005441 | Bacteria | 1221 |
| 179 | Ga0070700_100426352 | 3300005441 | Bacteria | 1003 |
| 180 | Ga0070694_100026031 | 3300005444 | Unclassified | 3789 |
| 181 | Ga0070694_100071018 | 3300005444 | Bacteria | 2399 |
| 182 | Ga0070694_100389417 | 3300005444 | Bacteria | 1089 |
| 183 | Ga0070708_100000198 | 3300005445 | Bacteria | 44012 |
| 184 | Ga0070708_100319285 | 3300005445 | Bacteria | 1463 |
| 185 | Ga0070708_100319362 | 3300005445 | Bacteria | 1463 |
| 186 | Ga0070708_100335521 | 3300005445 | Unclassified | 1425 |
| 187 | Ga0070708_102155434 | 3300005445 | Unclassified | 515 |
| 188 | Ga0070663_100006553 | 3300005455 | Bacteria | 7017 |
| 189 | Ga0070663_100026569 | 3300005455 | Bacteria | 3923 |
| 190 | Ga0070663_100426316 | 3300005455 | Unclassified | 1089 |
| 191 | Ga0070663_100462429 | 3300005455 | Bacteria | 1048 |
| 192 | Ga0070663_100628698 | 3300005455 | Bacteria | 906 |
| 193 | Ga0070663_100846071 | 3300005455 | Unclassified | 787 |
| 194 | Ga0070663_100969771 | 3300005455 | Bacteria | 738 |
| 195 | Ga0070678_100216556 | 3300005456 | Bacteria | 1589 |
| 196 | Ga0070678_100318911 | 3300005456 | Bacteria | 1326 |
| 197 | Ga0070678_100941283 | 3300005456 | Unclassified | 791 |
| 198 | Ga0070678_101712329 | 3300005456 | Unclassified | 592 |
| 199 | Ga0070662_100005643 | 3300005457 | Bacteria | 8003 |
| 200 | Ga0070662_100008788 | 3300005457 | Bacteria | 6588 |
| 201 | Ga0070662_100317522 | 3300005457 | Bacteria | 1269 |
| 202 | Ga0070662_101025354 | 3300005457 | Bacteria | 707 |
| 203 | Ga0070662_101027303 | 3300005457 | Bacteria | 706 |
| 204 | Ga0070662_101457880 | 3300005457 | Bacteria | 590 |
| 205 | Ga0070681_10000404 | 3300005458 | Bacteria | 35078 |
| 206 | Ga0070681_10002832 | 3300005458 | Bacteria | 16029 |
| 207 | Ga0070681_10003332 | 3300005458 | Bacteria | 15018 |
| 208 | Ga0070681_10003955 | 3300005458 | Bacteria | 13970 |
| 209 | Ga0070681_10010307 | 3300005458 | Bacteria | 9226 |
| 210 | Ga0070681_10039341 | 3300005458 | Bacteria | 4741 |
| 211 | Ga0070681_10044751 | 3300005458 | Bacteria | 4431 |
| 212 | Ga0070681_10061350 | 3300005458 | Bacteria | 3735 |
| 213 | Ga0070681_10169614 | 3300005458 | Unclassified | 2104 |
| 214 | Ga0070681_10330035 | 3300005458 | Bacteria | 1435 |
| 215 | Ga0070681_10363900 | 3300005458 | Bacteria | 1357 |
| 216 | Ga0070681_10543348 | 3300005458 | Bacteria | 1076 |
| 217 | Ga0070681_10586316 | 3300005458 | Bacteria | 1029 |
| 218 | Ga0070681_11039480 | 3300005458 | Bacteria | 739 |
| 219 | Ga0070681_11206837 | 3300005458 | Bacteria | 678 |
| 220 | Ga0070681_11206838 | 3300005458 | Bacteria | 678 |
| 221 | Ga0070681_12049106 | 3300005458 | Unclassified | 500 |
| 222 | Ga0068867_100005117 | 3300005459 | Bacteria | 9266 |
| 223 | Ga0068867_100010994 | 3300005459 | Bacteria | 6381 |
| 224 | Ga0068867_100080320 | 3300005459 | Bacteria | 2455 |
| 225 | Ga0068867_100937268 | 3300005459 | Unclassified | 781 |
| 226 | Ga0068867_101231203 | 3300005459 | Bacteria | 689 |
| 227 | Ga0068867_101566659 | 3300005459 | Unclassified | 615 |
| 228 | Ga0070685_10237064 | 3300005466 | Bacteria | 1203 |
| 229 | Ga0070706_100180612 | 3300005467 | Bacteria | 1970 |
| 230 | Ga0070706_100638097 | 3300005467 | Bacteria | 989 |
| 231 | Ga0070706_101174498 | 3300005467 | Bacteria | 706 |
| 232 | Ga0070707_100172133 | 3300005468 | Bacteria | 2110 |
| 233 | Ga0070707_100253278 | 3300005468 | Bacteria | 1713 |
| 234 | Ga0070707_100338019 | 3300005468 | Bacteria | 1463 |
| 235 | Ga0070707_100748109 | 3300005468 | Unclassified | 941 |
| 236 | Ga0070698_100012821 | 3300005471 | Bacteria | 8876 |
| 237 | Ga0070698_100033083 | 3300005471 | Bacteria | 5356 |
| 238 | Ga0070698_100060582 | 3300005471 | Bacteria | 3820 |
| 239 | Ga0070698_100245585 | 3300005471 | Bacteria | 1723 |
| 240 | Ga0070698_100297994 | 3300005471 | Unclassified | 1543 |
| 241 | Ga0070699_100075909 | 3300005518 | Bacteria | 2925 |
| 242 | Ga0070699_100142767 | 3300005518 | Bacteria | 2115 |
| 243 | Ga0070699_100269595 | 3300005518 | Bacteria | 1523 |
| 244 | Ga0070699_100762451 | 3300005518 | Unclassified | 885 |
| 245 | Ga0070679_100000919 | 3300005530 | Bacteria | 25597 |
| 246 | Ga0070679_100001084 | 3300005530 | Bacteria | 23776 |
| 247 | Ga0070679_100006169 | 3300005530 | Bacteria | 11157 |
| 248 | Ga0070679_100043081 | 3300005530 | Bacteria | 4496 |
| 249 | Ga0070679_100043325 | 3300005530 | Bacteria | 4482 |
| 250 | Ga0070679_100095100 | 3300005530 | Bacteria | 2967 |
| 251 | Ga0070679_100245133 | 3300005530 | Bacteria | 1749 |
| 252 | Ga0070679_100359492 | 3300005530 | Unclassified | 1403 |
| 253 | Ga0070679_100408428 | 3300005530 | Bacteria | 1303 |
| 254 | Ga0070679_100670594 | 3300005530 | Bacteria | 980 |
| 255 | Ga0070679_100702985 | 3300005530 | Bacteria | 954 |
| 256 | Ga0070679_101279873 | 3300005530 | Bacteria | 679 |
| 257 | Ga0070679_101506731 | 3300005530 | Unclassified | 619 |
| 258 | Ga0070684_100006699 | 3300005535 | Bacteria | 8930 |
| 259 | Ga0070684_100024585 | 3300005535 | Bacteria | 5055 |
| 260 | Ga0070684_100038174 | 3300005535 | Bacteria | 4124 |
| 261 | Ga0070684_100043865 | 3300005535 | Bacteria | 3864 |
| 262 | Ga0070684_100076836 | 3300005535 | Unclassified | 2948 |
| 263 | Ga0070684_100297248 | 3300005535 | Bacteria | 1481 |
| 264 | Ga0070684_100301427 | 3300005535 | Bacteria | 1470 |
| 265 | Ga0070684_100365457 | 3300005535 | Bacteria | 1328 |
| 266 | Ga0070684_100387243 | 3300005535 | Bacteria | 1288 |
| 267 | Ga0070684_100390698 | 3300005535 | Bacteria | 1282 |
| 268 | Ga0070684_100725714 | 3300005535 | Bacteria | 927 |
| 269 | Ga0070697_100659546 | 3300005536 | Bacteria | 922 |
| 270 | Ga0068853_100013646 | 3300005539 | Bacteria | 6638 |
| 271 | Ga0068853_100016074 | 3300005539 | Bacteria | 6155 |
| 272 | Ga0068853_100487555 | 3300005539 | Bacteria | 1162 |
| 273 | Ga0068853_100531253 | 3300005539 | Bacteria | 1113 |
| 274 | Ga0068853_100600016 | 3300005539 | Bacteria | 1045 |
| 275 | Ga0068853_101020938 | 3300005539 | Unclassified | 796 |
| 276 | Ga0070672_100004984 | 3300005543 | Bacteria | 8750 |
| 277 | Ga0070672_100005766 | 3300005543 | Bacteria | 8256 |
| 278 | Ga0070672_100206844 | 3300005543 | Bacteria | 1643 |
| 279 | Ga0070672_102093168 | 3300005543 | Bacteria | 510 |
| 280 | Ga0070686_100256050 | 3300005544 | Bacteria | 1281 |
| 281 | Ga0070686_100505251 | 3300005544 | Bacteria | 939 |
| 282 | Ga0070695_100001483 | 3300005545 | Bacteria | 13033 |
| 283 | Ga0070695_100246326 | 3300005545 | Bacteria | 1299 |
| 284 | Ga0070695_100441644 | 3300005545 | Bacteria | 995 |
| 285 | Ga0070695_100461616 | 3300005545 | Bacteria | 975 |
| 286 | Ga0070695_101161069 | 3300005545 | Bacteria | 634 |
| 287 | Ga0070696_100001375 | 3300005546 | Bacteria | 15888 |
| 288 | Ga0070696_100007637 | 3300005546 | Bacteria | 7228 |
| 289 | Ga0070696_100077827 | 3300005546 | Bacteria | 2344 |
| 290 | Ga0070696_100091579 | 3300005546 | Unclassified | 2165 |
| 291 | Ga0070696_101883053 | 3300005546 | Bacteria | 518 |
| 292 | Ga0070693_100008533 | 3300005547 | Bacteria | 5058 |
| 293 | Ga0070693_100013713 | 3300005547 | Bacteria | 4136 |
| 294 | Ga0070693_100057558 | 3300005547 | Bacteria | 2247 |
| 295 | Ga0070693_100503499 | 3300005547 | Bacteria | 859 |
| 296 | Ga0070693_100912568 | 3300005547 | Unclassified | 659 |
| 297 | Ga0070665_100042538 | 3300005548 | Bacteria | 4567 |
| 298 | Ga0070665_100052068 | 3300005548 | Unclassified | 4107 |
| 299 | Ga0070665_102600001 | 3300005548 | Bacteria | 507 |
| 300 | Ga0070704_100227659 | 3300005549 | Bacteria | 1519 |
| 301 | Ga0070704_100285705 | 3300005549 | Bacteria | 1369 |
| 302 | Ga0070704_101093287 | 3300005549 | Bacteria | 724 |
| 303 | Ga0068855_100002169 | 3300005563 | Bacteria | 24243 |
| 304 | Ga0068855_100005082 | 3300005563 | Bacteria | 16038 |
| 305 | Ga0068855_100008571 | 3300005563 | Bacteria | 12363 |
| 306 | Ga0068855_100043978 | 3300005563 | Bacteria | 5288 |
| 307 | Ga0068855_100366932 | 3300005563 | Bacteria | 1583 |
| 308 | Ga0068855_100381898 | 3300005563 | Unclassified | 1547 |
| 309 | Ga0068855_100646997 | 3300005563 | Bacteria | 1136 |
| 310 | Ga0068855_100990687 | 3300005563 | Bacteria | 883 |
| 311 | Ga0068855_101054914 | 3300005563 | Unclassified | 851 |
| 312 | Ga0068855_101547206 | 3300005563 | Bacteria | 680 |
| 313 | Ga0070664_100013154 | 3300005564 | Bacteria | 6738 |
| 314 | Ga0070664_100024766 | 3300005564 | Bacteria | 4968 |
| 315 | Ga0070664_100051722 | 3300005564 | Bacteria | 3478 |
| 316 | Ga0070664_100485014 | 3300005564 | Bacteria | 1138 |
| 317 | Ga0070664_101004731 | 3300005564 | Bacteria | 784 |
| 318 | Ga0070664_101389984 | 3300005564 | Unclassified | 663 |
| 319 | Ga0068857_100012151 | 3300005577 | Bacteria | 7490 |
| 320 | Ga0068857_100012440 | 3300005577 | Bacteria | 7408 |
| 321 | Ga0068857_100015739 | 3300005577 | Bacteria | 6617 |
| 322 | Ga0068857_100020862 | 3300005577 | Bacteria | 5764 |
| 323 | Ga0068857_100087176 | 3300005577 | Bacteria | 2792 |
| 324 | Ga0068857_100736577 | 3300005577 | Bacteria | 938 |
| 325 | Ga0068854_100000340 | 3300005578 | Bacteria | 30112 |
| 326 | Ga0068854_100034276 | 3300005578 | Bacteria | 3545 |
| 327 | Ga0068854_100053241 | 3300005578 | Bacteria | 2905 |
| 328 | Ga0068854_100420152 | 3300005578 | Bacteria | 1110 |
| 329 | Ga0068854_100745723 | 3300005578 | Bacteria | 849 |
| 330 | Ga0068854_100790047 | 3300005578 | Unclassified | 826 |
| 331 | Ga0068854_101739925 | 3300005578 | Unclassified | 571 |
| 332 | Ga0068856_100364022 | 3300005614 | Bacteria | 1465 |
| 333 | Ga0068856_100457035 | 3300005614 | Bacteria | 1298 |
| 334 | Ga0068856_100648460 | 3300005614 | Bacteria | 1076 |
| 335 | Ga0068856_100680175 | 3300005614 | Unclassified | 1049 |
| 336 | Ga0068856_100941185 | 3300005614 | Unclassified | 883 |
| 337 | Ga0068856_101002356 | 3300005614 | Unclassified | 853 |
| 338 | Ga0070702_100015870 | 3300005615 | Bacteria | 3854 |
| 339 | Ga0070702_100518545 | 3300005615 | Bacteria | 879 |
| 340 | Ga0068852_100014974 | 3300005616 | Bacteria | 5995 |
| 341 | Ga0068852_100018984 | 3300005616 | Bacteria | 5431 |
| 342 | Ga0068852_100069165 | 3300005616 | Bacteria | 3093 |
| 343 | Ga0068852_100192890 | 3300005616 | Bacteria | 1923 |
| 344 | Ga0068852_100202237 | 3300005616 | Bacteria | 1880 |
| 345 | Ga0068852_100546103 | 3300005616 | Unclassified | 1159 |
| 346 | Ga0068852_101079483 | 3300005616 | Bacteria | 823 |
| 347 | Ga0068852_101434378 | 3300005616 | Bacteria | 712 |
| 348 | Ga0068859_100056150 | 3300005617 | Bacteria | 3962 |
| 349 | Ga0068859_100897660 | 3300005617 | Unclassified | 971 |
| 350 | Ga0068864_100005386 | 3300005618 | Bacteria | 10484 |
| 351 | Ga0068864_100038902 | 3300005618 | Bacteria | 4064 |
| 352 | Ga0068864_100318803 | 3300005618 | Bacteria | 1459 |
| 353 | Ga0068864_100369234 | 3300005618 | Bacteria | 1357 |
| 354 | Ga0068864_101236591 | 3300005618 | Bacteria | 746 |
| 355 | Ga0068866_10000524 | 3300005718 | Bacteria | 17645 |
| 356 | Ga0068866_10116924 | 3300005718 | Bacteria | 1496 |
| 357 | Ga0068866_10376060 | 3300005718 | Unclassified | 910 |
| 358 | Ga0068866_10812860 | 3300005718 | Bacteria | 651 |
| 359 | Ga0068861_100001019 | 3300005719 | Bacteria | 17119 |
| 360 | Ga0068861_100049474 | 3300005719 | Bacteria | 3183 |
| 361 | Ga0068861_100289917 | 3300005719 | Bacteria | 1413 |
| 362 | Ga0068861_100944581 | 3300005719 | Unclassified | 820 |
| 363 | Ga0068851_10015465 | 3300005834 | Bacteria | 3636 |
| 364 | Ga0068851_10071393 | 3300005834 | Unclassified | 1797 |
| 365 | Ga0068851_10269088 | 3300005834 | Bacteria | 971 |
| 366 | Ga0068870_10002079 | 3300005840 | Bacteria | 8295 |
| 367 | Ga0068870_10304076 | 3300005840 | Bacteria | 1008 |
| 368 | Ga0068870_10408049 | 3300005840 | Bacteria | 886 |
| 369 | Ga0068870_10428249 | 3300005840 | Bacteria | 867 |
| 370 | Ga0068870_10492048 | 3300005840 | Bacteria | 816 |
| 371 | Ga0068863_100041206 | 3300005841 | Bacteria | 4390 |
| 372 | Ga0068863_100160660 | 3300005841 | Bacteria | 2153 |
| 373 | Ga0068863_100319991 | 3300005841 | Unclassified | 1507 |
| 374 | Ga0068858_100022826 | 3300005842 | Bacteria | 5836 |
| 375 | Ga0068858_100321105 | 3300005842 | Bacteria | 1480 |
| 376 | Ga0068860_100040126 | 3300005843 | Bacteria | 4476 |
| 377 | Ga0068860_100227646 | 3300005843 | Bacteria | 1811 |
| 378 | Ga0068860_100535547 | 3300005843 | Bacteria | 1172 |
| 379 | Ga0068862_100000376 | 3300005844 | Bacteria | 48418 |
| 380 | Ga0068862_100030151 | 3300005844 | Bacteria | 4570 |
| 381 | Ga0068862_100126281 | 3300005844 | Bacteria | 2258 |
| 382 | Ga0081455_10038603 | 3300005937 | Bacteria | 4227 |
| 383 | Ga0081455_10050687 | 3300005937 | Bacteria | 3566 |
| 384 | Ga0081539_10000104 | 3300005985 | Bacteria | 197478 |
| 385 | Ga0081539_10043960 | 3300005985 | Unclassified | 2583 |
| 386 | Ga0081539_10230857 | 3300005985 | Bacteria | 835 |
| 387 | Ga0070717_10016213 | 3300006028 | Bacteria | 5773 |
| 388 | Ga0070717_10418219 | 3300006028 | Unclassified | 1206 |
| 389 | Ga0070717_10918133 | 3300006028 | Unclassified | 797 |
| 390 | Ga0075432_10382237 | 3300006058 | Unclassified | 604 |
| 391 | Ga0070716_100172719 | 3300006173 | Bacteria | 1412 |
| 392 | Ga0070716_100338785 | 3300006173 | Unclassified | 1060 |
| 393 | Ga0070716_100489729 | 3300006173 | Bacteria | 905 |
| 394 | Ga0070716_100573872 | 3300006173 | Bacteria | 844 |
| 395 | Ga0070716_100851716 | 3300006173 | Bacteria | 710 |
| 396 | Ga0070712_100012458 | 3300006175 | Bacteria | 5407 |
| 397 | Ga0070712_100028870 | 3300006175 | Bacteria | 3714 |
| 398 | Ga0070712_100062454 | 3300006175 | Bacteria | 2634 |
| 399 | Ga0070712_100347417 | 3300006175 | Unclassified | 1213 |
| 400 | Ga0070712_100413145 | 3300006175 | Unclassified | 1117 |
| 401 | Ga0070712_100488267 | 3300006175 | Unclassified | 1031 |
| 402 | Ga0097621_100208928 | 3300006237 | Bacteria | 1697 |
| 403 | Ga0068871_100139055 | 3300006358 | Bacteria | 2064 |
| 404 | Ga0068871_100407653 | 3300006358 | Bacteria | 1211 |
| 405 | Ga0075428_100235434 | 3300006844 | Bacteria | 1976 |
| 406 | Ga0075428_100397778 | 3300006844 | Bacteria | 1477 |
| 407 | Ga0075428_101094780 | 3300006844 | Bacteria | 842 |
| 408 | Ga0075428_101376680 | 3300006844 | Bacteria | 741 |
| 409 | Ga0075428_101708408 | 3300006844 | Bacteria | 657 |
| 410 | Ga0075430_100003192 | 3300006846 | Bacteria | 13741 |
| 411 | Ga0075430_100013015 | 3300006846 | Bacteria | 7091 |
| 412 | Ga0075430_100019170 | 3300006846 | Bacteria | 5816 |
| 413 | Ga0075430_100029938 | 3300006846 | Bacteria | 4622 |
| 414 | Ga0075430_100194674 | 3300006846 | Bacteria | 1684 |
| 415 | Ga0075430_100269583 | 3300006846 | Bacteria | 1409 |
| 416 | Ga0075431_100024864 | 3300006847 | Bacteria | 6141 |
| 417 | Ga0075431_100037185 | 3300006847 | Bacteria | 5017 |
| 418 | Ga0075431_100053473 | 3300006847 | Unclassified | 4164 |
| 419 | Ga0075431_100065457 | 3300006847 | Bacteria | 3753 |
| 420 | Ga0075431_100076205 | 3300006847 | Bacteria | 3461 |
| 421 | Ga0075431_100135269 | 3300006847 | Bacteria | 2541 |
| 422 | Ga0075431_100186854 | 3300006847 | Bacteria | 2125 |
| 423 | Ga0075431_100236239 | 3300006847 | Bacteria | 1861 |
| 424 | Ga0075431_100247272 | 3300006847 | Bacteria | 1813 |
| 425 | Ga0075431_100373540 | 3300006847 | Unclassified | 1431 |
| 426 | Ga0075433_10005348 | 3300006852 | Bacteria | 10079 |
| 427 | Ga0075433_10718897 | 3300006852 | Bacteria | 874 |
| 428 | Ga0075434_100001804 | 3300006871 | Bacteria | 18514 |
| 429 | Ga0075434_100035507 | 3300006871 | Bacteria | 4929 |
| 430 | Ga0075434_100244634 | 3300006871 | Bacteria | 1814 |
| 431 | Ga0075434_100261801 | 3300006871 | Bacteria | 1749 |
| 432 | Ga0075434_100873154 | 3300006871 | Bacteria | 915 |
| 433 | Ga0075434_100881508 | 3300006871 | Bacteria | 910 |
| 434 | Ga0075429_100067642 | 3300006880 | Bacteria | 3108 |
| 435 | Ga0075429_100208196 | 3300006880 | Bacteria | 1713 |
| 436 | Ga0075429_100453510 | 3300006880 | Bacteria | 1124 |
| 437 | Ga0075429_100470855 | 3300006880 | Bacteria | 1101 |
| 438 | Ga0068865_100001514 | 3300006881 | Bacteria | 13558 |
| 439 | Ga0068865_100117526 | 3300006881 | Bacteria | 1971 |
| 440 | Ga0068865_100628234 | 3300006881 | Unclassified | 910 |
| 441 | Ga0075436_100114952 | 3300006914 | Bacteria | 1879 |
| 442 | Ga0075436_100194376 | 3300006914 | Bacteria | 1436 |
| 443 | Ga0075436_100209048 | 3300006914 | Bacteria | 1383 |
| 444 | Ga0097620_100056151 | 3300006931 | Bacteria | 3962 |
| 445 | Ga0097620_100897771 | 3300006931 | Unclassified | 971 |
| 446 | Ga0075435_100694998 | 3300007076 | Bacteria | 884 |
| 447 | Ga0075435_100980540 | 3300007076 | Unclassified | 738 |
| 448 | Ga0075435_101112837 | 3300007076 | Bacteria | 690 |
| 449 | Ga0075435_101766042 | 3300007076 | Unclassified | 543 |
| 450 | Ga0105240_10009204 | 3300009093 | Bacteria | 14007 |
| 451 | Ga0105240_10011015 | 3300009093 | Bacteria | 12657 |
| 452 | Ga0105240_10016684 | 3300009093 | Bacteria | 9932 |
| 453 | Ga0105240_10037426 | 3300009093 | Bacteria | 6236 |
| 454 | Ga0105240_10046608 | 3300009093 | Bacteria | 5492 |
| 455 | Ga0105240_10070716 | 3300009093 | Bacteria | 4316 |
| 456 | Ga0105240_10074073 | 3300009093 | Bacteria | 4204 |
| 457 | Ga0105240_10090200 | 3300009093 | Bacteria | 3747 |
| 458 | Ga0105240_10705779 | 3300009093 | Bacteria | 1101 |
| 459 | Ga0105240_10890443 | 3300009093 | Bacteria | 958 |
| 460 | Ga0105240_11048922 | 3300009093 | Unclassified | 870 |
| 461 | Ga0111539_10042342 | 3300009094 | Bacteria | 5469 |
| 462 | Ga0111539_10088891 | 3300009094 | Bacteria | 3629 |
| 463 | Ga0111539_10150269 | 3300009094 | Bacteria | 2726 |
| 464 | Ga0111539_10251608 | 3300009094 | Bacteria | 2057 |
| 465 | Ga0111539_10920564 | 3300009094 | Bacteria | 1017 |
| 466 | Ga0105245_10025521 | 3300009098 | Bacteria | 5198 |
| 467 | Ga0105245_10036543 | 3300009098 | Bacteria | 4364 |
| 468 | Ga0105245_12730105 | 3300009098 | Bacteria | 547 |
| 469 | Ga0105247_10439480 | 3300009101 | Bacteria | 938 |
| 470 | Ga0114129_10017266 | 3300009147 | Bacteria | 10277 |
| 471 | Ga0114129_10068560 | 3300009147 | Bacteria | 4946 |
| 472 | Ga0114129_10230022 | 3300009147 | Bacteria | 2497 |
| 473 | Ga0114129_10273868 | 3300009147 | Bacteria | 2257 |
| 474 | Ga0114129_10299783 | 3300009147 | Bacteria | 2143 |
| 475 | Ga0114129_10477216 | 3300009147 | Archaea | 1632 |
| 476 | Ga0114129_10941962 | 3300009147 | Bacteria | 1091 |
| 477 | Ga0114129_11407312 | 3300009147 | Bacteria | 860 |
| 478 | Ga0105243_10042543 | 3300009148 | Bacteria | 3556 |
| 479 | Ga0105243_10242951 | 3300009148 | Bacteria | 1603 |
| 480 | Ga0105243_10590746 | 3300009148 | Bacteria | 1067 |
| 481 | Ga0105241_10000729 | 3300009174 | Bacteria | 24921 |
| 482 | Ga0105241_10024142 | 3300009174 | Bacteria | 4515 |
| 483 | Ga0105241_10116790 | 3300009174 | Bacteria | 2143 |
| 484 | Ga0105241_10169367 | 3300009174 | Bacteria | 1803 |
| 485 | Ga0105241_10525033 | 3300009174 | Bacteria | 1059 |
| 486 | Ga0105241_10717479 | 3300009174 | Bacteria | 914 |
| 487 | Ga0105241_11098168 | 3300009174 | Unclassified | 749 |
| 488 | Ga0105242_10006526 | 3300009176 | Bacteria | 8978 |
| 489 | Ga0105242_10015995 | 3300009176 | Bacteria | 5830 |
| 490 | Ga0105242_10181321 | 3300009176 | Unclassified | 1858 |
| 491 | Ga0105242_10993453 | 3300009176 | Unclassified | 846 |
| 492 | Ga0105242_11994438 | 3300009176 | Bacteria | 622 |
| 493 | Ga0105248_10009365 | 3300009177 | Bacteria | 10781 |
| 494 | Ga0105248_10011120 | 3300009177 | Bacteria | 9932 |
| 495 | Ga0105248_10104035 | 3300009177 | Bacteria | 3200 |
| 496 | Ga0105248_10916580 | 3300009177 | Bacteria | 990 |
| 497 | Ga0105248_12078802 | 3300009177 | Bacteria | 646 |
| 498 | Ga0105237_10079939 | 3300009545 | Bacteria | 3259 |
| 499 | Ga0105237_10149201 | 3300009545 | Bacteria | 2334 |
| 500 | Ga0105237_10431669 | 3300009545 | Bacteria | 1323 |
| 501 | Ga0105237_10472521 | 3300009545 | Bacteria | 1260 |
| 502 | Ga0105237_11009553 | 3300009545 | Bacteria | 839 |
| 503 | Ga0105237_11127262 | 3300009545 | Unclassified | 791 |
| 504 | Ga0105238_10024368 | 3300009551 | Bacteria | 6168 |
| 505 | Ga0105238_10066363 | 3300009551 | Bacteria | 3610 |
| 506 | Ga0105238_10073038 | 3300009551 | Bacteria | 3425 |
| 507 | Ga0105238_10087946 | 3300009551 | Bacteria | 3094 |
| 508 | Ga0105238_10325721 | 3300009551 | Bacteria | 1523 |
| 509 | Ga0105238_10816832 | 3300009551 | Bacteria | 948 |
| 510 | Ga0105238_11465449 | 3300009551 | Bacteria | 711 |
| 511 | Ga0105238_12277478 | 3300009551 | Unclassified | 577 |
| 512 | Ga0105249_10000454 | 3300009553 | Bacteria | 38498 |
| 513 | Ga0105249_10069734 | 3300009553 | Bacteria | 3245 |
| 514 | Ga0105249_10190726 | 3300009553 | Bacteria | 2000 |
| 515 | Ga0105249_10325281 | 3300009553 | Bacteria | 1550 |
| 516 | Ga0105249_10809129 | 3300009553 | Bacteria | 1001 |
| 517 | Ga0105239_10147980 | 3300010375 | Bacteria | 2620 |
| 518 | Ga0105239_10231952 | 3300010375 | Unclassified | 2071 |
| 519 | Ga0105239_10259676 | 3300010375 | Bacteria | 1952 |
| 520 | Ga0105239_10382025 | 3300010375 | Bacteria | 1592 |
| 521 | Ga0105239_11245419 | 3300010375 | Unclassified | 858 |
| 522 | Ga0105239_12469307 | 3300010375 | Unclassified | 606 |
| 523 | Ga0105246_10055844 | 3300011119 | Bacteria | 2727 |
| 524 | Ga0105246_10471626 | 3300011119 | Bacteria | 1060 |
| 525 | Ga0157342_1073673 | 3300012507 | Unclassified | 524 |
| 526 | Ga0157373_10001473 | 3300013100 | Bacteria | 17949 |
| 527 | Ga0157373_10027655 | 3300013100 | Bacteria | 4092 |
| 528 | Ga0157373_10091952 | 3300013100 | Bacteria | 2136 |
| 529 | Ga0157373_10152454 | 3300013100 | Bacteria | 1626 |
| 530 | Ga0157373_10201626 | 3300013100 | Bacteria | 1403 |
| 531 | Ga0157373_10237167 | 3300013100 | Unclassified | 1289 |
| 532 | Ga0157373_11331309 | 3300013100 | Bacteria | 544 |
| 533 | Ga0157371_10007275 | 3300013102 | Bacteria | 8992 |
| 534 | Ga0157371_10714457 | 3300013102 | Bacteria | 751 |
| 535 | Ga0157371_10743094 | 3300013102 | Unclassified | 736 |
| 536 | Ga0157371_11534102 | 3300013102 | Bacteria | 520 |
| 537 | Ga0157370_10003508 | 3300013104 | Bacteria | 18392 |
| 538 | Ga0157370_10008754 | 3300013104 | Bacteria | 10881 |
| 539 | Ga0157370_10041763 | 3300013104 | Bacteria | 4422 |
| 540 | Ga0157370_10136189 | 3300013104 | Bacteria | 2289 |
| 541 | Ga0157370_10165029 | 3300013104 | Bacteria | 2060 |
| 542 | Ga0157370_10166493 | 3300013104 | Bacteria | 2050 |
| 543 | Ga0157370_10282223 | 3300013104 | Bacteria | 1534 |
| 544 | Ga0157370_10861985 | 3300013104 | Unclassified | 823 |
| 545 | Ga0157370_11117989 | 3300013104 | Bacteria | 712 |
| 546 | Ga0157370_11609613 | 3300013104 | Unclassified | 583 |
| 547 | Ga0157369_10009705 | 3300013105 | Bacteria | 11007 |
| 548 | Ga0157369_10017338 | 3300013105 | Bacteria | 8095 |
| 549 | Ga0157369_10073925 | 3300013105 | Bacteria | 3656 |
| 550 | Ga0157369_10115485 | 3300013105 | Bacteria | 2851 |
| 551 | Ga0157369_10117595 | 3300013105 | Bacteria | 2822 |
| 552 | Ga0157369_10119385 | 3300013105 | Bacteria | 2798 |
| 553 | Ga0157369_10232225 | 3300013105 | Bacteria | 1928 |
| 554 | Ga0157369_10232838 | 3300013105 | Bacteria | 1925 |
| 555 | Ga0157369_10739412 | 3300013105 | Bacteria | 1012 |
| 556 | Ga0157369_10743766 | 3300013105 | Bacteria | 1009 |
| 557 | Ga0157369_11755948 | 3300013105 | Unclassified | 630 |
| 558 | Ga0157374_10433589 | 3300013296 | Bacteria | 1314 |
| 559 | Ga0157374_10990234 | 3300013296 | Bacteria | 860 |
| 560 | Ga0157374_11098074 | 3300013296 | Bacteria | 816 |
| 561 | Ga0157374_11385070 | 3300013296 | Bacteria | 726 |
| 562 | Ga0157374_12425697 | 3300013296 | Bacteria | 552 |
| 563 | Ga0157378_10005002 | 3300013297 | Bacteria | 11631 |
| 564 | Ga0157378_10016080 | 3300013297 | Bacteria | 6553 |
| 565 | Ga0157378_10429050 | 3300013297 | Bacteria | 1308 |
| 566 | Ga0163162_10001492 | 3300013306 | Bacteria | 21813 |
| 567 | Ga0163162_10013828 | 3300013306 | Bacteria | 7885 |
| 568 | Ga0163162_10075056 | 3300013306 | Bacteria | 3441 |
| 569 | Ga0163162_12869838 | 3300013306 | Unclassified | 555 |
| 570 | Ga0163162_13441632 | 3300013306 | Unclassified | 504 |
| 571 | Ga0157372_10010171 | 3300013307 | Bacteria | 9988 |
| 572 | Ga0157372_10013087 | 3300013307 | Bacteria | 8852 |
| 573 | Ga0157372_10015470 | 3300013307 | Bacteria | 8178 |
| 574 | Ga0157372_10025540 | 3300013307 | Bacteria | 6425 |
| 575 | Ga0157372_10068103 | 3300013307 | Bacteria | 4002 |
| 576 | Ga0157372_10118363 | 3300013307 | Bacteria | 3039 |
| 577 | Ga0157372_10124994 | 3300013307 | Bacteria | 2957 |
| 578 | Ga0157372_10252248 | 3300013307 | Bacteria | 2048 |
| 579 | Ga0157372_10317512 | 3300013307 | Bacteria | 1814 |
| 580 | Ga0157372_10367523 | 3300013307 | Bacteria | 1676 |
| 581 | Ga0157372_10382231 | 3300013307 | Bacteria | 1640 |
| 582 | Ga0157372_10509511 | 3300013307 | Bacteria | 1403 |
| 583 | Ga0157372_10519876 | 3300013307 | Unclassified | 1388 |
| 584 | Ga0157372_10617092 | 3300013307 | Bacteria | 1264 |
| 585 | Ga0157372_10636435 | 3300013307 | Unclassified | 1242 |
| 586 | Ga0157372_10659924 | 3300013307 | Bacteria | 1218 |
| 587 | Ga0157372_10696387 | 3300013307 | Bacteria | 1182 |
| 588 | Ga0157372_11287462 | 3300013307 | Bacteria | 844 |
| 589 | Ga0157372_11664064 | 3300013307 | Bacteria | 734 |
| 590 | Ga0157372_11736237 | 3300013307 | Bacteria | 718 |
| 591 | Ga0157372_11902482 | 3300013307 | Bacteria | 684 |
| 592 | Ga0157372_12279322 | 3300013307 | Bacteria | 622 |
| 593 | Ga0157372_12346199 | 3300013307 | Bacteria | 613 |
| 594 | Ga0157372_12369999 | 3300013307 | Unclassified | 609 |
| 595 | Ga0157372_12614981 | 3300013307 | Bacteria | 579 |
| 596 | Ga0157375_10091745 | 3300013308 | Bacteria | 3100 |
| 597 | Ga0157375_10100651 | 3300013308 | Bacteria | 2971 |
| 598 | Ga0157375_10294846 | 3300013308 | Bacteria | 1785 |
| 599 | Ga0157375_10840832 | 3300013308 | Bacteria | 1065 |
| 600 | Ga0163163_10070485 | 3300014325 | Bacteria | 3481 |
| 601 | Ga0163163_10660291 | 3300014325 | Bacteria | 1109 |
| 602 | Ga0157380_10007646 | 3300014326 | Bacteria | 7684 |
| 603 | Ga0157380_10033634 | 3300014326 | Bacteria | 3949 |
| 604 | Ga0157380_10148905 | 3300014326 | Bacteria | 2021 |
| 605 | Ga0157380_10278831 | 3300014326 | Bacteria | 1528 |
| 606 | Ga0157380_12670253 | 3300014326 | Bacteria | 566 |
| 607 | Ga0182008_10009299 | 3300014497 | Bacteria | 5312 |
| 608 | Ga0182008_10081193 | 3300014497 | Bacteria | 1596 |
| 609 | Ga0157377_10031866 | 3300014745 | Bacteria | 2867 |
| 610 | Ga0157379_10015608 | 3300014968 | Bacteria | 6670 |
| 611 | Ga0157379_10064796 | 3300014968 | Bacteria | 3265 |
| 612 | Ga0157376_10093515 | 3300014969 | Bacteria | 2610 |
| 613 | Ga0157376_10225367 | 3300014969 | Unclassified | 1739 |
| 614 | Ga0157376_11130927 | 3300014969 | Bacteria | 810 |
| 615 | Ga0157376_11883363 | 3300014969 | Bacteria | 635 |
| 616 | Ga0182007_10042612 | 3300015262 | Unclassified | 1510 |
| 617 | Ga0182007_10073079 | 3300015262 | Unclassified | 1123 |
| 618 | Ga0182007_10210130 | 3300015262 | Bacteria | 684 |
| 619 | Ga0182007_10215945 | 3300015262 | Unclassified | 676 |
| 620 | Ga0182007_10254854 | 3300015262 | Bacteria | 631 |
| 621 | Ga0182005_1079726 | 3300015265 | Unclassified | 903 |
| 622 | Ga0163161_10150679 | 3300017792 | Bacteria | 1767 |
| 623 | Ga0163161_11802713 | 3300017792 | Unclassified | 544 |
| 624 | Ga0197907_11166881 | 3300020069 | Bacteria | 793 |
| 625 | Ga0197907_11314107 | 3300020069 | Bacteria | 1027 |
| 626 | Ga0206356_10116592 | 3300020070 | Unclassified | 681 |
| 627 | Ga0206356_10125692 | 3300020070 | Bacteria | 1524 |
| 628 | Ga0206356_10416445 | 3300020070 | Bacteria | 748 |
| 629 | Ga0206356_10483138 | 3300020070 | Bacteria | 644 |
| 630 | Ga0206356_10839536 | 3300020070 | Unclassified | 730 |
| 631 | Ga0206356_11361504 | 3300020070 | Bacteria | 842 |
| 632 | Ga0206356_11525656 | 3300020070 | Bacteria | 806 |
| 633 | Ga0206356_11642972 | 3300020070 | Bacteria | 627 |
| 634 | Ga0206356_11798847 | 3300020070 | Bacteria | 567 |
| 635 | Ga0206355_1012074 | 3300020076 | Bacteria | 594 |
| 636 | Ga0206355_1360271 | 3300020076 | Bacteria | 773 |
| 637 | Ga0206352_10641371 | 3300020078 | Bacteria | 625 |
| 638 | Ga0206352_10860556 | 3300020078 | Bacteria | 760 |
| 639 | Ga0206352_10936146 | 3300020078 | Bacteria | 1046 |
| 640 | Ga0206352_11130402 | 3300020078 | Unclassified | 791 |
| 641 | Ga0206352_11362427 | 3300020078 | Bacteria | 1025 |
| 642 | Ga0206350_10135957 | 3300020080 | Bacteria | 835 |
| 643 | Ga0213876_10040236 | 3300021384 | Bacteria | 2469 |
| 644 | Ga0224712_10152424 | 3300022467 | Bacteria | 1025 |
| 645 | Ga0224712_10316866 | 3300022467 | Unclassified | 732 |
| 646 | Ga0224712_10352983 | 3300022467 | Bacteria | 695 |
| 647 | Ga0224712_10681828 | 3300022467 | Bacteria | 505 |
| 648 | Ga0207666_1047325 | 3300025271 | Unclassified | 678 |
| 649 | Ga0207673_1009498 | 3300025290 | Bacteria | 1243 |
| 650 | Ga0207697_10005445 | 3300025315 | Bacteria | 5918 |
| 651 | Ga0207697_10112113 | 3300025315 | Bacteria | 1169 |
| 652 | Ga0207656_10006385 | 3300025321 | Bacteria | 4232 |
| 653 | Ga0207656_10172199 | 3300025321 | Bacteria | 1035 |
| 654 | Ga0207653_10092535 | 3300025885 | Bacteria | 1061 |
| 655 | Ga0207682_10168826 | 3300025893 | Bacteria | 994 |
| 656 | Ga0207692_10101751 | 3300025898 | Bacteria | 1579 |
| 657 | Ga0207692_10231793 | 3300025898 | Unclassified | 1099 |
| 658 | Ga0207642_10069746 | 3300025899 | Bacteria | 1668 |
| 659 | Ga0207642_10150415 | 3300025899 | Bacteria | 1238 |
| 660 | Ga0207688_10023241 | 3300025901 | Bacteria | 3394 |
| 661 | Ga0207688_10186830 | 3300025901 | Bacteria | 1238 |
| 662 | Ga0207680_10113171 | 3300025903 | Bacteria | 1764 |
| 663 | Ga0207680_10213827 | 3300025903 | Bacteria | 1319 |
| 664 | Ga0207680_10821322 | 3300025903 | Unclassified | 666 |
| 665 | Ga0207647_10195587 | 3300025904 | Bacteria | 1171 |
| 666 | Ga0207685_10513020 | 3300025905 | Bacteria | 632 |
| 667 | Ga0207699_10008459 | 3300025906 | Bacteria | 5081 |
| 668 | Ga0207699_10045530 | 3300025906 | Bacteria | 2561 |
| 669 | Ga0207699_10106448 | 3300025906 | Bacteria | 1790 |
| 670 | Ga0207699_10106541 | 3300025906 | Bacteria | 1789 |
| 671 | Ga0207645_10000246 | 3300025907 | Bacteria | 44995 |
| 672 | Ga0207645_10000971 | 3300025907 | Bacteria | 23712 |
| 673 | Ga0207645_10067632 | 3300025907 | Bacteria | 2284 |
| 674 | Ga0207643_10001951 | 3300025908 | Bacteria | 11403 |
| 675 | Ga0207643_10076653 | 3300025908 | Unclassified | 1932 |
| 676 | Ga0207643_10131229 | 3300025908 | Bacteria | 1491 |
| 677 | Ga0207643_10266169 | 3300025908 | Unclassified | 1059 |
| 678 | Ga0207705_10007986 | 3300025909 | Bacteria | 7763 |
| 679 | Ga0207705_10085948 | 3300025909 | Bacteria | 2298 |
| 680 | Ga0207705_10089643 | 3300025909 | Bacteria | 2251 |
| 681 | Ga0207705_10092825 | 3300025909 | Bacteria | 2212 |
| 682 | Ga0207705_10104101 | 3300025909 | Bacteria | 2091 |
| 683 | Ga0207705_10568143 | 3300025909 | Bacteria | 882 |
| 684 | Ga0207684_10135612 | 3300025910 | Bacteria | 2114 |
| 685 | Ga0207684_10299794 | 3300025910 | Bacteria | 1386 |
| 686 | Ga0207684_11538460 | 3300025910 | Unclassified | 540 |
| 687 | Ga0207684_11568418 | 3300025910 | Bacteria | 534 |
| 688 | Ga0207654_10000860 | 3300025911 | Bacteria | 16810 |
| 689 | Ga0207654_10222487 | 3300025911 | Bacteria | 1253 |
| 690 | Ga0207654_10324081 | 3300025911 | Bacteria | 1054 |
| 691 | Ga0207654_10756775 | 3300025911 | Bacteria | 700 |
| 692 | Ga0207654_10955665 | 3300025911 | Bacteria | 622 |
| 693 | Ga0207654_11030082 | 3300025911 | Bacteria | 599 |
| 694 | Ga0207707_10000929 | 3300025912 | Bacteria | 28400 |
| 695 | Ga0207707_10002146 | 3300025912 | Bacteria | 17846 |
| 696 | Ga0207707_10002891 | 3300025912 | Bacteria | 15329 |
| 697 | Ga0207707_10007791 | 3300025912 | Bacteria | 9323 |
| 698 | Ga0207707_10013410 | 3300025912 | Bacteria | 7146 |
| 699 | Ga0207707_10018294 | 3300025912 | Bacteria | 6109 |
| 700 | Ga0207707_10021378 | 3300025912 | Bacteria | 5656 |
| 701 | Ga0207707_10029197 | 3300025912 | Bacteria | 4820 |
| 702 | Ga0207707_10075721 | 3300025912 | Bacteria | 2937 |
| 703 | Ga0207707_10138032 | 3300025912 | Unclassified | 2132 |
| 704 | Ga0207707_10629028 | 3300025912 | Bacteria | 906 |
| 705 | Ga0207707_10649450 | 3300025912 | Bacteria | 889 |
| 706 | Ga0207707_11269747 | 3300025912 | Bacteria | 593 |
| 707 | Ga0207695_10001441 | 3300025913 | Bacteria | 39845 |
| 708 | Ga0207695_10004676 | 3300025913 | Bacteria | 18554 |
| 709 | Ga0207695_10008984 | 3300025913 | Bacteria | 12435 |
| 710 | Ga0207695_10014206 | 3300025913 | Bacteria | 9447 |
| 711 | Ga0207695_10020766 | 3300025913 | Bacteria | 7513 |
| 712 | Ga0207695_10044422 | 3300025913 | Bacteria | 4726 |
| 713 | Ga0207695_10064710 | 3300025913 | Bacteria | 3763 |
| 714 | Ga0207695_10081615 | 3300025913 | Bacteria | 3272 |
| 715 | Ga0207695_10084488 | 3300025913 | Bacteria | 3205 |
| 716 | Ga0207671_10019018 | 3300025914 | Bacteria | 5262 |
| 717 | Ga0207671_10131053 | 3300025914 | Bacteria | 1924 |
| 718 | Ga0207671_10390182 | 3300025914 | Bacteria | 1107 |
| 719 | Ga0207693_10019839 | 3300025915 | Bacteria | 5346 |
| 720 | Ga0207693_10041127 | 3300025915 | Bacteria | 3640 |
| 721 | Ga0207693_10361743 | 3300025915 | Bacteria | 1135 |
| 722 | Ga0207693_10406055 | 3300025915 | Unclassified | 1065 |
| 723 | Ga0207693_10410453 | 3300025915 | Unclassified | 1058 |
| 724 | Ga0207693_10421808 | 3300025915 | Bacteria | 1043 |
| 725 | Ga0207693_10613331 | 3300025915 | Bacteria | 846 |
| 726 | Ga0207663_10001490 | 3300025916 | Bacteria | 10915 |
| 727 | Ga0207663_10080650 | 3300025916 | Bacteria | 2128 |
| 728 | Ga0207663_10172527 | 3300025916 | Bacteria | 1537 |
| 729 | Ga0207663_10243302 | 3300025916 | Bacteria | 1320 |
| 730 | Ga0207663_10898578 | 3300025916 | Bacteria | 708 |
| 731 | Ga0207663_11205783 | 3300025916 | Bacteria | 609 |
| 732 | Ga0207660_10001809 | 3300025917 | Bacteria | 14242 |
| 733 | Ga0207660_10017662 | 3300025917 | Bacteria | 4744 |
| 734 | Ga0207660_10032222 | 3300025917 | Bacteria | 3616 |
| 735 | Ga0207660_10065650 | 3300025917 | Bacteria | 2623 |
| 736 | Ga0207660_10087746 | 3300025917 | Bacteria | 2299 |
| 737 | Ga0207660_10090306 | 3300025917 | Bacteria | 2269 |
| 738 | Ga0207660_10101186 | 3300025917 | Bacteria | 2152 |
| 739 | Ga0207660_10141654 | 3300025917 | Bacteria | 1839 |
| 740 | Ga0207660_10218233 | 3300025917 | Bacteria | 1496 |
| 741 | Ga0207660_10239322 | 3300025917 | Unclassified | 1429 |
| 742 | Ga0207660_10918590 | 3300025917 | Bacteria | 714 |
| 743 | Ga0207660_11133214 | 3300025917 | Bacteria | 637 |
| 744 | Ga0207662_10003841 | 3300025918 | Bacteria | 7805 |
| 745 | Ga0207662_10105844 | 3300025918 | Bacteria | 1749 |
| 746 | Ga0207662_10244175 | 3300025918 | Unclassified | 1176 |
| 747 | Ga0207657_10005262 | 3300025919 | Bacteria | 13552 |
| 748 | Ga0207657_10021232 | 3300025919 | Bacteria | 6115 |
| 749 | Ga0207657_10237526 | 3300025919 | Bacteria | 1456 |
| 750 | Ga0207657_10250158 | 3300025919 | Bacteria | 1413 |
| 751 | Ga0207657_10541662 | 3300025919 | Bacteria | 910 |
| 752 | Ga0207657_10685639 | 3300025919 | Bacteria | 796 |
| 753 | Ga0207657_11469464 | 3300025919 | Unclassified | 510 |
| 754 | Ga0207649_10029427 | 3300025920 | Bacteria | 3243 |
| 755 | Ga0207649_10050337 | 3300025920 | Bacteria | 2576 |
| 756 | Ga0207649_10096437 | 3300025920 | Bacteria | 1948 |
| 757 | Ga0207649_10165257 | 3300025920 | Bacteria | 1537 |
| 758 | Ga0207649_10174948 | 3300025920 | Bacteria | 1498 |
| 759 | Ga0207649_10852542 | 3300025920 | Bacteria | 713 |
| 760 | Ga0207652_10000470 | 3300025921 | Bacteria | 41380 |
| 761 | Ga0207652_10003423 | 3300025921 | Bacteria | 13091 |
| 762 | Ga0207652_10007324 | 3300025921 | Bacteria | 8892 |
| 763 | Ga0207652_10020285 | 3300025921 | Bacteria | 5472 |
| 764 | Ga0207652_10022221 | 3300025921 | Bacteria | 5244 |
| 765 | Ga0207652_10024204 | 3300025921 | Bacteria | 5036 |
| 766 | Ga0207652_10031148 | 3300025921 | Bacteria | 4476 |
| 767 | Ga0207652_10086061 | 3300025921 | Bacteria | 2755 |
| 768 | Ga0207652_10088832 | 3300025921 | Bacteria | 2712 |
| 769 | Ga0207652_10267542 | 3300025921 | Bacteria | 1542 |
| 770 | Ga0207652_10564050 | 3300025921 | Bacteria | 1023 |
| 771 | Ga0207652_11525639 | 3300025921 | Bacteria | 572 |
| 772 | Ga0207646_10123227 | 3300025922 | Bacteria | 2330 |
| 773 | Ga0207646_10142024 | 3300025922 | Bacteria | 2163 |
| 774 | Ga0207646_10424101 | 3300025922 | Bacteria | 1201 |
| 775 | Ga0207681_10009785 | 3300025923 | Bacteria | 5864 |
| 776 | Ga0207681_10054383 | 3300025923 | Bacteria | 2722 |
| 777 | Ga0207681_10066558 | 3300025923 | Bacteria | 2494 |
| 778 | Ga0207681_10221702 | 3300025923 | Bacteria | 1463 |
| 779 | Ga0207694_10023333 | 3300025924 | Bacteria | 4696 |
| 780 | Ga0207694_10137479 | 3300025924 | Bacteria | 1963 |
| 781 | Ga0207694_10209118 | 3300025924 | Bacteria | 1589 |
| 782 | Ga0207694_10360180 | 3300025924 | Bacteria | 1205 |
| 783 | Ga0207694_10664094 | 3300025924 | Bacteria | 878 |
| 784 | Ga0207694_11230706 | 3300025924 | Unclassified | 633 |
| 785 | Ga0207650_10004487 | 3300025925 | Bacteria | 9540 |
| 786 | Ga0207650_10101704 | 3300025925 | Unclassified | 2213 |
| 787 | Ga0207650_10104656 | 3300025925 | Bacteria | 2184 |
| 788 | Ga0207659_10003254 | 3300025926 | Bacteria | 9727 |
| 789 | Ga0207659_10009170 | 3300025926 | Bacteria | 6179 |
| 790 | Ga0207659_10555758 | 3300025926 | Bacteria | 976 |
| 791 | Ga0207659_10642311 | 3300025926 | Bacteria | 907 |
| 792 | Ga0207659_11039265 | 3300025926 | Bacteria | 705 |
| 793 | Ga0207659_11089345 | 3300025926 | Bacteria | 687 |
| 794 | Ga0207687_10039639 | 3300025927 | Bacteria | 3226 |
| 795 | Ga0207687_10073181 | 3300025927 | Bacteria | 2453 |
| 796 | Ga0207700_10038793 | 3300025928 | Bacteria | 3461 |
| 797 | Ga0207700_10054883 | 3300025928 | Bacteria | 2993 |
| 798 | Ga0207700_10089999 | 3300025928 | Bacteria | 2420 |
| 799 | Ga0207700_10123261 | 3300025928 | Bacteria | 2105 |
| 800 | Ga0207700_10243155 | 3300025928 | Bacteria | 1535 |
| 801 | Ga0207700_10337740 | 3300025928 | Bacteria | 1309 |
| 802 | Ga0207700_10819651 | 3300025928 | Bacteria | 832 |
| 803 | Ga0207664_10025601 | 3300025929 | Bacteria | 4449 |
| 804 | Ga0207664_10039577 | 3300025929 | Bacteria | 3661 |
| 805 | Ga0207664_10119297 | 3300025929 | Unclassified | 2205 |
| 806 | Ga0207664_10167885 | 3300025929 | Unclassified | 1876 |
| 807 | Ga0207664_10572851 | 3300025929 | Bacteria | 1013 |
| 808 | Ga0207644_10035451 | 3300025931 | Bacteria | 3496 |
| 809 | Ga0207644_10257273 | 3300025931 | Unclassified | 1395 |
| 810 | Ga0207644_10686395 | 3300025931 | Bacteria | 853 |
| 811 | Ga0207644_10722079 | 3300025931 | Bacteria | 831 |
| 812 | Ga0207690_10012598 | 3300025932 | Bacteria | 5063 |
| 813 | Ga0207690_10037581 | 3300025932 | Bacteria | 3145 |
| 814 | Ga0207690_10042611 | 3300025932 | Bacteria | 2982 |
| 815 | Ga0207690_10044207 | 3300025932 | Bacteria | 2935 |
| 816 | Ga0207690_10068413 | 3300025932 | Bacteria | 2440 |
| 817 | Ga0207690_10278896 | 3300025932 | Bacteria | 1301 |
| 818 | Ga0207690_10747510 | 3300025932 | Unclassified | 806 |
| 819 | Ga0207690_11017212 | 3300025932 | Bacteria | 690 |
| 820 | Ga0207690_11587498 | 3300025932 | Bacteria | 547 |
| 821 | Ga0207706_10000065 | 3300025933 | Bacteria | 109080 |
| 822 | Ga0207706_10000357 | 3300025933 | Bacteria | 49369 |
| 823 | Ga0207706_10297873 | 3300025933 | Bacteria | 1406 |
| 824 | Ga0207706_11025855 | 3300025933 | Bacteria | 692 |
| 825 | Ga0207706_11312440 | 3300025933 | Bacteria | 597 |
| 826 | Ga0207686_10001117 | 3300025934 | Bacteria | 15528 |
| 827 | Ga0207686_10171259 | 3300025934 | Unclassified | 1531 |
| 828 | Ga0207709_10004346 | 3300025935 | Bacteria | 8201 |
| 829 | Ga0207709_10567253 | 3300025935 | Bacteria | 895 |
| 830 | Ga0207709_10740090 | 3300025935 | Bacteria | 790 |
| 831 | Ga0207670_10120778 | 3300025936 | Bacteria | 1904 |
| 832 | Ga0207670_11386390 | 3300025936 | Unclassified | 597 |
| 833 | Ga0207669_10001479 | 3300025937 | Bacteria | 10039 |
| 834 | Ga0207669_10015931 | 3300025937 | Bacteria | 3805 |
| 835 | Ga0207669_10077102 | 3300025937 | Bacteria | 2118 |
| 836 | Ga0207669_10215008 | 3300025937 | Bacteria | 1406 |
| 837 | Ga0207704_10058637 | 3300025938 | Bacteria | 2371 |
| 838 | Ga0207704_10414369 | 3300025938 | Bacteria | 1066 |
| 839 | Ga0207665_10157887 | 3300025939 | Bacteria | 1629 |
| 840 | Ga0207665_10226418 | 3300025939 | Bacteria | 1373 |
| 841 | Ga0207665_10407598 | 3300025939 | Bacteria | 1036 |
| 842 | Ga0207665_11088389 | 3300025939 | Bacteria | 637 |
| 843 | Ga0207665_11404281 | 3300025939 | Bacteria | 556 |
| 844 | Ga0207691_10001355 | 3300025940 | Bacteria | 24425 |
| 845 | Ga0207691_10001550 | 3300025940 | Bacteria | 22813 |
| 846 | Ga0207691_10022438 | 3300025940 | Bacteria | 5953 |
| 847 | Ga0207691_10131502 | 3300025940 | Bacteria | 2210 |
| 848 | Ga0207711_10028892 | 3300025941 | Bacteria | 4671 |
| 849 | Ga0207711_10222614 | 3300025941 | Unclassified | 1726 |
| 850 | Ga0207711_10908831 | 3300025941 | Bacteria | 818 |
| 851 | Ga0207689_10001360 | 3300025942 | Bacteria | 23476 |
| 852 | Ga0207689_10007750 | 3300025942 | Bacteria | 9398 |
| 853 | Ga0207689_10665749 | 3300025942 | Bacteria | 877 |
| 854 | Ga0207689_11505011 | 3300025942 | Bacteria | 562 |
| 855 | Ga0207661_10011833 | 3300025944 | Bacteria | 6336 |
| 856 | Ga0207661_10019670 | 3300025944 | Bacteria | 5040 |
| 857 | Ga0207661_10022228 | 3300025944 | Bacteria | 4771 |
| 858 | Ga0207661_10032021 | 3300025944 | Bacteria | 4070 |
| 859 | Ga0207661_10037459 | 3300025944 | Bacteria | 3793 |
| 860 | Ga0207661_10068735 | 3300025944 | Bacteria | 2885 |
| 861 | Ga0207661_10323213 | 3300025944 | Bacteria | 1387 |
| 862 | Ga0207661_10716921 | 3300025944 | Bacteria | 920 |
| 863 | Ga0207661_11987297 | 3300025944 | Unclassified | 527 |
| 864 | Ga0207661_12145826 | 3300025944 | Bacteria | 505 |
| 865 | Ga0207679_10000484 | 3300025945 | Bacteria | 27676 |
| 866 | Ga0207679_10006509 | 3300025945 | Bacteria | 7385 |
| 867 | Ga0207679_10024777 | 3300025945 | Bacteria | 4117 |
| 868 | Ga0207679_10271920 | 3300025945 | Bacteria | 1449 |
| 869 | Ga0207679_10276220 | 3300025945 | Bacteria | 1439 |
| 870 | Ga0207679_10602183 | 3300025945 | Bacteria | 990 |
| 871 | Ga0207667_10011137 | 3300025949 | Bacteria | 10468 |
| 872 | Ga0207667_10019276 | 3300025949 | Bacteria | 7622 |
| 873 | Ga0207667_10081585 | 3300025949 | Bacteria | 3350 |
| 874 | Ga0207667_10187587 | 3300025949 | Bacteria | 2122 |
| 875 | Ga0207667_10950863 | 3300025949 | Bacteria | 849 |
| 876 | Ga0207651_10058551 | 3300025960 | Bacteria | 2663 |
| 877 | Ga0207651_10150000 | 3300025960 | Bacteria | 1813 |
| 878 | Ga0207651_10452791 | 3300025960 | Bacteria | 1101 |
| 879 | Ga0207712_10001176 | 3300025961 | Bacteria | 18145 |
| 880 | Ga0207712_10044891 | 3300025961 | Bacteria | 3058 |
| 881 | Ga0207712_10130934 | 3300025961 | Bacteria | 1912 |
| 882 | Ga0207712_10481269 | 3300025961 | Bacteria | 1058 |
| 883 | Ga0207712_11682783 | 3300025961 | Unclassified | 569 |
| 884 | Ga0207668_10021247 | 3300025972 | Bacteria | 4137 |
| 885 | Ga0207668_10053139 | 3300025972 | Bacteria | 2806 |
| 886 | Ga0207668_10730561 | 3300025972 | Archaea | 872 |
| 887 | Ga0207640_10001456 | 3300025981 | Bacteria | 12799 |
| 888 | Ga0207640_10050446 | 3300025981 | Bacteria | 2700 |
| 889 | Ga0207640_10104663 | 3300025981 | Bacteria | 1993 |
| 890 | Ga0207640_10110876 | 3300025981 | Bacteria | 1945 |
| 891 | Ga0207640_10286487 | 3300025981 | Bacteria | 1297 |
| 892 | Ga0207640_10370752 | 3300025981 | Bacteria | 1157 |
| 893 | Ga0207640_10501830 | 3300025981 | Unclassified | 1010 |
| 894 | Ga0207658_10060833 | 3300025986 | Bacteria | 2820 |
| 895 | Ga0207658_10178304 | 3300025986 | Bacteria | 1756 |
| 896 | Ga0207658_11525645 | 3300025986 | Unclassified | 611 |
| 897 | Ga0207703_10156270 | 3300026035 | Bacteria | 1993 |
| 898 | Ga0207639_10004358 | 3300026041 | Bacteria | 9545 |
| 899 | Ga0207639_10116510 | 3300026041 | Bacteria | 2187 |
| 900 | Ga0207639_10150381 | 3300026041 | Bacteria | 1949 |
| 901 | Ga0207639_10331802 | 3300026041 | Bacteria | 1354 |
| 902 | Ga0207639_10517425 | 3300026041 | Bacteria | 1092 |
| 903 | Ga0207639_11916862 | 3300026041 | Bacteria | 553 |
| 904 | Ga0207678_10041333 | 3300026067 | Bacteria | 3998 |
| 905 | Ga0207678_10041868 | 3300026067 | Bacteria | 3970 |
| 906 | Ga0207678_10068814 | 3300026067 | Bacteria | 3036 |
| 907 | Ga0207678_10423890 | 3300026067 | Unclassified | 1154 |
| 908 | Ga0207678_12011429 | 3300026067 | Unclassified | 503 |
| 909 | Ga0207708_10098662 | 3300026075 | Bacteria | 2258 |
| 910 | Ga0207708_10104714 | 3300026075 | Bacteria | 2192 |
| 911 | Ga0207708_10154233 | 3300026075 | Bacteria | 1810 |
| 912 | Ga0207708_10751038 | 3300026075 | Bacteria | 837 |
| 913 | Ga0207702_10057844 | 3300026078 | Bacteria | 3297 |
| 914 | Ga0207702_10071273 | 3300026078 | Bacteria | 2992 |
| 915 | Ga0207702_10745631 | 3300026078 | Unclassified | 967 |
| 916 | Ga0207702_10915538 | 3300026078 | Bacteria | 869 |
| 917 | Ga0207702_10990133 | 3300026078 | Bacteria | 834 |
| 918 | Ga0207702_11682985 | 3300026078 | Bacteria | 627 |
| 919 | Ga0207641_10107617 | 3300026088 | Bacteria | 2466 |
| 920 | Ga0207641_10345441 | 3300026088 | Unclassified | 1417 |
| 921 | Ga0207648_10001169 | 3300026089 | Bacteria | 29362 |
| 922 | Ga0207648_10005220 | 3300026089 | Bacteria | 13139 |
| 923 | Ga0207648_10023923 | 3300026089 | Bacteria | 5460 |
| 924 | Ga0207648_10046448 | 3300026089 | Bacteria | 3807 |
| 925 | Ga0207648_12191754 | 3300026089 | Unclassified | 513 |
| 926 | Ga0207676_10048851 | 3300026095 | Bacteria | 3287 |
| 927 | Ga0207676_10093952 | 3300026095 | Bacteria | 2470 |
| 928 | Ga0207676_10142837 | 3300026095 | Bacteria | 2051 |
| 929 | Ga0207676_10163981 | 3300026095 | Bacteria | 1929 |
| 930 | Ga0207676_10343365 | 3300026095 | Bacteria | 1378 |
| 931 | Ga0207676_11694275 | 3300026095 | Bacteria | 630 |
| 932 | Ga0207674_10003135 | 3300026116 | Bacteria | 20383 |
| 933 | Ga0207674_10015526 | 3300026116 | Bacteria | 8364 |
| 934 | Ga0207674_10018565 | 3300026116 | Bacteria | 7555 |
| 935 | Ga0207674_10059142 | 3300026116 | Bacteria | 3880 |
| 936 | Ga0207674_10140302 | 3300026116 | Bacteria | 2376 |
| 937 | Ga0207674_10296301 | 3300026116 | Unclassified | 1566 |
| 938 | Ga0207674_10677573 | 3300026116 | Bacteria | 995 |
| 939 | Ga0207674_11584205 | 3300026116 | Unclassified | 624 |
| 940 | Ga0207675_100000320 | 3300026118 | Bacteria | 45668 |
| 941 | Ga0207675_100032261 | 3300026118 | Bacteria | 4879 |
| 942 | Ga0207675_100059762 | 3300026118 | Bacteria | 3558 |
| 943 | Ga0207675_100314828 | 3300026118 | Bacteria | 1527 |
| 944 | Ga0207675_100341058 | 3300026118 | Bacteria | 1467 |
| 945 | Ga0207683_10033546 | 3300026121 | Bacteria | 4459 |
| 946 | Ga0207683_10041068 | 3300026121 | Bacteria | 4038 |
| 947 | Ga0207683_10059100 | 3300026121 | Bacteria | 3367 |
| 948 | Ga0207683_10295458 | 3300026121 | Bacteria | 1482 |
| 949 | Ga0207698_10007055 | 3300026142 | Bacteria | 7036 |
| 950 | Ga0207698_10013973 | 3300026142 | Bacteria | 5318 |
| 951 | Ga0207698_10256188 | 3300026142 | Bacteria | 1604 |
| 952 | Ga0207698_11013550 | 3300026142 | Bacteria | 841 |
| 953 | Ga0207698_11089470 | 3300026142 | Bacteria | 811 |
| 954 | Ga0207698_11123693 | 3300026142 | Bacteria | 799 |
| 955 | Ga0207698_11183172 | 3300026142 | Bacteria | 778 |
| 956 | Ga0207698_11211289 | 3300026142 | Bacteria | 769 |
| 957 | Ga0207428_10075404 | 3300027907 | Bacteria | 2643 |
| 958 | Ga0207428_10258988 | 3300027907 | Bacteria | 1296 |
| 959 | Ga0268266_10083429 | 3300028379 | Bacteria | 2790 |
| 960 | Ga0268266_10102533 | 3300028379 | Bacteria | 2524 |
| 961 | Ga0268266_11123594 | 3300028379 | Bacteria | 760 |
| 962 | Ga0268265_10002121 | 3300028380 | Bacteria | 15384 |
| 963 | Ga0268265_10037895 | 3300028380 | Bacteria | 3541 |
| 964 | Ga0268265_10266956 | 3300028380 | Bacteria | 1524 |
| 965 | Ga0268265_10715986 | 3300028380 | Unclassified | 968 |
| 966 | Ga0268265_10802452 | 3300028380 | Bacteria | 918 |
| 967 | Ga0268264_10022106 | 3300028381 | Bacteria | 5192 |
| 968 | Ga0268264_10480925 | 3300028381 | Bacteria | 1208 |
| 969 | Ga0268264_10488128 | 3300028381 | Bacteria | 1199 |
| 970 | Ga0316178_1053326 | 3300030735 | Bacteria | 540 |
| 971 | Ga0307408_100008337 | 3300031548 | Bacteria | 6844 |
| 972 | Ga0307408_100187150 | 3300031548 | Bacteria | 1665 |
| 973 | Ga0307408_100297064 | 3300031548 | Bacteria | 1351 |
| 974 | Ga0307408_100368413 | 3300031548 | Bacteria | 1224 |
| 975 | Ga0307408_100559101 | 3300031548 | Bacteria | 1011 |
| 976 | Ga0307408_100875500 | 3300031548 | Bacteria | 820 |
| 977 | Ga0307408_102494544 | 3300031548 | Bacteria | 503 |
| 978 | Ga0316579_10111135 | 3300031691 | Bacteria | 1315 |
| 979 | Ga0316576_10002948 | 3300031727 | Bacteria | 9864 |
| 980 | Ga0316578_10013404 | 3300031728 | Bacteria | 4349 |
| 981 | Ga0316578_10015348 | 3300031728 | Bacteria | 4117 |
| 982 | Ga0307405_10000187 | 3300031731 | Bacteria | 22922 |
| 983 | Ga0307405_10014127 | 3300031731 | Bacteria | 4283 |
| 984 | Ga0307405_10036009 | 3300031731 | Bacteria | 2962 |
| 985 | Ga0307405_10092885 | 3300031731 | Bacteria | 2003 |
| 986 | Ga0307405_10144722 | 3300031731 | Bacteria | 1663 |
| 987 | Ga0307405_10154782 | 3300031731 | Unclassified | 1616 |
| 988 | Ga0307405_10173627 | 3300031731 | Bacteria | 1540 |
| 989 | Ga0307405_10258162 | 3300031731 | Bacteria | 1300 |
| 990 | Ga0307405_10406577 | 3300031731 | Bacteria | 1067 |
| 991 | Ga0307405_10487220 | 3300031731 | Bacteria | 985 |
| 992 | Ga0307405_10986256 | 3300031731 | Bacteria | 718 |
| 993 | Ga0307405_11102917 | 3300031731 | Bacteria | 682 |
| 994 | Ga0307405_11372694 | 3300031731 | Bacteria | 617 |
| 995 | Ga0307405_12113955 | 3300031731 | Bacteria | 505 |
| 996 | Ga0307405_12137608 | 3300031731 | Bacteria | 503 |
| 997 | Ga0316577_10002399 | 3300031733 | Bacteria | 9273 |
| 998 | Ga0316577_10025102 | 3300031733 | Bacteria | 3315 |
| 999 | Ga0307413_10000837 | 3300031824 | Bacteria | 10804 |
| 1000 | Ga0307413_10002229 | 3300031824 | Bacteria | 7809 |
| 1001 | Ga0307413_10030411 | 3300031824 | Bacteria | 3033 |
| 1002 | Ga0307413_10042391 | 3300031824 | Bacteria | 2674 |
| 1003 | Ga0307413_10055375 | 3300031824 | Bacteria | 2413 |
| 1004 | Ga0307413_10073618 | 3300031824 | Bacteria | 2160 |
| 1005 | Ga0307413_10140859 | 3300031824 | Bacteria | 1666 |
| 1006 | Ga0307413_10171588 | 3300031824 | Bacteria | 1536 |
| 1007 | Ga0307413_10284805 | 3300031824 | Bacteria | 1245 |
| 1008 | Ga0307413_10457015 | 3300031824 | Bacteria | 1015 |
| 1009 | Ga0307413_10640847 | 3300031824 | Bacteria | 875 |
| 1010 | Ga0307413_10817679 | 3300031824 | Unclassified | 784 |
| 1011 | Ga0307413_11214826 | 3300031824 | Bacteria | 656 |
| 1012 | Ga0307410_10002520 | 3300031852 | Bacteria | 8857 |
| 1013 | Ga0307410_10012076 | 3300031852 | Bacteria | 4972 |
| 1014 | Ga0307410_10015315 | 3300031852 | Bacteria | 4545 |
| 1015 | Ga0307410_10022976 | 3300031852 | Bacteria | 3867 |
| 1016 | Ga0307410_10027658 | 3300031852 | Bacteria | 3587 |
| 1017 | Ga0307410_10070059 | 3300031852 | Bacteria | 2427 |
| 1018 | Ga0307410_10127016 | 3300031852 | Bacteria | 1868 |
| 1019 | Ga0307410_10249681 | 3300031852 | Bacteria | 1379 |
| 1020 | Ga0307410_10272665 | 3300031852 | Bacteria | 1324 |
| 1021 | Ga0307410_10314703 | 3300031852 | Bacteria | 1240 |
| 1022 | Ga0307410_10337316 | 3300031852 | Bacteria | 1200 |
| 1023 | Ga0307410_10344968 | 3300031852 | Bacteria | 1188 |
| 1024 | Ga0307410_10345358 | 3300031852 | Bacteria | 1187 |
| 1025 | Ga0307410_10498068 | 3300031852 | Bacteria | 1002 |
| 1026 | Ga0307410_10549744 | 3300031852 | Bacteria | 957 |
| 1027 | Ga0307410_11023698 | 3300031852 | Bacteria | 713 |
| 1028 | Ga0307410_11691523 | 3300031852 | Unclassified | 560 |
| 1029 | Ga0307406_10001688 | 3300031901 | Bacteria | 12133 |
| 1030 | Ga0307406_10002595 | 3300031901 | Bacteria | 9848 |
| 1031 | Ga0307406_10014718 | 3300031901 | Bacteria | 4506 |
| 1032 | Ga0307406_10023424 | 3300031901 | Bacteria | 3673 |
| 1033 | Ga0307406_10028708 | 3300031901 | Bacteria | 3363 |
| 1034 | Ga0307406_10043279 | 3300031901 | Bacteria | 2815 |
| 1035 | Ga0307406_10085068 | 3300031901 | Bacteria | 2114 |
| 1036 | Ga0307406_10108565 | 3300031901 | Bacteria | 1905 |
| 1037 | Ga0307406_10146070 | 3300031901 | Unclassified | 1681 |
| 1038 | Ga0307406_10230915 | 3300031901 | Bacteria | 1382 |
| 1039 | Ga0307406_10260498 | 3300031901 | Bacteria | 1312 |
| 1040 | Ga0307406_10362133 | 3300031901 | Bacteria | 1137 |
| 1041 | Ga0307406_11611758 | 3300031901 | Bacteria | 573 |
| 1042 | Ga0307407_10000201 | 3300031903 | Bacteria | 18078 |
| 1043 | Ga0307407_10004682 | 3300031903 | Bacteria | 5843 |
| 1044 | Ga0307407_10008899 | 3300031903 | Bacteria | 4640 |
| 1045 | Ga0307407_10024361 | 3300031903 | Bacteria | 3173 |
| 1046 | Ga0307407_10027368 | 3300031903 | Bacteria | 3033 |
| 1047 | Ga0307407_10085331 | 3300031903 | Bacteria | 1921 |
| 1048 | Ga0307407_10091391 | 3300031903 | Bacteria | 1866 |
| 1049 | Ga0307407_10116337 | 3300031903 | Bacteria | 1687 |
| 1050 | Ga0307407_10124907 | 3300031903 | Bacteria | 1637 |
| 1051 | Ga0307407_10333724 | 3300031903 | Bacteria | 1068 |
| 1052 | Ga0307407_10342090 | 3300031903 | Bacteria | 1057 |
| 1053 | Ga0307407_10379864 | 3300031903 | Bacteria | 1008 |
| 1054 | Ga0307407_10441069 | 3300031903 | Bacteria | 943 |
| 1055 | Ga0307407_10525226 | 3300031903 | Bacteria | 871 |
| 1056 | Ga0307407_10962072 | 3300031903 | Unclassified | 658 |
| 1057 | Ga0307412_10012476 | 3300031911 | Bacteria | 4956 |
| 1058 | Ga0307412_10028271 | 3300031911 | Bacteria | 3506 |
| 1059 | Ga0307412_10129946 | 3300031911 | Bacteria | 1828 |
| 1060 | Ga0307412_10193021 | 3300031911 | Bacteria | 1541 |
| 1061 | Ga0307412_10234054 | 3300031911 | Bacteria | 1416 |
| 1062 | Ga0307412_10398104 | 3300031911 | Bacteria | 1120 |
| 1063 | Ga0307412_11261340 | 3300031911 | Bacteria | 664 |
| 1064 | Ga0307409_100000144 | 3300031995 | Bacteria | 26764 |
| 1065 | Ga0307409_100003493 | 3300031995 | Bacteria | 8552 |
| 1066 | Ga0307409_100009411 | 3300031995 | Bacteria | 6000 |
| 1067 | Ga0307409_100009792 | 3300031995 | Bacteria | 5910 |
| 1068 | Ga0307409_100023234 | 3300031995 | Bacteria | 4291 |
| 1069 | Ga0307409_100026152 | 3300031995 | Bacteria | 4111 |
| 1070 | Ga0307409_100027599 | 3300031995 | Bacteria | 4027 |
| 1071 | Ga0307409_100033448 | 3300031995 | Bacteria | 3742 |
| 1072 | Ga0307409_100048332 | 3300031995 | Bacteria | 3236 |
| 1073 | Ga0307409_100118546 | 3300031995 | Bacteria | 2236 |
| 1074 | Ga0307409_100126080 | 3300031995 | Unclassified | 2178 |
| 1075 | Ga0307409_100186505 | 3300031995 | Bacteria | 1842 |
| 1076 | Ga0307409_100254667 | 3300031995 | Unclassified | 1607 |
| 1077 | Ga0307409_100383328 | 3300031995 | Bacteria | 1337 |
| 1078 | Ga0307409_100556156 | 3300031995 | Bacteria | 1127 |
| 1079 | Ga0307409_100717738 | 3300031995 | Bacteria | 1000 |
| 1080 | Ga0307409_100867596 | 3300031995 | Bacteria | 914 |
| 1081 | Ga0307409_101141677 | 3300031995 | Bacteria | 801 |
| 1082 | Ga0307416_100000828 | 3300032002 | Bacteria | 16247 |
| 1083 | Ga0307416_100004156 | 3300032002 | Bacteria | 8675 |
| 1084 | Ga0307416_100007355 | 3300032002 | Bacteria | 6994 |
| 1085 | Ga0307416_100012718 | 3300032002 | Bacteria | 5685 |
| 1086 | Ga0307416_100014248 | 3300032002 | Bacteria | 5438 |
| 1087 | Ga0307416_100024844 | 3300032002 | Bacteria | 4381 |
| 1088 | Ga0307416_100049239 | 3300032002 | Bacteria | 3349 |
| 1089 | Ga0307416_100073566 | 3300032002 | Bacteria | 2850 |
| 1090 | Ga0307416_100073588 | 3300032002 | Bacteria | 2850 |
| 1091 | Ga0307416_100120247 | 3300032002 | Bacteria | 2338 |
| 1092 | Ga0307416_100247873 | 3300032002 | Bacteria | 1731 |
| 1093 | Ga0307416_100356860 | 3300032002 | Bacteria | 1482 |
| 1094 | Ga0307416_100450307 | 3300032002 | Bacteria | 1340 |
| 1095 | Ga0307416_100477679 | 3300032002 | Bacteria | 1306 |
| 1096 | Ga0307416_100511350 | 3300032002 | Bacteria | 1267 |
| 1097 | Ga0307416_100735010 | 3300032002 | Bacteria | 1078 |
| 1098 | Ga0307416_101424102 | 3300032002 | Bacteria | 799 |
| 1099 | Ga0307416_102811952 | 3300032002 | Unclassified | 582 |
| 1100 | Ga0307416_103058978 | 3300032002 | Bacteria | 560 |
| 1101 | Ga0307416_103753912 | 3300032002 | Bacteria | 508 |
| 1102 | Ga0307414_10002383 | 3300032004 | Bacteria | 9831 |
| 1103 | Ga0307414_10006027 | 3300032004 | Bacteria | 6721 |
| 1104 | Ga0307414_10030309 | 3300032004 | Bacteria | 3532 |
| 1105 | Ga0307414_10043031 | 3300032004 | Bacteria | 3073 |
| 1106 | Ga0307414_10090810 | 3300032004 | Bacteria | 2268 |
| 1107 | Ga0307414_10345745 | 3300032004 | Bacteria | 1275 |
| 1108 | Ga0307414_10408267 | 3300032004 | Bacteria | 1181 |
| 1109 | Ga0307414_10426642 | 3300032004 | Bacteria | 1157 |
| 1110 | Ga0307414_10465715 | 3300032004 | Bacteria | 1112 |
| 1111 | Ga0307414_11271125 | 3300032004 | Bacteria | 682 |
| 1112 | Ga0307411_10001066 | 3300032005 | Bacteria | 10635 |
| 1113 | Ga0307411_10006929 | 3300032005 | Bacteria | 5717 |
| 1114 | Ga0307411_10007270 | 3300032005 | Bacteria | 5620 |
| 1115 | Ga0307411_10017609 | 3300032005 | Bacteria | 4077 |
| 1116 | Ga0307411_10028273 | 3300032005 | Bacteria | 3407 |
| 1117 | Ga0307411_10045742 | 3300032005 | Bacteria | 2817 |
| 1118 | Ga0307411_10062970 | 3300032005 | Bacteria | 2476 |
| 1119 | Ga0307411_10141185 | 3300032005 | Bacteria | 1776 |
| 1120 | Ga0307411_10147865 | 3300032005 | Bacteria | 1742 |
| 1121 | Ga0307411_10166152 | 3300032005 | Bacteria | 1659 |
| 1122 | Ga0307411_10208308 | 3300032005 | Bacteria | 1508 |
| 1123 | Ga0307411_10276620 | 3300032005 | Unclassified | 1334 |
| 1124 | Ga0307411_10282820 | 3300032005 | Bacteria | 1321 |
| 1125 | Ga0307411_10531822 | 3300032005 | Bacteria | 1000 |
| 1126 | Ga0307411_10645798 | 3300032005 | Bacteria | 915 |
| 1127 | Ga0307411_10663386 | 3300032005 | Bacteria | 904 |
| 1128 | Ga0307411_10672848 | 3300032005 | Bacteria | 898 |
| 1129 | Ga0307411_10773159 | 3300032005 | Bacteria | 843 |
| 1130 | Ga0307411_10858996 | 3300032005 | Bacteria | 803 |
| 1131 | Ga0307411_11345317 | 3300032005 | Unclassified | 652 |
| 1132 | Ga0307411_11551779 | 3300032005 | Bacteria | 610 |
| 1133 | Ga0307411_11809007 | 3300032005 | Bacteria | 567 |
| 1134 | Ga0307411_11845197 | 3300032005 | Bacteria | 562 |
| 1135 | Ga0307415_100000419 | 3300032126 | Bacteria | 18192 |
| 1136 | Ga0307415_100002432 | 3300032126 | Bacteria | 9294 |
| 1137 | Ga0307415_100021813 | 3300032126 | Bacteria | 3944 |
| 1138 | Ga0307415_100036475 | 3300032126 | Bacteria | 3222 |
| 1139 | Ga0307415_100041599 | 3300032126 | Bacteria | 3052 |
| 1140 | Ga0307415_100051781 | 3300032126 | Bacteria | 2788 |
| 1141 | Ga0307415_100125154 | 3300032126 | Bacteria | 1936 |
| 1142 | Ga0307415_100143241 | 3300032126 | Bacteria | 1829 |
| 1143 | Ga0307415_100459811 | 3300032126 | Bacteria | 1102 |
| 1144 | Ga0307415_100490786 | 3300032126 | Bacteria | 1071 |
| 1145 | Ga0307415_100970217 | 3300032126 | Bacteria | 788 |
| 1146 | Ga0307415_102463500 | 3300032126 | Bacteria | 512 |
| 1147 | Ga0316583_10003563 | 3300032133 | Bacteria | 5495 |
| 1148 | Ga0316585_10006893 | 3300032137 | Bacteria | 3261 |
| 1149 | Ga0316596_1143350 | 3300033541 | Unclassified | 655 |
| 1150 | Ga0373950_0167964 | 3300034818 | Bacteria | 510 |
| 1151 | Ga0373938_0040184 | 3300034957 | Unclassified | 1037 |
| 1152 | Ga0373926_0004167 | 3300035083 | Bacteria | 4716 |
| 1153 | Ga0373928_0048895 | 3300035084 | Bacteria | 993 |
| 1154 | Ga0373934_0005211 | 3300035086 | Bacteria | 4809 |
| 1155 | Ga0373934_0037374 | 3300035086 | Bacteria | 1912 |
| 1156 | Ga0373934_0040553 | 3300035086 | Bacteria | 1837 |
| 1157 | Ga0373940_0070749 | 3300035088 | Bacteria | 1015 |
| 1158 | Ga0373944_0396028 | 3300035089 | Bacteria | 532 |
| 1159 | Ga0373951_0051655 | 3300035091 | Bacteria | 1012 |
| 1160 | Ga0373952_0095406 | 3300035092 | Bacteria | 778 |
| 1161 | Ga0373923_0007123 | 3300035111 | Bacteria | 3916 |
| 1162 | Ga0373932_0198412 | 3300035112 | Bacteria | 712 |
| 1163 | Ga0373936_0011918 | 3300035113 | Bacteria | 3299 |
| 1164 | Ga0373936_0128849 | 3300035113 | Bacteria | 1086 |
| 1165 | Ga0373941_0333309 | 3300035115 | Unclassified | 613 |
| 1166 | Ga0373945_0258114 | 3300035116 | Unclassified | 738 |
| 1167 | Ga0373953_0002759 | 3300035117 | Bacteria | 5334 |
| 1168 | Ga0373953_0009331 | 3300035117 | Bacteria | 3370 |
| 1169 | Ga0373953_0568949 | 3300035117 | Bacteria | 504 |
| 1170 | Ga0373954_0057621 | 3300035118 | Bacteria | 1830 |
| 1171 | Ga0373954_0066241 | 3300035118 | Bacteria | 1710 |
| 1172 | Ga0373954_0440984 | 3300035118 | Bacteria | 644 |
| 1173 | Ga0373956_0000678 | 3300035119 | Bacteria | 13976 |
| 1174 | Ga0373956_0113697 | 3300035119 | Bacteria | 1261 |
| 1175 | Ga0373956_0548048 | 3300035119 | Unclassified | 552 |
| 1176 | Ga0373957_0099398 | 3300035120 | Bacteria | 1163 |
| 1177 | Ga0373957_0165776 | 3300035120 | Bacteria | 911 |
| 1178 | Ga0373960_0139748 | 3300035121 | Unclassified | 819 |
| 1179 | Ga0373943_0016857 | 3300035170 | Bacteria | 3338 |
| 1180 | Ga0373943_0028594 | 3300035170 | Unclassified | 2628 |
| 1181 | Ga0373946_0009275 | 3300035171 | Bacteria | 3620 |
| 1182 | Ga0373942_0342387 | 3300035207 | Unclassified | 527 |
| 1183 | Ga0373961_0059628 | 3300035241 | Bacteria | 1154 |
| 1184 | Ga0316574_0204529 | 3300035398 | Bacteria | 1268 |
| 1185 | Ga0316574_0695716 | 3300035398 | Bacteria | 624 |
| 1186 | Ga0373924_0002127 | 3300035410 | Bacteria | 6622 |
| 1187 | Ga0373924_0285833 | 3300035410 | Unclassified | 732 |
| 1188 | Ga0373931_0018182 | 3300035691 | Bacteria | 3492 |
| 1189 | Ga0373931_0018416 | 3300035691 | Bacteria | 3474 |
| 1190 | Ga0373935_0018031 | 3300035692 | Bacteria | 4290 |
| 1191 | Ga0373935_0063447 | 3300035692 | Bacteria | 2368 |
| 1192 | Ga0373935_0124591 | 3300035692 | Unclassified | 1725 |
| 1193 | Ga0373935_0378071 | 3300035692 | Bacteria | 1014 |
| 1194 | Ga0373927_0026060 | 3300035695 | Bacteria | 3821 |
| 1195 | Ga0373927_1094838 | 3300035695 | Bacteria | 525 |
| 1196 | Ga0373933_0001111 | 3300035724 | Bacteria | 16018 |
| 1197 | Ga0373933_0013654 | 3300035724 | Bacteria | 4504 |
| 1198 | Ga0373947_0002126 | 3300035725 | Bacteria | 12064 |
| 1199 | Ga0373947_0048812 | 3300035725 | Unclassified | 2540 |
| 1200 | Ga0373947_0115326 | 3300035725 | Unclassified | 1702 |
| 1201 | Ga0373937_0002914 | 3300036401 | Bacteria | 14299 |
| 1202 | Ga0373937_0065385 | 3300036401 | Bacteria | 3347 |
| 1203 | Ga0373937_0096592 | 3300036401 | Bacteria | 2740 |
| 1204 | Ga0316582_0026818 | 3300036647 | Bacteria | 3472 |
| 1205 | Ga0316582_0075578 | 3300036647 | Bacteria | 2189 |
| 1206 | Ga0316584_0009015 | 3300036712 | Bacteria | 6902 |
| 1207 | Ga0373925_0034016 | 3300037068 | Bacteria | 3756 |
| 1208 | Ga0373925_0216655 | 3300037068 | Bacteria | 1527 |
| 1209 | Ga0373925_0592715 | 3300037068 | Archaea | 913 |
| 1210 | Ga0395899_0038329 | 3300037312 | Bacteria | 3590 |
| 1211 | Ga0395900_0005143 | 3300037418 | Bacteria | 13738 |
| 1212 | Ga0395898_0365364 | 3300037466 | Bacteria | 1376 |
| 1213 | Ga0395905_0049760 | 3300037471 | Bacteria | 3928 |
| 1214 | Ga0395905_0117856 | 3300037471 | Bacteria | 2495 |
| 1215 | Ga0395905_0624983 | 3300037471 | Bacteria | 979 |
| 1216 | Ga0395905_1377214 | 3300037471 | Bacteria | 609 |
| 1217 | Ga0316581_0052652 | 3300037588 | Bacteria | 1247 |
| 1218 | Ga0436364_0287855 | 3300037853 | Bacteria | 1071 |
| 1219 | Ga0395901_0003407 | 3300038443 | Bacteria | 16018 |
| 1220 | Ga0395901_0694213 | 3300038443 | Bacteria | 1016 |
| 1221 | Ga0395901_1490842 | 3300038443 | Unclassified | 632 |
| 1222 | Ga0242420_024104 | 3300038996 | Bacteria | 1101 |
| 1223 | Ga0242420_054477 | 3300038996 | Bacteria | 787 |
| 1224 | Ga0436365_0290864 | 3300039437 | Bacteria | 776 |
| 1225 | Ga0436365_0304609 | 3300039437 | Bacteria | 856 |
| 1226 | Ga0436365_1159467 | 3300039437 | Unclassified | 506 |
| 1227 | Ga0436365_1602166 | 3300039437 | Bacteria | 18827 |
| 1228 | Ga0436363_0390436 | 3300039450 | Bacteria | 674 |
| 1229 | Ga0436363_0732405 | 3300039450 | Bacteria | 543 |
| 1230 | Ga0439439_0021339 | 3300041406 | Bacteria | 1614 |
| 1231 | Ga0451839_1205934 | 3300041496 | Bacteria | 701 |
| 1232 | Ga0451853_1987835 | 3300041512 | Bacteria | 543 |
| 1233 | Ga0439448_0040558 | 3300042005 | Bacteria | 1504 |
| 1234 | Ga0439457_103357 | 3300042014 | Bacteria | 665 |
| 1235 | Ga0439462_0132713 | 3300042015 | Unclassified | 696 |
| 1236 | Ga0439446_0184978 | 3300042156 | Unclassified | 698 |
| 1237 | Ga0451577_0003975 | 3300042876 | Bacteria | 15941 |
| 1238 | Ga0451577_0076398 | 3300042876 | Bacteria | 2986 |
| 1239 | Ga0451577_0233619 | 3300042876 | Bacteria | 1663 |
| 1240 | Ga0451577_0278304 | 3300042876 | Unclassified | 1516 |
| 1241 | Ga0453683_0083881 | 3300044673 | Bacteria | 1997 |
| 1242 | Ga0453683_1216232 | 3300044673 | Bacteria | 505 |
| 1243 | Ga0466965_0319755 | 3300044683 | Bacteria | 845 |
| 1244 | Ga0466966_0310517 | 3300044684 | Bacteria | 948 |
| 1245 | Ga0466966_0984788 | 3300044684 | Bacteria | 509 |
| 1246 | Ga0466961_0148652 | 3300044693 | Bacteria | 1464 |
| 1247 | Ga0466964_0177363 | 3300044706 | Bacteria | 1008 |
| 1248 | Ga0466964_0240783 | 3300044706 | Bacteria | 887 |
| 1249 | Ga0466964_0355081 | 3300044706 | Bacteria | 754 |
| 1250 | Ga0453684_1058605 | 3300044712 | Bacteria | 859 |
| 1251 | Ga0466971_0083762 | 3300044719 | Bacteria | 1456 |
| 1252 | Ga0466971_0634884 | 3300044719 | Bacteria | 534 |
| 1253 | Ga0466970_0236236 | 3300044765 | Bacteria | 1022 |
| 1254 | Ga0466957_1006802 | 3300044842 | Unclassified | 599 |
| 1255 | Ga0466957_1282518 | 3300044842 | Bacteria | 531 |
| 1256 | Ga0451576_0042077 | 3300045051 | Bacteria | 4824 |
| 1257 | Ga0451576_0116352 | 3300045051 | Bacteria | 2784 |
| 1258 | Ga0451576_0321037 | 3300045051 | Bacteria | 1620 |
| 1259 | Ga0451576_0781793 | 3300045051 | Bacteria | 1003 |
| 1260 | Ga0451576_1522734 | 3300045051 | Unclassified | 695 |
| 1261 | Ga0466958_0130129 | 3300045836 | Bacteria | 1580 |
| 1262 | Ga0466958_0334514 | 3300045836 | Bacteria | 974 |
| 1263 | Ga0466967_0250970 | 3300045976 | Bacteria | 1690 |
| 1264 | Ga0466967_0533636 | 3300045976 | Bacteria | 1154 |
| 1265 | Ga0466967_0777573 | 3300045976 | Unclassified | 950 |
| 1266 | Ga0466967_2175858 | 3300045976 | Unclassified | 551 |
| 1267 | Ga0495592_0002525 | 3300046454 | Bacteria | 12917 |
| 1268 | Ga0495592_0365590 | 3300046454 | Bacteria | 921 |
| 1269 | Ga0495592_0902943 | 3300046454 | Bacteria | 519 |
| 1270 | Ga0495603_0015387 | 3300046455 | Bacteria | 4628 |
| 1271 | Ga0495603_0046197 | 3300046455 | Bacteria | 2595 |
| 1272 | Ga0495603_0238765 | 3300046455 | Unclassified | 1047 |
| 1273 | Ga0495629_0003115 | 3300046459 | Bacteria | 12567 |
| 1274 | Ga0495629_0025075 | 3300046459 | Bacteria | 4241 |
| 1275 | Ga0495629_0040407 | 3300046459 | Bacteria | 3281 |
| 1276 | Ga0495629_0303378 | 3300046459 | Bacteria | 1093 |
| 1277 | Ga0495629_0618441 | 3300046459 | Bacteria | 723 |
| 1278 | Ga0495629_1112862 | 3300046459 | Bacteria | 510 |
| 1279 | Ga0495651_0009970 | 3300046462 | Bacteria | 7304 |
| 1280 | Ga0495651_0017083 | 3300046462 | Bacteria | 5622 |
| 1281 | Ga0495651_0124418 | 3300046462 | Bacteria | 1890 |
| 1282 | Ga0495651_0644771 | 3300046462 | Bacteria | 664 |
| 1283 | Ga0495653_0000547 | 3300046463 | Bacteria | 28742 |
| 1284 | Ga0495653_0006042 | 3300046463 | Bacteria | 9914 |
| 1285 | Ga0495653_0636764 | 3300046463 | Bacteria | 652 |
| 1286 | Ga0495580_0001189 | 3300046472 | Bacteria | 22911 |
| 1287 | Ga0495580_0005504 | 3300046472 | Bacteria | 10461 |
| 1288 | Ga0495580_0109372 | 3300046472 | Bacteria | 1919 |
| 1289 | Ga0495580_0614116 | 3300046472 | Unclassified | 718 |
| 1290 | Ga0495580_1020227 | 3300046472 | Unclassified | 526 |
| 1291 | Ga0495582_0013598 | 3300046473 | Bacteria | 4481 |
| 1292 | Ga0495582_0039450 | 3300046473 | Bacteria | 2600 |
| 1293 | Ga0495582_0088607 | 3300046473 | Bacteria | 1724 |
| 1294 | Ga0495582_0151791 | 3300046473 | Bacteria | 1315 |
| 1295 | Ga0495582_0762531 | 3300046473 | Unclassified | 560 |
| 1296 | Ga0495639_0000549 | 3300046475 | Bacteria | 17446 |
| 1297 | Ga0495639_0011675 | 3300046475 | Bacteria | 3790 |
| 1298 | Ga0495639_0316237 | 3300046475 | Unclassified | 780 |
| 1299 | Ga0495662_0417003 | 3300046476 | Unclassified | 659 |
| 1300 | Ga0495664_0281001 | 3300046477 | Bacteria | 1006 |
| 1301 | Ga0495664_0714430 | 3300046477 | Bacteria | 592 |
| 1302 | Ga0495585_0160087 | 3300046492 | Unclassified | 1169 |
| 1303 | Ga0495594_0011878 | 3300046499 | Bacteria | 4531 |
| 1304 | Ga0495594_0145232 | 3300046499 | Bacteria | 1346 |
| 1305 | Ga0495607_0370303 | 3300046501 | Unclassified | 657 |
| 1306 | Ga0495608_0000405 | 3300046511 | Bacteria | 30184 |
| 1307 | Ga0495608_0028611 | 3300046511 | Unclassified | 3787 |
| 1308 | Ga0495618_0153235 | 3300046514 | Bacteria | 1472 |
| 1309 | Ga0495628_0000494 | 3300046516 | Bacteria | 36135 |
| 1310 | Ga0495628_0040700 | 3300046516 | Bacteria | 3712 |
| 1311 | Ga0495628_0122008 | 3300046516 | Unclassified | 1998 |
| 1312 | Ga0495630_0002236 | 3300046517 | Bacteria | 13469 |
| 1313 | Ga0495630_0003849 | 3300046517 | Bacteria | 10477 |
| 1314 | Ga0495630_0015750 | 3300046517 | Bacteria | 5524 |
| 1315 | Ga0495630_0085082 | 3300046517 | Bacteria | 2387 |
| 1316 | Ga0495663_0099594 | 3300046525 | Bacteria | 956 |
| 1317 | Ga0495666_0050611 | 3300046526 | Bacteria | 1997 |
| 1318 | Ga0495652_0008315 | 3300046529 | Bacteria | 9480 |
| 1319 | Ga0495652_0042274 | 3300046529 | Bacteria | 3930 |
| 1320 | Ga0495665_0000358 | 3300046531 | Bacteria | 23104 |
| 1321 | Ga0495665_0003130 | 3300046531 | Bacteria | 8950 |
| 1322 | Ga0495665_0075851 | 3300046531 | Bacteria | 1770 |
| 1323 | Ga0495665_0593238 | 3300046531 | Bacteria | 554 |
| 1324 | Ga0495640_0359579 | 3300046533 | Bacteria | 898 |
| 1325 | Ga0495586_0004190 | 3300046535 | Bacteria | 7724 |
| 1326 | Ga0495587_0000269 | 3300046536 | Bacteria | 37262 |
| 1327 | Ga0495587_0000334 | 3300046536 | Bacteria | 33589 |
| 1328 | Ga0495587_0001945 | 3300046536 | Bacteria | 13762 |
| 1329 | Ga0495587_0124263 | 3300046536 | Unclassified | 1477 |
| 1330 | Ga0495621_0210913 | 3300046539 | Bacteria | 784 |
| 1331 | Ga0495621_0343511 | 3300046539 | Bacteria | 625 |
| 1332 | Ga0495645_0005088 | 3300046543 | Bacteria | 9010 |
| 1333 | Ga0495645_0087646 | 3300046543 | Bacteria | 2227 |
| 1334 | Ga0495622_0022950 | 3300046557 | Bacteria | 2908 |
| 1335 | Ga0495622_0225599 | 3300046557 | Bacteria | 829 |
| 1336 | Ga0495633_0152348 | 3300046558 | Bacteria | 1068 |
| 1337 | Ga0495667_0000504 | 3300046559 | Bacteria | 24895 |
| 1338 | Ga0495667_0001705 | 3300046559 | Bacteria | 14587 |
| 1339 | Ga0495667_0005981 | 3300046559 | Bacteria | 8228 |
| 1340 | Ga0495634_0830558 | 3300046642 | Bacteria | 526 |
| 1341 | Ga0495635_0000200 | 3300046663 | Bacteria | 37911 |
| 1342 | Ga0495635_0354627 | 3300046663 | Unclassified | 978 |
| 1343 | Ga0495659_0150507 | 3300046664 | Bacteria | 934 |
| 1344 | Ga0495659_0328021 | 3300046664 | Unclassified | 651 |
| 1345 | Ga0495659_0379927 | 3300046664 | Bacteria | 607 |
| 1346 | Ga0495588_0012498 | 3300046674 | Bacteria | 4015 |
| 1347 | Ga0495588_0023908 | 3300046674 | Bacteria | 3031 |
| 1348 | Ga0495657_0011939 | 3300046675 | Bacteria | 6471 |
| 1349 | Ga0495657_0464029 | 3300046675 | Unclassified | 741 |
| 1350 | Ga0495657_0876098 | 3300046675 | Unclassified | 511 |
| 1351 | Ga0495599_0002011 | 3300046678 | Bacteria | 11757 |
| 1352 | Ga0495599_0021680 | 3300046678 | Bacteria | 4008 |
| 1353 | Ga0495599_0082661 | 3300046678 | Bacteria | 2006 |
| 1354 | Ga0495623_0000156 | 3300046679 | Bacteria | 42279 |
| 1355 | Ga0495623_0003024 | 3300046679 | Bacteria | 11067 |
| 1356 | Ga0495623_0052162 | 3300046679 | Bacteria | 2585 |
| 1357 | Ga0495646_0038350 | 3300046680 | Bacteria | 2959 |
| 1358 | Ga0495658_0001403 | 3300046683 | Bacteria | 12652 |
| 1359 | Ga0495658_0048011 | 3300046683 | Bacteria | 2406 |
| 1360 | Ga0495658_0251892 | 3300046683 | Bacteria | 1111 |
| 1361 | Ga0495658_0357189 | 3300046683 | Unclassified | 929 |
| 1362 | Ga0495658_0662063 | 3300046683 | Bacteria | 669 |
| 1363 | Ga0495613_0102611 | 3300046689 | Bacteria | 2065 |
| 1364 | Ga0495613_0168100 | 3300046689 | Bacteria | 1557 |
| 1365 | Ga0495613_0312533 | 3300046689 | Bacteria | 1086 |
| 1366 | Ga0495613_0387039 | 3300046689 | Unclassified | 955 |
| 1367 | Ga0495613_0510664 | 3300046689 | Unclassified | 808 |
| 1368 | Ga0495670_0290462 | 3300046691 | Bacteria | 875 |
| 1369 | Ga0495600_0003971 | 3300046809 | Bacteria | 8786 |
| 1370 | Ga0495581_0000659 | 3300047315 | Bacteria | 18109 |
| 1371 | Ga0495581_0016943 | 3300047315 | Bacteria | 4234 |
| 1372 | Ga0495581_0051860 | 3300047315 | Bacteria | 2369 |
| 1373 | Ga0495581_0564619 | 3300047315 | Unclassified | 660 |
| 1374 | Ga0495581_0636522 | 3300047315 | Bacteria | 617 |
| 1375 | Ga0495604_0004192 | 3300047317 | Bacteria | 11427 |
| 1376 | Ga0495604_0025411 | 3300047317 | Bacteria | 4720 |
| 1377 | Ga0495604_0939967 | 3300047317 | Unclassified | 538 |
| 1378 | Ga0495636_0095234 | 3300047318 | Unclassified | 1297 |
| 1379 | Ga0495674_0007567 | 3300047319 | Bacteria | 10378 |
| 1380 | Ga0495674_0032263 | 3300047319 | Bacteria | 4752 |
| 1381 | Ga0495674_0043600 | 3300047319 | Bacteria | 3993 |
| 1382 | Ga0495674_0894607 | 3300047319 | Bacteria | 686 |
| 1383 | Ga0495680_0004788 | 3300047322 | Bacteria | 12847 |
| 1384 | Ga0495680_0791030 | 3300047322 | Bacteria | 620 |
| 1385 | Ga0495675_0002012 | 3300047444 | Bacteria | 12138 |
| 1386 | Ga0495675_0057891 | 3300047444 | Bacteria | 2458 |
| 1387 | Ga0495675_0070071 | 3300047444 | Bacteria | 2213 |
| 1388 | Ga0495675_0075070 | 3300047444 | Bacteria | 2130 |
| 1389 | Ga0495675_0402624 | 3300047444 | Unclassified | 798 |
| 1390 | Ga0495675_0837854 | 3300047444 | Unclassified | 507 |
| 1391 | Ga0495684_0001442 | 3300047471 | Bacteria | 19043 |
| 1392 | Ga0495684_0024474 | 3300047471 | Bacteria | 4647 |
| 1393 | Ga0495684_0063191 | 3300047471 | Bacteria | 2815 |
| 1394 | Ga0495593_0000356 | 3300047673 | Bacteria | 25268 |
| 1395 | Ga0495593_0111707 | 3300047673 | Bacteria | 1395 |
| 1396 | Ga0495593_0133358 | 3300047673 | Bacteria | 1260 |
| 1397 | Ga0495593_0509573 | 3300047673 | Bacteria | 603 |
| 1398 | Ga0495602_0003996 | 3300048088 | Bacteria | 15368 |
| 1399 | Ga0495602_0039288 | 3300048088 | Bacteria | 4360 |
| 1400 | Ga0495602_0133381 | 3300048088 | Bacteria | 1977 |
| 1401 | Ga0495614_0000638 | 3300048089 | Bacteria | 14664 |
| 1402 | Ga0495614_0279277 | 3300048089 | Unclassified | 769 |
| 1403 | Ga0495615_0073472 | 3300048090 | Bacteria | 926 |
| 1404 | Ga0496100_0073025 | 3300048903 | Bacteria | 2295 |
| 1405 | Ga0496100_0171604 | 3300048903 | Bacteria | 1562 |
| 1406 | Ga0496100_0202865 | 3300048903 | Bacteria | 1446 |
| 1407 | Ga0496100_0835443 | 3300048903 | Unclassified | 722 |
| 1408 | Ga0496100_0848128 | 3300048903 | Bacteria | 717 |
| 1409 | Ga0496100_1059323 | 3300048903 | Unclassified | 639 |
| 1410 | Ga0496101_0038807 | 3300048904 | Bacteria | 3384 |
| 1411 | Ga0496101_0077774 | 3300048904 | Bacteria | 2446 |
| 1412 | Ga0496101_1050509 | 3300048904 | Bacteria | 640 |
| 1413 | Ga0496102_0067085 | 3300048905 | Bacteria | 3290 |
| 1414 | Ga0496102_0134419 | 3300048905 | Bacteria | 2317 |
| 1415 | Ga0496102_0451550 | 3300048905 | Unclassified | 1206 |
| 1416 | Ga0496102_0749520 | 3300048905 | Bacteria | 899 |
| 1417 | Ga0496102_1123092 | 3300048905 | Bacteria | 706 |
| 1418 | Ga0496103_0181794 | 3300048906 | Unclassified | 1351 |
| 1419 | Ga0496103_0431769 | 3300048906 | Bacteria | 845 |
| 1420 | Ga0496104_0004744 | 3300048907 | Bacteria | 11832 |
| 1421 | Ga0496104_0183124 | 3300048907 | Unclassified | 2005 |
| 1422 | Ga0496104_0623643 | 3300048907 | Bacteria | 988 |
| 1423 | Ga0496105_0572812 | 3300048908 | Bacteria | 879 |
| 1424 | Ga0496106_0012262 | 3300048909 | Bacteria | 6328 |
| 1425 | Ga0496106_0053593 | 3300048909 | Bacteria | 3047 |
| 1426 | Ga0496106_0467735 | 3300048909 | Bacteria | 1013 |
| 1427 | Ga0496106_0644154 | 3300048909 | Bacteria | 847 |
| 1428 | Ga0496106_0649088 | 3300048909 | Bacteria | 843 |
| 1429 | Ga0496107_0177846 | 3300048910 | Bacteria | 1580 |
| 1430 | Ga0496107_0294105 | 3300048910 | Bacteria | 1209 |
| 1431 | Ga0496108_0005237 | 3300048911 | Bacteria | 10474 |
| 1432 | Ga0496108_0017435 | 3300048911 | Bacteria | 5876 |
| 1433 | Ga0496108_0180869 | 3300048911 | Bacteria | 1826 |
| 1434 | Ga0496108_0820892 | 3300048911 | Unclassified | 801 |
| 1435 | Ga0496109_0007523 | 3300048912 | Bacteria | 9228 |
| 1436 | Ga0496109_0071352 | 3300048912 | Bacteria | 3188 |
| 1437 | Ga0496109_0382259 | 3300048912 | Bacteria | 1330 |
| 1438 | Ga0496109_2049924 | 3300048912 | Bacteria | 504 |
| 1439 | Ga0496110_0029147 | 3300048913 | Bacteria | 4747 |
| 1440 | Ga0496110_0080168 | 3300048913 | Bacteria | 2908 |
| 1441 | Ga0496111_0032614 | 3300048914 | Bacteria | 3714 |
| 1442 | Ga0496111_0115469 | 3300048914 | Bacteria | 1979 |
| 1443 | Ga0496112_0001950 | 3300048915 | Bacteria | 16300 |
| 1444 | Ga0496112_0022068 | 3300048915 | Bacteria | 6062 |
| 1445 | Ga0496112_0889592 | 3300048915 | Bacteria | 813 |
| 1446 | Ga0496113_0000769 | 3300048916 | Bacteria | 16520 |
| 1447 | Ga0496113_0068922 | 3300048916 | Bacteria | 2685 |
| 1448 | Ga0496113_0116662 | 3300048916 | Bacteria | 2084 |
| 1449 | Ga0496114_0134245 | 3300048917 | Bacteria | 2139 |
| 1450 | Ga0496114_0384593 | 3300048917 | Bacteria | 1242 |
| 1451 | Ga0496115_0004680 | 3300048918 | Bacteria | 9915 |
| 1452 | Ga0496115_0215545 | 3300048918 | Unclassified | 1585 |
| 1453 | Ga0501306_036833 | 3300049127 | Unclassified | 747 |
| 1454 | Ga0501309_062896 | 3300049129 | Bacteria | 600 |
| 1455 | Ga0501304_027104 | 3300049160 | Bacteria | 594 |
| 1456 | Ga0501290_016941 | 3300049513 | Bacteria | 974 |
| 1457 | Ga0501291_039674 | 3300049514 | Unclassified | 824 |
| 1458 | Ga0501294_011442 | 3300049517 | Bacteria | 883 |
| 1459 | Ga0501297_044363 | 3300049520 | Bacteria | 636 |
| 1460 | Ga0501298_059127 | 3300049521 | Bacteria | 809 |
| 1461 | Ga0501298_113859 | 3300049521 | Bacteria | 630 |
| 1462 | Ga0501299_123283 | 3300049522 | Bacteria | 627 |
| 1463 | Ga0501299_157296 | 3300049522 | Bacteria | 578 |
| 1464 | Ga0501311_048452 | 3300049527 | Bacteria | 661 |
| 1465 | Ga0501311_058505 | 3300049527 | Bacteria | 618 |
| 1466 | Ga0501313_027753 | 3300049529 | Bacteria | 724 |
| 1467 | Ga0501314_036812 | 3300049530 | Bacteria | 560 |
| 1468 | Ga0501315_102951 | 3300049531 | Unclassified | 506 |
| 1469 | Ga0501316_045992 | 3300049532 | Bacteria | 619 |
| 1470 | Ga0501317_080926 | 3300049533 | Bacteria | 562 |
| 1471 | Ga0501323_043397 | 3300049539 | Bacteria | 665 |
| 1472 | Ga0501323_065499 | 3300049539 | Bacteria | 574 |
| 1473 | Ga0501325_027581 | 3300049541 | Bacteria | 634 |
| 1474 | Ga0501340_016227 | 3300049556 | Bacteria | 593 |
| 1475 | Ga0501340_026915 | 3300049556 | Bacteria | 507 |
| 1476 | Ga0501032_0043085 | 3300049569 | Bacteria | 3059 |
| 1477 | Ga0501032_0160958 | 3300049569 | Bacteria | 1474 |
| 1478 | Ga0501033_0031074 | 3300049570 | Bacteria | 4015 |
| 1479 | Ga0501034_1216412 | 3300049571 | Bacteria | 632 |
| 1480 | Ga0501036_0038635 | 3300049572 | Bacteria | 4040 |
| 1481 | Ga0501036_0200401 | 3300049572 | Bacteria | 1679 |
| 1482 | Ga0501037_0241493 | 3300049573 | Bacteria | 1266 |
| 1483 | Ga0501038_0108158 | 3300049574 | Bacteria | 2306 |
| 1484 | Ga0501038_0581194 | 3300049574 | Bacteria | 849 |
| 1485 | Ga0501039_0160910 | 3300049575 | Bacteria | 1765 |
| 1486 | Ga0501040_1191822 | 3300049576 | Bacteria | 553 |
| 1487 | Ga0501041_0073333 | 3300049577 | Bacteria | 2104 |
| 1488 | Ga0501041_0134378 | 3300049577 | Bacteria | 1541 |
| 1489 | Ga0501041_0668060 | 3300049577 | Unclassified | 664 |
| 1490 | Ga0501042_0144495 | 3300049578 | Bacteria | 1715 |
| 1491 | Ga0501042_0244581 | 3300049578 | Bacteria | 1294 |
| 1492 | Ga0501043_0048272 | 3300049579 | Bacteria | 3347 |
| 1493 | Ga0501043_0108258 | 3300049579 | Bacteria | 2183 |
| 1494 | Ga0501046_0133310 | 3300049580 | Bacteria | 1883 |
| 1495 | Ga0501046_0945160 | 3300049580 | Bacteria | 600 |
| 1496 | Ga0501047_0216687 | 3300049581 | Bacteria | 1771 |
| 1497 | Ga0501047_0243318 | 3300049581 | Bacteria | 1649 |
| 1498 | Ga0501067_0000353 | 3300049583 | Bacteria | 25052 |
| 1499 | Ga0501067_0044515 | 3300049583 | Bacteria | 2465 |
| 1500 | Ga0501067_0257517 | 3300049583 | Unclassified | 971 |
| 1501 | Ga0501067_0334725 | 3300049583 | Bacteria | 843 |
| 1502 | Ga0501068_0001339 | 3300049584 | Bacteria | 13056 |
| 1503 | Ga0501068_0084626 | 3300049584 | Unclassified | 1951 |
| 1504 | Ga0501068_0831386 | 3300049584 | Bacteria | 606 |
| 1505 | Ga0501069_0026566 | 3300049585 | Bacteria | 3170 |
| 1506 | Ga0501069_0032090 | 3300049585 | Unclassified | 2891 |
| 1507 | Ga0501069_0032461 | 3300049585 | Unclassified | 2874 |
| 1508 | Ga0501069_0166828 | 3300049585 | Bacteria | 1269 |
| 1509 | Ga0501070_0000192 | 3300049586 | Bacteria | 57359 |
| 1510 | Ga0501070_0123099 | 3300049586 | Bacteria | 2143 |
| 1511 | Ga0501070_0137205 | 3300049586 | Unclassified | 2020 |
| 1512 | Ga0501070_0168786 | 3300049586 | Bacteria | 1803 |
| 1513 | Ga0501070_0369431 | 3300049586 | Bacteria | 1163 |
| 1514 | Ga0501070_0726126 | 3300049586 | Bacteria | 784 |
| 1515 | Ga0501071_0000678 | 3300049587 | Bacteria | 17791 |
| 1516 | Ga0501071_0325048 | 3300049587 | Bacteria | 1168 |
| 1517 | Ga0501071_0591982 | 3300049587 | Bacteria | 853 |
| 1518 | Ga0501071_0796005 | 3300049587 | Unclassified | 729 |
| 1519 | Ga0501072_0009721 | 3300049588 | Bacteria | 7315 |
| 1520 | Ga0501072_0078699 | 3300049588 | Bacteria | 2611 |
| 1521 | Ga0501072_0409368 | 3300049588 | Bacteria | 1076 |
| 1522 | Ga0501072_0962943 | 3300049588 | Bacteria | 666 |
| 1523 | Ga0501072_1102293 | 3300049588 | Bacteria | 618 |
| 1524 | Ga0501072_1230604 | 3300049588 | Bacteria | 581 |
| 1525 | Ga0501073_0000949 | 3300049589 | Bacteria | 20906 |
| 1526 | Ga0501073_0631350 | 3300049589 | Bacteria | 739 |
| 1527 | Ga0501073_0790902 | 3300049589 | Bacteria | 654 |
| 1528 | Ga0501074_0000171 | 3300049590 | Bacteria | 34937 |
| 1529 | Ga0501074_0368537 | 3300049590 | Bacteria | 1019 |
| 1530 | Ga0501076_0149239 | 3300049592 | Bacteria | 1901 |
| 1531 | Ga0501076_0194593 | 3300049592 | Bacteria | 1655 |
| 1532 | Ga0501202_079250 | 3300049652 | Bacteria | 769 |
| 1533 | Ga0501206_044105 | 3300049653 | Unclassified | 695 |
| 1534 | Ga0501211_051127 | 3300049658 | Bacteria | 513 |
| 1535 | Ga0501216_079627 | 3300049660 | Bacteria | 691 |
| 1536 | Ga0501216_133714 | 3300049660 | Unclassified | 577 |
| 1537 | Ga0501217_042743 | 3300049661 | Unclassified | 1158 |
| 1538 | Ga0501217_066451 | 3300049661 | Bacteria | 973 |
| 1539 | Ga0501217_090548 | 3300049661 | Bacteria | 858 |
| 1540 | Ga0501217_201734 | 3300049661 | Bacteria | 620 |
| 1541 | Ga0501223_050772 | 3300049663 | Bacteria | 805 |
| 1542 | Ga0501227_041230 | 3300049665 | Bacteria | 1141 |
| 1543 | Ga0501230_029252 | 3300049667 | Bacteria | 1017 |
| 1544 | Ga0501239_036423 | 3300049672 | Bacteria | 665 |
| 1545 | Ga0501242_003701 | 3300049674 | Bacteria | 1666 |
| 1546 | Ga0501243_014106 | 3300049675 | Bacteria | 1274 |
| 1547 | Ga0501243_072468 | 3300049675 | Bacteria | 657 |
| 1548 | Ga0501248_012725 | 3300049678 | Bacteria | 778 |
| 1549 | Ga0501249_006910 | 3300049679 | Bacteria | 2339 |
| 1550 | Ga0501249_014954 | 3300049679 | Bacteria | 1657 |
| 1551 | Ga0501256_002047 | 3300049685 | Bacteria | 1571 |
| 1552 | Ga0501257_025964 | 3300049686 | Bacteria | 1396 |
| 1553 | Ga0501257_034172 | 3300049686 | Unclassified | 1234 |
| 1554 | Ga0501261_097815 | 3300049690 | Unclassified | 554 |
| 1555 | Ga0501225_0104002 | 3300049705 | Bacteria | 832 |
| 1556 | Ga0501245_027410 | 3300049708 | Bacteria | 924 |
| 1557 | Ga0501079_0076548 | 3300049741 | Bacteria | 2588 |
| 1558 | Ga0501079_0142055 | 3300049741 | Bacteria | 1870 |
| 1559 | Ga0501079_0218931 | 3300049741 | Bacteria | 1487 |
| 1560 | Ga0501080_0000060 | 3300049742 | Bacteria | 71292 |
| 1561 | Ga0501080_0005735 | 3300049742 | Bacteria | 11107 |
| 1562 | Ga0501080_0111578 | 3300049742 | Bacteria | 2535 |
| 1563 | Ga0501080_0247391 | 3300049742 | Bacteria | 1626 |
| 1564 | Ga0501081_0337820 | 3300049743 | Bacteria | 1109 |
| 1565 | Ga0501081_0376070 | 3300049743 | Bacteria | 1049 |
| 1566 | Ga0501081_0931676 | 3300049743 | Bacteria | 655 |
| 1567 | Ga0501083_0008037 | 3300049744 | Bacteria | 7464 |
| 1568 | Ga0501083_0529860 | 3300049744 | Bacteria | 767 |
| 1569 | Ga0501264_006568 | 3300049761 | Bacteria | 1073 |
| 1570 | Ga0501268_001006 | 3300049765 | Bacteria | 3352 |
| 1571 | Ga0501268_045841 | 3300049765 | Bacteria | 835 |
| 1572 | Ga0501272_005087 | 3300049769 | Bacteria | 1377 |
| 1573 | Ga0501273_005428 | 3300049770 | Bacteria | 1439 |
| 1574 | Ga0501273_045094 | 3300049770 | Bacteria | 662 |
| 1575 | Ga0501275_011114 | 3300049772 | Bacteria | 972 |
| 1576 | Ga0501275_042240 | 3300049772 | Bacteria | 643 |
| 1577 | Ga0501276_019420 | 3300049773 | Bacteria | 640 |
| 1578 | Ga0501283_085767 | 3300049779 | Bacteria | 598 |
| 1579 | Ga0501044_0006673 | 3300049823 | Bacteria | 12723 |
| 1580 | Ga0501044_0384435 | 3300049823 | Bacteria | 1318 |
| 1581 | Ga0501045_0059366 | 3300049824 | Bacteria | 2802 |
| 1582 | Ga0501045_0457465 | 3300049824 | Bacteria | 948 |
| 1583 | Ga0501204_040726 | 3300049850 | Bacteria | 680 |
| 1584 | Ga0501220_08404 | 3300049852 | Bacteria | 543 |
| 1585 | nmdc:mga05p37_1158346_c1 | 3300050507 | Bacteria | 803 |
| 1586 | nmdc:mga05p37_2129497_c1 | 3300050507 | Unclassified | 524 |
| 1587 | nmdc:mga05p37_24458_c1 | 3300050507 | Bacteria | 2422 |
| 1588 | nmdc:mga05p37_259528_c1 | 3300050507 | Bacteria | 2080 |
| 1589 | nmdc:mga05p37_313439_c1 | 3300050507 | Bacteria | 1859 |
| 1590 | nmdc:mga05p37_328502_c1 | 3300050507 | Bacteria | 1807 |
| 1591 | nmdc:mga05p37_372223_c1 | 3300050507 | Bacteria | 1676 |
| 1592 | nmdc:mga05p37_81382_c1 | 3300050507 | Bacteria | 3989 |
| 1593 | nmdc:mga05p37_82134_c1 | 3300050507 | Bacteria | 3970 |
| 1594 | nmdc:mga05p37_830499_c1 | 3300050507 | Bacteria | 1006 |
| 1595 | nmdc:mga09592_132413_c1 | 3300050508 | Bacteria | 2146 |
| 1596 | nmdc:mga09592_132896_c1 | 3300050508 | Unclassified | 2142 |
| 1597 | nmdc:mga09592_216657_c1 | 3300050508 | Bacteria | 1659 |
| 1598 | nmdc:mga09592_72535_c1 | 3300050508 | Bacteria | 2923 |
| 1599 | nmdc:mga0qj67_10094_c1 | 3300050509 | Bacteria | 7046 |
| 1600 | nmdc:mga0qj67_1478095_c1 | 3300050509 | Unclassified | 523 |
| 1601 | nmdc:mga0qj67_18195_c1 | 3300050509 | Bacteria | 5353 |
| 1602 | nmdc:mga0qj67_3022_c1 | 3300050509 | Bacteria | 12093 |
| 1603 | nmdc:mga0qj67_3465_c1 | 3300050509 | Bacteria | 11369 |
| 1604 | nmdc:mga0qj67_37040_c1 | 3300050509 | Unclassified | 3819 |
| 1605 | nmdc:mga0qj67_505202_c1 | 3300050509 | Unclassified | 972 |
| 1606 | nmdc:mga0qj67_52160_c1 | 3300050509 | Bacteria | 3236 |
| 1607 | nmdc:mga06r32_139003_c1 | 3300050510 | Bacteria | 2404 |
| 1608 | nmdc:mga06r32_1637814_c1 | 3300050510 | Bacteria | 581 |
| 1609 | nmdc:mga06r32_186579_c1 | 3300050510 | Bacteria | 2061 |
| 1610 | nmdc:mga06r32_363451_c1 | 3300050510 | Bacteria | 1431 |
| 1611 | nmdc:mga06r32_406801_c1 | 3300050510 | Bacteria | 1343 |
| 1612 | nmdc:mga06r32_533345_c1 | 3300050510 | Bacteria | 1149 |
| 1613 | nmdc:mga06r32_712109_c1 | 3300050510 | Unclassified | 969 |
| 1614 | nmdc:mga06r32_73470_c1 | 3300050510 | Bacteria | 3313 |
| 1615 | nmdc:mga06r32_77166_c1 | 3300050510 | Bacteria | 3236 |
| 1616 | nmdc:mga06r32_812426_c1 | 3300050510 | Unclassified | 895 |
| 1617 | nmdc:mga08y16_1335218_c1 | 3300050511 | Bacteria | 682 |
| 1618 | nmdc:mga08y16_345174_c1 | 3300050511 | Bacteria | 1530 |
| 1619 | nmdc:mga08y16_479660_c1 | 3300050511 | Bacteria | 1266 |
| 1620 | nmdc:mga08y16_560798_c1 | 3300050511 | Bacteria | 1155 |
| 1621 | nmdc:mga08y16_9037_c1 | 3300050511 | Bacteria | 10459 |
| 1622 | nmdc:mga0n895_1454242_c1 | 3300050512 | Bacteria | 653 |
| 1623 | nmdc:mga0n895_1552889_c1 | 3300050512 | Bacteria | 627 |
| 1624 | nmdc:mga0n895_24093_c1 | 3300050512 | Bacteria | 5731 |
| 1625 | nmdc:mga0n895_40283_c1 | 3300050512 | Bacteria | 4537 |
| 1626 | nmdc:mga0n895_42112_c1 | 3300050512 | Bacteria | 4442 |
| 1627 | nmdc:mga0n895_753427_c1 | 3300050512 | Bacteria | 967 |
| 1628 | nmdc:mga0n895_770868_c1 | 3300050512 | Bacteria | 954 |
| 1629 | nmdc:mga0rr50_196370_c1 | 3300050513 | Bacteria | 1656 |
| 1630 | nmdc:mga0rr50_545513_c1 | 3300050513 | Bacteria | 987 |
| 1631 | nmdc:mga0rr50_820594_c1 | 3300050513 | Bacteria | 793 |
| 1632 | nmdc:mga08x19_12152_c1 | 3300050514 | Bacteria | 5183 |
| 1633 | nmdc:mga08x19_425860_c1 | 3300050514 | Unclassified | 932 |
| 1634 | nmdc:mga0a205_32863_c1 | 3300050515 | Bacteria | 4975 |
| 1635 | nmdc:mga0a205_37088_c1 | 3300050515 | Bacteria | 4687 |
| 1636 | nmdc:mga0a205_605389_c1 | 3300050515 | Unclassified | 949 |
| 1637 | nmdc:mga0a205_646225_c1 | 3300050515 | Bacteria | 909 |
| 1638 | Ga0495601_0003937 | 3300053077 | Bacteria | 8549 |
| 1639 | Ga0495601_0081254 | 3300053077 | Bacteria | 2080 |
| 1640 | Ga0495601_0084821 | 3300053077 | Bacteria | 2035 |
| 1641 | Ga0495601_0840966 | 3300053077 | Bacteria | 581 |
| 1642 | Ga0495612_0000490 | 3300053078 | Bacteria | 15773 |
| 1643 | Ga0495595_0024258 | 3300053084 | Bacteria | 2678 |
| 1644 | Ga0495619_0002629 | 3300053085 | Bacteria | 11736 |
| 1645 | Ga0495619_0062774 | 3300053085 | Bacteria | 2474 |
| 1646 | Ga0495619_0414562 | 3300053085 | Unclassified | 929 |
| 1647 | Ga0501084_0081149 | 3300054114 | Bacteria | 2720 |
| 1648 | Ga0501084_0095051 | 3300054114 | Bacteria | 2503 |
| 1649 | Ga0501084_0170156 | 3300054114 | Bacteria | 1839 |
| 1650 | Ga0501084_0184919 | 3300054114 | Bacteria | 1759 |
| 1651 | Ga0590071_031312 | 3300059421 | Bacteria | 1268 |
| 1652 | Ga0590071_043838 | 3300059421 | Bacteria | 1078 |
| 1653 | Ga0590075_026983 | 3300059424 | Bacteria | 1447 |
| 1654 | Ga0590075_045298 | 3300059424 | Bacteria | 1127 |
| 1655 | Ga0590077_022697 | 3300059426 | Unclassified | 1340 |
| 1656 | Ga0587066_078833 | 3300059490 | Bacteria | 709 |
| 1657 | Ga0587070_143242 | 3300059491 | Bacteria | 592 |
| 1658 | Ga0587073_0057828 | 3300059492 | Bacteria | 900 |
| 1659 | Ga0587073_0117544 | 3300059492 | Bacteria | 713 |
| 1660 | Ga0587077_128672 | 3300059493 | Bacteria | 640 |
| 1661 | Ga0587083_0108493 | 3300059505 | Unclassified | 702 |
| 1662 | Ga0587083_0153285 | 3300059505 | Bacteria | 624 |
| 1663 | Ga0587083_0260290 | 3300059505 | Bacteria | 520 |
| 1664 | Ga0587085_026550 | 3300059506 | Unclassified | 923 |
| 1665 | Ga0587088_101991 | 3300059508 | Bacteria | 642 |
| 1666 | Ga0587088_104734 | 3300059508 | Bacteria | 636 |
| 1667 | Ga0587089_057672 | 3300059509 | Unclassified | 636 |
| 1668 | Ga0587091_071005 | 3300059511 | Bacteria | 762 |
| 1669 | Ga0587092_118003 | 3300059512 | Bacteria | 564 |
| 1670 | Ga0587094_083647 | 3300059513 | Unclassified | 594 |
| 1671 | Ga0587101_077787 | 3300059623 | Unclassified | 623 |
| 1672 | Ga0587117_093637 | 3300059627 | Unclassified | 564 |
| 1673 | Ga0587128_084766 | 3300059630 | Bacteria | 640 |
| 1674 | Ga0587062_056317 | 3300059639 | Unclassified | 679 |
| 1675 | Ga0587067_156622 | 3300059640 | Bacteria | 576 |
| 1676 | Ga0587067_189136 | 3300059640 | Bacteria | 541 |
| 1677 | Ga0587072_083036 | 3300059643 | Bacteria | 695 |
| 1678 | Ga0587072_091123 | 3300059643 | Bacteria | 672 |
| 1679 | Ga0587075_107383 | 3300059644 | Unclassified | 564 |
| 1680 | Ga0587076_078824 | 3300059645 | Bacteria | 699 |
| 1681 | Ga0587076_103535 | 3300059645 | Bacteria | 639 |
| 1682 | Ga0501082_0036435 | 3300060353 | Bacteria | 4238 |
| 1683 | Ga0501082_0160735 | 3300060353 | Bacteria | 1952 |
| 1684 | Ga0501082_0206675 | 3300060353 | Unclassified | 1708 |
| 1685 | Ga0466962_0514034 | 3300061719 | Bacteria | 607 |
| 1686 | Ga0530510_0335764 | 3300061734 | Bacteria | 1134 |
| 1687 | Ga0530510_1264863 | 3300061734 | Bacteria | 566 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005330 | Ga0070690_100045286 | Ga0070690_1000452864 | 109 |
| 2 | 3300005333 | Ga0070677_10119039 | Ga0070677_101190393 | 109 |
| 3 | 3300005334 | Ga0068869_100010103 | Ga0068869_1000101034 | 109 |
| 4 | 3300005335 | Ga0070666_10117395 | Ga0070666_101173952 | 109 |
| 5 | 3300005336 | Ga0070680_100471466 | Ga0070680_1004714662 | 109 |
| 6 | 3300005339 | Ga0070660_100666225 | Ga0070660_1006662252 | 109 |
| 7 | 3300005341 | Ga0070691_10021952 | Ga0070691_100219524 | 109 |
| 8 | 3300005343 | Ga0070687_100301426 | Ga0070687_1003014262 | 109 |
| 9 | 3300005347 | Ga0070668_100110467 | Ga0070668_1001104673 | 109 |
| 10 | 3300005353 | Ga0070669_100628490 | Ga0070669_1006284902 | 109 |
| 11 | 3300005354 | Ga0070675_100129213 | Ga0070675_1001292132 | 109 |
| 12 | 3300005355 | Ga0070671_100119992 | Ga0070671_1001199922 | 109 |
| 13 | 3300005356 | Ga0070674_100002673 | Ga0070674_1000026738 | 109 |
| 14 | 3300005364 | Ga0070673_100174961 | Ga0070673_1001749612 | 109 |
| 15 | 3300005366 | Ga0070659_100182606 | Ga0070659_1001826062 | 109 |
| 16 | 3300005406 | Ga0070703_10045433 | Ga0070703_100454332 | 109 |
| 17 | 3300005438 | Ga0070701_10081963 | Ga0070701_100819631 | 109 |
| 18 | 3300005440 | Ga0070705_100008002 | Ga0070705_1000080023 | 109 |
| 19 | 3300005444 | Ga0070694_100389417 | Ga0070694_1003894173 | 109 |
| 20 | 3300005445 | Ga0070708_102155434 | Ga0070708_1021554341 | 109 |
| 21 | 3300005455 | Ga0070663_100462429 | Ga0070663_1004624292 | 109 |
| 22 | 3300005456 | Ga0070678_100216556 | Ga0070678_1002165562 | 109 |
| 23 | 3300005457 | Ga0070662_100005643 | Ga0070662_1000056432 | 109 |
| 24 | 3300005458 | Ga0070681_11039480 | Ga0070681_110394802 | 109 |
| 25 | 3300005459 | Ga0068867_100005117 | Ga0068867_1000051173 | 109 |
| 26 | 3300005467 | Ga0070706_100638097 | Ga0070706_1006380972 | 109 |
| 27 | 3300005468 | Ga0070707_100253278 | Ga0070707_1002532783 | 109 |
| 28 | 3300005518 | Ga0070699_100762451 | Ga0070699_1007624512 | 109 |
| 29 | 3300005536 | Ga0070697_100659546 | Ga0070697_1006595462 | 109 |
| 30 | 3300005543 | Ga0070672_100206844 | Ga0070672_1002068443 | 109 |
| 31 | 3300005545 | Ga0070695_100001483 | Ga0070695_1000014838 | 109 |
| 32 | 3300005546 | Ga0070696_100007637 | Ga0070696_1000076373 | 109 |
| 33 | 3300005547 | Ga0070693_100013713 | Ga0070693_1000137133 | 109 |
| 34 | 3300005549 | Ga0070704_100285705 | Ga0070704_1002857052 | 109 |
| 35 | 3300005563 | Ga0068855_100646997 | Ga0068855_1006469972 | 109 |
| 36 | 3300005577 | Ga0068857_100012440 | Ga0068857_1000124404 | 109 |
| 37 | 3300005578 | Ga0068854_100000340 | Ga0068854_10000034021 | 109 |
| 38 | 3300005615 | Ga0070702_100015870 | Ga0070702_1000158705 | 109 |
| 39 | 3300005616 | Ga0068852_101079483 | Ga0068852_1010794832 | 109 |
| 40 | 3300005618 | Ga0068864_100005386 | Ga0068864_1000053868 | 109 |
| 41 | 3300005718 | Ga0068866_10000524 | Ga0068866_100005244 | 109 |
| 42 | 3300005719 | Ga0068861_100289917 | Ga0068861_1002899172 | 109 |
| 43 | 3300005840 | Ga0068870_10408049 | Ga0068870_104080492 | 109 |
| 44 | 3300005842 | Ga0068858_100321105 | Ga0068858_1003211052 | 109 |
| 45 | 3300005843 | Ga0068860_100040126 | Ga0068860_1000401262 | 109 |
| 46 | 3300006237 | Ga0097621_100208928 | Ga0097621_1002089283 | 109 |
| 47 | 3300006358 | Ga0068871_100139055 | Ga0068871_1001390553 | 109 |
| 48 | 3300006847 | Ga0075431_100135269 | Ga0075431_1001352695 | 109 |
| 49 | 3300006871 | Ga0075434_100261801 | Ga0075434_1002618011 | 109 |
| 50 | 3300006871 | Ga0075434_100873154 | Ga0075434_1008731542 | 109 |
| 51 | 3300006881 | Ga0068865_100117526 | Ga0068865_1001175263 | 109 |
| 52 | 3300006914 | Ga0075436_100194376 | Ga0075436_1001943763 | 109 |
| 53 | 3300007076 | Ga0075435_101766042 | Ga0075435_1017660421 | 109 |
| 54 | 3300009093 | Ga0105240_10046608 | Ga0105240_100466083 | 109 |
| 55 | 3300009098 | Ga0105245_10036543 | Ga0105245_100365433 | 109 |
| 56 | 3300009101 | Ga0105247_10439480 | Ga0105247_104394801 | 109 |
| 57 | 3300009148 | Ga0105243_10042543 | Ga0105243_100425435 | 109 |
| 58 | 3300009174 | Ga0105241_10024142 | Ga0105241_100241425 | 109 |
| 59 | 3300009176 | Ga0105242_10006526 | Ga0105242_100065268 | 109 |
| 60 | 3300009177 | Ga0105248_10011120 | Ga0105248_100111202 | 109 |
| 61 | 3300009545 | Ga0105237_11009553 | Ga0105237_110095531 | 109 |
| 62 | 3300009551 | Ga0105238_10325721 | Ga0105238_103257212 | 109 |
| 63 | 3300009553 | Ga0105249_10190726 | Ga0105249_101907262 | 109 |
| 64 | 3300010375 | Ga0105239_10147980 | Ga0105239_101479802 | 109 |
| 65 | 3300010375 | Ga0105239_12469307 | Ga0105239_124693072 | 109 |
| 66 | 3300011119 | Ga0105246_10055844 | Ga0105246_100558443 | 109 |
| 67 | 3300013297 | Ga0157378_10016080 | Ga0157378_100160807 | 109 |
| 68 | 3300013306 | Ga0163162_10075056 | Ga0163162_100750563 | 109 |
| 69 | 3300013306 | Ga0163162_13441632 | Ga0163162_134416322 | 109 |
| 70 | 3300013307 | Ga0157372_10696387 | Ga0157372_106963873 | 109 |
| 71 | 3300014326 | Ga0157380_10278831 | Ga0157380_102788312 | 109 |
| 72 | 3300014968 | Ga0157379_10064796 | Ga0157379_100647964 | 109 |
| 73 | 3300014969 | Ga0157376_10093515 | Ga0157376_100935153 | 109 |
| 74 | 3300014969 | Ga0157376_11130927 | Ga0157376_111309272 | 109 |
| 75 | 3300017792 | Ga0163161_10150679 | Ga0163161_101506792 | 109 |
| 76 | 3300025315 | Ga0207697_10112113 | Ga0207697_101121133 | 109 |
| 77 | 3300025899 | Ga0207642_10069746 | Ga0207642_100697463 | 109 |
| 78 | 3300025901 | Ga0207688_10186830 | Ga0207688_101868302 | 109 |
| 79 | 3300025903 | Ga0207680_10113171 | Ga0207680_101131713 | 109 |
| 80 | 3300025907 | Ga0207645_10000971 | Ga0207645_100009715 | 109 |
| 81 | 3300025908 | Ga0207643_10076653 | Ga0207643_100766533 | 109 |
| 82 | 3300025910 | Ga0207684_11538460 | Ga0207684_115384601 | 109 |
| 83 | 3300025911 | Ga0207654_11030082 | Ga0207654_110300822 | 109 |
| 84 | 3300025913 | Ga0207695_10044422 | Ga0207695_100444225 | 109 |
| 85 | 3300025917 | Ga0207660_10090306 | Ga0207660_100903062 | 109 |
| 86 | 3300025918 | Ga0207662_10105844 | Ga0207662_101058442 | 109 |
| 87 | 3300025919 | Ga0207657_10237526 | Ga0207657_102375263 | 109 |
| 88 | 3300025922 | Ga0207646_10123227 | Ga0207646_101232272 | 109 |
| 89 | 3300025923 | Ga0207681_10221702 | Ga0207681_102217022 | 109 |
| 90 | 3300025924 | Ga0207694_10664094 | Ga0207694_106640942 | 109 |
| 91 | 3300025926 | Ga0207659_10642311 | Ga0207659_106423112 | 109 |
| 92 | 3300025927 | Ga0207687_10073181 | Ga0207687_100731813 | 109 |
| 93 | 3300025931 | Ga0207644_10722079 | Ga0207644_107220791 | 109 |
| 94 | 3300025933 | Ga0207706_10000065 | Ga0207706_1000006515 | 109 |
| 95 | 3300025934 | Ga0207686_10001117 | Ga0207686_100011176 | 109 |
| 96 | 3300025935 | Ga0207709_10004346 | Ga0207709_100043463 | 109 |
| 97 | 3300025936 | Ga0207670_11386390 | Ga0207670_113863902 | 109 |
| 98 | 3300025937 | Ga0207669_10001479 | Ga0207669_100014797 | 109 |
| 99 | 3300025938 | Ga0207704_10058637 | Ga0207704_100586373 | 109 |
| 100 | 3300025940 | Ga0207691_10131502 | Ga0207691_101315023 | 109 |
| 101 | 3300025941 | Ga0207711_10028892 | Ga0207711_100288925 | 109 |
| 102 | 3300025942 | Ga0207689_10007750 | Ga0207689_100077504 | 109 |
| 103 | 3300025949 | Ga0207667_10950863 | Ga0207667_109508632 | 109 |
| 104 | 3300025960 | Ga0207651_10150000 | Ga0207651_101500003 | 109 |
| 105 | 3300025961 | Ga0207712_10044891 | Ga0207712_100448914 | 109 |
| 106 | 3300025961 | Ga0207712_10481269 | Ga0207712_104812692 | 109 |
| 107 | 3300025972 | Ga0207668_10053139 | Ga0207668_100531393 | 109 |
| 108 | 3300025981 | Ga0207640_10110876 | Ga0207640_101108762 | 109 |
| 109 | 3300026075 | Ga0207708_10104714 | Ga0207708_101047142 | 109 |
| 110 | 3300026089 | Ga0207648_10001169 | Ga0207648_100011697 | 109 |
| 111 | 3300026095 | Ga0207676_10048851 | Ga0207676_100488513 | 109 |
| 112 | 3300026116 | Ga0207674_10059142 | Ga0207674_100591424 | 109 |
| 113 | 3300026118 | Ga0207675_100032261 | Ga0207675_1000322614 | 109 |
| 114 | 3300026121 | Ga0207683_10041068 | Ga0207683_100410682 | 109 |
| 115 | 3300026142 | Ga0207698_11013550 | Ga0207698_110135502 | 109 |
| 116 | 3300028380 | Ga0268265_10037895 | Ga0268265_100378954 | 109 |
| 117 | 3300028381 | Ga0268264_10022106 | Ga0268264_100221065 | 109 |
| 118 | 3300031548 | Ga0307408_100559101 | Ga0307408_1005591013 | 109 |
| 119 | 3300031548 | Ga0307408_100875500 | Ga0307408_1008755002 | 109 |
| 120 | 3300031731 | Ga0307405_10154782 | Ga0307405_101547822 | 109 |
| 121 | 3300031824 | Ga0307413_10002229 | Ga0307413_100022293 | 109 |
| 122 | 3300031824 | Ga0307413_10640847 | Ga0307413_106408472 | 109 |
| 123 | 3300031852 | Ga0307410_10015315 | Ga0307410_100153153 | 109 |
| 124 | 3300031901 | Ga0307406_10085068 | Ga0307406_100850683 | 109 |
| 125 | 3300031903 | Ga0307407_10024361 | Ga0307407_100243612 | 109 |
| 126 | 3300031903 | Ga0307407_10379864 | Ga0307407_103798642 | 109 |
| 127 | 3300031911 | Ga0307412_10129946 | Ga0307412_101299463 | 109 |
| 128 | 3300031995 | Ga0307409_100023234 | Ga0307409_1000232344 | 109 |
| 129 | 3300031995 | Ga0307409_100867596 | Ga0307409_1008675962 | 109 |
| 130 | 3300032002 | Ga0307416_100073588 | Ga0307416_1000735883 | 109 |
| 131 | 3300032002 | Ga0307416_100247873 | Ga0307416_1002478733 | 109 |
| 132 | 3300032004 | Ga0307414_10090810 | Ga0307414_100908103 | 109 |
| 133 | 3300032005 | Ga0307411_10028273 | Ga0307411_100282733 | 109 |
| 134 | 3300032005 | Ga0307411_10858996 | Ga0307411_108589962 | 109 |
| 135 | 3300032126 | Ga0307415_100125154 | Ga0307415_1001251542 | 109 |
| 136 | 3300039437 | Ga0436365_1159467 | Ga0436365_1159467_20_352 | 109 |
| 137 | 3300042876 | Ga0451577_0076398 | Ga0451577_0076398_520_852 | 109 |
| 138 | 3300044673 | Ga0453683_0083881 | Ga0453683_0083881_1635_1967 | 109 |
| 139 | 3300045051 | Ga0451576_0042077 | Ga0451576_0042077_1968_2300 | 109 |
| 140 | 3300045051 | Ga0451576_0781793 | Ga0451576_0781793_368_700 | 109 |
| 141 | 3300046455 | Ga0495603_0015387 | Ga0495603_0015387_2675_3007 | 109 |
| 142 | 3300046472 | Ga0495580_0614116 | Ga0495580_0614116_358_690 | 109 |
| 143 | 3300046492 | Ga0495585_0160087 | Ga0495585_0160087_611_943 | 109 |
| 144 | 3300046501 | Ga0495607_0370303 | Ga0495607_0370303_132_464 | 109 |
| 145 | 3300046539 | Ga0495621_0210913 | Ga0495621_0210913_13_345 | 109 |
| 146 | 3300046557 | Ga0495622_0022950 | Ga0495622_0022950_883_1215 | 109 |
| 147 | 3300046558 | Ga0495633_0152348 | Ga0495633_0152348_575_907 | 109 |
| 148 | 3300046691 | Ga0495670_0290462 | Ga0495670_0290462_413_745 | 109 |
| 149 | 3300048903 | Ga0496100_0202865 | Ga0496100_0202865_287_619 | 109 |
| 150 | 3300048906 | Ga0496103_0431769 | Ga0496103_0431769_486_818 | 109 |
| 151 | 3300048909 | Ga0496106_0012262 | Ga0496106_0012262_668_1000 | 109 |
| 152 | 3300049772 | Ga0501275_011114 | Ga0501275_011114_50_382 | 109 |
| 153 | 3300050508 | nmdc:mga09592_132413_c1 | nmdc:mga09592_132413_c1_1207_1539 | 109 |
| 154 | 3300050512 | nmdc:mga0n895_1552889_c1 | nmdc:mga0n895_1552889_c1_271_603 | 109 |
| 155 | 3300050512 | nmdc:mga0n895_40283_c1 | nmdc:mga0n895_40283_c1_16_348 | 109 |
| 156 | 3300050513 | nmdc:mga0rr50_820594_c1 | nmdc:mga0rr50_820594_c1_85_417 | 109 |
| 157 | 3300002070 | JGI24750J21931_1019297 | JGI24750J21931_10192972 | 110 |
| 158 | 3300003203 | JGI25406J46586_10052517 | JGI25406J46586_100525172 | 110 |
| 159 | 3300003322 | rootL2_10101677 | rootL2_101016773 | 110 |
| 160 | 3300003693 | Ga0032354_1121886 | Ga0032354_11218862 | 110 |
| 161 | 3300004798 | Ga0058859_11814094 | Ga0058859_118140941 | 110 |
| 162 | 3300004799 | Ga0058863_10023017 | Ga0058863_100230172 | 110 |
| 163 | 3300004799 | Ga0058863_11749219 | Ga0058863_117492191 | 110 |
| 164 | 3300004799 | Ga0058863_11766029 | Ga0058863_117660292 | 110 |
| 165 | 3300004799 | Ga0058863_11873702 | Ga0058863_118737022 | 110 |
| 166 | 3300004799 | Ga0058863_11972071 | Ga0058863_119720711 | 110 |
| 167 | 3300004800 | Ga0058861_11621628 | Ga0058861_116216281 | 110 |
| 168 | 3300004800 | Ga0058861_11623768 | Ga0058861_116237682 | 110 |
| 169 | 3300004800 | Ga0058861_11793331 | Ga0058861_117933312 | 110 |
| 170 | 3300004800 | Ga0058861_11819252 | Ga0058861_118192521 | 110 |
| 171 | 3300004800 | Ga0058861_11862569 | Ga0058861_118625692 | 110 |
| 172 | 3300004800 | Ga0058861_11977672 | Ga0058861_119776722 | 110 |
| 173 | 3300004801 | Ga0058860_12016274 | Ga0058860_120162741 | 110 |
| 174 | 3300004803 | Ga0058862_10007717 | Ga0058862_100077171 | 110 |
| 175 | 3300004803 | Ga0058862_10139180 | Ga0058862_101391802 | 110 |
| 176 | 3300004803 | Ga0058862_11895783 | Ga0058862_118957831 | 110 |
| 177 | 3300004803 | Ga0058862_12536806 | Ga0058862_125368061 | 110 |
| 178 | 3300004803 | Ga0058862_12551672 | Ga0058862_125516721 | 110 |
| 179 | 3300004803 | Ga0058862_12614112 | Ga0058862_126141122 | 110 |
| 180 | 3300004803 | Ga0058862_12730940 | Ga0058862_127309402 | 110 |
| 181 | 3300004803 | Ga0058862_12733296 | Ga0058862_127332961 | 110 |
| 182 | 3300004803 | Ga0058862_12860400 | Ga0058862_128604002 | 110 |
| 183 | 3300004803 | Ga0058862_12875333 | Ga0058862_128753332 | 110 |
| 184 | 3300005289 | Ga0065704_10156196 | Ga0065704_101561962 | 110 |
| 185 | 3300005290 | Ga0065712_10002894 | Ga0065712_100028945 | 110 |
| 186 | 3300005293 | Ga0065715_10162401 | Ga0065715_101624012 | 110 |
| 187 | 3300005295 | Ga0065707_10113306 | Ga0065707_101133063 | 110 |
| 188 | 3300005327 | Ga0070658_10009701 | Ga0070658_100097013 | 110 |
| 189 | 3300005327 | Ga0070658_10035917 | Ga0070658_100359173 | 110 |
| 190 | 3300005327 | Ga0070658_10091002 | Ga0070658_100910022 | 110 |
| 191 | 3300005327 | Ga0070658_10188744 | Ga0070658_101887441 | 110 |
| 192 | 3300005327 | Ga0070658_10265771 | Ga0070658_102657712 | 110 |
| 193 | 3300005327 | Ga0070658_10295648 | Ga0070658_102956483 | 110 |
| 194 | 3300005327 | Ga0070658_10569624 | Ga0070658_105696242 | 110 |
| 195 | 3300005327 | Ga0070658_10586066 | Ga0070658_105860661 | 110 |
| 196 | 3300005328 | Ga0070676_10004346 | Ga0070676_100043468 | 110 |
| 197 | 3300005328 | Ga0070676_10830801 | Ga0070676_108308012 | 110 |
| 198 | 3300005328 | Ga0070676_10948230 | Ga0070676_109482302 | 110 |
| 199 | 3300005329 | Ga0070683_100000233 | Ga0070683_1000002333 | 110 |
| 200 | 3300005329 | Ga0070683_100007640 | Ga0070683_10000764011 | 110 |
| 201 | 3300005329 | Ga0070683_100021811 | Ga0070683_1000218111 | 110 |
| 202 | 3300005329 | Ga0070683_100050905 | Ga0070683_1000509053 | 110 |
| 203 | 3300005329 | Ga0070683_100088898 | Ga0070683_1000888984 | 110 |
| 204 | 3300005329 | Ga0070683_100104030 | Ga0070683_1001040303 | 110 |
| 205 | 3300005329 | Ga0070683_100141480 | Ga0070683_1001414801 | 110 |
| 206 | 3300005329 | Ga0070683_100153583 | Ga0070683_1001535832 | 110 |
| 207 | 3300005329 | Ga0070683_100225934 | Ga0070683_1002259343 | 110 |
| 208 | 3300005329 | Ga0070683_100318464 | Ga0070683_1003184642 | 110 |
| 209 | 3300005329 | Ga0070683_100567773 | Ga0070683_1005677733 | 110 |
| 210 | 3300005329 | Ga0070683_100697499 | Ga0070683_1006974992 | 110 |
| 211 | 3300005329 | Ga0070683_100729882 | Ga0070683_1007298822 | 110 |
| 212 | 3300005329 | Ga0070683_101339638 | Ga0070683_1013396381 | 110 |
| 213 | 3300005330 | Ga0070690_100430372 | Ga0070690_1004303722 | 110 |
| 214 | 3300005330 | Ga0070690_100568538 | Ga0070690_1005685381 | 110 |
| 215 | 3300005330 | Ga0070690_101566059 | Ga0070690_1015660591 | 110 |
| 216 | 3300005331 | Ga0070670_100007272 | Ga0070670_10000727210 | 110 |
| 217 | 3300005331 | Ga0070670_100965521 | Ga0070670_1009655211 | 110 |
| 218 | 3300005331 | Ga0070670_101308577 | Ga0070670_1013085772 | 110 |
| 219 | 3300005333 | Ga0070677_10445234 | Ga0070677_104452342 | 110 |
| 220 | 3300005334 | Ga0068869_100057602 | Ga0068869_1000576024 | 110 |
| 221 | 3300005334 | Ga0068869_100895419 | Ga0068869_1008954192 | 110 |
| 222 | 3300005335 | Ga0070666_10127916 | Ga0070666_101279162 | 110 |
| 223 | 3300005336 | Ga0070680_100027511 | Ga0070680_1000275113 | 110 |
| 224 | 3300005336 | Ga0070680_100028065 | Ga0070680_1000280654 | 110 |
| 225 | 3300005336 | Ga0070680_100043156 | Ga0070680_1000431562 | 110 |
| 226 | 3300005336 | Ga0070680_100050348 | Ga0070680_1000503484 | 110 |
| 227 | 3300005336 | Ga0070680_100069042 | Ga0070680_1000690423 | 110 |
| 228 | 3300005336 | Ga0070680_100087628 | Ga0070680_1000876283 | 110 |
| 229 | 3300005336 | Ga0070680_100314700 | Ga0070680_1003147002 | 110 |
| 230 | 3300005336 | Ga0070680_100373251 | Ga0070680_1003732512 | 110 |
| 231 | 3300005336 | Ga0070680_100378701 | Ga0070680_1003787012 | 110 |
| 232 | 3300005336 | Ga0070680_100442334 | Ga0070680_1004423341 | 110 |
| 233 | 3300005337 | Ga0070682_100125509 | Ga0070682_1001255093 | 110 |
| 234 | 3300005337 | Ga0070682_100229953 | Ga0070682_1002299532 | 110 |
| 235 | 3300005337 | Ga0070682_100382888 | Ga0070682_1003828882 | 110 |
| 236 | 3300005337 | Ga0070682_100556699 | Ga0070682_1005566993 | 110 |
| 237 | 3300005337 | Ga0070682_101686893 | Ga0070682_1016868931 | 110 |
| 238 | 3300005337 | Ga0070682_101724306 | Ga0070682_1017243062 | 110 |
| 239 | 3300005338 | Ga0068868_101341298 | Ga0068868_1013412982 | 110 |
| 240 | 3300005339 | Ga0070660_100012909 | Ga0070660_1000129092 | 110 |
| 241 | 3300005339 | Ga0070660_100125019 | Ga0070660_1001250193 | 110 |
| 242 | 3300005339 | Ga0070660_100741289 | Ga0070660_1007412891 | 110 |
| 243 | 3300005339 | Ga0070660_100785146 | Ga0070660_1007851462 | 110 |
| 244 | 3300005339 | Ga0070660_100945336 | Ga0070660_1009453361 | 110 |
| 245 | 3300005340 | Ga0070689_100125500 | Ga0070689_1001255003 | 110 |
| 246 | 3300005341 | Ga0070691_10178744 | Ga0070691_101787443 | 110 |
| 247 | 3300005341 | Ga0070691_10353471 | Ga0070691_103534712 | 110 |
| 248 | 3300005341 | Ga0070691_10856079 | Ga0070691_108560791 | 110 |
| 249 | 3300005343 | Ga0070687_100014103 | Ga0070687_1000141034 | 110 |
| 250 | 3300005343 | Ga0070687_100275992 | Ga0070687_1002759921 | 110 |
| 251 | 3300005344 | Ga0070661_100002985 | Ga0070661_10000298513 | 110 |
| 252 | 3300005344 | Ga0070661_100003411 | Ga0070661_10000341111 | 110 |
| 253 | 3300005344 | Ga0070661_100003797 | Ga0070661_1000037977 | 110 |
| 254 | 3300005344 | Ga0070661_100015035 | Ga0070661_1000150356 | 110 |
| 255 | 3300005344 | Ga0070661_100035622 | Ga0070661_1000356222 | 110 |
| 256 | 3300005344 | Ga0070661_100065843 | Ga0070661_1000658432 | 110 |
| 257 | 3300005344 | Ga0070661_100092097 | Ga0070661_1000920973 | 110 |
| 258 | 3300005344 | Ga0070661_100978447 | Ga0070661_1009784472 | 110 |
| 259 | 3300005345 | Ga0070692_10104273 | Ga0070692_101042732 | 110 |
| 260 | 3300005345 | Ga0070692_10452886 | Ga0070692_104528861 | 110 |
| 261 | 3300005345 | Ga0070692_10455385 | Ga0070692_104553852 | 110 |
| 262 | 3300005345 | Ga0070692_10543731 | Ga0070692_105437312 | 110 |
| 263 | 3300005345 | Ga0070692_10798877 | Ga0070692_107988772 | 110 |
| 264 | 3300005347 | Ga0070668_100003043 | Ga0070668_1000030438 | 110 |
| 265 | 3300005353 | Ga0070669_100003079 | Ga0070669_1000030796 | 110 |
| 266 | 3300005353 | Ga0070669_100006567 | Ga0070669_1000065677 | 110 |
| 267 | 3300005353 | Ga0070669_100017058 | Ga0070669_1000170586 | 110 |
| 268 | 3300005353 | Ga0070669_101526970 | Ga0070669_1015269701 | 110 |
| 269 | 3300005354 | Ga0070675_100002631 | Ga0070675_10000263110 | 110 |
| 270 | 3300005354 | Ga0070675_100002663 | Ga0070675_10000266312 | 110 |
| 271 | 3300005354 | Ga0070675_100443798 | Ga0070675_1004437982 | 110 |
| 272 | 3300005354 | Ga0070675_100538919 | Ga0070675_1005389191 | 110 |
| 273 | 3300005354 | Ga0070675_100628948 | Ga0070675_1006289482 | 110 |
| 274 | 3300005355 | Ga0070671_100023147 | Ga0070671_1000231475 | 110 |
| 275 | 3300005355 | Ga0070671_100306722 | Ga0070671_1003067222 | 110 |
| 276 | 3300005355 | Ga0070671_100948637 | Ga0070671_1009486372 | 110 |
| 277 | 3300005356 | Ga0070674_100005627 | Ga0070674_1000056273 | 110 |
| 278 | 3300005356 | Ga0070674_100090184 | Ga0070674_1000901842 | 110 |
| 279 | 3300005356 | Ga0070674_100716610 | Ga0070674_1007166101 | 110 |
| 280 | 3300005356 | Ga0070674_101373216 | Ga0070674_1013732162 | 110 |
| 281 | 3300005364 | Ga0070673_100071202 | Ga0070673_1000712023 | 110 |
| 282 | 3300005364 | Ga0070673_100423788 | Ga0070673_1004237882 | 110 |
| 283 | 3300005365 | Ga0070688_100002319 | Ga0070688_1000023193 | 110 |
| 284 | 3300005365 | Ga0070688_100210072 | Ga0070688_1002100723 | 110 |
| 285 | 3300005366 | Ga0070659_100008807 | Ga0070659_1000088075 | 110 |
| 286 | 3300005366 | Ga0070659_100045001 | Ga0070659_1000450013 | 110 |
| 287 | 3300005366 | Ga0070659_100098927 | Ga0070659_1000989273 | 110 |
| 288 | 3300005366 | Ga0070659_100125537 | Ga0070659_1001255373 | 110 |
| 289 | 3300005366 | Ga0070659_100372354 | Ga0070659_1003723542 | 110 |
| 290 | 3300005366 | Ga0070659_101093415 | Ga0070659_1010934151 | 110 |
| 291 | 3300005366 | Ga0070659_101305541 | Ga0070659_1013055412 | 110 |
| 292 | 3300005367 | Ga0070667_100078670 | Ga0070667_1000786702 | 110 |
| 293 | 3300005434 | Ga0070709_10004387 | Ga0070709_100043875 | 110 |
| 294 | 3300005434 | Ga0070709_10127383 | Ga0070709_101273833 | 110 |
| 295 | 3300005434 | Ga0070709_10250300 | Ga0070709_102503003 | 110 |
| 296 | 3300005435 | Ga0070714_100017298 | Ga0070714_1000172985 | 110 |
| 297 | 3300005435 | Ga0070714_100059789 | Ga0070714_1000597891 | 110 |
| 298 | 3300005435 | Ga0070714_101233724 | Ga0070714_1012337242 | 110 |
| 299 | 3300005436 | Ga0070713_100007166 | Ga0070713_1000071667 | 110 |
| 300 | 3300005436 | Ga0070713_100044534 | Ga0070713_1000445344 | 110 |
| 301 | 3300005436 | Ga0070713_100116823 | Ga0070713_1001168233 | 110 |
| 302 | 3300005436 | Ga0070713_100460388 | Ga0070713_1004603881 | 110 |
| 303 | 3300005436 | Ga0070713_100497774 | Ga0070713_1004977742 | 110 |
| 304 | 3300005436 | Ga0070713_102030405 | Ga0070713_1020304051 | 110 |
| 305 | 3300005437 | Ga0070710_10184315 | Ga0070710_101843152 | 110 |
| 306 | 3300005437 | Ga0070710_10208052 | Ga0070710_102080522 | 110 |
| 307 | 3300005438 | Ga0070701_10066722 | Ga0070701_100667223 | 110 |
| 308 | 3300005438 | Ga0070701_10197945 | Ga0070701_101979452 | 110 |
| 309 | 3300005439 | Ga0070711_100032354 | Ga0070711_1000323544 | 110 |
| 310 | 3300005439 | Ga0070711_100093604 | Ga0070711_1000936042 | 110 |
| 311 | 3300005439 | Ga0070711_100197012 | Ga0070711_1001970122 | 110 |
| 312 | 3300005439 | Ga0070711_100551202 | Ga0070711_1005512021 | 110 |
| 313 | 3300005439 | Ga0070711_101492201 | Ga0070711_1014922011 | 110 |
| 314 | 3300005440 | Ga0070705_100260434 | Ga0070705_1002604342 | 110 |
| 315 | 3300005441 | Ga0070700_100084227 | Ga0070700_1000842272 | 110 |
| 316 | 3300005441 | Ga0070700_100273692 | Ga0070700_1002736922 | 110 |
| 317 | 3300005441 | Ga0070700_100426352 | Ga0070700_1004263522 | 110 |
| 318 | 3300005444 | Ga0070694_100026031 | Ga0070694_1000260314 | 110 |
| 319 | 3300005444 | Ga0070694_100071018 | Ga0070694_1000710183 | 110 |
| 320 | 3300005445 | Ga0070708_100000198 | Ga0070708_10000019819 | 110 |
| 321 | 3300005445 | Ga0070708_100319285 | Ga0070708_1003192853 | 110 |
| 322 | 3300005445 | Ga0070708_100319362 | Ga0070708_1003193622 | 110 |
| 323 | 3300005445 | Ga0070708_100335521 | Ga0070708_1003355212 | 110 |
| 324 | 3300005455 | Ga0070663_100006553 | Ga0070663_1000065536 | 110 |
| 325 | 3300005455 | Ga0070663_100026569 | Ga0070663_1000265693 | 110 |
| 326 | 3300005455 | Ga0070663_100426316 | Ga0070663_1004263162 | 110 |
| 327 | 3300005455 | Ga0070663_100628698 | Ga0070663_1006286982 | 110 |
| 328 | 3300005455 | Ga0070663_100846071 | Ga0070663_1008460711 | 110 |
| 329 | 3300005455 | Ga0070663_100969771 | Ga0070663_1009697711 | 110 |
| 330 | 3300005456 | Ga0070678_100318911 | Ga0070678_1003189111 | 110 |
| 331 | 3300005456 | Ga0070678_100941283 | Ga0070678_1009412832 | 110 |
| 332 | 3300005456 | Ga0070678_101712329 | Ga0070678_1017123292 | 110 |
| 333 | 3300005457 | Ga0070662_100008788 | Ga0070662_1000087883 | 110 |
| 334 | 3300005457 | Ga0070662_100317522 | Ga0070662_1003175221 | 110 |
| 335 | 3300005457 | Ga0070662_101025354 | Ga0070662_1010253542 | 110 |
| 336 | 3300005457 | Ga0070662_101027303 | Ga0070662_1010273031 | 110 |
| 337 | 3300005457 | Ga0070662_101457880 | Ga0070662_1014578802 | 110 |
| 338 | 3300005458 | Ga0070681_10000404 | Ga0070681_1000040436 | 110 |
| 339 | 3300005458 | Ga0070681_10002832 | Ga0070681_100028323 | 110 |
| 340 | 3300005458 | Ga0070681_10003332 | Ga0070681_100033323 | 110 |
| 341 | 3300005458 | Ga0070681_10003955 | Ga0070681_1000395512 | 110 |
| 342 | 3300005458 | Ga0070681_10010307 | Ga0070681_100103077 | 110 |
| 343 | 3300005458 | Ga0070681_10039341 | Ga0070681_100393416 | 110 |
| 344 | 3300005458 | Ga0070681_10044751 | Ga0070681_100447514 | 110 |
| 345 | 3300005458 | Ga0070681_10061350 | Ga0070681_100613502 | 110 |
| 346 | 3300005458 | Ga0070681_10169614 | Ga0070681_101696143 | 110 |
| 347 | 3300005458 | Ga0070681_10330035 | Ga0070681_103300353 | 110 |
| 348 | 3300005458 | Ga0070681_10363900 | Ga0070681_103639001 | 110 |
| 349 | 3300005458 | Ga0070681_10543348 | Ga0070681_105433481 | 110 |
| 350 | 3300005458 | Ga0070681_10586316 | Ga0070681_105863161 | 110 |
| 351 | 3300005458 | Ga0070681_11206837 | Ga0070681_112068372 | 110 |
| 352 | 3300005458 | Ga0070681_11206838 | Ga0070681_112068382 | 110 |
| 353 | 3300005458 | Ga0070681_12049106 | Ga0070681_120491061 | 110 |
| 354 | 3300005459 | Ga0068867_100010994 | Ga0068867_1000109945 | 110 |
| 355 | 3300005459 | Ga0068867_100080320 | Ga0068867_1000803202 | 110 |
| 356 | 3300005459 | Ga0068867_100937268 | Ga0068867_1009372681 | 110 |
| 357 | 3300005459 | Ga0068867_101231203 | Ga0068867_1012312032 | 110 |
| 358 | 3300005459 | Ga0068867_101566659 | Ga0068867_1015666591 | 110 |
| 359 | 3300005466 | Ga0070685_10237064 | Ga0070685_102370642 | 110 |
| 360 | 3300005467 | Ga0070706_100180612 | Ga0070706_1001806123 | 110 |
| 361 | 3300005467 | Ga0070706_101174498 | Ga0070706_1011744982 | 110 |
| 362 | 3300005468 | Ga0070707_100172133 | Ga0070707_1001721333 | 110 |
| 363 | 3300005468 | Ga0070707_100338019 | Ga0070707_1003380192 | 110 |
| 364 | 3300005468 | Ga0070707_100748109 | Ga0070707_1007481092 | 110 |
| 365 | 3300005471 | Ga0070698_100012821 | Ga0070698_1000128218 | 110 |
| 366 | 3300005471 | Ga0070698_100033083 | Ga0070698_1000330835 | 110 |
| 367 | 3300005471 | Ga0070698_100060582 | Ga0070698_1000605824 | 110 |
| 368 | 3300005471 | Ga0070698_100245585 | Ga0070698_1002455853 | 110 |
| 369 | 3300005471 | Ga0070698_100297994 | Ga0070698_1002979942 | 110 |
| 370 | 3300005518 | Ga0070699_100075909 | Ga0070699_1000759093 | 110 |
| 371 | 3300005518 | Ga0070699_100142767 | Ga0070699_1001427671 | 110 |
| 372 | 3300005518 | Ga0070699_100269595 | Ga0070699_1002695951 | 110 |
| 373 | 3300005530 | Ga0070679_100000919 | Ga0070679_10000091910 | 110 |
| 374 | 3300005530 | Ga0070679_100001084 | Ga0070679_10000108425 | 110 |
| 375 | 3300005530 | Ga0070679_100006169 | Ga0070679_1000061696 | 110 |
| 376 | 3300005530 | Ga0070679_100043081 | Ga0070679_1000430811 | 110 |
| 377 | 3300005530 | Ga0070679_100043325 | Ga0070679_1000433255 | 110 |
| 378 | 3300005530 | Ga0070679_100095100 | Ga0070679_1000951003 | 110 |
| 379 | 3300005530 | Ga0070679_100245133 | Ga0070679_1002451333 | 110 |
| 380 | 3300005530 | Ga0070679_100359492 | Ga0070679_1003594922 | 110 |
| 381 | 3300005530 | Ga0070679_100408428 | Ga0070679_1004084282 | 110 |
| 382 | 3300005530 | Ga0070679_100670594 | Ga0070679_1006705942 | 110 |
| 383 | 3300005530 | Ga0070679_100702985 | Ga0070679_1007029852 | 110 |
| 384 | 3300005530 | Ga0070679_101279873 | Ga0070679_1012798732 | 110 |
| 385 | 3300005530 | Ga0070679_101506731 | Ga0070679_1015067311 | 110 |
| 386 | 3300005535 | Ga0070684_100006699 | Ga0070684_1000066995 | 110 |
| 387 | 3300005535 | Ga0070684_100024585 | Ga0070684_1000245853 | 110 |
| 388 | 3300005535 | Ga0070684_100038174 | Ga0070684_1000381744 | 110 |
| 389 | 3300005535 | Ga0070684_100043865 | Ga0070684_1000438654 | 110 |
| 390 | 3300005535 | Ga0070684_100076836 | Ga0070684_1000768363 | 110 |
| 391 | 3300005535 | Ga0070684_100297248 | Ga0070684_1002972482 | 110 |
| 392 | 3300005535 | Ga0070684_100301427 | Ga0070684_1003014273 | 110 |
| 393 | 3300005535 | Ga0070684_100365457 | Ga0070684_1003654572 | 110 |
| 394 | 3300005535 | Ga0070684_100387243 | Ga0070684_1003872433 | 110 |
| 395 | 3300005535 | Ga0070684_100390698 | Ga0070684_1003906982 | 110 |
| 396 | 3300005535 | Ga0070684_100725714 | Ga0070684_1007257142 | 110 |
| 397 | 3300005539 | Ga0068853_100013646 | Ga0068853_1000136463 | 110 |
| 398 | 3300005539 | Ga0068853_100016074 | Ga0068853_1000160747 | 110 |
| 399 | 3300005539 | Ga0068853_100487555 | Ga0068853_1004875552 | 110 |
| 400 | 3300005539 | Ga0068853_100531253 | Ga0068853_1005312532 | 110 |
| 401 | 3300005539 | Ga0068853_100600016 | Ga0068853_1006000162 | 110 |
| 402 | 3300005539 | Ga0068853_101020938 | Ga0068853_1010209382 | 110 |
| 403 | 3300005543 | Ga0070672_100004984 | Ga0070672_1000049842 | 110 |
| 404 | 3300005543 | Ga0070672_100005766 | Ga0070672_1000057667 | 110 |
| 405 | 3300005543 | Ga0070672_102093168 | Ga0070672_1020931682 | 110 |
| 406 | 3300005544 | Ga0070686_100256050 | Ga0070686_1002560501 | 110 |
| 407 | 3300005544 | Ga0070686_100505251 | Ga0070686_1005052512 | 110 |
| 408 | 3300005545 | Ga0070695_100246326 | Ga0070695_1002463263 | 110 |
| 409 | 3300005545 | Ga0070695_100441644 | Ga0070695_1004416442 | 110 |
| 410 | 3300005545 | Ga0070695_100461616 | Ga0070695_1004616162 | 110 |
| 411 | 3300005545 | Ga0070695_101161069 | Ga0070695_1011610691 | 110 |
| 412 | 3300005546 | Ga0070696_100001375 | Ga0070696_1000013758 | 110 |
| 413 | 3300005546 | Ga0070696_100077827 | Ga0070696_1000778273 | 110 |
| 414 | 3300005546 | Ga0070696_100091579 | Ga0070696_1000915793 | 110 |
| 415 | 3300005546 | Ga0070696_101883053 | Ga0070696_1018830531 | 110 |
| 416 | 3300005547 | Ga0070693_100008533 | Ga0070693_1000085333 | 110 |
| 417 | 3300005547 | Ga0070693_100057558 | Ga0070693_1000575581 | 110 |
| 418 | 3300005547 | Ga0070693_100503499 | Ga0070693_1005034992 | 110 |
| 419 | 3300005547 | Ga0070693_100912568 | Ga0070693_1009125681 | 110 |
| 420 | 3300005548 | Ga0070665_100042538 | Ga0070665_1000425383 | 110 |
| 421 | 3300005548 | Ga0070665_100052068 | Ga0070665_1000520685 | 110 |
| 422 | 3300005548 | Ga0070665_102600001 | Ga0070665_1026000012 | 110 |
| 423 | 3300005549 | Ga0070704_100227659 | Ga0070704_1002276592 | 110 |
| 424 | 3300005549 | Ga0070704_101093287 | Ga0070704_1010932871 | 110 |
| 425 | 3300005563 | Ga0068855_100002169 | Ga0068855_10000216922 | 110 |
| 426 | 3300005563 | Ga0068855_100005082 | Ga0068855_10000508213 | 110 |
| 427 | 3300005563 | Ga0068855_100008571 | Ga0068855_1000085717 | 110 |
| 428 | 3300005563 | Ga0068855_100043978 | Ga0068855_1000439785 | 110 |
| 429 | 3300005563 | Ga0068855_100366932 | Ga0068855_1003669323 | 110 |
| 430 | 3300005563 | Ga0068855_100381898 | Ga0068855_1003818982 | 110 |
| 431 | 3300005563 | Ga0068855_100990687 | Ga0068855_1009906871 | 110 |
| 432 | 3300005563 | Ga0068855_101054914 | Ga0068855_1010549142 | 110 |
| 433 | 3300005563 | Ga0068855_101547206 | Ga0068855_1015472061 | 110 |
| 434 | 3300005564 | Ga0070664_100013154 | Ga0070664_1000131542 | 110 |
| 435 | 3300005564 | Ga0070664_100024766 | Ga0070664_1000247663 | 110 |
| 436 | 3300005564 | Ga0070664_100051722 | Ga0070664_1000517224 | 110 |
| 437 | 3300005564 | Ga0070664_100485014 | Ga0070664_1004850142 | 110 |
| 438 | 3300005564 | Ga0070664_101004731 | Ga0070664_1010047311 | 110 |
| 439 | 3300005564 | Ga0070664_101389984 | Ga0070664_1013899842 | 110 |
| 440 | 3300005577 | Ga0068857_100012151 | Ga0068857_1000121512 | 110 |
| 441 | 3300005577 | Ga0068857_100015739 | Ga0068857_1000157398 | 110 |
| 442 | 3300005577 | Ga0068857_100020862 | Ga0068857_1000208624 | 110 |
| 443 | 3300005577 | Ga0068857_100087176 | Ga0068857_1000871763 | 110 |
| 444 | 3300005577 | Ga0068857_100736577 | Ga0068857_1007365772 | 110 |
| 445 | 3300005578 | Ga0068854_100034276 | Ga0068854_1000342764 | 110 |
| 446 | 3300005578 | Ga0068854_100053241 | Ga0068854_1000532414 | 110 |
| 447 | 3300005578 | Ga0068854_100420152 | Ga0068854_1004201522 | 110 |
| 448 | 3300005578 | Ga0068854_100745723 | Ga0068854_1007457232 | 110 |
| 449 | 3300005578 | Ga0068854_100790047 | Ga0068854_1007900472 | 110 |
| 450 | 3300005578 | Ga0068854_101739925 | Ga0068854_1017399252 | 110 |
| 451 | 3300005614 | Ga0068856_100364022 | Ga0068856_1003640222 | 110 |
| 452 | 3300005614 | Ga0068856_100457035 | Ga0068856_1004570351 | 110 |
| 453 | 3300005614 | Ga0068856_100648460 | Ga0068856_1006484602 | 110 |
| 454 | 3300005614 | Ga0068856_100680175 | Ga0068856_1006801751 | 110 |
| 455 | 3300005614 | Ga0068856_100941185 | Ga0068856_1009411852 | 110 |
| 456 | 3300005614 | Ga0068856_101002356 | Ga0068856_1010023562 | 110 |
| 457 | 3300005615 | Ga0070702_100518545 | Ga0070702_1005185451 | 110 |
| 458 | 3300005616 | Ga0068852_100014974 | Ga0068852_1000149742 | 110 |
| 459 | 3300005616 | Ga0068852_100018984 | Ga0068852_1000189843 | 110 |
| 460 | 3300005616 | Ga0068852_100069165 | Ga0068852_1000691652 | 110 |
| 461 | 3300005616 | Ga0068852_100192890 | Ga0068852_1001928902 | 110 |
| 462 | 3300005616 | Ga0068852_100202237 | Ga0068852_1002022371 | 110 |
| 463 | 3300005616 | Ga0068852_100546103 | Ga0068852_1005461032 | 110 |
| 464 | 3300005616 | Ga0068852_101434378 | Ga0068852_1014343782 | 110 |
| 465 | 3300005617 | Ga0068859_100056150 | Ga0068859_1000561503 | 110 |
| 466 | 3300005617 | Ga0068859_100897660 | Ga0068859_1008976601 | 110 |
| 467 | 3300005618 | Ga0068864_100038902 | Ga0068864_1000389023 | 110 |
| 468 | 3300005618 | Ga0068864_100318803 | Ga0068864_1003188032 | 110 |
| 469 | 3300005618 | Ga0068864_100369234 | Ga0068864_1003692342 | 110 |
| 470 | 3300005618 | Ga0068864_101236591 | Ga0068864_1012365912 | 110 |
| 471 | 3300005718 | Ga0068866_10116924 | Ga0068866_101169243 | 110 |
| 472 | 3300005718 | Ga0068866_10376060 | Ga0068866_103760602 | 110 |
| 473 | 3300005718 | Ga0068866_10812860 | Ga0068866_108128601 | 110 |
| 474 | 3300005719 | Ga0068861_100001019 | Ga0068861_10000101911 | 110 |
| 475 | 3300005719 | Ga0068861_100049474 | Ga0068861_1000494743 | 110 |
| 476 | 3300005719 | Ga0068861_100944581 | Ga0068861_1009445812 | 110 |
| 477 | 3300005834 | Ga0068851_10015465 | Ga0068851_100154652 | 110 |
| 478 | 3300005834 | Ga0068851_10071393 | Ga0068851_100713933 | 110 |
| 479 | 3300005834 | Ga0068851_10269088 | Ga0068851_102690882 | 110 |
| 480 | 3300005840 | Ga0068870_10002079 | Ga0068870_100020798 | 110 |
| 481 | 3300005840 | Ga0068870_10304076 | Ga0068870_103040762 | 110 |
| 482 | 3300005840 | Ga0068870_10428249 | Ga0068870_104282492 | 110 |
| 483 | 3300005840 | Ga0068870_10492048 | Ga0068870_104920482 | 110 |
| 484 | 3300005841 | Ga0068863_100041206 | Ga0068863_1000412064 | 110 |
| 485 | 3300005841 | Ga0068863_100160660 | Ga0068863_1001606602 | 110 |
| 486 | 3300005841 | Ga0068863_100319991 | Ga0068863_1003199912 | 110 |
| 487 | 3300005842 | Ga0068858_100022826 | Ga0068858_1000228262 | 110 |
| 488 | 3300005843 | Ga0068860_100227646 | Ga0068860_1002276463 | 110 |
| 489 | 3300005843 | Ga0068860_100535547 | Ga0068860_1005355472 | 110 |
| 490 | 3300005844 | Ga0068862_100000376 | Ga0068862_10000037611 | 110 |
| 491 | 3300005844 | Ga0068862_100030151 | Ga0068862_1000301515 | 110 |
| 492 | 3300005844 | Ga0068862_100126281 | Ga0068862_1001262813 | 110 |
| 493 | 3300005937 | Ga0081455_10038603 | Ga0081455_100386033 | 110 |
| 494 | 3300005937 | Ga0081455_10050687 | Ga0081455_100506873 | 110 |
| 495 | 3300005985 | Ga0081539_10000104 | Ga0081539_10000104179 | 110 |
| 496 | 3300005985 | Ga0081539_10043960 | Ga0081539_100439603 | 110 |
| 497 | 3300005985 | Ga0081539_10230857 | Ga0081539_102308571 | 110 |
| 498 | 3300006028 | Ga0070717_10016213 | Ga0070717_100162136 | 110 |
| 499 | 3300006028 | Ga0070717_10418219 | Ga0070717_104182193 | 110 |
| 500 | 3300006028 | Ga0070717_10918133 | Ga0070717_109181331 | 110 |
| 501 | 3300006058 | Ga0075432_10382237 | Ga0075432_103822372 | 110 |
| 502 | 3300006173 | Ga0070716_100172719 | Ga0070716_1001727192 | 110 |
| 503 | 3300006173 | Ga0070716_100338785 | Ga0070716_1003387852 | 110 |
| 504 | 3300006173 | Ga0070716_100489729 | Ga0070716_1004897292 | 110 |
| 505 | 3300006173 | Ga0070716_100573872 | Ga0070716_1005738722 | 110 |
| 506 | 3300006173 | Ga0070716_100851716 | Ga0070716_1008517162 | 110 |
| 507 | 3300006175 | Ga0070712_100012458 | Ga0070712_1000124585 | 110 |
| 508 | 3300006175 | Ga0070712_100028870 | Ga0070712_1000288702 | 110 |
| 509 | 3300006175 | Ga0070712_100062454 | Ga0070712_1000624544 | 110 |
| 510 | 3300006175 | Ga0070712_100347417 | Ga0070712_1003474172 | 110 |
| 511 | 3300006175 | Ga0070712_100413145 | Ga0070712_1004131452 | 110 |
| 512 | 3300006175 | Ga0070712_100488267 | Ga0070712_1004882671 | 110 |
| 513 | 3300006358 | Ga0068871_100407653 | Ga0068871_1004076532 | 110 |
| 514 | 3300006844 | Ga0075428_100235434 | Ga0075428_1002354343 | 110 |
| 515 | 3300006844 | Ga0075428_100397778 | Ga0075428_1003977782 | 110 |
| 516 | 3300006844 | Ga0075428_101094780 | Ga0075428_1010947801 | 110 |
| 517 | 3300006844 | Ga0075428_101376680 | Ga0075428_1013766802 | 110 |
| 518 | 3300006844 | Ga0075428_101708408 | Ga0075428_1017084081 | 110 |
| 519 | 3300006846 | Ga0075430_100003192 | Ga0075430_1000031923 | 110 |
| 520 | 3300006846 | Ga0075430_100013015 | Ga0075430_1000130154 | 110 |
| 521 | 3300006846 | Ga0075430_100019170 | Ga0075430_1000191704 | 110 |
| 522 | 3300006846 | Ga0075430_100029938 | Ga0075430_1000299385 | 110 |
| 523 | 3300006846 | Ga0075430_100194674 | Ga0075430_1001946741 | 110 |
| 524 | 3300006846 | Ga0075430_100269583 | Ga0075430_1002695833 | 110 |
| 525 | 3300006847 | Ga0075431_100024864 | Ga0075431_1000248645 | 110 |
| 526 | 3300006847 | Ga0075431_100037185 | Ga0075431_1000371853 | 110 |
| 527 | 3300006847 | Ga0075431_100053473 | Ga0075431_1000534732 | 110 |
| 528 | 3300006847 | Ga0075431_100065457 | Ga0075431_1000654573 | 110 |
| 529 | 3300006847 | Ga0075431_100076205 | Ga0075431_1000762053 | 110 |
| 530 | 3300006847 | Ga0075431_100186854 | Ga0075431_1001868543 | 110 |
| 531 | 3300006847 | Ga0075431_100236239 | Ga0075431_1002362392 | 110 |
| 532 | 3300006847 | Ga0075431_100247272 | Ga0075431_1002472722 | 110 |
| 533 | 3300006847 | Ga0075431_100373540 | Ga0075431_1003735402 | 110 |
| 534 | 3300006852 | Ga0075433_10005348 | Ga0075433_100053488 | 110 |
| 535 | 3300006852 | Ga0075433_10718897 | Ga0075433_107188972 | 110 |
| 536 | 3300006871 | Ga0075434_100001804 | Ga0075434_10000180421 | 110 |
| 537 | 3300006871 | Ga0075434_100035507 | Ga0075434_1000355074 | 110 |
| 538 | 3300006871 | Ga0075434_100244634 | Ga0075434_1002446341 | 110 |
| 539 | 3300006871 | Ga0075434_100881508 | Ga0075434_1008815082 | 110 |
| 540 | 3300006880 | Ga0075429_100067642 | Ga0075429_1000676423 | 110 |
| 541 | 3300006880 | Ga0075429_100208196 | Ga0075429_1002081963 | 110 |
| 542 | 3300006880 | Ga0075429_100453510 | Ga0075429_1004535102 | 110 |
| 543 | 3300006880 | Ga0075429_100470855 | Ga0075429_1004708552 | 110 |
| 544 | 3300006881 | Ga0068865_100001514 | Ga0068865_1000015148 | 110 |
| 545 | 3300006881 | Ga0068865_100628234 | Ga0068865_1006282342 | 110 |
| 546 | 3300006914 | Ga0075436_100114952 | Ga0075436_1001149523 | 110 |
| 547 | 3300006914 | Ga0075436_100209048 | Ga0075436_1002090481 | 110 |
| 548 | 3300006931 | Ga0097620_100056151 | Ga0097620_1000561513 | 110 |
| 549 | 3300006931 | Ga0097620_100897771 | Ga0097620_1008977711 | 110 |
| 550 | 3300007076 | Ga0075435_100694998 | Ga0075435_1006949981 | 110 |
| 551 | 3300007076 | Ga0075435_100980540 | Ga0075435_1009805402 | 110 |
| 552 | 3300007076 | Ga0075435_101112837 | Ga0075435_1011128372 | 110 |
| 553 | 3300009093 | Ga0105240_10009204 | Ga0105240_100092048 | 110 |
| 554 | 3300009093 | Ga0105240_10011015 | Ga0105240_100110156 | 110 |
| 555 | 3300009093 | Ga0105240_10016684 | Ga0105240_100166843 | 110 |
| 556 | 3300009093 | Ga0105240_10037426 | Ga0105240_100374262 | 110 |
| 557 | 3300009093 | Ga0105240_10070716 | Ga0105240_100707163 | 110 |
| 558 | 3300009093 | Ga0105240_10074073 | Ga0105240_100740734 | 110 |
| 559 | 3300009093 | Ga0105240_10090200 | Ga0105240_100902004 | 110 |
| 560 | 3300009093 | Ga0105240_10705779 | Ga0105240_107057792 | 110 |
| 561 | 3300009093 | Ga0105240_10890443 | Ga0105240_108904432 | 110 |
| 562 | 3300009093 | Ga0105240_11048922 | Ga0105240_110489221 | 110 |
| 563 | 3300009094 | Ga0111539_10042342 | Ga0111539_100423425 | 110 |
| 564 | 3300009094 | Ga0111539_10088891 | Ga0111539_100888913 | 110 |
| 565 | 3300009094 | Ga0111539_10150269 | Ga0111539_101502693 | 110 |
| 566 | 3300009094 | Ga0111539_10251608 | Ga0111539_102516083 | 110 |
| 567 | 3300009094 | Ga0111539_10920564 | Ga0111539_109205642 | 110 |
| 568 | 3300009098 | Ga0105245_10025521 | Ga0105245_100255213 | 110 |
| 569 | 3300009098 | Ga0105245_12730105 | Ga0105245_127301052 | 110 |
| 570 | 3300009147 | Ga0114129_10017266 | Ga0114129_100172668 | 110 |
| 571 | 3300009147 | Ga0114129_10068560 | Ga0114129_100685606 | 110 |
| 572 | 3300009147 | Ga0114129_10230022 | Ga0114129_102300223 | 110 |
| 573 | 3300009147 | Ga0114129_10273868 | Ga0114129_102738683 | 110 |
| 574 | 3300009147 | Ga0114129_10299783 | Ga0114129_102997833 | 110 |
| 575 | 3300009147 | Ga0114129_10477216 | Ga0114129_104772162 | 110 |
| 576 | 3300009147 | Ga0114129_10941962 | Ga0114129_109419622 | 110 |
| 577 | 3300009147 | Ga0114129_11407312 | Ga0114129_114073122 | 110 |
| 578 | 3300009148 | Ga0105243_10242951 | Ga0105243_102429512 | 110 |
| 579 | 3300009148 | Ga0105243_10590746 | Ga0105243_105907462 | 110 |
| 580 | 3300009174 | Ga0105241_10000729 | Ga0105241_1000072912 | 110 |
| 581 | 3300009174 | Ga0105241_10116790 | Ga0105241_101167903 | 110 |
| 582 | 3300009174 | Ga0105241_10169367 | Ga0105241_101693673 | 110 |
| 583 | 3300009174 | Ga0105241_10525033 | Ga0105241_105250332 | 110 |
| 584 | 3300009174 | Ga0105241_10717479 | Ga0105241_107174792 | 110 |
| 585 | 3300009174 | Ga0105241_11098168 | Ga0105241_110981682 | 110 |
| 586 | 3300009176 | Ga0105242_10015995 | Ga0105242_100159955 | 110 |
| 587 | 3300009176 | Ga0105242_10181321 | Ga0105242_101813213 | 110 |
| 588 | 3300009176 | Ga0105242_10993453 | Ga0105242_109934532 | 110 |
| 589 | 3300009176 | Ga0105242_11994438 | Ga0105242_119944381 | 110 |
| 590 | 3300009177 | Ga0105248_10009365 | Ga0105248_100093656 | 110 |
| 591 | 3300009177 | Ga0105248_10104035 | Ga0105248_101040354 | 110 |
| 592 | 3300009177 | Ga0105248_10916580 | Ga0105248_109165801 | 110 |
| 593 | 3300009177 | Ga0105248_12078802 | Ga0105248_120788021 | 110 |
| 594 | 3300009545 | Ga0105237_10079939 | Ga0105237_100799392 | 110 |
| 595 | 3300009545 | Ga0105237_10149201 | Ga0105237_101492013 | 110 |
| 596 | 3300009545 | Ga0105237_10431669 | Ga0105237_104316692 | 110 |
| 597 | 3300009545 | Ga0105237_10472521 | Ga0105237_104725212 | 110 |
| 598 | 3300009545 | Ga0105237_11127262 | Ga0105237_111272622 | 110 |
| 599 | 3300009551 | Ga0105238_10024368 | Ga0105238_100243683 | 110 |
| 600 | 3300009551 | Ga0105238_10066363 | Ga0105238_100663633 | 110 |
| 601 | 3300009551 | Ga0105238_10073038 | Ga0105238_100730383 | 110 |
| 602 | 3300009551 | Ga0105238_10087946 | Ga0105238_100879463 | 110 |
| 603 | 3300009551 | Ga0105238_10816832 | Ga0105238_108168322 | 110 |
| 604 | 3300009551 | Ga0105238_11465449 | Ga0105238_114654492 | 110 |
| 605 | 3300009551 | Ga0105238_12277478 | Ga0105238_122774781 | 110 |
| 606 | 3300009553 | Ga0105249_10000454 | Ga0105249_1000045429 | 110 |
| 607 | 3300009553 | Ga0105249_10069734 | Ga0105249_100697343 | 110 |
| 608 | 3300009553 | Ga0105249_10325281 | Ga0105249_103252813 | 110 |
| 609 | 3300009553 | Ga0105249_10809129 | Ga0105249_108091292 | 110 |
| 610 | 3300010375 | Ga0105239_10231952 | Ga0105239_102319523 | 110 |
| 611 | 3300010375 | Ga0105239_10259676 | Ga0105239_102596762 | 110 |
| 612 | 3300010375 | Ga0105239_10382025 | Ga0105239_103820252 | 110 |
| 613 | 3300010375 | Ga0105239_11245419 | Ga0105239_112454192 | 110 |
| 614 | 3300011119 | Ga0105246_10471626 | Ga0105246_104716262 | 110 |
| 615 | 3300012507 | Ga0157342_1073673 | Ga0157342_10736731 | 110 |
| 616 | 3300013100 | Ga0157373_10001473 | Ga0157373_1000147313 | 110 |
| 617 | 3300013100 | Ga0157373_10027655 | Ga0157373_100276554 | 110 |
| 618 | 3300013100 | Ga0157373_10091952 | Ga0157373_100919521 | 110 |
| 619 | 3300013100 | Ga0157373_10152454 | Ga0157373_101524543 | 110 |
| 620 | 3300013100 | Ga0157373_10201626 | Ga0157373_102016261 | 110 |
| 621 | 3300013100 | Ga0157373_10237167 | Ga0157373_102371671 | 110 |
| 622 | 3300013100 | Ga0157373_11331309 | Ga0157373_113313092 | 110 |
| 623 | 3300013102 | Ga0157371_10007275 | Ga0157371_1000727510 | 110 |
| 624 | 3300013102 | Ga0157371_10714457 | Ga0157371_107144571 | 110 |
| 625 | 3300013102 | Ga0157371_10743094 | Ga0157371_107430942 | 110 |
| 626 | 3300013102 | Ga0157371_11534102 | Ga0157371_115341022 | 110 |
| 627 | 3300013104 | Ga0157370_10003508 | Ga0157370_100035088 | 110 |
| 628 | 3300013104 | Ga0157370_10008754 | Ga0157370_100087543 | 110 |
| 629 | 3300013104 | Ga0157370_10041763 | Ga0157370_100417634 | 110 |
| 630 | 3300013104 | Ga0157370_10136189 | Ga0157370_101361891 | 110 |
| 631 | 3300013104 | Ga0157370_10165029 | Ga0157370_101650291 | 110 |
| 632 | 3300013104 | Ga0157370_10166493 | Ga0157370_101664932 | 110 |
| 633 | 3300013104 | Ga0157370_10282223 | Ga0157370_102822233 | 110 |
| 634 | 3300013104 | Ga0157370_10861985 | Ga0157370_108619852 | 110 |
| 635 | 3300013104 | Ga0157370_11117989 | Ga0157370_111179891 | 110 |
| 636 | 3300013104 | Ga0157370_11609613 | Ga0157370_116096132 | 110 |
| 637 | 3300013105 | Ga0157369_10009705 | Ga0157369_100097055 | 110 |
| 638 | 3300013105 | Ga0157369_10017338 | Ga0157369_100173384 | 110 |
| 639 | 3300013105 | Ga0157369_10073925 | Ga0157369_100739254 | 110 |
| 640 | 3300013105 | Ga0157369_10115485 | Ga0157369_101154852 | 110 |
| 641 | 3300013105 | Ga0157369_10117595 | Ga0157369_101175954 | 110 |
| 642 | 3300013105 | Ga0157369_10119385 | Ga0157369_101193853 | 110 |
| 643 | 3300013105 | Ga0157369_10232225 | Ga0157369_102322253 | 110 |
| 644 | 3300013105 | Ga0157369_10232838 | Ga0157369_102328381 | 110 |
| 645 | 3300013105 | Ga0157369_10739412 | Ga0157369_107394121 | 110 |
| 646 | 3300013105 | Ga0157369_10743766 | Ga0157369_107437662 | 110 |
| 647 | 3300013105 | Ga0157369_11755948 | Ga0157369_117559481 | 110 |
| 648 | 3300013296 | Ga0157374_10433589 | Ga0157374_104335891 | 110 |
| 649 | 3300013296 | Ga0157374_10990234 | Ga0157374_109902342 | 110 |
| 650 | 3300013296 | Ga0157374_11098074 | Ga0157374_110980742 | 110 |
| 651 | 3300013296 | Ga0157374_11385070 | Ga0157374_113850702 | 110 |
| 652 | 3300013296 | Ga0157374_12425697 | Ga0157374_124256972 | 110 |
| 653 | 3300013297 | Ga0157378_10005002 | Ga0157378_1000500210 | 110 |
| 654 | 3300013297 | Ga0157378_10429050 | Ga0157378_104290502 | 110 |
| 655 | 3300013306 | Ga0163162_10001492 | Ga0163162_1000149222 | 110 |
| 656 | 3300013306 | Ga0163162_10013828 | Ga0163162_100138282 | 110 |
| 657 | 3300013306 | Ga0163162_12869838 | Ga0163162_128698381 | 110 |
| 658 | 3300013307 | Ga0157372_10010171 | Ga0157372_100101714 | 110 |
| 659 | 3300013307 | Ga0157372_10013087 | Ga0157372_100130871 | 110 |
| 660 | 3300013307 | Ga0157372_10015470 | Ga0157372_100154708 | 110 |
| 661 | 3300013307 | Ga0157372_10025540 | Ga0157372_100255408 | 110 |
| 662 | 3300013307 | Ga0157372_10068103 | Ga0157372_100681033 | 110 |
| 663 | 3300013307 | Ga0157372_10118363 | Ga0157372_101183633 | 110 |
| 664 | 3300013307 | Ga0157372_10124994 | Ga0157372_101249944 | 110 |
| 665 | 3300013307 | Ga0157372_10252248 | Ga0157372_102522483 | 110 |
| 666 | 3300013307 | Ga0157372_10317512 | Ga0157372_103175121 | 110 |
| 667 | 3300013307 | Ga0157372_10367523 | Ga0157372_103675232 | 110 |
| 668 | 3300013307 | Ga0157372_10382231 | Ga0157372_103822313 | 110 |
| 669 | 3300013307 | Ga0157372_10509511 | Ga0157372_105095112 | 110 |
| 670 | 3300013307 | Ga0157372_10519876 | Ga0157372_105198762 | 110 |
| 671 | 3300013307 | Ga0157372_10617092 | Ga0157372_106170922 | 110 |
| 672 | 3300013307 | Ga0157372_10636435 | Ga0157372_106364353 | 110 |
| 673 | 3300013307 | Ga0157372_10659924 | Ga0157372_106599241 | 110 |
| 674 | 3300013307 | Ga0157372_11287462 | Ga0157372_112874621 | 110 |
| 675 | 3300013307 | Ga0157372_11664064 | Ga0157372_116640642 | 110 |
| 676 | 3300013307 | Ga0157372_11736237 | Ga0157372_117362372 | 110 |
| 677 | 3300013307 | Ga0157372_11902482 | Ga0157372_119024822 | 110 |
| 678 | 3300013307 | Ga0157372_12279322 | Ga0157372_122793221 | 110 |
| 679 | 3300013307 | Ga0157372_12346199 | Ga0157372_123461992 | 110 |
| 680 | 3300013307 | Ga0157372_12369999 | Ga0157372_123699991 | 110 |
| 681 | 3300013307 | Ga0157372_12614981 | Ga0157372_126149811 | 110 |
| 682 | 3300013308 | Ga0157375_10091745 | Ga0157375_100917452 | 110 |
| 683 | 3300013308 | Ga0157375_10100651 | Ga0157375_101006512 | 110 |
| 684 | 3300013308 | Ga0157375_10294846 | Ga0157375_102948462 | 110 |
| 685 | 3300013308 | Ga0157375_10840832 | Ga0157375_108408322 | 110 |
| 686 | 3300014325 | Ga0163163_10070485 | Ga0163163_100704852 | 110 |
| 687 | 3300014325 | Ga0163163_10660291 | Ga0163163_106602912 | 110 |
| 688 | 3300014326 | Ga0157380_10007646 | Ga0157380_100076467 | 110 |
| 689 | 3300014326 | Ga0157380_10033634 | Ga0157380_100336342 | 110 |
| 690 | 3300014326 | Ga0157380_10148905 | Ga0157380_101489052 | 110 |
| 691 | 3300014326 | Ga0157380_12670253 | Ga0157380_126702531 | 110 |
| 692 | 3300014497 | Ga0182008_10009299 | Ga0182008_100092993 | 110 |
| 693 | 3300014497 | Ga0182008_10081193 | Ga0182008_100811933 | 110 |
| 694 | 3300014745 | Ga0157377_10031866 | Ga0157377_100318663 | 110 |
| 695 | 3300014968 | Ga0157379_10015608 | Ga0157379_100156082 | 110 |
| 696 | 3300014969 | Ga0157376_10225367 | Ga0157376_102253673 | 110 |
| 697 | 3300014969 | Ga0157376_11883363 | Ga0157376_118833631 | 110 |
| 698 | 3300015262 | Ga0182007_10042612 | Ga0182007_100426122 | 110 |
| 699 | 3300015262 | Ga0182007_10073079 | Ga0182007_100730792 | 110 |
| 700 | 3300015262 | Ga0182007_10210130 | Ga0182007_102101302 | 110 |
| 701 | 3300015262 | Ga0182007_10215945 | Ga0182007_102159452 | 110 |
| 702 | 3300015262 | Ga0182007_10254854 | Ga0182007_102548542 | 110 |
| 703 | 3300015265 | Ga0182005_1079726 | Ga0182005_10797263 | 110 |
| 704 | 3300017792 | Ga0163161_11802713 | Ga0163161_118027131 | 110 |
| 705 | 3300020069 | Ga0197907_11166881 | Ga0197907_111668812 | 110 |
| 706 | 3300020069 | Ga0197907_11314107 | Ga0197907_113141071 | 110 |
| 707 | 3300020070 | Ga0206356_10116592 | Ga0206356_101165922 | 110 |
| 708 | 3300020070 | Ga0206356_10125692 | Ga0206356_101256922 | 110 |
| 709 | 3300020070 | Ga0206356_10416445 | Ga0206356_104164452 | 110 |
| 710 | 3300020070 | Ga0206356_10483138 | Ga0206356_104831381 | 110 |
| 711 | 3300020070 | Ga0206356_10839536 | Ga0206356_108395362 | 110 |
| 712 | 3300020070 | Ga0206356_11361504 | Ga0206356_113615041 | 110 |
| 713 | 3300020070 | Ga0206356_11525656 | Ga0206356_115256562 | 110 |
| 714 | 3300020070 | Ga0206356_11642972 | Ga0206356_116429721 | 110 |
| 715 | 3300020070 | Ga0206356_11798847 | Ga0206356_117988471 | 110 |
| 716 | 3300020076 | Ga0206355_1012074 | Ga0206355_10120741 | 110 |
| 717 | 3300020076 | Ga0206355_1360271 | Ga0206355_13602712 | 110 |
| 718 | 3300020078 | Ga0206352_10641371 | Ga0206352_106413711 | 110 |
| 719 | 3300020078 | Ga0206352_10860556 | Ga0206352_108605562 | 110 |
| 720 | 3300020078 | Ga0206352_10936146 | Ga0206352_109361462 | 110 |
| 721 | 3300020078 | Ga0206352_11130402 | Ga0206352_111304022 | 110 |
| 722 | 3300020078 | Ga0206352_11362427 | Ga0206352_113624272 | 110 |
| 723 | 3300020080 | Ga0206350_10135957 | Ga0206350_101359572 | 110 |
| 724 | 3300021384 | Ga0213876_10040236 | Ga0213876_100402362 | 110 |
| 725 | 3300022467 | Ga0224712_10152424 | Ga0224712_101524242 | 110 |
| 726 | 3300022467 | Ga0224712_10316866 | Ga0224712_103168662 | 110 |
| 727 | 3300022467 | Ga0224712_10352983 | Ga0224712_103529831 | 110 |
| 728 | 3300022467 | Ga0224712_10681828 | Ga0224712_106818281 | 110 |
| 729 | 3300025271 | Ga0207666_1047325 | Ga0207666_10473252 | 110 |
| 730 | 3300025290 | Ga0207673_1009498 | Ga0207673_10094982 | 110 |
| 731 | 3300025315 | Ga0207697_10005445 | Ga0207697_100054454 | 110 |
| 732 | 3300025321 | Ga0207656_10006385 | Ga0207656_100063855 | 110 |
| 733 | 3300025321 | Ga0207656_10172199 | Ga0207656_101721992 | 110 |
| 734 | 3300025885 | Ga0207653_10092535 | Ga0207653_100925351 | 110 |
| 735 | 3300025893 | Ga0207682_10168826 | Ga0207682_101688262 | 110 |
| 736 | 3300025898 | Ga0207692_10101751 | Ga0207692_101017513 | 110 |
| 737 | 3300025898 | Ga0207692_10231793 | Ga0207692_102317932 | 110 |
| 738 | 3300025899 | Ga0207642_10150415 | Ga0207642_101504153 | 110 |
| 739 | 3300025901 | Ga0207688_10023241 | Ga0207688_100232412 | 110 |
| 740 | 3300025903 | Ga0207680_10213827 | Ga0207680_102138271 | 110 |
| 741 | 3300025903 | Ga0207680_10821322 | Ga0207680_108213222 | 110 |
| 742 | 3300025904 | Ga0207647_10195587 | Ga0207647_101955872 | 110 |
| 743 | 3300025905 | Ga0207685_10513020 | Ga0207685_105130202 | 110 |
| 744 | 3300025906 | Ga0207699_10008459 | Ga0207699_100084593 | 110 |
| 745 | 3300025906 | Ga0207699_10045530 | Ga0207699_100455302 | 110 |
| 746 | 3300025906 | Ga0207699_10106448 | Ga0207699_101064483 | 110 |
| 747 | 3300025906 | Ga0207699_10106541 | Ga0207699_101065413 | 110 |
| 748 | 3300025907 | Ga0207645_10000246 | Ga0207645_1000024621 | 110 |
| 749 | 3300025907 | Ga0207645_10067632 | Ga0207645_100676324 | 110 |
| 750 | 3300025908 | Ga0207643_10001951 | Ga0207643_100019512 | 110 |
| 751 | 3300025908 | Ga0207643_10131229 | Ga0207643_101312292 | 110 |
| 752 | 3300025908 | Ga0207643_10266169 | Ga0207643_102661691 | 110 |
| 753 | 3300025909 | Ga0207705_10007986 | Ga0207705_100079868 | 110 |
| 754 | 3300025909 | Ga0207705_10085948 | Ga0207705_100859484 | 110 |
| 755 | 3300025909 | Ga0207705_10089643 | Ga0207705_100896434 | 110 |
| 756 | 3300025909 | Ga0207705_10092825 | Ga0207705_100928253 | 110 |
| 757 | 3300025909 | Ga0207705_10104101 | Ga0207705_101041013 | 110 |
| 758 | 3300025909 | Ga0207705_10568143 | Ga0207705_105681432 | 110 |
| 759 | 3300025910 | Ga0207684_10135612 | Ga0207684_101356123 | 110 |
| 760 | 3300025910 | Ga0207684_10299794 | Ga0207684_102997943 | 110 |
| 761 | 3300025910 | Ga0207684_11568418 | Ga0207684_115684181 | 110 |
| 762 | 3300025911 | Ga0207654_10000860 | Ga0207654_1000086012 | 110 |
| 763 | 3300025911 | Ga0207654_10222487 | Ga0207654_102224871 | 110 |
| 764 | 3300025911 | Ga0207654_10324081 | Ga0207654_103240811 | 110 |
| 765 | 3300025911 | Ga0207654_10756775 | Ga0207654_107567752 | 110 |
| 766 | 3300025911 | Ga0207654_10955665 | Ga0207654_109556652 | 110 |
| 767 | 3300025912 | Ga0207707_10000929 | Ga0207707_100009298 | 110 |
| 768 | 3300025912 | Ga0207707_10002146 | Ga0207707_1000214616 | 110 |
| 769 | 3300025912 | Ga0207707_10002891 | Ga0207707_100028916 | 110 |
| 770 | 3300025912 | Ga0207707_10007791 | Ga0207707_100077917 | 110 |
| 771 | 3300025912 | Ga0207707_10013410 | Ga0207707_100134105 | 110 |
| 772 | 3300025912 | Ga0207707_10018294 | Ga0207707_100182943 | 110 |
| 773 | 3300025912 | Ga0207707_10021378 | Ga0207707_100213785 | 110 |
| 774 | 3300025912 | Ga0207707_10029197 | Ga0207707_100291973 | 110 |
| 775 | 3300025912 | Ga0207707_10075721 | Ga0207707_100757215 | 110 |
| 776 | 3300025912 | Ga0207707_10138032 | Ga0207707_101380323 | 110 |
| 777 | 3300025912 | Ga0207707_10629028 | Ga0207707_106290282 | 110 |
| 778 | 3300025912 | Ga0207707_10649450 | Ga0207707_106494501 | 110 |
| 779 | 3300025912 | Ga0207707_11269747 | Ga0207707_112697472 | 110 |
| 780 | 3300025913 | Ga0207695_10001441 | Ga0207695_1000144123 | 110 |
| 781 | 3300025913 | Ga0207695_10004676 | Ga0207695_1000467613 | 110 |
| 782 | 3300025913 | Ga0207695_10008984 | Ga0207695_100089847 | 110 |
| 783 | 3300025913 | Ga0207695_10014206 | Ga0207695_100142065 | 110 |
| 784 | 3300025913 | Ga0207695_10020766 | Ga0207695_100207662 | 110 |
| 785 | 3300025913 | Ga0207695_10064710 | Ga0207695_100647103 | 110 |
| 786 | 3300025913 | Ga0207695_10081615 | Ga0207695_100816152 | 110 |
| 787 | 3300025913 | Ga0207695_10084488 | Ga0207695_100844881 | 110 |
| 788 | 3300025914 | Ga0207671_10019018 | Ga0207671_100190182 | 110 |
| 789 | 3300025914 | Ga0207671_10131053 | Ga0207671_101310533 | 110 |
| 790 | 3300025914 | Ga0207671_10390182 | Ga0207671_103901822 | 110 |
| 791 | 3300025915 | Ga0207693_10019839 | Ga0207693_100198395 | 110 |
| 792 | 3300025915 | Ga0207693_10041127 | Ga0207693_100411275 | 110 |
| 793 | 3300025915 | Ga0207693_10361743 | Ga0207693_103617432 | 110 |
| 794 | 3300025915 | Ga0207693_10406055 | Ga0207693_104060553 | 110 |
| 795 | 3300025915 | Ga0207693_10410453 | Ga0207693_104104532 | 110 |
| 796 | 3300025915 | Ga0207693_10421808 | Ga0207693_104218081 | 110 |
| 797 | 3300025915 | Ga0207693_10613331 | Ga0207693_106133312 | 110 |
| 798 | 3300025916 | Ga0207663_10001490 | Ga0207663_1000149012 | 110 |
| 799 | 3300025916 | Ga0207663_10080650 | Ga0207663_100806503 | 110 |
| 800 | 3300025916 | Ga0207663_10172527 | Ga0207663_101725272 | 110 |
| 801 | 3300025916 | Ga0207663_10243302 | Ga0207663_102433022 | 110 |
| 802 | 3300025916 | Ga0207663_10898578 | Ga0207663_108985782 | 110 |
| 803 | 3300025916 | Ga0207663_11205783 | Ga0207663_112057831 | 110 |
| 804 | 3300025917 | Ga0207660_10001809 | Ga0207660_100018099 | 110 |
| 805 | 3300025917 | Ga0207660_10017662 | Ga0207660_100176625 | 110 |
| 806 | 3300025917 | Ga0207660_10032222 | Ga0207660_100322223 | 110 |
| 807 | 3300025917 | Ga0207660_10065650 | Ga0207660_100656503 | 110 |
| 808 | 3300025917 | Ga0207660_10087746 | Ga0207660_100877463 | 110 |
| 809 | 3300025917 | Ga0207660_10101186 | Ga0207660_101011863 | 110 |
| 810 | 3300025917 | Ga0207660_10141654 | Ga0207660_101416542 | 110 |
| 811 | 3300025917 | Ga0207660_10218233 | Ga0207660_102182332 | 110 |
| 812 | 3300025917 | Ga0207660_10239322 | Ga0207660_102393222 | 110 |
| 813 | 3300025917 | Ga0207660_10918590 | Ga0207660_109185901 | 110 |
| 814 | 3300025917 | Ga0207660_11133214 | Ga0207660_111332141 | 110 |
| 815 | 3300025918 | Ga0207662_10003841 | Ga0207662_100038413 | 110 |
| 816 | 3300025918 | Ga0207662_10244175 | Ga0207662_102441753 | 110 |
| 817 | 3300025919 | Ga0207657_10005262 | Ga0207657_1000526213 | 110 |
| 818 | 3300025919 | Ga0207657_10021232 | Ga0207657_100212322 | 110 |
| 819 | 3300025919 | Ga0207657_10250158 | Ga0207657_102501582 | 110 |
| 820 | 3300025919 | Ga0207657_10541662 | Ga0207657_105416622 | 110 |
| 821 | 3300025919 | Ga0207657_10685639 | Ga0207657_106856392 | 110 |
| 822 | 3300025919 | Ga0207657_11469464 | Ga0207657_114694641 | 110 |
| 823 | 3300025920 | Ga0207649_10029427 | Ga0207649_100294274 | 110 |
| 824 | 3300025920 | Ga0207649_10050337 | Ga0207649_100503372 | 110 |
| 825 | 3300025920 | Ga0207649_10096437 | Ga0207649_100964373 | 110 |
| 826 | 3300025920 | Ga0207649_10165257 | Ga0207649_101652572 | 110 |
| 827 | 3300025920 | Ga0207649_10174948 | Ga0207649_101749482 | 110 |
| 828 | 3300025920 | Ga0207649_10852542 | Ga0207649_108525422 | 110 |
| 829 | 3300025921 | Ga0207652_10000470 | Ga0207652_1000047020 | 110 |
| 830 | 3300025921 | Ga0207652_10003423 | Ga0207652_1000342311 | 110 |
| 831 | 3300025921 | Ga0207652_10007324 | Ga0207652_100073243 | 110 |
| 832 | 3300025921 | Ga0207652_10020285 | Ga0207652_100202855 | 110 |
| 833 | 3300025921 | Ga0207652_10022221 | Ga0207652_100222213 | 110 |
| 834 | 3300025921 | Ga0207652_10024204 | Ga0207652_100242044 | 110 |
| 835 | 3300025921 | Ga0207652_10031148 | Ga0207652_100311484 | 110 |
| 836 | 3300025921 | Ga0207652_10086061 | Ga0207652_100860612 | 110 |
| 837 | 3300025921 | Ga0207652_10088832 | Ga0207652_100888321 | 110 |
| 838 | 3300025921 | Ga0207652_10267542 | Ga0207652_102675422 | 110 |
| 839 | 3300025921 | Ga0207652_10564050 | Ga0207652_105640501 | 110 |
| 840 | 3300025921 | Ga0207652_11525639 | Ga0207652_115256391 | 110 |
| 841 | 3300025922 | Ga0207646_10142024 | Ga0207646_101420242 | 110 |
| 842 | 3300025922 | Ga0207646_10424101 | Ga0207646_104241011 | 110 |
| 843 | 3300025923 | Ga0207681_10009785 | Ga0207681_100097857 | 110 |
| 844 | 3300025923 | Ga0207681_10054383 | Ga0207681_100543832 | 110 |
| 845 | 3300025923 | Ga0207681_10066558 | Ga0207681_100665583 | 110 |
| 846 | 3300025924 | Ga0207694_10023333 | Ga0207694_100233333 | 110 |
| 847 | 3300025924 | Ga0207694_10137479 | Ga0207694_101374792 | 110 |
| 848 | 3300025924 | Ga0207694_10209118 | Ga0207694_102091182 | 110 |
| 849 | 3300025924 | Ga0207694_10360180 | Ga0207694_103601802 | 110 |
| 850 | 3300025924 | Ga0207694_11230706 | Ga0207694_112307062 | 110 |
| 851 | 3300025925 | Ga0207650_10004487 | Ga0207650_100044874 | 110 |
| 852 | 3300025925 | Ga0207650_10101704 | Ga0207650_101017042 | 110 |
| 853 | 3300025925 | Ga0207650_10104656 | Ga0207650_101046563 | 110 |
| 854 | 3300025926 | Ga0207659_10003254 | Ga0207659_100032548 | 110 |
| 855 | 3300025926 | Ga0207659_10009170 | Ga0207659_100091703 | 110 |
| 856 | 3300025926 | Ga0207659_10555758 | Ga0207659_105557582 | 110 |
| 857 | 3300025926 | Ga0207659_11039265 | Ga0207659_110392651 | 110 |
| 858 | 3300025926 | Ga0207659_11089345 | Ga0207659_110893452 | 110 |
| 859 | 3300025927 | Ga0207687_10039639 | Ga0207687_100396393 | 110 |
| 860 | 3300025928 | Ga0207700_10038793 | Ga0207700_100387934 | 110 |
| 861 | 3300025928 | Ga0207700_10054883 | Ga0207700_100548833 | 110 |
| 862 | 3300025928 | Ga0207700_10089999 | Ga0207700_100899993 | 110 |
| 863 | 3300025928 | Ga0207700_10123261 | Ga0207700_101232613 | 110 |
| 864 | 3300025928 | Ga0207700_10243155 | Ga0207700_102431552 | 110 |
| 865 | 3300025928 | Ga0207700_10337740 | Ga0207700_103377402 | 110 |
| 866 | 3300025928 | Ga0207700_10819651 | Ga0207700_108196512 | 110 |
| 867 | 3300025929 | Ga0207664_10025601 | Ga0207664_100256012 | 110 |
| 868 | 3300025929 | Ga0207664_10039577 | Ga0207664_100395773 | 110 |
| 869 | 3300025929 | Ga0207664_10119297 | Ga0207664_101192971 | 110 |
| 870 | 3300025929 | Ga0207664_10167885 | Ga0207664_101678852 | 110 |
| 871 | 3300025929 | Ga0207664_10572851 | Ga0207664_105728512 | 110 |
| 872 | 3300025931 | Ga0207644_10035451 | Ga0207644_100354513 | 110 |
| 873 | 3300025931 | Ga0207644_10257273 | Ga0207644_102572732 | 110 |
| 874 | 3300025931 | Ga0207644_10686395 | Ga0207644_106863952 | 110 |
| 875 | 3300025932 | Ga0207690_10012598 | Ga0207690_100125986 | 110 |
| 876 | 3300025932 | Ga0207690_10037581 | Ga0207690_100375812 | 110 |
| 877 | 3300025932 | Ga0207690_10042611 | Ga0207690_100426112 | 110 |
| 878 | 3300025932 | Ga0207690_10044207 | Ga0207690_100442073 | 110 |
| 879 | 3300025932 | Ga0207690_10068413 | Ga0207690_100684133 | 110 |
| 880 | 3300025932 | Ga0207690_10278896 | Ga0207690_102788963 | 110 |
| 881 | 3300025932 | Ga0207690_10747510 | Ga0207690_107475102 | 110 |
| 882 | 3300025932 | Ga0207690_11017212 | Ga0207690_110172122 | 110 |
| 883 | 3300025932 | Ga0207690_11587498 | Ga0207690_115874981 | 110 |
| 884 | 3300025933 | Ga0207706_10000357 | Ga0207706_1000035721 | 110 |
| 885 | 3300025933 | Ga0207706_10297873 | Ga0207706_102978732 | 110 |
| 886 | 3300025933 | Ga0207706_11025855 | Ga0207706_110258551 | 110 |
| 887 | 3300025933 | Ga0207706_11312440 | Ga0207706_113124401 | 110 |
| 888 | 3300025934 | Ga0207686_10171259 | Ga0207686_101712591 | 110 |
| 889 | 3300025935 | Ga0207709_10567253 | Ga0207709_105672532 | 110 |
| 890 | 3300025935 | Ga0207709_10740090 | Ga0207709_107400902 | 110 |
| 891 | 3300025936 | Ga0207670_10120778 | Ga0207670_101207783 | 110 |
| 892 | 3300025937 | Ga0207669_10015931 | Ga0207669_100159313 | 110 |
| 893 | 3300025937 | Ga0207669_10077102 | Ga0207669_100771022 | 110 |
| 894 | 3300025937 | Ga0207669_10215008 | Ga0207669_102150082 | 110 |
| 895 | 3300025938 | Ga0207704_10414369 | Ga0207704_104143692 | 110 |
| 896 | 3300025939 | Ga0207665_10157887 | Ga0207665_101578873 | 110 |
| 897 | 3300025939 | Ga0207665_10226418 | Ga0207665_102264182 | 110 |
| 898 | 3300025939 | Ga0207665_10407598 | Ga0207665_104075982 | 110 |
| 899 | 3300025939 | Ga0207665_11088389 | Ga0207665_110883892 | 110 |
| 900 | 3300025939 | Ga0207665_11404281 | Ga0207665_114042811 | 110 |
| 901 | 3300025940 | Ga0207691_10001355 | Ga0207691_100013554 | 110 |
| 902 | 3300025940 | Ga0207691_10001550 | Ga0207691_100015508 | 110 |
| 903 | 3300025940 | Ga0207691_10022438 | Ga0207691_100224386 | 110 |
| 904 | 3300025941 | Ga0207711_10222614 | Ga0207711_102226142 | 110 |
| 905 | 3300025941 | Ga0207711_10908831 | Ga0207711_109088312 | 110 |
| 906 | 3300025942 | Ga0207689_10001360 | Ga0207689_1000136023 | 110 |
| 907 | 3300025942 | Ga0207689_10665749 | Ga0207689_106657492 | 110 |
| 908 | 3300025942 | Ga0207689_11505011 | Ga0207689_115050111 | 110 |
| 909 | 3300025944 | Ga0207661_10011833 | Ga0207661_100118332 | 110 |
| 910 | 3300025944 | Ga0207661_10019670 | Ga0207661_100196705 | 110 |
| 911 | 3300025944 | Ga0207661_10022228 | Ga0207661_100222282 | 110 |
| 912 | 3300025944 | Ga0207661_10032021 | Ga0207661_100320215 | 110 |
| 913 | 3300025944 | Ga0207661_10037459 | Ga0207661_100374591 | 110 |
| 914 | 3300025944 | Ga0207661_10068735 | Ga0207661_100687353 | 110 |
| 915 | 3300025944 | Ga0207661_10323213 | Ga0207661_103232132 | 110 |
| 916 | 3300025944 | Ga0207661_10716921 | Ga0207661_107169212 | 110 |
| 917 | 3300025944 | Ga0207661_11987297 | Ga0207661_119872972 | 110 |
| 918 | 3300025944 | Ga0207661_12145826 | Ga0207661_121458261 | 110 |
| 919 | 3300025945 | Ga0207679_10000484 | Ga0207679_1000048415 | 110 |
| 920 | 3300025945 | Ga0207679_10006509 | Ga0207679_100065094 | 110 |
| 921 | 3300025945 | Ga0207679_10024777 | Ga0207679_100247775 | 110 |
| 922 | 3300025945 | Ga0207679_10271920 | Ga0207679_102719203 | 110 |
| 923 | 3300025945 | Ga0207679_10276220 | Ga0207679_102762203 | 110 |
| 924 | 3300025945 | Ga0207679_10602183 | Ga0207679_106021832 | 110 |
| 925 | 3300025949 | Ga0207667_10011137 | Ga0207667_1001113712 | 110 |
| 926 | 3300025949 | Ga0207667_10019276 | Ga0207667_100192767 | 110 |
| 927 | 3300025949 | Ga0207667_10081585 | Ga0207667_100815854 | 110 |
| 928 | 3300025949 | Ga0207667_10187587 | Ga0207667_101875873 | 110 |
| 929 | 3300025960 | Ga0207651_10058551 | Ga0207651_100585512 | 110 |
| 930 | 3300025960 | Ga0207651_10452791 | Ga0207651_104527912 | 110 |
| 931 | 3300025961 | Ga0207712_10001176 | Ga0207712_1000117611 | 110 |
| 932 | 3300025961 | Ga0207712_10130934 | Ga0207712_101309343 | 110 |
| 933 | 3300025961 | Ga0207712_11682783 | Ga0207712_116827832 | 110 |
| 934 | 3300025972 | Ga0207668_10021247 | Ga0207668_100212474 | 110 |
| 935 | 3300025972 | Ga0207668_10730561 | Ga0207668_107305612 | 110 |
| 936 | 3300025981 | Ga0207640_10001456 | Ga0207640_100014568 | 110 |
| 937 | 3300025981 | Ga0207640_10050446 | Ga0207640_100504463 | 110 |
| 938 | 3300025981 | Ga0207640_10104663 | Ga0207640_101046633 | 110 |
| 939 | 3300025981 | Ga0207640_10286487 | Ga0207640_102864872 | 110 |
| 940 | 3300025981 | Ga0207640_10370752 | Ga0207640_103707522 | 110 |
| 941 | 3300025981 | Ga0207640_10501830 | Ga0207640_105018303 | 110 |
| 942 | 3300025986 | Ga0207658_10060833 | Ga0207658_100608333 | 110 |
| 943 | 3300025986 | Ga0207658_10178304 | Ga0207658_101783042 | 110 |
| 944 | 3300025986 | Ga0207658_11525645 | Ga0207658_115256452 | 110 |
| 945 | 3300026035 | Ga0207703_10156270 | Ga0207703_101562702 | 110 |
| 946 | 3300026041 | Ga0207639_10004358 | Ga0207639_1000435811 | 110 |
| 947 | 3300026041 | Ga0207639_10116510 | Ga0207639_101165102 | 110 |
| 948 | 3300026041 | Ga0207639_10150381 | Ga0207639_101503813 | 110 |
| 949 | 3300026041 | Ga0207639_10331802 | Ga0207639_103318023 | 110 |
| 950 | 3300026041 | Ga0207639_10517425 | Ga0207639_105174251 | 110 |
| 951 | 3300026041 | Ga0207639_11916862 | Ga0207639_119168622 | 110 |
| 952 | 3300026067 | Ga0207678_10041333 | Ga0207678_100413332 | 110 |
| 953 | 3300026067 | Ga0207678_10041868 | Ga0207678_100418683 | 110 |
| 954 | 3300026067 | Ga0207678_10068814 | Ga0207678_100688142 | 110 |
| 955 | 3300026067 | Ga0207678_10423890 | Ga0207678_104238902 | 110 |
| 956 | 3300026067 | Ga0207678_12011429 | Ga0207678_120114292 | 110 |
| 957 | 3300026075 | Ga0207708_10098662 | Ga0207708_100986623 | 110 |
| 958 | 3300026075 | Ga0207708_10154233 | Ga0207708_101542333 | 110 |
| 959 | 3300026075 | Ga0207708_10751038 | Ga0207708_107510382 | 110 |
| 960 | 3300026078 | Ga0207702_10057844 | Ga0207702_100578443 | 110 |
| 961 | 3300026078 | Ga0207702_10071273 | Ga0207702_100712732 | 110 |
| 962 | 3300026078 | Ga0207702_10745631 | Ga0207702_107456313 | 110 |
| 963 | 3300026078 | Ga0207702_10915538 | Ga0207702_109155382 | 110 |
| 964 | 3300026078 | Ga0207702_10990133 | Ga0207702_109901332 | 110 |
| 965 | 3300026078 | Ga0207702_11682985 | Ga0207702_116829851 | 110 |
| 966 | 3300026088 | Ga0207641_10107617 | Ga0207641_101076172 | 110 |
| 967 | 3300026088 | Ga0207641_10345441 | Ga0207641_103454412 | 110 |
| 968 | 3300026089 | Ga0207648_10005220 | Ga0207648_1000522012 | 110 |
| 969 | 3300026089 | Ga0207648_10023923 | Ga0207648_100239235 | 110 |
| 970 | 3300026089 | Ga0207648_10046448 | Ga0207648_100464485 | 110 |
| 971 | 3300026089 | Ga0207648_12191754 | Ga0207648_121917542 | 110 |
| 972 | 3300026095 | Ga0207676_10093952 | Ga0207676_100939522 | 110 |
| 973 | 3300026095 | Ga0207676_10142837 | Ga0207676_101428373 | 110 |
| 974 | 3300026095 | Ga0207676_10163981 | Ga0207676_101639812 | 110 |
| 975 | 3300026095 | Ga0207676_10343365 | Ga0207676_103433652 | 110 |
| 976 | 3300026095 | Ga0207676_11694275 | Ga0207676_116942752 | 110 |
| 977 | 3300026116 | Ga0207674_10003135 | Ga0207674_1000313515 | 110 |
| 978 | 3300026116 | Ga0207674_10015526 | Ga0207674_100155268 | 110 |
| 979 | 3300026116 | Ga0207674_10018565 | Ga0207674_100185658 | 110 |
| 980 | 3300026116 | Ga0207674_10140302 | Ga0207674_101403024 | 110 |
| 981 | 3300026116 | Ga0207674_10296301 | Ga0207674_102963011 | 110 |
| 982 | 3300026116 | Ga0207674_10677573 | Ga0207674_106775732 | 110 |
| 983 | 3300026116 | Ga0207674_11584205 | Ga0207674_115842051 | 110 |
| 984 | 3300026118 | Ga0207675_100000320 | Ga0207675_10000032025 | 110 |
| 985 | 3300026118 | Ga0207675_100059762 | Ga0207675_1000597624 | 110 |
| 986 | 3300026118 | Ga0207675_100314828 | Ga0207675_1003148281 | 110 |
| 987 | 3300026118 | Ga0207675_100341058 | Ga0207675_1003410583 | 110 |
| 988 | 3300026121 | Ga0207683_10033546 | Ga0207683_100335462 | 110 |
| 989 | 3300026121 | Ga0207683_10059100 | Ga0207683_100591004 | 110 |
| 990 | 3300026121 | Ga0207683_10295458 | Ga0207683_102954582 | 110 |
| 991 | 3300026142 | Ga0207698_10007055 | Ga0207698_100070554 | 110 |
| 992 | 3300026142 | Ga0207698_10013973 | Ga0207698_100139736 | 110 |
| 993 | 3300026142 | Ga0207698_10256188 | Ga0207698_102561882 | 110 |
| 994 | 3300026142 | Ga0207698_11089470 | Ga0207698_110894702 | 110 |
| 995 | 3300026142 | Ga0207698_11123693 | Ga0207698_111236931 | 110 |
| 996 | 3300026142 | Ga0207698_11183172 | Ga0207698_111831721 | 110 |
| 997 | 3300026142 | Ga0207698_11211289 | Ga0207698_112112892 | 110 |
| 998 | 3300027907 | Ga0207428_10075404 | Ga0207428_100754043 | 110 |
| 999 | 3300027907 | Ga0207428_10258988 | Ga0207428_102589882 | 110 |
| 1000 | 3300028379 | Ga0268266_10083429 | Ga0268266_100834292 | 110 |
| 1001 | 3300028379 | Ga0268266_10102533 | Ga0268266_101025333 | 110 |
| 1002 | 3300028379 | Ga0268266_11123594 | Ga0268266_111235942 | 110 |
| 1003 | 3300028380 | Ga0268265_10002121 | Ga0268265_100021217 | 110 |
| 1004 | 3300028380 | Ga0268265_10266956 | Ga0268265_102669561 | 110 |
| 1005 | 3300028380 | Ga0268265_10715986 | Ga0268265_107159862 | 110 |
| 1006 | 3300028380 | Ga0268265_10802452 | Ga0268265_108024522 | 110 |
| 1007 | 3300028381 | Ga0268264_10480925 | Ga0268264_104809252 | 110 |
| 1008 | 3300028381 | Ga0268264_10488128 | Ga0268264_104881281 | 110 |
| 1009 | 3300030735 | Ga0316178_1053326 | Ga0316178_10533261 | 110 |
| 1010 | 3300031548 | Ga0307408_100008337 | Ga0307408_1000083373 | 110 |
| 1011 | 3300031548 | Ga0307408_100187150 | Ga0307408_1001871502 | 110 |
| 1012 | 3300031548 | Ga0307408_100297064 | Ga0307408_1002970643 | 110 |
| 1013 | 3300031548 | Ga0307408_100368413 | Ga0307408_1003684131 | 110 |
| 1014 | 3300031548 | Ga0307408_102494544 | Ga0307408_1024945441 | 110 |
| 1015 | 3300031691 | Ga0316579_10111135 | Ga0316579_101111352 | 110 |
| 1016 | 3300031727 | Ga0316576_10002948 | Ga0316576_100029489 | 110 |
| 1017 | 3300031728 | Ga0316578_10013404 | Ga0316578_100134044 | 110 |
| 1018 | 3300031728 | Ga0316578_10015348 | Ga0316578_100153485 | 110 |
| 1019 | 3300031731 | Ga0307405_10000187 | Ga0307405_1000018721 | 110 |
| 1020 | 3300031731 | Ga0307405_10014127 | Ga0307405_100141272 | 110 |
| 1021 | 3300031731 | Ga0307405_10036009 | Ga0307405_100360094 | 110 |
| 1022 | 3300031731 | Ga0307405_10092885 | Ga0307405_100928853 | 110 |
| 1023 | 3300031731 | Ga0307405_10144722 | Ga0307405_101447223 | 110 |
| 1024 | 3300031731 | Ga0307405_10173627 | Ga0307405_101736272 | 110 |
| 1025 | 3300031731 | Ga0307405_10258162 | Ga0307405_102581622 | 110 |
| 1026 | 3300031731 | Ga0307405_10406577 | Ga0307405_104065772 | 110 |
| 1027 | 3300031731 | Ga0307405_10487220 | Ga0307405_104872201 | 110 |
| 1028 | 3300031731 | Ga0307405_10986256 | Ga0307405_109862561 | 110 |
| 1029 | 3300031731 | Ga0307405_11102917 | Ga0307405_111029172 | 110 |
| 1030 | 3300031731 | Ga0307405_11372694 | Ga0307405_113726941 | 110 |
| 1031 | 3300031731 | Ga0307405_12113955 | Ga0307405_121139551 | 110 |
| 1032 | 3300031731 | Ga0307405_12137608 | Ga0307405_121376082 | 110 |
| 1033 | 3300031733 | Ga0316577_10002399 | Ga0316577_100023991 | 110 |
| 1034 | 3300031733 | Ga0316577_10025102 | Ga0316577_100251024 | 110 |
| 1035 | 3300031824 | Ga0307413_10000837 | Ga0307413_100008375 | 110 |
| 1036 | 3300031824 | Ga0307413_10030411 | Ga0307413_100304113 | 110 |
| 1037 | 3300031824 | Ga0307413_10042391 | Ga0307413_100423913 | 110 |
| 1038 | 3300031824 | Ga0307413_10055375 | Ga0307413_100553753 | 110 |
| 1039 | 3300031824 | Ga0307413_10073618 | Ga0307413_100736184 | 110 |
| 1040 | 3300031824 | Ga0307413_10140859 | Ga0307413_101408592 | 110 |
| 1041 | 3300031824 | Ga0307413_10171588 | Ga0307413_101715883 | 110 |
| 1042 | 3300031824 | Ga0307413_10284805 | Ga0307413_102848052 | 110 |
| 1043 | 3300031824 | Ga0307413_10457015 | Ga0307413_104570151 | 110 |
| 1044 | 3300031824 | Ga0307413_10817679 | Ga0307413_108176792 | 110 |
| 1045 | 3300031824 | Ga0307413_11214826 | Ga0307413_112148262 | 110 |
| 1046 | 3300031852 | Ga0307410_10002520 | Ga0307410_100025206 | 110 |
| 1047 | 3300031852 | Ga0307410_10012076 | Ga0307410_100120765 | 110 |
| 1048 | 3300031852 | Ga0307410_10022976 | Ga0307410_100229764 | 110 |
| 1049 | 3300031852 | Ga0307410_10027658 | Ga0307410_100276583 | 110 |
| 1050 | 3300031852 | Ga0307410_10070059 | Ga0307410_100700593 | 110 |
| 1051 | 3300031852 | Ga0307410_10127016 | Ga0307410_101270163 | 110 |
| 1052 | 3300031852 | Ga0307410_10249681 | Ga0307410_102496811 | 110 |
| 1053 | 3300031852 | Ga0307410_10272665 | Ga0307410_102726651 | 110 |
| 1054 | 3300031852 | Ga0307410_10314703 | Ga0307410_103147032 | 110 |
| 1055 | 3300031852 | Ga0307410_10337316 | Ga0307410_103373162 | 110 |
| 1056 | 3300031852 | Ga0307410_10344968 | Ga0307410_103449682 | 110 |
| 1057 | 3300031852 | Ga0307410_10345358 | Ga0307410_103453582 | 110 |
| 1058 | 3300031852 | Ga0307410_10498068 | Ga0307410_104980682 | 110 |
| 1059 | 3300031852 | Ga0307410_10549744 | Ga0307410_105497442 | 110 |
| 1060 | 3300031852 | Ga0307410_11023698 | Ga0307410_110236982 | 110 |
| 1061 | 3300031852 | Ga0307410_11691523 | Ga0307410_116915232 | 110 |
| 1062 | 3300031901 | Ga0307406_10001688 | Ga0307406_100016884 | 110 |
| 1063 | 3300031901 | Ga0307406_10002595 | Ga0307406_100025958 | 110 |
| 1064 | 3300031901 | Ga0307406_10014718 | Ga0307406_100147183 | 110 |
| 1065 | 3300031901 | Ga0307406_10023424 | Ga0307406_100234242 | 110 |
| 1066 | 3300031901 | Ga0307406_10028708 | Ga0307406_100287082 | 110 |
| 1067 | 3300031901 | Ga0307406_10043279 | Ga0307406_100432795 | 110 |
| 1068 | 3300031901 | Ga0307406_10108565 | Ga0307406_101085653 | 110 |
| 1069 | 3300031901 | Ga0307406_10146070 | Ga0307406_101460702 | 110 |
| 1070 | 3300031901 | Ga0307406_10230915 | Ga0307406_102309153 | 110 |
| 1071 | 3300031901 | Ga0307406_10260498 | Ga0307406_102604982 | 110 |
| 1072 | 3300031901 | Ga0307406_10362133 | Ga0307406_103621332 | 110 |
| 1073 | 3300031901 | Ga0307406_11611758 | Ga0307406_116117582 | 110 |
| 1074 | 3300031903 | Ga0307407_10000201 | Ga0307407_1000020117 | 110 |
| 1075 | 3300031903 | Ga0307407_10004682 | Ga0307407_100046825 | 110 |
| 1076 | 3300031903 | Ga0307407_10008899 | Ga0307407_100088995 | 110 |
| 1077 | 3300031903 | Ga0307407_10027368 | Ga0307407_100273681 | 110 |
| 1078 | 3300031903 | Ga0307407_10085331 | Ga0307407_100853312 | 110 |
| 1079 | 3300031903 | Ga0307407_10091391 | Ga0307407_100913913 | 110 |
| 1080 | 3300031903 | Ga0307407_10116337 | Ga0307407_101163372 | 110 |
| 1081 | 3300031903 | Ga0307407_10124907 | Ga0307407_101249072 | 110 |
| 1082 | 3300031903 | Ga0307407_10333724 | Ga0307407_103337242 | 110 |
| 1083 | 3300031903 | Ga0307407_10342090 | Ga0307407_103420902 | 110 |
| 1084 | 3300031903 | Ga0307407_10441069 | Ga0307407_104410692 | 110 |
| 1085 | 3300031903 | Ga0307407_10525226 | Ga0307407_105252261 | 110 |
| 1086 | 3300031903 | Ga0307407_10962072 | Ga0307407_109620721 | 110 |
| 1087 | 3300031911 | Ga0307412_10012476 | Ga0307412_100124765 | 110 |
| 1088 | 3300031911 | Ga0307412_10028271 | Ga0307412_100282712 | 110 |
| 1089 | 3300031911 | Ga0307412_10193021 | Ga0307412_101930212 | 110 |
| 1090 | 3300031911 | Ga0307412_10234054 | Ga0307412_102340543 | 110 |
| 1091 | 3300031911 | Ga0307412_10398104 | Ga0307412_103981042 | 110 |
| 1092 | 3300031911 | Ga0307412_11261340 | Ga0307412_112613402 | 110 |
| 1093 | 3300031995 | Ga0307409_100000144 | Ga0307409_1000001446 | 110 |
| 1094 | 3300031995 | Ga0307409_100003493 | Ga0307409_1000034936 | 110 |
| 1095 | 3300031995 | Ga0307409_100009411 | Ga0307409_1000094112 | 110 |
| 1096 | 3300031995 | Ga0307409_100009792 | Ga0307409_1000097924 | 110 |
| 1097 | 3300031995 | Ga0307409_100026152 | Ga0307409_1000261523 | 110 |
| 1098 | 3300031995 | Ga0307409_100027599 | Ga0307409_1000275994 | 110 |
| 1099 | 3300031995 | Ga0307409_100033448 | Ga0307409_1000334482 | 110 |
| 1100 | 3300031995 | Ga0307409_100048332 | Ga0307409_1000483322 | 110 |
| 1101 | 3300031995 | Ga0307409_100118546 | Ga0307409_1001185463 | 110 |
| 1102 | 3300031995 | Ga0307409_100126080 | Ga0307409_1001260803 | 110 |
| 1103 | 3300031995 | Ga0307409_100186505 | Ga0307409_1001865051 | 110 |
| 1104 | 3300031995 | Ga0307409_100254667 | Ga0307409_1002546672 | 110 |
| 1105 | 3300031995 | Ga0307409_100383328 | Ga0307409_1003833282 | 110 |
| 1106 | 3300031995 | Ga0307409_100556156 | Ga0307409_1005561562 | 110 |
| 1107 | 3300031995 | Ga0307409_100717738 | Ga0307409_1007177382 | 110 |
| 1108 | 3300031995 | Ga0307409_101141677 | Ga0307409_1011416772 | 110 |
| 1109 | 3300032002 | Ga0307416_100000828 | Ga0307416_10000082812 | 110 |
| 1110 | 3300032002 | Ga0307416_100004156 | Ga0307416_1000041561 | 110 |
| 1111 | 3300032002 | Ga0307416_100007355 | Ga0307416_1000073557 | 110 |
| 1112 | 3300032002 | Ga0307416_100012718 | Ga0307416_1000127186 | 110 |
| 1113 | 3300032002 | Ga0307416_100014248 | Ga0307416_1000142483 | 110 |
| 1114 | 3300032002 | Ga0307416_100024844 | Ga0307416_1000248445 | 110 |
| 1115 | 3300032002 | Ga0307416_100049239 | Ga0307416_1000492394 | 110 |
| 1116 | 3300032002 | Ga0307416_100073566 | Ga0307416_1000735662 | 110 |
| 1117 | 3300032002 | Ga0307416_100120247 | Ga0307416_1001202472 | 110 |
| 1118 | 3300032002 | Ga0307416_100356860 | Ga0307416_1003568602 | 110 |
| 1119 | 3300032002 | Ga0307416_100450307 | Ga0307416_1004503072 | 110 |
| 1120 | 3300032002 | Ga0307416_100477679 | Ga0307416_1004776792 | 110 |
| 1121 | 3300032002 | Ga0307416_100511350 | Ga0307416_1005113502 | 110 |
| 1122 | 3300032002 | Ga0307416_100735010 | Ga0307416_1007350102 | 110 |
| 1123 | 3300032002 | Ga0307416_101424102 | Ga0307416_1014241022 | 110 |
| 1124 | 3300032002 | Ga0307416_102811952 | Ga0307416_1028119521 | 110 |
| 1125 | 3300032002 | Ga0307416_103058978 | Ga0307416_1030589781 | 110 |
| 1126 | 3300032002 | Ga0307416_103753912 | Ga0307416_1037539121 | 110 |
| 1127 | 3300032004 | Ga0307414_10002383 | Ga0307414_100023835 | 110 |
| 1128 | 3300032004 | Ga0307414_10006027 | Ga0307414_100060275 | 110 |
| 1129 | 3300032004 | Ga0307414_10030309 | Ga0307414_100303092 | 110 |
| 1130 | 3300032004 | Ga0307414_10043031 | Ga0307414_100430313 | 110 |
| 1131 | 3300032004 | Ga0307414_10345745 | Ga0307414_103457452 | 110 |
| 1132 | 3300032004 | Ga0307414_10408267 | Ga0307414_104082672 | 110 |
| 1133 | 3300032004 | Ga0307414_10426642 | Ga0307414_104266422 | 110 |
| 1134 | 3300032004 | Ga0307414_10465715 | Ga0307414_104657152 | 110 |
| 1135 | 3300032004 | Ga0307414_11271125 | Ga0307414_112711251 | 110 |
| 1136 | 3300032005 | Ga0307411_10001066 | Ga0307411_100010665 | 110 |
| 1137 | 3300032005 | Ga0307411_10006929 | Ga0307411_100069295 | 110 |
| 1138 | 3300032005 | Ga0307411_10007270 | Ga0307411_100072703 | 110 |
| 1139 | 3300032005 | Ga0307411_10017609 | Ga0307411_100176094 | 110 |
| 1140 | 3300032005 | Ga0307411_10045742 | Ga0307411_100457423 | 110 |
| 1141 | 3300032005 | Ga0307411_10062970 | Ga0307411_100629702 | 110 |
| 1142 | 3300032005 | Ga0307411_10141185 | Ga0307411_101411851 | 110 |
| 1143 | 3300032005 | Ga0307411_10147865 | Ga0307411_101478651 | 110 |
| 1144 | 3300032005 | Ga0307411_10166152 | Ga0307411_101661523 | 110 |
| 1145 | 3300032005 | Ga0307411_10208308 | Ga0307411_102083083 | 110 |
| 1146 | 3300032005 | Ga0307411_10276620 | Ga0307411_102766202 | 110 |
| 1147 | 3300032005 | Ga0307411_10282820 | Ga0307411_102828202 | 110 |
| 1148 | 3300032005 | Ga0307411_10531822 | Ga0307411_105318222 | 110 |
| 1149 | 3300032005 | Ga0307411_10645798 | Ga0307411_106457982 | 110 |
| 1150 | 3300032005 | Ga0307411_10663386 | Ga0307411_106633862 | 110 |
| 1151 | 3300032005 | Ga0307411_10672848 | Ga0307411_106728482 | 110 |
| 1152 | 3300032005 | Ga0307411_10773159 | Ga0307411_107731592 | 110 |
| 1153 | 3300032005 | Ga0307411_11345317 | Ga0307411_113453172 | 110 |
| 1154 | 3300032005 | Ga0307411_11551779 | Ga0307411_115517791 | 110 |
| 1155 | 3300032005 | Ga0307411_11809007 | Ga0307411_118090071 | 110 |
| 1156 | 3300032005 | Ga0307411_11845197 | Ga0307411_118451972 | 110 |
| 1157 | 3300032126 | Ga0307415_100000419 | Ga0307415_10000041917 | 110 |
| 1158 | 3300032126 | Ga0307415_100002432 | Ga0307415_1000024325 | 110 |
| 1159 | 3300032126 | Ga0307415_100021813 | Ga0307415_1000218134 | 110 |
| 1160 | 3300032126 | Ga0307415_100036475 | Ga0307415_1000364755 | 110 |
| 1161 | 3300032126 | Ga0307415_100041599 | Ga0307415_1000415992 | 110 |
| 1162 | 3300032126 | Ga0307415_100051781 | Ga0307415_1000517815 | 110 |
| 1163 | 3300032126 | Ga0307415_100143241 | Ga0307415_1001432413 | 110 |
| 1164 | 3300032126 | Ga0307415_100459811 | Ga0307415_1004598112 | 110 |
| 1165 | 3300032126 | Ga0307415_100490786 | Ga0307415_1004907862 | 110 |
| 1166 | 3300032126 | Ga0307415_100970217 | Ga0307415_1009702171 | 110 |
| 1167 | 3300032126 | Ga0307415_102463500 | Ga0307415_1024635001 | 110 |
| 1168 | 3300032133 | Ga0316583_10003563 | Ga0316583_100035634 | 110 |
| 1169 | 3300032137 | Ga0316585_10006893 | Ga0316585_100068933 | 110 |
| 1170 | 3300033541 | Ga0316596_1143350 | Ga0316596_11433502 | 110 |
| 1171 | 3300034818 | Ga0373950_0167964 | Ga0373950_0167964_50_385 | 110 |
| 1172 | 3300034957 | Ga0373938_0040184 | Ga0373938_0040184_565_900 | 110 |
| 1173 | 3300035083 | Ga0373926_0004167 | Ga0373926_0004167_2330_2662 | 110 |
| 1174 | 3300035084 | Ga0373928_0048895 | Ga0373928_0048895_139_474 | 110 |
| 1175 | 3300035086 | Ga0373934_0005211 | Ga0373934_0005211_1970_2302 | 110 |
| 1176 | 3300035086 | Ga0373934_0037374 | Ga0373934_0037374_1564_1896 | 110 |
| 1177 | 3300035086 | Ga0373934_0040553 | Ga0373934_0040553_64_396 | 110 |
| 1178 | 3300035088 | Ga0373940_0070749 | Ga0373940_0070749_214_549 | 110 |
| 1179 | 3300035089 | Ga0373944_0396028 | Ga0373944_0396028_175_507 | 110 |
| 1180 | 3300035091 | Ga0373951_0051655 | Ga0373951_0051655_394_729 | 110 |
| 1181 | 3300035092 | Ga0373952_0095406 | Ga0373952_0095406_132_467 | 110 |
| 1182 | 3300035111 | Ga0373923_0007123 | Ga0373923_0007123_2308_2640 | 110 |
| 1183 | 3300035112 | Ga0373932_0198412 | Ga0373932_0198412_63_398 | 110 |
| 1184 | 3300035113 | Ga0373936_0011918 | Ga0373936_0011918_704_1036 | 110 |
| 1185 | 3300035113 | Ga0373936_0128849 | Ga0373936_0128849_218_550 | 110 |
| 1186 | 3300035115 | Ga0373941_0333309 | Ga0373941_0333309_21_356 | 110 |
| 1187 | 3300035116 | Ga0373945_0258114 | Ga0373945_0258114_54_386 | 110 |
| 1188 | 3300035117 | Ga0373953_0002759 | Ga0373953_0002759_3576_3908 | 110 |
| 1189 | 3300035117 | Ga0373953_0009331 | Ga0373953_0009331_2288_2620 | 110 |
| 1190 | 3300035117 | Ga0373953_0568949 | Ga0373953_0568949_17_349 | 110 |
| 1191 | 3300035118 | Ga0373954_0057621 | Ga0373954_0057621_1026_1358 | 110 |
| 1192 | 3300035118 | Ga0373954_0066241 | Ga0373954_0066241_632_964 | 110 |
| 1193 | 3300035118 | Ga0373954_0440984 | Ga0373954_0440984_294_626 | 110 |
| 1194 | 3300035119 | Ga0373956_0000678 | Ga0373956_0000678_4458_4790 | 110 |
| 1195 | 3300035119 | Ga0373956_0113697 | Ga0373956_0113697_894_1226 | 110 |
| 1196 | 3300035119 | Ga0373956_0548048 | Ga0373956_0548048_92_424 | 110 |
| 1197 | 3300035120 | Ga0373957_0099398 | Ga0373957_0099398_776_1108 | 110 |
| 1198 | 3300035120 | Ga0373957_0165776 | Ga0373957_0165776_179_511 | 110 |
| 1199 | 3300035121 | Ga0373960_0139748 | Ga0373960_0139748_303_638 | 110 |
| 1200 | 3300035170 | Ga0373943_0016857 | Ga0373943_0016857_1318_1650 | 110 |
| 1201 | 3300035170 | Ga0373943_0028594 | Ga0373943_0028594_1615_1947 | 110 |
| 1202 | 3300035171 | Ga0373946_0009275 | Ga0373946_0009275_1495_1827 | 110 |
| 1203 | 3300035207 | Ga0373942_0342387 | Ga0373942_0342387_86_421 | 110 |
| 1204 | 3300035241 | Ga0373961_0059628 | Ga0373961_0059628_321_656 | 110 |
| 1205 | 3300035398 | Ga0316574_0204529 | Ga0316574_0204529_245_577 | 110 |
| 1206 | 3300035398 | Ga0316574_0695716 | Ga0316574_0695716_52_384 | 110 |
| 1207 | 3300035410 | Ga0373924_0002127 | Ga0373924_0002127_4363_4695 | 110 |
| 1208 | 3300035410 | Ga0373924_0285833 | Ga0373924_0285833_92_424 | 110 |
| 1209 | 3300035691 | Ga0373931_0018182 | Ga0373931_0018182_1155_1490 | 110 |
| 1210 | 3300035691 | Ga0373931_0018416 | Ga0373931_0018416_1619_1954 | 110 |
| 1211 | 3300035692 | Ga0373935_0018031 | Ga0373935_0018031_1605_1937 | 110 |
| 1212 | 3300035692 | Ga0373935_0063447 | Ga0373935_0063447_934_1266 | 110 |
| 1213 | 3300035692 | Ga0373935_0124591 | Ga0373935_0124591_342_674 | 110 |
| 1214 | 3300035692 | Ga0373935_0378071 | Ga0373935_0378071_396_728 | 110 |
| 1215 | 3300035695 | Ga0373927_0026060 | Ga0373927_0026060_1543_1875 | 110 |
| 1216 | 3300035695 | Ga0373927_1094838 | Ga0373927_1094838_37_369 | 110 |
| 1217 | 3300035724 | Ga0373933_0001111 | Ga0373933_0001111_9347_9679 | 110 |
| 1218 | 3300035724 | Ga0373933_0013654 | Ga0373933_0013654_3405_3737 | 110 |
| 1219 | 3300035725 | Ga0373947_0002126 | Ga0373947_0002126_1834_2166 | 110 |
| 1220 | 3300035725 | Ga0373947_0048812 | Ga0373947_0048812_586_918 | 110 |
| 1221 | 3300035725 | Ga0373947_0115326 | Ga0373947_0115326_341_673 | 110 |
| 1222 | 3300036401 | Ga0373937_0002914 | Ga0373937_0002914_78_410 | 110 |
| 1223 | 3300036401 | Ga0373937_0065385 | Ga0373937_0065385_2510_2842 | 110 |
| 1224 | 3300036401 | Ga0373937_0096592 | Ga0373937_0096592_617_949 | 110 |
| 1225 | 3300036647 | Ga0316582_0026818 | Ga0316582_0026818_3103_3435 | 110 |
| 1226 | 3300036647 | Ga0316582_0075578 | Ga0316582_0075578_663_995 | 110 |
| 1227 | 3300036712 | Ga0316584_0009015 | Ga0316584_0009015_2589_2921 | 110 |
| 1228 | 3300037068 | Ga0373925_0034016 | Ga0373925_0034016_2996_3328 | 110 |
| 1229 | 3300037068 | Ga0373925_0216655 | Ga0373925_0216655_36_368 | 110 |
| 1230 | 3300037068 | Ga0373925_0592715 | Ga0373925_0592715_214_546 | 110 |
| 1231 | 3300037312 | Ga0395899_0038329 | Ga0395899_0038329_596_928 | 110 |
| 1232 | 3300037418 | Ga0395900_0005143 | Ga0395900_0005143_6341_6673 | 110 |
| 1233 | 3300037466 | Ga0395898_0365364 | Ga0395898_0365364_270_602 | 110 |
| 1234 | 3300037471 | Ga0395905_0049760 | Ga0395905_0049760_696_1028 | 110 |
| 1235 | 3300037471 | Ga0395905_0117856 | Ga0395905_0117856_2009_2341 | 110 |
| 1236 | 3300037471 | Ga0395905_0624983 | Ga0395905_0624983_63_398 | 110 |
| 1237 | 3300037471 | Ga0395905_1377214 | Ga0395905_1377214_125_457 | 110 |
| 1238 | 3300037588 | Ga0316581_0052652 | Ga0316581_0052652_884_1216 | 110 |
| 1239 | 3300037853 | Ga0436364_0287855 | Ga0436364_0287855_684_1016 | 110 |
| 1240 | 3300038443 | Ga0395901_0003407 | Ga0395901_0003407_15283_15615 | 110 |
| 1241 | 3300038443 | Ga0395901_0694213 | Ga0395901_0694213_251_583 | 110 |
| 1242 | 3300038443 | Ga0395901_1490842 | Ga0395901_1490842_268_600 | 110 |
| 1243 | 3300038996 | Ga0242420_024104 | Ga0242420_024104_652_987 | 110 |
| 1244 | 3300038996 | Ga0242420_054477 | Ga0242420_054477_136_471 | 110 |
| 1245 | 3300039437 | Ga0436365_0290864 | Ga0436365_0290864_328_660 | 110 |
| 1246 | 3300039437 | Ga0436365_0304609 | Ga0436365_0304609_273_605 | 110 |
| 1247 | 3300039437 | Ga0436365_1602166 | Ga0436365_1602166_3369_3701 | 110 |
| 1248 | 3300039450 | Ga0436363_0390436 | Ga0436363_0390436_172_504 | 110 |
| 1249 | 3300039450 | Ga0436363_0732405 | Ga0436363_0732405_69_401 | 110 |
| 1250 | 3300041406 | Ga0439439_0021339 | Ga0439439_0021339_529_861 | 110 |
| 1251 | 3300041496 | Ga0451839_1205934 | Ga0451839_1205934_91_423 | 110 |
| 1252 | 3300041512 | Ga0451853_1987835 | Ga0451853_1987835_164_496 | 110 |
| 1253 | 3300042005 | Ga0439448_0040558 | Ga0439448_0040558_112_444 | 110 |
| 1254 | 3300042014 | Ga0439457_103357 | Ga0439457_103357_189_521 | 110 |
| 1255 | 3300042015 | Ga0439462_0132713 | Ga0439462_0132713_140_472 | 110 |
| 1256 | 3300042156 | Ga0439446_0184978 | Ga0439446_0184978_227_559 | 110 |
| 1257 | 3300042876 | Ga0451577_0003975 | Ga0451577_0003975_3793_4125 | 110 |
| 1258 | 3300042876 | Ga0451577_0233619 | Ga0451577_0233619_98_433 | 110 |
| 1259 | 3300042876 | Ga0451577_0278304 | Ga0451577_0278304_148_480 | 110 |
| 1260 | 3300044673 | Ga0453683_1216232 | Ga0453683_1216232_100_480 | 110 |
| 1261 | 3300044683 | Ga0466965_0319755 | Ga0466965_0319755_294_626 | 110 |
| 1262 | 3300044684 | Ga0466966_0310517 | Ga0466966_0310517_110_442 | 110 |
| 1263 | 3300044684 | Ga0466966_0984788 | Ga0466966_0984788_138_470 | 110 |
| 1264 | 3300044693 | Ga0466961_0148652 | Ga0466961_0148652_652_984 | 110 |
| 1265 | 3300044706 | Ga0466964_0177363 | Ga0466964_0177363_21_353 | 110 |
| 1266 | 3300044706 | Ga0466964_0240783 | Ga0466964_0240783_150_482 | 110 |
| 1267 | 3300044706 | Ga0466964_0355081 | Ga0466964_0355081_358_693 | 110 |
| 1268 | 3300044712 | Ga0453684_1058605 | Ga0453684_1058605_73_405 | 110 |
| 1269 | 3300044719 | Ga0466971_0083762 | Ga0466971_0083762_777_1109 | 110 |
| 1270 | 3300044719 | Ga0466971_0634884 | Ga0466971_0634884_143_475 | 110 |
| 1271 | 3300044765 | Ga0466970_0236236 | Ga0466970_0236236_539_871 | 110 |
| 1272 | 3300044842 | Ga0466957_1006802 | Ga0466957_1006802_135_467 | 110 |
| 1273 | 3300044842 | Ga0466957_1282518 | Ga0466957_1282518_28_360 | 110 |
| 1274 | 3300045051 | Ga0451576_0116352 | Ga0451576_0116352_1669_2001 | 110 |
| 1275 | 3300045051 | Ga0451576_0321037 | Ga0451576_0321037_984_1316 | 110 |
| 1276 | 3300045051 | Ga0451576_1522734 | Ga0451576_1522734_114_449 | 110 |
| 1277 | 3300045836 | Ga0466958_0130129 | Ga0466958_0130129_325_657 | 110 |
| 1278 | 3300045836 | Ga0466958_0334514 | Ga0466958_0334514_152_484 | 110 |
| 1279 | 3300045976 | Ga0466967_0250970 | Ga0466967_0250970_575_907 | 110 |
| 1280 | 3300045976 | Ga0466967_0533636 | Ga0466967_0533636_574_906 | 110 |
| 1281 | 3300045976 | Ga0466967_0777573 | Ga0466967_0777573_490_822 | 110 |
| 1282 | 3300045976 | Ga0466967_2175858 | Ga0466967_2175858_177_512 | 110 |
| 1283 | 3300046454 | Ga0495592_0002525 | Ga0495592_0002525_9391_9723 | 110 |
| 1284 | 3300046454 | Ga0495592_0365590 | Ga0495592_0365590_295_627 | 110 |
| 1285 | 3300046454 | Ga0495592_0902943 | Ga0495592_0902943_162_494 | 110 |
| 1286 | 3300046455 | Ga0495603_0046197 | Ga0495603_0046197_866_1198 | 110 |
| 1287 | 3300046455 | Ga0495603_0238765 | Ga0495603_0238765_117_449 | 110 |
| 1288 | 3300046459 | Ga0495629_0003115 | Ga0495629_0003115_3500_3832 | 110 |
| 1289 | 3300046459 | Ga0495629_0025075 | Ga0495629_0025075_1653_1985 | 110 |
| 1290 | 3300046459 | Ga0495629_0040407 | Ga0495629_0040407_64_396 | 110 |
| 1291 | 3300046459 | Ga0495629_0303378 | Ga0495629_0303378_748_1080 | 110 |
| 1292 | 3300046459 | Ga0495629_0618441 | Ga0495629_0618441_249_581 | 110 |
| 1293 | 3300046459 | Ga0495629_1112862 | Ga0495629_1112862_64_396 | 110 |
| 1294 | 3300046462 | Ga0495651_0009970 | Ga0495651_0009970_6484_6816 | 110 |
| 1295 | 3300046462 | Ga0495651_0017083 | Ga0495651_0017083_2876_3208 | 110 |
| 1296 | 3300046462 | Ga0495651_0124418 | Ga0495651_0124418_424_756 | 110 |
| 1297 | 3300046462 | Ga0495651_0644771 | Ga0495651_0644771_134_466 | 110 |
| 1298 | 3300046463 | Ga0495653_0000547 | Ga0495653_0000547_5451_5783 | 110 |
| 1299 | 3300046463 | Ga0495653_0006042 | Ga0495653_0006042_7175_7507 | 110 |
| 1300 | 3300046463 | Ga0495653_0636764 | Ga0495653_0636764_56_388 | 110 |
| 1301 | 3300046472 | Ga0495580_0001189 | Ga0495580_0001189_9052_9384 | 110 |
| 1302 | 3300046472 | Ga0495580_0005504 | Ga0495580_0005504_8831_9163 | 110 |
| 1303 | 3300046472 | Ga0495580_0109372 | Ga0495580_0109372_918_1250 | 110 |
| 1304 | 3300046472 | Ga0495580_1020227 | Ga0495580_1020227_51_383 | 110 |
| 1305 | 3300046473 | Ga0495582_0013598 | Ga0495582_0013598_2293_2625 | 110 |
| 1306 | 3300046473 | Ga0495582_0039450 | Ga0495582_0039450_900_1232 | 110 |
| 1307 | 3300046473 | Ga0495582_0088607 | Ga0495582_0088607_365_697 | 110 |
| 1308 | 3300046473 | Ga0495582_0151791 | Ga0495582_0151791_537_869 | 110 |
| 1309 | 3300046473 | Ga0495582_0762531 | Ga0495582_0762531_170_502 | 110 |
| 1310 | 3300046475 | Ga0495639_0000549 | Ga0495639_0000549_7396_7728 | 110 |
| 1311 | 3300046475 | Ga0495639_0011675 | Ga0495639_0011675_1904_2236 | 110 |
| 1312 | 3300046475 | Ga0495639_0316237 | Ga0495639_0316237_13_345 | 110 |
| 1313 | 3300046476 | Ga0495662_0417003 | Ga0495662_0417003_217_549 | 110 |
| 1314 | 3300046477 | Ga0495664_0281001 | Ga0495664_0281001_616_948 | 110 |
| 1315 | 3300046477 | Ga0495664_0714430 | Ga0495664_0714430_37_390 | 110 |
| 1316 | 3300046499 | Ga0495594_0011878 | Ga0495594_0011878_3522_3854 | 110 |
| 1317 | 3300046499 | Ga0495594_0145232 | Ga0495594_0145232_693_1025 | 110 |
| 1318 | 3300046511 | Ga0495608_0000405 | Ga0495608_0000405_8473_8805 | 110 |
| 1319 | 3300046511 | Ga0495608_0028611 | Ga0495608_0028611_2066_2398 | 110 |
| 1320 | 3300046514 | Ga0495618_0153235 | Ga0495618_0153235_229_561 | 110 |
| 1321 | 3300046516 | Ga0495628_0000494 | Ga0495628_0000494_22130_22462 | 110 |
| 1322 | 3300046516 | Ga0495628_0040700 | Ga0495628_0040700_3362_3694 | 110 |
| 1323 | 3300046516 | Ga0495628_0122008 | Ga0495628_0122008_790_1122 | 110 |
| 1324 | 3300046517 | Ga0495630_0002236 | Ga0495630_0002236_1684_2016 | 110 |
| 1325 | 3300046517 | Ga0495630_0003849 | Ga0495630_0003849_5288_5620 | 110 |
| 1326 | 3300046517 | Ga0495630_0015750 | Ga0495630_0015750_4034_4366 | 110 |
| 1327 | 3300046517 | Ga0495630_0085082 | Ga0495630_0085082_1795_2127 | 110 |
| 1328 | 3300046525 | Ga0495663_0099594 | Ga0495663_0099594_384_716 | 110 |
| 1329 | 3300046526 | Ga0495666_0050611 | Ga0495666_0050611_1340_1672 | 110 |
| 1330 | 3300046529 | Ga0495652_0008315 | Ga0495652_0008315_1574_1906 | 110 |
| 1331 | 3300046529 | Ga0495652_0042274 | Ga0495652_0042274_2018_2350 | 110 |
| 1332 | 3300046531 | Ga0495665_0000358 | Ga0495665_0000358_13315_13647 | 110 |
| 1333 | 3300046531 | Ga0495665_0003130 | Ga0495665_0003130_5929_6261 | 110 |
| 1334 | 3300046531 | Ga0495665_0075851 | Ga0495665_0075851_990_1322 | 110 |
| 1335 | 3300046531 | Ga0495665_0593238 | Ga0495665_0593238_31_363 | 110 |
| 1336 | 3300046533 | Ga0495640_0359579 | Ga0495640_0359579_478_810 | 110 |
| 1337 | 3300046535 | Ga0495586_0004190 | Ga0495586_0004190_2859_3191 | 110 |
| 1338 | 3300046536 | Ga0495587_0000269 | Ga0495587_0000269_24083_24415 | 110 |
| 1339 | 3300046536 | Ga0495587_0000334 | Ga0495587_0000334_24838_25170 | 110 |
| 1340 | 3300046536 | Ga0495587_0001945 | Ga0495587_0001945_2998_3330 | 110 |
| 1341 | 3300046536 | Ga0495587_0124263 | Ga0495587_0124263_38_391 | 110 |
| 1342 | 3300046539 | Ga0495621_0343511 | Ga0495621_0343511_35_367 | 110 |
| 1343 | 3300046543 | Ga0495645_0005088 | Ga0495645_0005088_2710_3042 | 110 |
| 1344 | 3300046543 | Ga0495645_0087646 | Ga0495645_0087646_49_381 | 110 |
| 1345 | 3300046557 | Ga0495622_0225599 | Ga0495622_0225599_94_426 | 110 |
| 1346 | 3300046559 | Ga0495667_0000504 | Ga0495667_0000504_17627_17959 | 110 |
| 1347 | 3300046559 | Ga0495667_0001705 | Ga0495667_0001705_11873_12205 | 110 |
| 1348 | 3300046559 | Ga0495667_0005981 | Ga0495667_0005981_2765_3097 | 110 |
| 1349 | 3300046642 | Ga0495634_0830558 | Ga0495634_0830558_141_473 | 110 |
| 1350 | 3300046663 | Ga0495635_0000200 | Ga0495635_0000200_24732_25064 | 110 |
| 1351 | 3300046663 | Ga0495635_0354627 | Ga0495635_0354627_619_951 | 110 |
| 1352 | 3300046664 | Ga0495659_0150507 | Ga0495659_0150507_323_655 | 110 |
| 1353 | 3300046664 | Ga0495659_0328021 | Ga0495659_0328021_158_490 | 110 |
| 1354 | 3300046664 | Ga0495659_0379927 | Ga0495659_0379927_16_348 | 110 |
| 1355 | 3300046674 | Ga0495588_0012498 | Ga0495588_0012498_1964_2296 | 110 |
| 1356 | 3300046674 | Ga0495588_0023908 | Ga0495588_0023908_1069_1401 | 110 |
| 1357 | 3300046675 | Ga0495657_0011939 | Ga0495657_0011939_4509_4841 | 110 |
| 1358 | 3300046675 | Ga0495657_0464029 | Ga0495657_0464029_116_448 | 110 |
| 1359 | 3300046675 | Ga0495657_0876098 | Ga0495657_0876098_97_429 | 110 |
| 1360 | 3300046678 | Ga0495599_0002011 | Ga0495599_0002011_4881_5213 | 110 |
| 1361 | 3300046678 | Ga0495599_0021680 | Ga0495599_0021680_839_1171 | 110 |
| 1362 | 3300046678 | Ga0495599_0082661 | Ga0495599_0082661_75_407 | 110 |
| 1363 | 3300046679 | Ga0495623_0000156 | Ga0495623_0000156_18164_18496 | 110 |
| 1364 | 3300046679 | Ga0495623_0003024 | Ga0495623_0003024_3035_3367 | 110 |
| 1365 | 3300046679 | Ga0495623_0052162 | Ga0495623_0052162_2165_2497 | 110 |
| 1366 | 3300046680 | Ga0495646_0038350 | Ga0495646_0038350_369_701 | 110 |
| 1367 | 3300046683 | Ga0495658_0001403 | Ga0495658_0001403_10061_10393 | 110 |
| 1368 | 3300046683 | Ga0495658_0048011 | Ga0495658_0048011_1032_1364 | 110 |
| 1369 | 3300046683 | Ga0495658_0251892 | Ga0495658_0251892_452_787 | 110 |
| 1370 | 3300046683 | Ga0495658_0357189 | Ga0495658_0357189_463_795 | 110 |
| 1371 | 3300046683 | Ga0495658_0662063 | Ga0495658_0662063_298_630 | 110 |
| 1372 | 3300046689 | Ga0495613_0102611 | Ga0495613_0102611_1695_2027 | 110 |
| 1373 | 3300046689 | Ga0495613_0168100 | Ga0495613_0168100_680_1012 | 110 |
| 1374 | 3300046689 | Ga0495613_0312533 | Ga0495613_0312533_585_917 | 110 |
| 1375 | 3300046689 | Ga0495613_0387039 | Ga0495613_0387039_548_901 | 110 |
| 1376 | 3300046689 | Ga0495613_0510664 | Ga0495613_0510664_252_584 | 110 |
| 1377 | 3300046809 | Ga0495600_0003971 | Ga0495600_0003971_424_756 | 110 |
| 1378 | 3300047315 | Ga0495581_0000659 | Ga0495581_0000659_6539_6871 | 110 |
| 1379 | 3300047315 | Ga0495581_0016943 | Ga0495581_0016943_1294_1626 | 110 |
| 1380 | 3300047315 | Ga0495581_0051860 | Ga0495581_0051860_411_743 | 110 |
| 1381 | 3300047315 | Ga0495581_0564619 | Ga0495581_0564619_237_590 | 110 |
| 1382 | 3300047315 | Ga0495581_0636522 | Ga0495581_0636522_220_552 | 110 |
| 1383 | 3300047317 | Ga0495604_0004192 | Ga0495604_0004192_7505_7837 | 110 |
| 1384 | 3300047317 | Ga0495604_0025411 | Ga0495604_0025411_1233_1565 | 110 |
| 1385 | 3300047317 | Ga0495604_0939967 | Ga0495604_0939967_70_402 | 110 |
| 1386 | 3300047318 | Ga0495636_0095234 | Ga0495636_0095234_834_1166 | 110 |
| 1387 | 3300047319 | Ga0495674_0007567 | Ga0495674_0007567_2134_2466 | 110 |
| 1388 | 3300047319 | Ga0495674_0032263 | Ga0495674_0032263_3670_4002 | 110 |
| 1389 | 3300047319 | Ga0495674_0043600 | Ga0495674_0043600_2432_2764 | 110 |
| 1390 | 3300047319 | Ga0495674_0894607 | Ga0495674_0894607_65_397 | 110 |
| 1391 | 3300047322 | Ga0495680_0004788 | Ga0495680_0004788_7475_7807 | 110 |
| 1392 | 3300047322 | Ga0495680_0791030 | Ga0495680_0791030_189_521 | 110 |
| 1393 | 3300047444 | Ga0495675_0002012 | Ga0495675_0002012_4208_4540 | 110 |
| 1394 | 3300047444 | Ga0495675_0057891 | Ga0495675_0057891_2026_2358 | 110 |
| 1395 | 3300047444 | Ga0495675_0070071 | Ga0495675_0070071_794_1126 | 110 |
| 1396 | 3300047444 | Ga0495675_0075070 | Ga0495675_0075070_71_403 | 110 |
| 1397 | 3300047444 | Ga0495675_0402624 | Ga0495675_0402624_379_732 | 110 |
| 1398 | 3300047444 | Ga0495675_0837854 | Ga0495675_0837854_53_385 | 110 |
| 1399 | 3300047471 | Ga0495684_0001442 | Ga0495684_0001442_3805_4137 | 110 |
| 1400 | 3300047471 | Ga0495684_0024474 | Ga0495684_0024474_3159_3491 | 110 |
| 1401 | 3300047471 | Ga0495684_0063191 | Ga0495684_0063191_432_764 | 110 |
| 1402 | 3300047673 | Ga0495593_0000356 | Ga0495593_0000356_19753_20085 | 110 |
| 1403 | 3300047673 | Ga0495593_0111707 | Ga0495593_0111707_433_765 | 110 |
| 1404 | 3300047673 | Ga0495593_0133358 | Ga0495593_0133358_381_713 | 110 |
| 1405 | 3300047673 | Ga0495593_0509573 | Ga0495593_0509573_202_534 | 110 |
| 1406 | 3300048088 | Ga0495602_0003996 | Ga0495602_0003996_7683_8015 | 110 |
| 1407 | 3300048088 | Ga0495602_0039288 | Ga0495602_0039288_1950_2282 | 110 |
| 1408 | 3300048088 | Ga0495602_0133381 | Ga0495602_0133381_1606_1938 | 110 |
| 1409 | 3300048089 | Ga0495614_0000638 | Ga0495614_0000638_8715_9047 | 110 |
| 1410 | 3300048089 | Ga0495614_0279277 | Ga0495614_0279277_398_751 | 110 |
| 1411 | 3300048090 | Ga0495615_0073472 | Ga0495615_0073472_457_789 | 110 |
| 1412 | 3300048903 | Ga0496100_0073025 | Ga0496100_0073025_941_1276 | 110 |
| 1413 | 3300048903 | Ga0496100_0171604 | Ga0496100_0171604_464_796 | 110 |
| 1414 | 3300048903 | Ga0496100_0835443 | Ga0496100_0835443_56_391 | 110 |
| 1415 | 3300048903 | Ga0496100_0848128 | Ga0496100_0848128_96_428 | 110 |
| 1416 | 3300048903 | Ga0496100_1059323 | Ga0496100_1059323_29_364 | 110 |
| 1417 | 3300048904 | Ga0496101_0038807 | Ga0496101_0038807_1606_1941 | 110 |
| 1418 | 3300048904 | Ga0496101_0077774 | Ga0496101_0077774_482_814 | 110 |
| 1419 | 3300048904 | Ga0496101_1050509 | Ga0496101_1050509_195_530 | 110 |
| 1420 | 3300048905 | Ga0496102_0067085 | Ga0496102_0067085_2224_2559 | 110 |
| 1421 | 3300048905 | Ga0496102_0134419 | Ga0496102_0134419_1105_1440 | 110 |
| 1422 | 3300048905 | Ga0496102_0451550 | Ga0496102_0451550_750_1085 | 110 |
| 1423 | 3300048905 | Ga0496102_0749520 | Ga0496102_0749520_509_844 | 110 |
| 1424 | 3300048905 | Ga0496102_1123092 | Ga0496102_1123092_44_379 | 110 |
| 1425 | 3300048906 | Ga0496103_0181794 | Ga0496103_0181794_29_364 | 110 |
| 1426 | 3300048907 | Ga0496104_0004744 | Ga0496104_0004744_3020_3355 | 110 |
| 1427 | 3300048907 | Ga0496104_0183124 | Ga0496104_0183124_1196_1531 | 110 |
| 1428 | 3300048907 | Ga0496104_0623643 | Ga0496104_0623643_111_446 | 110 |
| 1429 | 3300048908 | Ga0496105_0572812 | Ga0496105_0572812_40_372 | 110 |
| 1430 | 3300048909 | Ga0496106_0053593 | Ga0496106_0053593_1718_2053 | 110 |
| 1431 | 3300048909 | Ga0496106_0467735 | Ga0496106_0467735_127_462 | 110 |
| 1432 | 3300048909 | Ga0496106_0644154 | Ga0496106_0644154_39_374 | 110 |
| 1433 | 3300048909 | Ga0496106_0649088 | Ga0496106_0649088_207_542 | 110 |
| 1434 | 3300048910 | Ga0496107_0177846 | Ga0496107_0177846_1157_1492 | 110 |
| 1435 | 3300048910 | Ga0496107_0294105 | Ga0496107_0294105_581_916 | 110 |
| 1436 | 3300048911 | Ga0496108_0005237 | Ga0496108_0005237_2130_2465 | 110 |
| 1437 | 3300048911 | Ga0496108_0017435 | Ga0496108_0017435_2020_2355 | 110 |
| 1438 | 3300048911 | Ga0496108_0180869 | Ga0496108_0180869_84_419 | 110 |
| 1439 | 3300048911 | Ga0496108_0820892 | Ga0496108_0820892_265_597 | 110 |
| 1440 | 3300048912 | Ga0496109_0007523 | Ga0496109_0007523_3177_3512 | 110 |
| 1441 | 3300048912 | Ga0496109_0071352 | Ga0496109_0071352_1605_1940 | 110 |
| 1442 | 3300048912 | Ga0496109_0382259 | Ga0496109_0382259_494_826 | 110 |
| 1443 | 3300048912 | Ga0496109_2049924 | Ga0496109_2049924_104_436 | 110 |
| 1444 | 3300048913 | Ga0496110_0029147 | Ga0496110_0029147_1453_1788 | 110 |
| 1445 | 3300048913 | Ga0496110_0080168 | Ga0496110_0080168_2143_2478 | 110 |
| 1446 | 3300048914 | Ga0496111_0032614 | Ga0496111_0032614_1653_1988 | 110 |
| 1447 | 3300048914 | Ga0496111_0115469 | Ga0496111_0115469_1167_1502 | 110 |
| 1448 | 3300048915 | Ga0496112_0001950 | Ga0496112_0001950_10526_10861 | 110 |
| 1449 | 3300048915 | Ga0496112_0022068 | Ga0496112_0022068_3598_3933 | 110 |
| 1450 | 3300048915 | Ga0496112_0889592 | Ga0496112_0889592_383_718 | 110 |
| 1451 | 3300048916 | Ga0496113_0000769 | Ga0496113_0000769_9062_9397 | 110 |
| 1452 | 3300048916 | Ga0496113_0068922 | Ga0496113_0068922_1695_2030 | 110 |
| 1453 | 3300048916 | Ga0496113_0116662 | Ga0496113_0116662_791_1123 | 110 |
| 1454 | 3300048917 | Ga0496114_0134245 | Ga0496114_0134245_1475_1810 | 110 |
| 1455 | 3300048917 | Ga0496114_0384593 | Ga0496114_0384593_617_949 | 110 |
| 1456 | 3300048918 | Ga0496115_0004680 | Ga0496115_0004680_615_947 | 110 |
| 1457 | 3300048918 | Ga0496115_0215545 | Ga0496115_0215545_43_396 | 110 |
| 1458 | 3300049127 | Ga0501306_036833 | Ga0501306_036833_389_721 | 110 |
| 1459 | 3300049129 | Ga0501309_062896 | Ga0501309_062896_246_578 | 110 |
| 1460 | 3300049160 | Ga0501304_027104 | Ga0501304_027104_164_496 | 110 |
| 1461 | 3300049513 | Ga0501290_016941 | Ga0501290_016941_75_407 | 110 |
| 1462 | 3300049514 | Ga0501291_039674 | Ga0501291_039674_430_762 | 110 |
| 1463 | 3300049517 | Ga0501294_011442 | Ga0501294_011442_235_570 | 110 |
| 1464 | 3300049520 | Ga0501297_044363 | Ga0501297_044363_156_488 | 110 |
| 1465 | 3300049521 | Ga0501298_059127 | Ga0501298_059127_355_690 | 110 |
| 1466 | 3300049521 | Ga0501298_113859 | Ga0501298_113859_68_400 | 110 |
| 1467 | 3300049522 | Ga0501299_123283 | Ga0501299_123283_274_606 | 110 |
| 1468 | 3300049522 | Ga0501299_157296 | Ga0501299_157296_139_471 | 110 |
| 1469 | 3300049527 | Ga0501311_048452 | Ga0501311_048452_202_534 | 110 |
| 1470 | 3300049527 | Ga0501311_058505 | Ga0501311_058505_55_387 | 110 |
| 1471 | 3300049529 | Ga0501313_027753 | Ga0501313_027753_242_574 | 110 |
| 1472 | 3300049530 | Ga0501314_036812 | Ga0501314_036812_162_494 | 110 |
| 1473 | 3300049531 | Ga0501315_102951 | Ga0501315_102951_90_422 | 110 |
| 1474 | 3300049532 | Ga0501316_045992 | Ga0501316_045992_253_585 | 110 |
| 1475 | 3300049533 | Ga0501317_080926 | Ga0501317_080926_160_492 | 110 |
| 1476 | 3300049539 | Ga0501323_043397 | Ga0501323_043397_95_427 | 110 |
| 1477 | 3300049539 | Ga0501323_065499 | Ga0501323_065499_12_344 | 110 |
| 1478 | 3300049541 | Ga0501325_027581 | Ga0501325_027581_240_572 | 110 |
| 1479 | 3300049556 | Ga0501340_016227 | Ga0501340_016227_20_352 | 110 |
| 1480 | 3300049556 | Ga0501340_026915 | Ga0501340_026915_135_467 | 110 |
| 1481 | 3300049569 | Ga0501032_0043085 | Ga0501032_0043085_673_1005 | 110 |
| 1482 | 3300049569 | Ga0501032_0160958 | Ga0501032_0160958_196_528 | 110 |
| 1483 | 3300049570 | Ga0501033_0031074 | Ga0501033_0031074_1451_1783 | 110 |
| 1484 | 3300049571 | Ga0501034_1216412 | Ga0501034_1216412_271_603 | 110 |
| 1485 | 3300049572 | Ga0501036_0038635 | Ga0501036_0038635_2200_2532 | 110 |
| 1486 | 3300049572 | Ga0501036_0200401 | Ga0501036_0200401_876_1208 | 110 |
| 1487 | 3300049573 | Ga0501037_0241493 | Ga0501037_0241493_728_1060 | 110 |
| 1488 | 3300049574 | Ga0501038_0108158 | Ga0501038_0108158_1285_1617 | 110 |
| 1489 | 3300049574 | Ga0501038_0581194 | Ga0501038_0581194_472_804 | 110 |
| 1490 | 3300049575 | Ga0501039_0160910 | Ga0501039_0160910_355_687 | 110 |
| 1491 | 3300049576 | Ga0501040_1191822 | Ga0501040_1191822_165_497 | 110 |
| 1492 | 3300049577 | Ga0501041_0073333 | Ga0501041_0073333_309_641 | 110 |
| 1493 | 3300049577 | Ga0501041_0134378 | Ga0501041_0134378_411_743 | 110 |
| 1494 | 3300049577 | Ga0501041_0668060 | Ga0501041_0668060_236_571 | 110 |
| 1495 | 3300049578 | Ga0501042_0144495 | Ga0501042_0144495_1180_1512 | 110 |
| 1496 | 3300049578 | Ga0501042_0244581 | Ga0501042_0244581_31_363 | 110 |
| 1497 | 3300049579 | Ga0501043_0048272 | Ga0501043_0048272_63_395 | 110 |
| 1498 | 3300049579 | Ga0501043_0108258 | Ga0501043_0108258_889_1221 | 110 |
| 1499 | 3300049580 | Ga0501046_0133310 | Ga0501046_0133310_1185_1517 | 110 |
| 1500 | 3300049580 | Ga0501046_0945160 | Ga0501046_0945160_35_367 | 110 |
| 1501 | 3300049581 | Ga0501047_0216687 | Ga0501047_0216687_1063_1395 | 110 |
| 1502 | 3300049581 | Ga0501047_0243318 | Ga0501047_0243318_768_1100 | 110 |
| 1503 | 3300049583 | Ga0501067_0000353 | Ga0501067_0000353_22690_23022 | 110 |
| 1504 | 3300049583 | Ga0501067_0044515 | Ga0501067_0044515_493_828 | 110 |
| 1505 | 3300049583 | Ga0501067_0257517 | Ga0501067_0257517_375_707 | 110 |
| 1506 | 3300049583 | Ga0501067_0334725 | Ga0501067_0334725_91_426 | 110 |
| 1507 | 3300049584 | Ga0501068_0001339 | Ga0501068_0001339_4658_4990 | 110 |
| 1508 | 3300049584 | Ga0501068_0084626 | Ga0501068_0084626_890_1225 | 110 |
| 1509 | 3300049584 | Ga0501068_0831386 | Ga0501068_0831386_20_355 | 110 |
| 1510 | 3300049585 | Ga0501069_0026566 | Ga0501069_0026566_927_1259 | 110 |
| 1511 | 3300049585 | Ga0501069_0032090 | Ga0501069_0032090_614_946 | 110 |
| 1512 | 3300049585 | Ga0501069_0032461 | Ga0501069_0032461_1626_1961 | 110 |
| 1513 | 3300049585 | Ga0501069_0166828 | Ga0501069_0166828_589_924 | 110 |
| 1514 | 3300049586 | Ga0501070_0000192 | Ga0501070_0000192_14988_15320 | 110 |
| 1515 | 3300049586 | Ga0501070_0123099 | Ga0501070_0123099_280_612 | 110 |
| 1516 | 3300049586 | Ga0501070_0137205 | Ga0501070_0137205_805_1137 | 110 |
| 1517 | 3300049586 | Ga0501070_0168786 | Ga0501070_0168786_979_1311 | 110 |
| 1518 | 3300049586 | Ga0501070_0369431 | Ga0501070_0369431_148_480 | 110 |
| 1519 | 3300049586 | Ga0501070_0726126 | Ga0501070_0726126_331_666 | 110 |
| 1520 | 3300049587 | Ga0501071_0000678 | Ga0501071_0000678_13553_13885 | 110 |
| 1521 | 3300049587 | Ga0501071_0325048 | Ga0501071_0325048_250_582 | 110 |
| 1522 | 3300049587 | Ga0501071_0591982 | Ga0501071_0591982_154_489 | 110 |
| 1523 | 3300049587 | Ga0501071_0796005 | Ga0501071_0796005_291_626 | 110 |
| 1524 | 3300049588 | Ga0501072_0009721 | Ga0501072_0009721_2893_3225 | 110 |
| 1525 | 3300049588 | Ga0501072_0078699 | Ga0501072_0078699_1612_1944 | 110 |
| 1526 | 3300049588 | Ga0501072_0409368 | Ga0501072_0409368_180_512 | 110 |
| 1527 | 3300049588 | Ga0501072_0962943 | Ga0501072_0962943_147_479 | 110 |
| 1528 | 3300049588 | Ga0501072_1102293 | Ga0501072_1102293_49_381 | 110 |
| 1529 | 3300049588 | Ga0501072_1230604 | Ga0501072_1230604_86_418 | 110 |
| 1530 | 3300049589 | Ga0501073_0000949 | Ga0501073_0000949_3734_4066 | 110 |
| 1531 | 3300049589 | Ga0501073_0631350 | Ga0501073_0631350_327_662 | 110 |
| 1532 | 3300049589 | Ga0501073_0790902 | Ga0501073_0790902_143_475 | 110 |
| 1533 | 3300049590 | Ga0501074_0000171 | Ga0501074_0000171_4532_4864 | 110 |
| 1534 | 3300049590 | Ga0501074_0368537 | Ga0501074_0368537_38_370 | 110 |
| 1535 | 3300049592 | Ga0501076_0149239 | Ga0501076_0149239_552_884 | 110 |
| 1536 | 3300049592 | Ga0501076_0194593 | Ga0501076_0194593_609_941 | 110 |
| 1537 | 3300049652 | Ga0501202_079250 | Ga0501202_079250_316_651 | 110 |
| 1538 | 3300049653 | Ga0501206_044105 | Ga0501206_044105_132_467 | 110 |
| 1539 | 3300049658 | Ga0501211_051127 | Ga0501211_051127_16_348 | 110 |
| 1540 | 3300049660 | Ga0501216_079627 | Ga0501216_079627_283_615 | 110 |
| 1541 | 3300049660 | Ga0501216_133714 | Ga0501216_133714_118_453 | 110 |
| 1542 | 3300049661 | Ga0501217_042743 | Ga0501217_042743_591_923 | 110 |
| 1543 | 3300049661 | Ga0501217_066451 | Ga0501217_066451_210_545 | 110 |
| 1544 | 3300049661 | Ga0501217_090548 | Ga0501217_090548_188_523 | 110 |
| 1545 | 3300049661 | Ga0501217_201734 | Ga0501217_201734_245_577 | 110 |
| 1546 | 3300049663 | Ga0501223_050772 | Ga0501223_050772_180_512 | 110 |
| 1547 | 3300049665 | Ga0501227_041230 | Ga0501227_041230_180_512 | 110 |
| 1548 | 3300049667 | Ga0501230_029252 | Ga0501230_029252_182_517 | 110 |
| 1549 | 3300049672 | Ga0501239_036423 | Ga0501239_036423_21_356 | 110 |
| 1550 | 3300049674 | Ga0501242_003701 | Ga0501242_003701_1319_1654 | 110 |
| 1551 | 3300049675 | Ga0501243_014106 | Ga0501243_014106_548_883 | 110 |
| 1552 | 3300049675 | Ga0501243_072468 | Ga0501243_072468_77_409 | 110 |
| 1553 | 3300049678 | Ga0501248_012725 | Ga0501248_012725_215_550 | 110 |
| 1554 | 3300049679 | Ga0501249_006910 | Ga0501249_006910_33_365 | 110 |
| 1555 | 3300049679 | Ga0501249_014954 | Ga0501249_014954_631_966 | 110 |
| 1556 | 3300049685 | Ga0501256_002047 | Ga0501256_002047_1137_1472 | 110 |
| 1557 | 3300049686 | Ga0501257_025964 | Ga0501257_025964_434_769 | 110 |
| 1558 | 3300049686 | Ga0501257_034172 | Ga0501257_034172_685_1017 | 110 |
| 1559 | 3300049690 | Ga0501261_097815 | Ga0501261_097815_171_503 | 110 |
| 1560 | 3300049705 | Ga0501225_0104002 | Ga0501225_0104002_104_439 | 110 |
| 1561 | 3300049708 | Ga0501245_027410 | Ga0501245_027410_215_547 | 110 |
| 1562 | 3300049741 | Ga0501079_0076548 | Ga0501079_0076548_232_567 | 110 |
| 1563 | 3300049741 | Ga0501079_0142055 | Ga0501079_0142055_600_932 | 110 |
| 1564 | 3300049741 | Ga0501079_0218931 | Ga0501079_0218931_392_724 | 110 |
| 1565 | 3300049742 | Ga0501080_0000060 | Ga0501080_0000060_13544_13876 | 110 |
| 1566 | 3300049742 | Ga0501080_0005735 | Ga0501080_0005735_2991_3323 | 110 |
| 1567 | 3300049742 | Ga0501080_0111578 | Ga0501080_0111578_563_898 | 110 |
| 1568 | 3300049742 | Ga0501080_0247391 | Ga0501080_0247391_862_1194 | 110 |
| 1569 | 3300049743 | Ga0501081_0337820 | Ga0501081_0337820_348_683 | 110 |
| 1570 | 3300049743 | Ga0501081_0376070 | Ga0501081_0376070_323_655 | 110 |
| 1571 | 3300049743 | Ga0501081_0931676 | Ga0501081_0931676_248_580 | 110 |
| 1572 | 3300049744 | Ga0501083_0008037 | Ga0501083_0008037_2153_2485 | 110 |
| 1573 | 3300049744 | Ga0501083_0529860 | Ga0501083_0529860_298_630 | 110 |
| 1574 | 3300049761 | Ga0501264_006568 | Ga0501264_006568_421_753 | 110 |
| 1575 | 3300049765 | Ga0501268_001006 | Ga0501268_001006_480_815 | 110 |
| 1576 | 3300049765 | Ga0501268_045841 | Ga0501268_045841_334_666 | 110 |
| 1577 | 3300049769 | Ga0501272_005087 | Ga0501272_005087_551_886 | 110 |
| 1578 | 3300049770 | Ga0501273_005428 | Ga0501273_005428_388_723 | 110 |
| 1579 | 3300049770 | Ga0501273_045094 | Ga0501273_045094_97_429 | 110 |
| 1580 | 3300049772 | Ga0501275_042240 | Ga0501275_042240_84_419 | 110 |
| 1581 | 3300049773 | Ga0501276_019420 | Ga0501276_019420_231_563 | 110 |
| 1582 | 3300049779 | Ga0501283_085767 | Ga0501283_085767_82_414 | 110 |
| 1583 | 3300049823 | Ga0501044_0006673 | Ga0501044_0006673_6191_6523 | 110 |
| 1584 | 3300049823 | Ga0501044_0384435 | Ga0501044_0384435_44_376 | 110 |
| 1585 | 3300049824 | Ga0501045_0059366 | Ga0501045_0059366_1571_1903 | 110 |
| 1586 | 3300049824 | Ga0501045_0457465 | Ga0501045_0457465_279_611 | 110 |
| 1587 | 3300049850 | Ga0501204_040726 | Ga0501204_040726_317_652 | 110 |
| 1588 | 3300049852 | Ga0501220_08404 | Ga0501220_08404_194_526 | 110 |
| 1589 | 3300050507 | nmdc:mga05p37_1158346_c1 | nmdc:mga05p37_1158346_c1_103_435 | 110 |
| 1590 | 3300050507 | nmdc:mga05p37_2129497_c1 | nmdc:mga05p37_2129497_c1_160_495 | 110 |
| 1591 | 3300050507 | nmdc:mga05p37_24458_c1 | nmdc:mga05p37_24458_c1_527_859 | 110 |
| 1592 | 3300050507 | nmdc:mga05p37_259528_c1 | nmdc:mga05p37_259528_c1_340_672 | 110 |
| 1593 | 3300050507 | nmdc:mga05p37_313439_c1 | nmdc:mga05p37_313439_c1_328_663 | 110 |
| 1594 | 3300050507 | nmdc:mga05p37_328502_c1 | nmdc:mga05p37_328502_c1_177_557 | 110 |
| 1595 | 3300050507 | nmdc:mga05p37_372223_c1 | nmdc:mga05p37_372223_c1_442_774 | 110 |
| 1596 | 3300050507 | nmdc:mga05p37_81382_c1 | nmdc:mga05p37_81382_c1_1630_1962 | 110 |
| 1597 | 3300050507 | nmdc:mga05p37_82134_c1 | nmdc:mga05p37_82134_c1_771_1106 | 110 |
| 1598 | 3300050507 | nmdc:mga05p37_830499_c1 | nmdc:mga05p37_830499_c1_420_752 | 110 |
| 1599 | 3300050508 | nmdc:mga09592_132896_c1 | nmdc:mga09592_132896_c1_243_575 | 110 |
| 1600 | 3300050508 | nmdc:mga09592_216657_c1 | nmdc:mga09592_216657_c1_288_620 | 110 |
| 1601 | 3300050508 | nmdc:mga09592_72535_c1 | nmdc:mga09592_72535_c1_986_1318 | 110 |
| 1602 | 3300050509 | nmdc:mga0qj67_10094_c1 | nmdc:mga0qj67_10094_c1_1081_1413 | 110 |
| 1603 | 3300050509 | nmdc:mga0qj67_1478095_c1 | nmdc:mga0qj67_1478095_c1_94_429 | 110 |
| 1604 | 3300050509 | nmdc:mga0qj67_18195_c1 | nmdc:mga0qj67_18195_c1_1123_1455 | 110 |
| 1605 | 3300050509 | nmdc:mga0qj67_3022_c1 | nmdc:mga0qj67_3022_c1_4300_4632 | 110 |
| 1606 | 3300050509 | nmdc:mga0qj67_3465_c1 | nmdc:mga0qj67_3465_c1_9542_9874 | 110 |
| 1607 | 3300050509 | nmdc:mga0qj67_37040_c1 | nmdc:mga0qj67_37040_c1_3317_3652 | 110 |
| 1608 | 3300050509 | nmdc:mga0qj67_505202_c1 | nmdc:mga0qj67_505202_c1_32_364 | 110 |
| 1609 | 3300050509 | nmdc:mga0qj67_52160_c1 | nmdc:mga0qj67_52160_c1_906_1238 | 110 |
| 1610 | 3300050510 | nmdc:mga06r32_139003_c1 | nmdc:mga06r32_139003_c1_307_639 | 110 |
| 1611 | 3300050510 | nmdc:mga06r32_1637814_c1 | nmdc:mga06r32_1637814_c1_233_565 | 110 |
| 1612 | 3300050510 | nmdc:mga06r32_186579_c1 | nmdc:mga06r32_186579_c1_678_1010 | 110 |
| 1613 | 3300050510 | nmdc:mga06r32_363451_c1 | nmdc:mga06r32_363451_c1_440_772 | 110 |
| 1614 | 3300050510 | nmdc:mga06r32_406801_c1 | nmdc:mga06r32_406801_c1_853_1185 | 110 |
| 1615 | 3300050510 | nmdc:mga06r32_533345_c1 | nmdc:mga06r32_533345_c1_404_736 | 110 |
| 1616 | 3300050510 | nmdc:mga06r32_712109_c1 | nmdc:mga06r32_712109_c1_233_565 | 110 |
| 1617 | 3300050510 | nmdc:mga06r32_73470_c1 | nmdc:mga06r32_73470_c1_1430_1762 | 110 |
| 1618 | 3300050510 | nmdc:mga06r32_77166_c1 | nmdc:mga06r32_77166_c1_35_370 | 110 |
| 1619 | 3300050510 | nmdc:mga06r32_812426_c1 | nmdc:mga06r32_812426_c1_523_855 | 110 |
| 1620 | 3300050511 | nmdc:mga08y16_1335218_c1 | nmdc:mga08y16_1335218_c1_77_412 | 110 |
| 1621 | 3300050511 | nmdc:mga08y16_345174_c1 | nmdc:mga08y16_345174_c1_209_544 | 110 |
| 1622 | 3300050511 | nmdc:mga08y16_479660_c1 | nmdc:mga08y16_479660_c1_876_1208 | 110 |
| 1623 | 3300050511 | nmdc:mga08y16_560798_c1 | nmdc:mga08y16_560798_c1_688_1020 | 110 |
| 1624 | 3300050511 | nmdc:mga08y16_9037_c1 | nmdc:mga08y16_9037_c1_3771_4103 | 110 |
| 1625 | 3300050512 | nmdc:mga0n895_1454242_c1 | nmdc:mga0n895_1454242_c1_191_523 | 110 |
| 1626 | 3300050512 | nmdc:mga0n895_24093_c1 | nmdc:mga0n895_24093_c1_2455_2787 | 110 |
| 1627 | 3300050512 | nmdc:mga0n895_42112_c1 | nmdc:mga0n895_42112_c1_2234_2566 | 110 |
| 1628 | 3300050512 | nmdc:mga0n895_753427_c1 | nmdc:mga0n895_753427_c1_361_693 | 110 |
| 1629 | 3300050512 | nmdc:mga0n895_770868_c1 | nmdc:mga0n895_770868_c1_261_593 | 110 |
| 1630 | 3300050513 | nmdc:mga0rr50_196370_c1 | nmdc:mga0rr50_196370_c1_745_1077 | 110 |
| 1631 | 3300050513 | nmdc:mga0rr50_545513_c1 | nmdc:mga0rr50_545513_c1_322_657 | 110 |
| 1632 | 3300050514 | nmdc:mga08x19_12152_c1 | nmdc:mga08x19_12152_c1_708_1040 | 110 |
| 1633 | 3300050514 | nmdc:mga08x19_425860_c1 | nmdc:mga08x19_425860_c1_421_753 | 110 |
| 1634 | 3300050515 | nmdc:mga0a205_32863_c1 | nmdc:mga0a205_32863_c1_2902_3234 | 110 |
| 1635 | 3300050515 | nmdc:mga0a205_37088_c1 | nmdc:mga0a205_37088_c1_686_1018 | 110 |
| 1636 | 3300050515 | nmdc:mga0a205_605389_c1 | nmdc:mga0a205_605389_c1_318_650 | 110 |
| 1637 | 3300050515 | nmdc:mga0a205_646225_c1 | nmdc:mga0a205_646225_c1_210_542 | 110 |
| 1638 | 3300053077 | Ga0495601_0003937 | Ga0495601_0003937_5175_5507 | 110 |
| 1639 | 3300053077 | Ga0495601_0081254 | Ga0495601_0081254_1443_1775 | 110 |
| 1640 | 3300053077 | Ga0495601_0084821 | Ga0495601_0084821_353_685 | 110 |
| 1641 | 3300053077 | Ga0495601_0840966 | Ga0495601_0840966_59_391 | 110 |
| 1642 | 3300053078 | Ga0495612_0000490 | Ga0495612_0000490_8554_8886 | 110 |
| 1643 | 3300053084 | Ga0495595_0024258 | Ga0495595_0024258_473_805 | 110 |
| 1644 | 3300053085 | Ga0495619_0002629 | Ga0495619_0002629_4116_4448 | 110 |
| 1645 | 3300053085 | Ga0495619_0062774 | Ga0495619_0062774_645_977 | 110 |
| 1646 | 3300053085 | Ga0495619_0414562 | Ga0495619_0414562_486_818 | 110 |
| 1647 | 3300054114 | Ga0501084_0081149 | Ga0501084_0081149_2071_2403 | 110 |
| 1648 | 3300054114 | Ga0501084_0095051 | Ga0501084_0095051_1856_2188 | 110 |
| 1649 | 3300054114 | Ga0501084_0170156 | Ga0501084_0170156_1494_1829 | 110 |
| 1650 | 3300054114 | Ga0501084_0184919 | Ga0501084_0184919_838_1170 | 110 |
| 1651 | 3300059421 | Ga0590071_031312 | Ga0590071_031312_301_633 | 110 |
| 1652 | 3300059421 | Ga0590071_043838 | Ga0590071_043838_387_719 | 110 |
| 1653 | 3300059424 | Ga0590075_026983 | Ga0590075_026983_783_1115 | 110 |
| 1654 | 3300059424 | Ga0590075_045298 | Ga0590075_045298_30_362 | 110 |
| 1655 | 3300059426 | Ga0590077_022697 | Ga0590077_022697_545_880 | 110 |
| 1656 | 3300059490 | Ga0587066_078833 | Ga0587066_078833_110_442 | 110 |
| 1657 | 3300059491 | Ga0587070_143242 | Ga0587070_143242_226_558 | 110 |
| 1658 | 3300059492 | Ga0587073_0057828 | Ga0587073_0057828_256_588 | 110 |
| 1659 | 3300059492 | Ga0587073_0117544 | Ga0587073_0117544_107_439 | 110 |
| 1660 | 3300059493 | Ga0587077_128672 | Ga0587077_128672_34_366 | 110 |
| 1661 | 3300059505 | Ga0587083_0108493 | Ga0587083_0108493_277_609 | 110 |
| 1662 | 3300059505 | Ga0587083_0153285 | Ga0587083_0153285_258_590 | 110 |
| 1663 | 3300059505 | Ga0587083_0260290 | Ga0587083_0260290_50_382 | 110 |
| 1664 | 3300059506 | Ga0587085_026550 | Ga0587085_026550_277_609 | 110 |
| 1665 | 3300059508 | Ga0587088_101991 | Ga0587088_101991_217_549 | 110 |
| 1666 | 3300059508 | Ga0587088_104734 | Ga0587088_104734_33_365 | 110 |
| 1667 | 3300059509 | Ga0587089_057672 | Ga0587089_057672_109_441 | 110 |
| 1668 | 3300059511 | Ga0587091_071005 | Ga0587091_071005_156_488 | 110 |
| 1669 | 3300059512 | Ga0587092_118003 | Ga0587092_118003_51_386 | 110 |
| 1670 | 3300059513 | Ga0587094_083647 | Ga0587094_083647_159_491 | 110 |
| 1671 | 3300059623 | Ga0587101_077787 | Ga0587101_077787_260_592 | 110 |
| 1672 | 3300059627 | Ga0587117_093637 | Ga0587117_093637_30_362 | 110 |
| 1673 | 3300059630 | Ga0587128_084766 | Ga0587128_084766_277_609 | 110 |
| 1674 | 3300059639 | Ga0587062_056317 | Ga0587062_056317_80_454 | 110 |
| 1675 | 3300059640 | Ga0587067_156622 | Ga0587067_156622_53_385 | 110 |
| 1676 | 3300059640 | Ga0587067_189136 | Ga0587067_189136_122_466 | 110 |
| 1677 | 3300059643 | Ga0587072_083036 | Ga0587072_083036_100_432 | 110 |
| 1678 | 3300059643 | Ga0587072_091123 | Ga0587072_091123_277_609 | 110 |
| 1679 | 3300059644 | Ga0587075_107383 | Ga0587075_107383_139_471 | 110 |
| 1680 | 3300059645 | Ga0587076_078824 | Ga0587076_078824_274_606 | 110 |
| 1681 | 3300059645 | Ga0587076_103535 | Ga0587076_103535_33_365 | 110 |
| 1682 | 3300060353 | Ga0501082_0036435 | Ga0501082_0036435_1138_1470 | 110 |
| 1683 | 3300060353 | Ga0501082_0160735 | Ga0501082_0160735_1330_1662 | 110 |
| 1684 | 3300060353 | Ga0501082_0206675 | Ga0501082_0206675_545_877 | 110 |
| 1685 | 3300061719 | Ga0466962_0514034 | Ga0466962_0514034_44_376 | 110 |
| 1686 | 3300061734 | Ga0530510_0335764 | Ga0530510_0335764_636_977 | 110 |
| 1687 | 3300061734 | Ga0530510_1264863 | Ga0530510_1264863_144_476 | 110 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3f43-assembly1.cif.gz_A-2 | crystal structure of a putative anti-sigma factor antagonist (tm1081) from thermotoga maritima at 1.59 a resolution | 0.9495 | 3 | 109 |
| 1vc1-assembly1.cif.gz_B | crystal structure of the tm1442 protein from thermotoga maritima, a homolog of the bacillus subtilis general stress response anti-anti-sigma factor rsbv | 0.9366 | 2 | 105 |
| 1th8-assembly1.cif.gz_B | crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form ii | 0.934 | 2 | 109 |
| 1til-assembly1.cif.gz_B | crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa:poised for phosphorylation complex with atp, crystal form ii | 0.9295 | 2 | 109 |
| 6m36-assembly1.cif.gz_F | the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form | 0.9268 | 2 | 98 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3f43A01 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.9293 | 6 | 108 | 3.30.750.24 |
| af_A0A0N7KGR6_2_88_3.30.750.24 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.9241 | 44 | 109 | 3.30.750.24 |
| af_A0A0R0KL09_2_75_3.30.750.24 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.92 | 52 | 109 | 3.30.750.24 |
| 1tidD00 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.9176 | 2 | 109 | 3.30.750.24 |
| 4qtpB00 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.9138 | 2 | 109 | 3.30.750.24 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W1H9L1-F1-model_v4 | Anti-sigma factor antagonist | 1.006 | 1 | 110 |
GO:0043856
|
| AF-A0A7X5WEP3-F1-model_v4 | deleted | 1.005 | 1 | 110 |
|
| AF-A0A2G4IH21-F1-model_v4 | Anti-sigma factor antagonist | 1.005 | 1 | 110 |
GO:0043856
|
| AF-A0A7X4BDD0-F1-model_v4 | Anti-sigma factor antagonist | 1.001 | 1 | 107 |
GO:0043856
|
| AF-A0A6B1FRW9-F1-model_v4 | deleted | 1.001 | 3 | 107 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar