F495307
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1679 | 714 | 1410 | 438 |
Family's Representative Sequence
| Representative Sequence | 3300053119|Ga0500595_007986|Ga0500595_007986_2225_3784 |
| Length | 519 |
| Sequence | LTIRKKDIVAPAVRNFHATLVQCRQPLCFLDRGKQFWSDLITKISAGRRLLTAPRRTETKNKKQNLAQQRGDVMLRKKLSRRQFVAATALSSAALISAPYVRGAHAAGKLTIGFWDHWVPGANKASTDLVNEWAEKEKVEVTIDYIPSQGNKNLLTIAAEAQAKSGHDIFAMPTWWAHANAEQLEDVADIMGPIIAENGEVNGTVTYLGKAGNKWLGVPACVGSQIKGPCSRIDLMKKHAGIDVQEMYPAGAEPKADNWTLETFLKAAEACHKGGVPFGIGLGETTDNVDTAGAIFLSFGAQLVDAKGNLTVKTDAVRQALEYYKKLISFLPPDVAAWDDASNNKWLVSGRGAMIMNPPSAWAVAKRDAPQVAEQCWTHGFPAGPKGRFAPYLPYYWSIWNFSKNKEAAKRLLVQLSKPAAIEKMVTASGGYDLPAYEKLTTLKVWQEEGPPKGTLYHYPNPYKHQTLSIAASPAPPKIAQQIYAQATLTKMCLRYHQGEAMEKTLAWAEGECEGFMRS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 7 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 8 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 9 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 10 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 11 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 12 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 13 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 14 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 15 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 16 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 17 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 18 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 19 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 20 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 21 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 22 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 23 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 24 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 25 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 26 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 27 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 28 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 29 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 30 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 31 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 32 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 33 | 2791355199 | |||
| 34 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 35 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 36 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 37 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 38 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 39 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 40 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 41 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 42 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 43 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 44 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 45 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 46 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 47 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 48 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 49 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 50 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 51 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 52 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 53 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 54 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 55 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 56 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 57 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 58 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 59 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 60 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 61 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 62 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 63 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 64 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 65 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 66 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 67 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 68 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 69 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 70 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 71 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 72 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 73 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 74 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 75 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 76 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 77 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 78 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 79 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 80 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 81 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 82 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 83 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 84 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 85 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 86 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 87 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 88 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 89 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 90 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 91 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 92 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 93 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 94 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 95 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 96 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 97 | 2904699407 | |||
| 98 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 99 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 100 | 2906610324 | |||
| 101 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 102 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 103 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 104 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 105 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 106 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 107 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 108 | 2922368715 | |||
| 109 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 110 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 111 | 2922425934 | |||
| 112 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 113 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 114 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 115 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 116 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 117 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 118 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 119 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 120 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 121 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 122 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 123 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 124 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 125 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 126 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 127 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 128 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 129 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 130 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 131 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 132 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 133 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 134 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 135 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 136 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 137 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 138 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 139 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 140 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 141 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 142 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 143 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 144 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 145 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 146 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 147 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 148 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 149 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 150 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 151 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 152 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 153 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 154 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 155 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 156 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 157 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 158 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 159 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 160 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 161 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 162 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 163 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 164 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 165 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 166 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 167 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 168 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 169 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 170 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 171 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 172 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 173 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 174 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 175 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 176 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 177 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 178 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 179 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 180 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 181 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 182 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 183 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 184 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 185 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 186 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 187 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 188 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 189 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 190 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 191 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 192 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 193 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 194 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 195 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 196 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 197 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 198 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 199 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 200 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 201 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 202 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 203 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 204 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 205 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 206 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 207 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 208 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 209 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 210 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 211 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 212 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 213 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 214 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 215 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 216 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 217 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 218 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 219 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 220 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 221 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 222 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 223 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 224 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 225 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 226 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 227 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 228 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 229 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 230 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 231 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 232 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 233 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 234 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 235 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 236 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 237 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 238 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 239 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 240 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 241 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 242 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 243 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 244 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 245 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 246 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 247 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 248 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 249 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 250 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 251 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 252 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 253 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 254 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 255 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 256 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 257 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 258 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 259 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 260 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 261 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 262 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 263 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 264 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 265 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 266 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 267 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 268 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 269 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 270 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 271 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 272 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 273 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 275 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 276 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 277 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 278 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 279 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 280 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 281 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 282 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 284 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 285 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 286 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 287 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 288 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 289 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 290 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 292 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 293 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 295 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 296 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 297 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 298 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 299 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 300 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 301 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 302 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 303 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 304 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 305 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 306 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 307 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 308 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 309 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 310 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 311 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 312 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 313 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 314 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 315 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 316 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 317 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 318 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 319 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 320 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 321 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 322 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 323 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 324 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 325 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 326 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 327 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 328 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 329 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 330 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 331 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 332 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 333 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 334 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 335 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 336 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 337 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 338 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 339 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 340 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 341 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 342 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 343 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 344 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 374 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 381 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 382 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 383 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 384 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 385 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 386 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 387 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 388 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 389 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 390 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 391 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 392 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 393 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 394 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 395 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 396 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 397 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 398 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 399 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 400 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 401 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 402 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 403 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 404 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 405 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 406 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 407 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 408 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 409 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 410 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 411 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 412 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 413 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 414 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 415 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 416 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 417 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 418 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 419 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 420 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 421 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 422 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 423 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 424 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 425 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 426 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 427 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 428 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 429 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 430 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 431 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 432 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 433 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 434 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 435 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 436 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 437 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 438 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 439 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 440 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 441 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 442 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 443 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 444 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 445 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 446 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 447 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 448 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 449 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 450 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 451 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 452 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 453 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 454 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 455 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 456 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 457 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 458 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 459 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 460 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 461 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 462 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 463 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 464 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 465 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 466 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 467 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 468 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 469 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 470 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 471 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 472 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 473 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 474 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 475 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 476 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 477 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 478 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 479 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 480 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 481 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 482 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 483 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 484 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 485 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 486 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 487 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 488 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 489 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 490 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 491 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 552 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 553 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 561 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 562 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 563 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 564 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 565 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 566 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 567 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 568 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 569 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 570 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 571 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 572 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 573 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 574 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 575 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 576 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 577 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 578 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 579 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 580 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 581 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 582 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 583 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 584 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 585 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 586 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 587 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 588 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 589 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 590 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 591 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 592 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 593 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 594 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 595 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 596 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 597 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 598 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 599 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 600 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 601 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 602 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 603 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 604 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 605 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 606 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 607 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 608 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 609 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 610 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 611 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 612 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 613 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 614 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 615 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 616 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 617 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 618 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 619 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 620 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 621 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 622 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 623 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 624 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 625 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 626 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 627 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 628 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 629 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 630 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 631 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 632 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 633 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 634 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 635 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 636 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 637 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 638 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 639 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 640 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 641 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 642 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 643 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 644 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 645 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 646 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 647 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 648 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 649 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 650 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 651 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 652 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 653 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 654 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 655 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 656 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 657 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 658 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 659 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 660 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 661 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 662 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 663 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 664 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 665 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 666 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 667 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 668 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 669 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 670 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 671 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 672 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 673 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 674 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 675 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 676 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 677 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 678 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 679 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 680 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 681 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 682 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 683 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 684 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 685 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 686 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 687 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 688 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 689 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 690 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 691 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 692 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 693 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 694 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 695 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 696 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 697 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 698 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 699 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 700 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 701 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 702 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 703 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 704 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 705 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 706 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 707 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 708 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 709 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 710 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 711 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 712 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 713 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 714 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.01 |
| Metatranscriptomes | 1.02 |
| Isolates | 13.98 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.27 |
| Nodule | 11.73 |
| Rhizoplane | 7.86 |
| Rhizosphere | 66.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24750J21931_1004125 | 3300002070 | Bacteria | 1752 |
| 2 | JGI25406J46586_10018043 | 3300003203 | Bacteria | 2904 |
| 3 | JGI25153J46596_10000235 | 3300003215 | Bacteria | 46542 |
| 4 | JGI25153J46596_10000238 | 3300003215 | Bacteria | 46211 |
| 5 | JGI25153J46596_10002996 | 3300003215 | Bacteria | 9557 |
| 6 | JGI25153J46596_10005350 | 3300003215 | Bacteria | 6743 |
| 7 | JGI25160J50197_1001951 | 3300003354 | Bacteria | 9849 |
| 8 | JGI25160J50197_1003045 | 3300003354 | Bacteria | 7648 |
| 9 | Ga0007409J51694_1040095 | 3300003575 | Bacteria | 1583 |
| 10 | Ga0055529_1006123 | 3300003763 | Bacteria | 1699 |
| 11 | Ga0055526_1020720 | 3300003771 | Bacteria | 2321 |
| 12 | Ga0055531_10009794 | 3300003794 | Bacteria | 4857 |
| 13 | Ga0055531_10012037 | 3300003794 | Bacteria | 4106 |
| 14 | JGI25405J52794_10007662 | 3300003911 | Bacteria | 1996 |
| 15 | JGI25405J52794_10015703 | 3300003911 | Bacteria | 1490 |
| 16 | Ga0058861_12054439 | 3300004800 | Bacteria | 1823 |
| 17 | Ga0058862_12877440 | 3300004803 | Bacteria | 2148 |
| 18 | Ga0065165_1000394 | 3300005262 | Bacteria | 70991 |
| 19 | Ga0065165_1003735 | 3300005262 | Bacteria | 10263 |
| 20 | Ga0065165_1008785 | 3300005262 | Bacteria | 4655 |
| 21 | Ga0070658_10006286 | 3300005327 | Bacteria | 9622 |
| 22 | Ga0070683_100021672 | 3300005329 | Bacteria | 5736 |
| 23 | Ga0070683_100033523 | 3300005329 | Bacteria | 4683 |
| 24 | Ga0070690_100088389 | 3300005330 | Bacteria | 2037 |
| 25 | Ga0070690_100113925 | 3300005330 | Bacteria | 1807 |
| 26 | Ga0070670_100046283 | 3300005331 | Bacteria | 3741 |
| 27 | Ga0070670_100099224 | 3300005331 | Bacteria | 2506 |
| 28 | Ga0070670_100272234 | 3300005331 | Bacteria | 1478 |
| 29 | Ga0070677_10016646 | 3300005333 | Bacteria | 2620 |
| 30 | Ga0068869_100023870 | 3300005334 | Bacteria | 4232 |
| 31 | Ga0068869_100033410 | 3300005334 | Bacteria | 3631 |
| 32 | Ga0070666_10086431 | 3300005335 | Bacteria | 2149 |
| 33 | Ga0070680_100005272 | 3300005336 | Bacteria | 9776 |
| 34 | Ga0068868_100031098 | 3300005338 | Bacteria | 4097 |
| 35 | Ga0068868_100047016 | 3300005338 | Bacteria | 3379 |
| 36 | Ga0068868_100097141 | 3300005338 | Bacteria | 2380 |
| 37 | Ga0070660_100018526 | 3300005339 | Bacteria | 5088 |
| 38 | Ga0070691_10010001 | 3300005341 | Bacteria | 4322 |
| 39 | Ga0070691_10028244 | 3300005341 | Bacteria | 2619 |
| 40 | Ga0070691_10068140 | 3300005341 | Bacteria | 1722 |
| 41 | Ga0070661_100028972 | 3300005344 | Bacteria | 3995 |
| 42 | Ga0070668_100012418 | 3300005347 | Bacteria | 6343 |
| 43 | Ga0070668_100037529 | 3300005347 | Bacteria | 3700 |
| 44 | Ga0070668_100090201 | 3300005347 | Bacteria | 2415 |
| 45 | Ga0070669_100025193 | 3300005353 | Bacteria | 4271 |
| 46 | Ga0070669_100058601 | 3300005353 | Bacteria | 2826 |
| 47 | Ga0070675_100045128 | 3300005354 | Bacteria | 3606 |
| 48 | Ga0070675_100136493 | 3300005354 | Bacteria | 2093 |
| 49 | Ga0070671_100014313 | 3300005355 | Bacteria | 6407 |
| 50 | Ga0070671_100035594 | 3300005355 | Bacteria | 4125 |
| 51 | Ga0070671_100048650 | 3300005355 | Bacteria | 3526 |
| 52 | Ga0070671_100059844 | 3300005355 | Bacteria | 3171 |
| 53 | Ga0070671_100128026 | 3300005355 | Bacteria | 2138 |
| 54 | Ga0070671_100158558 | 3300005355 | Bacteria | 1913 |
| 55 | Ga0070674_100005092 | 3300005356 | Bacteria | 7557 |
| 56 | Ga0070673_100014280 | 3300005364 | Bacteria | 5524 |
| 57 | Ga0070673_100095817 | 3300005364 | Bacteria | 2434 |
| 58 | Ga0070673_100099578 | 3300005364 | Bacteria | 2391 |
| 59 | Ga0070659_100088432 | 3300005366 | Bacteria | 2481 |
| 60 | Ga0070659_100211410 | 3300005366 | Bacteria | 1599 |
| 61 | Ga0070667_100029473 | 3300005367 | Bacteria | 4572 |
| 62 | Ga0070667_100093206 | 3300005367 | Bacteria | 2593 |
| 63 | Ga0070703_10004788 | 3300005406 | Bacteria | 3786 |
| 64 | Ga0070709_10001133 | 3300005434 | Bacteria | 14680 |
| 65 | Ga0070709_10004033 | 3300005434 | Bacteria | 7920 |
| 66 | Ga0070709_10004449 | 3300005434 | Bacteria | 7562 |
| 67 | Ga0070709_10018900 | 3300005434 | Bacteria | 3976 |
| 68 | Ga0070709_10021517 | 3300005434 | Bacteria | 3757 |
| 69 | Ga0070714_100016189 | 3300005435 | Bacteria | 6016 |
| 70 | Ga0070714_100018552 | 3300005435 | Bacteria | 5654 |
| 71 | Ga0070714_100022544 | 3300005435 | Bacteria | 5164 |
| 72 | Ga0070714_100057926 | 3300005435 | Bacteria | 3317 |
| 73 | Ga0070714_100077233 | 3300005435 | Bacteria | 2892 |
| 74 | Ga0070714_100118276 | 3300005435 | Bacteria | 2354 |
| 75 | Ga0070714_100130127 | 3300005435 | Bacteria | 2249 |
| 76 | Ga0070713_100009541 | 3300005436 | Bacteria | 6957 |
| 77 | Ga0070713_100019235 | 3300005436 | Bacteria | 5208 |
| 78 | Ga0070713_100031677 | 3300005436 | Bacteria | 4215 |
| 79 | Ga0070713_100035565 | 3300005436 | Bacteria | 4011 |
| 80 | Ga0070713_100066685 | 3300005436 | Bacteria | 3027 |
| 81 | Ga0070713_100068483 | 3300005436 | Bacteria | 2990 |
| 82 | Ga0070713_100122414 | 3300005436 | Bacteria | 2283 |
| 83 | Ga0070710_10000179 | 3300005437 | Bacteria | 29185 |
| 84 | Ga0070710_10002845 | 3300005437 | Bacteria | 8248 |
| 85 | Ga0070710_10004558 | 3300005437 | Bacteria | 6549 |
| 86 | Ga0070710_10005105 | 3300005437 | Bacteria | 6209 |
| 87 | Ga0070710_10005520 | 3300005437 | Bacteria | 6015 |
| 88 | Ga0070711_100001224 | 3300005439 | Bacteria | 13852 |
| 89 | Ga0070711_100003919 | 3300005439 | Bacteria | 8742 |
| 90 | Ga0070711_100004199 | 3300005439 | Bacteria | 8466 |
| 91 | Ga0070711_100008227 | 3300005439 | Bacteria | 6381 |
| 92 | Ga0070711_100020059 | 3300005439 | Bacteria | 4301 |
| 93 | Ga0070711_100038988 | 3300005439 | Bacteria | 3197 |
| 94 | Ga0070711_100252171 | 3300005439 | Bacteria | 1385 |
| 95 | Ga0070705_100000027 | 3300005440 | Bacteria | 77032 |
| 96 | Ga0070700_100041117 | 3300005441 | Bacteria | 2833 |
| 97 | Ga0070700_100047463 | 3300005441 | Bacteria | 2657 |
| 98 | Ga0070700_100075207 | 3300005441 | Bacteria | 2166 |
| 99 | Ga0070700_100077236 | 3300005441 | Bacteria | 2141 |
| 100 | Ga0070694_100001546 | 3300005444 | Bacteria | 13533 |
| 101 | Ga0070694_100025149 | 3300005444 | Bacteria | 3851 |
| 102 | Ga0070694_100078086 | 3300005444 | Bacteria | 2295 |
| 103 | Ga0070678_100015679 | 3300005456 | Bacteria | 4824 |
| 104 | Ga0070678_100025653 | 3300005456 | Bacteria | 3970 |
| 105 | Ga0070678_100125581 | 3300005456 | Bacteria | 2030 |
| 106 | Ga0070662_100064764 | 3300005457 | Bacteria | 2677 |
| 107 | Ga0070662_100067254 | 3300005457 | Bacteria | 2631 |
| 108 | Ga0070662_100071696 | 3300005457 | Bacteria | 2555 |
| 109 | Ga0070662_100080877 | 3300005457 | Bacteria | 2420 |
| 110 | Ga0070681_10006430 | 3300005458 | Bacteria | 11436 |
| 111 | Ga0070681_10026034 | 3300005458 | Bacteria | 5881 |
| 112 | Ga0070681_10026875 | 3300005458 | Bacteria | 5786 |
| 113 | Ga0070681_10034038 | 3300005458 | Bacteria | 5117 |
| 114 | Ga0070681_10302006 | 3300005458 | Bacteria | 1510 |
| 115 | Ga0068867_100044726 | 3300005459 | Bacteria | 3244 |
| 116 | Ga0070685_10061590 | 3300005466 | Bacteria | 2198 |
| 117 | Ga0070685_10062932 | 3300005466 | Bacteria | 2177 |
| 118 | Ga0070706_100018218 | 3300005467 | Bacteria | 6479 |
| 119 | Ga0070707_100039960 | 3300005468 | Bacteria | 4486 |
| 120 | Ga0070707_100351765 | 3300005468 | Bacteria | 1431 |
| 121 | Ga0070698_100054114 | 3300005471 | Bacteria | 4077 |
| 122 | Ga0070698_100131370 | 3300005471 | Bacteria | 2459 |
| 123 | Ga0070699_100003991 | 3300005518 | Bacteria | 13036 |
| 124 | Ga0070699_100007741 | 3300005518 | Bacteria | 9337 |
| 125 | Ga0070679_100027477 | 3300005530 | Bacteria | 5601 |
| 126 | Ga0070679_100111127 | 3300005530 | Bacteria | 2727 |
| 127 | Ga0070679_100126412 | 3300005530 | Bacteria | 2539 |
| 128 | Ga0070679_100129485 | 3300005530 | Bacteria | 2505 |
| 129 | Ga0070684_100001889 | 3300005535 | Bacteria | 15348 |
| 130 | Ga0070684_100030989 | 3300005535 | Bacteria | 4549 |
| 131 | Ga0070684_100037495 | 3300005535 | Bacteria | 4158 |
| 132 | Ga0070684_100061460 | 3300005535 | Bacteria | 3288 |
| 133 | Ga0070697_100025958 | 3300005536 | Bacteria | 4674 |
| 134 | Ga0070697_100056813 | 3300005536 | Bacteria | 3184 |
| 135 | Ga0070697_100121048 | 3300005536 | Bacteria | 2189 |
| 136 | Ga0070697_100121297 | 3300005536 | Bacteria | 2187 |
| 137 | Ga0070697_100164971 | 3300005536 | Bacteria | 1873 |
| 138 | Ga0068853_100031548 | 3300005539 | Bacteria | 4482 |
| 139 | Ga0068853_100048509 | 3300005539 | Bacteria | 3648 |
| 140 | Ga0068853_100106779 | 3300005539 | Bacteria | 2482 |
| 141 | Ga0068853_100136854 | 3300005539 | Bacteria | 2196 |
| 142 | Ga0068853_100160130 | 3300005539 | Bacteria | 2031 |
| 143 | Ga0068853_100214198 | 3300005539 | Bacteria | 1757 |
| 144 | Ga0070695_100001000 | 3300005545 | Bacteria | 15394 |
| 145 | Ga0070695_100002243 | 3300005545 | Bacteria | 11068 |
| 146 | Ga0070695_100004173 | 3300005545 | Bacteria | 8448 |
| 147 | Ga0070695_100005577 | 3300005545 | Bacteria | 7411 |
| 148 | Ga0070695_100013475 | 3300005545 | Bacteria | 4915 |
| 149 | Ga0070695_100021613 | 3300005545 | Bacteria | 3940 |
| 150 | Ga0070696_100000051 | 3300005546 | Bacteria | 54480 |
| 151 | Ga0070693_100004723 | 3300005547 | Bacteria | 6477 |
| 152 | Ga0070665_100011386 | 3300005548 | Bacteria | 8993 |
| 153 | Ga0070665_100014871 | 3300005548 | Bacteria | 7812 |
| 154 | Ga0070665_100030822 | 3300005548 | Bacteria | 5397 |
| 155 | Ga0070665_100047821 | 3300005548 | Bacteria | 4293 |
| 156 | Ga0070665_100049324 | 3300005548 | Bacteria | 4224 |
| 157 | Ga0070665_100140512 | 3300005548 | Bacteria | 2418 |
| 158 | Ga0070665_100141978 | 3300005548 | Bacteria | 2404 |
| 159 | Ga0070665_100190207 | 3300005548 | Bacteria | 2054 |
| 160 | Ga0070665_100220563 | 3300005548 | Bacteria | 1897 |
| 161 | Ga0070704_100005564 | 3300005549 | Bacteria | 7349 |
| 162 | Ga0070704_100092017 | 3300005549 | Bacteria | 2263 |
| 163 | Ga0068855_100060250 | 3300005563 | Bacteria | 4440 |
| 164 | Ga0068855_100081702 | 3300005563 | Bacteria | 3745 |
| 165 | Ga0068855_100096599 | 3300005563 | Bacteria | 3403 |
| 166 | Ga0068855_100196308 | 3300005563 | Bacteria | 2274 |
| 167 | Ga0068855_100221306 | 3300005563 | Bacteria | 2122 |
| 168 | Ga0068855_100232942 | 3300005563 | Bacteria | 2061 |
| 169 | Ga0068855_100238516 | 3300005563 | Bacteria | 2033 |
| 170 | Ga0070664_100026355 | 3300005564 | Bacteria | 4822 |
| 171 | Ga0070664_100100905 | 3300005564 | Bacteria | 2509 |
| 172 | Ga0068857_100009387 | 3300005577 | Bacteria | 8490 |
| 173 | Ga0068857_100014381 | 3300005577 | Bacteria | 6900 |
| 174 | Ga0068857_100038200 | 3300005577 | Bacteria | 4252 |
| 175 | Ga0068857_100063272 | 3300005577 | Bacteria | 3289 |
| 176 | Ga0068857_100063354 | 3300005577 | Bacteria | 3287 |
| 177 | Ga0068857_100198595 | 3300005577 | Bacteria | 1828 |
| 178 | Ga0068854_100100188 | 3300005578 | Bacteria | 2171 |
| 179 | Ga0068856_100001981 | 3300005614 | Bacteria | 21353 |
| 180 | Ga0068856_100017821 | 3300005614 | Bacteria | 6888 |
| 181 | Ga0068856_100088218 | 3300005614 | Unclassified | 3084 |
| 182 | Ga0068856_100158056 | 3300005614 | Bacteria | 2277 |
| 183 | Ga0070702_100051167 | 3300005615 | Bacteria | 2364 |
| 184 | Ga0070702_100104368 | 3300005615 | Bacteria | 1745 |
| 185 | Ga0068852_100011636 | 3300005616 | Bacteria | 6636 |
| 186 | Ga0068852_100118205 | 3300005616 | Bacteria | 2422 |
| 187 | Ga0068852_100268648 | 3300005616 | Bacteria | 1640 |
| 188 | Ga0068852_100314108 | 3300005616 | Bacteria | 1520 |
| 189 | Ga0068859_100017457 | 3300005617 | Bacteria | 7214 |
| 190 | Ga0068859_100097252 | 3300005617 | Bacteria | 2997 |
| 191 | Ga0068859_100230741 | 3300005617 | Bacteria | 1939 |
| 192 | Ga0068859_100402698 | 3300005617 | Bacteria | 1464 |
| 193 | Ga0068864_100040051 | 3300005618 | Bacteria | 4008 |
| 194 | Ga0068864_100074697 | 3300005618 | Bacteria | 2958 |
| 195 | Ga0068864_100149492 | 3300005618 | Bacteria | 2114 |
| 196 | Ga0068864_100225765 | 3300005618 | Bacteria | 1730 |
| 197 | Ga0068866_10011643 | 3300005718 | Bacteria | 3813 |
| 198 | Ga0068866_10038826 | 3300005718 | Bacteria | 2347 |
| 199 | Ga0068861_100050681 | 3300005719 | Bacteria | 3149 |
| 200 | Ga0068861_100060475 | 3300005719 | Bacteria | 2903 |
| 201 | Ga0068861_100151861 | 3300005719 | Bacteria | 1901 |
| 202 | Ga0068861_100183114 | 3300005719 | Bacteria | 1745 |
| 203 | Ga0068863_100017655 | 3300005841 | Bacteria | 6833 |
| 204 | Ga0068863_100093227 | 3300005841 | Bacteria | 2858 |
| 205 | Ga0068858_100016019 | 3300005842 | Bacteria | 7041 |
| 206 | Ga0068858_100019505 | 3300005842 | Bacteria | 6341 |
| 207 | Ga0068858_100031077 | 3300005842 | Bacteria | 4959 |
| 208 | Ga0068860_100000375 | 3300005843 | Bacteria | 58502 |
| 209 | Ga0068860_100001599 | 3300005843 | Bacteria | 24324 |
| 210 | Ga0068860_100013303 | 3300005843 | Bacteria | 8068 |
| 211 | Ga0068860_100022514 | 3300005843 | Bacteria | 6094 |
| 212 | Ga0068860_100032333 | 3300005843 | Bacteria | 5027 |
| 213 | Ga0068860_100155199 | 3300005843 | Bacteria | 2206 |
| 214 | Ga0068862_100001717 | 3300005844 | Bacteria | 19834 |
| 215 | Ga0068862_100031277 | 3300005844 | Bacteria | 4492 |
| 216 | Ga0068862_100068284 | 3300005844 | Bacteria | 3066 |
| 217 | Ga0068862_100162667 | 3300005844 | Bacteria | 1993 |
| 218 | Ga0081455_10000062 | 3300005937 | Bacteria | 115850 |
| 219 | Ga0081455_10000087 | 3300005937 | Bacteria | 99627 |
| 220 | Ga0081455_10000338 | 3300005937 | Bacteria | 61504 |
| 221 | Ga0081455_10001113 | 3300005937 | Bacteria | 33715 |
| 222 | Ga0081455_10001255 | 3300005937 | Bacteria | 31699 |
| 223 | Ga0081455_10003384 | 3300005937 | Bacteria | 18370 |
| 224 | Ga0081455_10009563 | 3300005937 | Bacteria | 9956 |
| 225 | Ga0081455_10020033 | 3300005937 | Bacteria | 6314 |
| 226 | Ga0081455_10037459 | 3300005937 | Bacteria | 4307 |
| 227 | Ga0081455_10087480 | 3300005937 | Bacteria | 2535 |
| 228 | Ga0081455_10129657 | 3300005937 | Bacteria | 1974 |
| 229 | Ga0081538_10004691 | 3300005981 | Bacteria | 12517 |
| 230 | Ga0081538_10047966 | 3300005981 | Bacteria | 2612 |
| 231 | Ga0081540_1000287 | 3300005983 | Bacteria | 52759 |
| 232 | Ga0081540_1000413 | 3300005983 | Bacteria | 42230 |
| 233 | Ga0081540_1000629 | 3300005983 | Bacteria | 33549 |
| 234 | Ga0081540_1000794 | 3300005983 | Bacteria | 28989 |
| 235 | Ga0081540_1001058 | 3300005983 | Bacteria | 24522 |
| 236 | Ga0081540_1001096 | 3300005983 | Bacteria | 23968 |
| 237 | Ga0081540_1001428 | 3300005983 | Bacteria | 20666 |
| 238 | Ga0081540_1002242 | 3300005983 | Bacteria | 15915 |
| 239 | Ga0081540_1003431 | 3300005983 | Bacteria | 12521 |
| 240 | Ga0081540_1020770 | 3300005983 | Bacteria | 3935 |
| 241 | Ga0081540_1036043 | 3300005983 | Bacteria | 2644 |
| 242 | Ga0081540_1053418 | 3300005983 | Unclassified | 1981 |
| 243 | Ga0081539_10000080 | 3300005985 | Bacteria | 222745 |
| 244 | Ga0081539_10003020 | 3300005985 | Bacteria | 21846 |
| 245 | Ga0081539_10003922 | 3300005985 | Bacteria | 17277 |
| 246 | Ga0081539_10007934 | 3300005985 | Bacteria | 9450 |
| 247 | Ga0070717_10000770 | 3300006028 | Bacteria | 20953 |
| 248 | Ga0070717_10002845 | 3300006028 | Bacteria | 12269 |
| 249 | Ga0070717_10006584 | 3300006028 | Bacteria | 8559 |
| 250 | Ga0070717_10018908 | 3300006028 | Bacteria | 5391 |
| 251 | Ga0070717_10040171 | 3300006028 | Bacteria | 3810 |
| 252 | Ga0070717_10051665 | 3300006028 | Bacteria | 3384 |
| 253 | Ga0070717_10051833 | 3300006028 | Bacteria | 3379 |
| 254 | Ga0070717_10071679 | 3300006028 | Bacteria | 2891 |
| 255 | Ga0070717_10076155 | 3300006028 | Bacteria | 2807 |
| 256 | Ga0075365_10052954 | 3300006038 | Bacteria | 2686 |
| 257 | Ga0075365_10057357 | 3300006038 | Bacteria | 2590 |
| 258 | Ga0075368_10001349 | 3300006042 | Bacteria | 7809 |
| 259 | Ga0075368_10002574 | 3300006042 | Bacteria | 5946 |
| 260 | Ga0075368_10008917 | 3300006042 | Bacteria | 3596 |
| 261 | Ga0075363_100010469 | 3300006048 | Bacteria | 4407 |
| 262 | Ga0075364_10004859 | 3300006051 | Bacteria | 7785 |
| 263 | Ga0075364_10051980 | 3300006051 | Bacteria | 2676 |
| 264 | Ga0070715_10000402 | 3300006163 | Bacteria | 10966 |
| 265 | Ga0070716_100012546 | 3300006173 | Bacteria | 4298 |
| 266 | Ga0070716_100014813 | 3300006173 | Bacteria | 3999 |
| 267 | Ga0070712_100012738 | 3300006175 | Bacteria | 5354 |
| 268 | Ga0070712_100016856 | 3300006175 | Bacteria | 4724 |
| 269 | Ga0070712_100022570 | 3300006175 | Bacteria | 4148 |
| 270 | Ga0070712_100033570 | 3300006175 | Bacteria | 3473 |
| 271 | Ga0070712_100076998 | 3300006175 | Bacteria | 2403 |
| 272 | Ga0070712_100204214 | 3300006175 | Bacteria | 1554 |
| 273 | Ga0070712_100224482 | 3300006175 | Bacteria | 1489 |
| 274 | Ga0075362_10006510 | 3300006177 | Bacteria | 4359 |
| 275 | Ga0075362_10023012 | 3300006177 | Bacteria | 2631 |
| 276 | Ga0075367_10007196 | 3300006178 | Bacteria | 5681 |
| 277 | Ga0075367_10015063 | 3300006178 | Bacteria | 4193 |
| 278 | Ga0075367_10015925 | 3300006178 | Bacteria | 4097 |
| 279 | Ga0075367_10018821 | 3300006178 | Bacteria | 3817 |
| 280 | Ga0075367_10139849 | 3300006178 | Bacteria | 1500 |
| 281 | Ga0075369_10006148 | 3300006186 | Bacteria | 4529 |
| 282 | Ga0075369_10009219 | 3300006186 | Bacteria | 3827 |
| 283 | Ga0075369_10010929 | 3300006186 | Bacteria | 3558 |
| 284 | Ga0075369_10021878 | 3300006186 | Bacteria | 2633 |
| 285 | Ga0075366_10027505 | 3300006195 | Bacteria | 3337 |
| 286 | Ga0097621_100027617 | 3300006237 | Bacteria | 4466 |
| 287 | Ga0097621_100063586 | 3300006237 | Bacteria | 3033 |
| 288 | Ga0097621_100122434 | 3300006237 | Bacteria | 2207 |
| 289 | Ga0075370_10003411 | 3300006353 | Bacteria | 7559 |
| 290 | Ga0075370_10011339 | 3300006353 | Bacteria | 4681 |
| 291 | Ga0068871_100014804 | 3300006358 | Bacteria | 5823 |
| 292 | Ga0068871_100226887 | 3300006358 | Bacteria | 1620 |
| 293 | Ga0075428_100001428 | 3300006844 | Bacteria | 25473 |
| 294 | Ga0075428_100025075 | 3300006844 | Bacteria | 6597 |
| 295 | Ga0075428_100074030 | 3300006844 | Bacteria | 3720 |
| 296 | Ga0075428_100104462 | 3300006844 | Bacteria | 3089 |
| 297 | Ga0075428_100190387 | 3300006844 | Bacteria | 2219 |
| 298 | Ga0075428_100233246 | 3300006844 | Bacteria | 1986 |
| 299 | Ga0075431_100000132 | 3300006847 | Bacteria | 49934 |
| 300 | Ga0075431_100007034 | 3300006847 | Bacteria | 11174 |
| 301 | Ga0075431_100033979 | 3300006847 | Bacteria | 5255 |
| 302 | Ga0075431_100141290 | 3300006847 | Bacteria | 2482 |
| 303 | Ga0075431_100144185 | 3300006847 | Bacteria | 2454 |
| 304 | Ga0075431_100148314 | 3300006847 | Bacteria | 2416 |
| 305 | Ga0075433_10007507 | 3300006852 | Bacteria | 8654 |
| 306 | Ga0075433_10009387 | 3300006852 | Bacteria | 7816 |
| 307 | Ga0075433_10063791 | 3300006852 | Bacteria | 3228 |
| 308 | Ga0075433_10226729 | 3300006852 | Bacteria | 1659 |
| 309 | Ga0075434_100002046 | 3300006871 | Bacteria | 17502 |
| 310 | Ga0075434_100003469 | 3300006871 | Bacteria | 14096 |
| 311 | Ga0075434_100010545 | 3300006871 | Bacteria | 8670 |
| 312 | Ga0075434_100010716 | 3300006871 | Bacteria | 8608 |
| 313 | Ga0075434_100015598 | 3300006871 | Bacteria | 7292 |
| 314 | Ga0075434_100018868 | 3300006871 | Bacteria | 6666 |
| 315 | Ga0075434_100043871 | 3300006871 | Bacteria | 4436 |
| 316 | Ga0075434_100056584 | 3300006871 | Bacteria | 3898 |
| 317 | Ga0075434_100059695 | 3300006871 | Bacteria | 3792 |
| 318 | Ga0075429_100005605 | 3300006880 | Bacteria | 10821 |
| 319 | Ga0075429_100125906 | 3300006880 | Bacteria | 2241 |
| 320 | Ga0075436_100022672 | 3300006914 | Bacteria | 4314 |
| 321 | Ga0075436_100078249 | 3300006914 | Bacteria | 2291 |
| 322 | Ga0097620_100017457 | 3300006931 | Bacteria | 7214 |
| 323 | Ga0097620_100097255 | 3300006931 | Bacteria | 2997 |
| 324 | Ga0097620_100117315 | 3300006931 | Bacteria | 2727 |
| 325 | Ga0097620_100230741 | 3300006931 | Bacteria | 1939 |
| 326 | Ga0097620_100402694 | 3300006931 | Bacteria | 1464 |
| 327 | Ga0099824_1010056 | 3300006942 | Bacteria | 11367 |
| 328 | Ga0099824_1013197 | 3300006942 | Bacteria | 8676 |
| 329 | Ga0099822_1001406 | 3300006943 | Bacteria | 27885 |
| 330 | Ga0099822_1026245 | 3300006943 | Bacteria | 4955 |
| 331 | Ga0075435_100009425 | 3300007076 | Bacteria | 7068 |
| 332 | Ga0075435_100029324 | 3300007076 | Bacteria | 4318 |
| 333 | Ga0075435_100064096 | 3300007076 | Bacteria | 2986 |
| 334 | Ga0099794_10003585 | 3300007265 | Bacteria | 5951 |
| 335 | Ga0099794_10009900 | 3300007265 | Bacteria | 4030 |
| 336 | Ga0099794_10015670 | 3300007265 | Bacteria | 3351 |
| 337 | Ga0099795_10003491 | 3300007788 | Bacteria | 3899 |
| 338 | Ga0099795_10005064 | 3300007788 | Bacteria | 3469 |
| 339 | Ga0105250_10030645 | 3300009092 | Bacteria | 2162 |
| 340 | Ga0105250_10049173 | 3300009092 | Bacteria | 1691 |
| 341 | Ga0105240_10016315 | 3300009093 | Bacteria | 10060 |
| 342 | Ga0105240_10018472 | 3300009093 | Bacteria | 9360 |
| 343 | Ga0105240_10104887 | 3300009093 | Bacteria | 3432 |
| 344 | Ga0105240_10122827 | 3300009093 | Bacteria | 3125 |
| 345 | Ga0105240_10368367 | 3300009093 | Bacteria | 1625 |
| 346 | Ga0111539_10000933 | 3300009094 | Bacteria | 38278 |
| 347 | Ga0111539_10006076 | 3300009094 | Bacteria | 15592 |
| 348 | Ga0111539_10010044 | 3300009094 | Bacteria | 11930 |
| 349 | Ga0111539_10019554 | 3300009094 | Bacteria | 8355 |
| 350 | Ga0111539_10103652 | 3300009094 | Bacteria | 3338 |
| 351 | Ga0111539_10131104 | 3300009094 | Bacteria | 2935 |
| 352 | Ga0111539_10149563 | 3300009094 | Bacteria | 2733 |
| 353 | Ga0111539_10216054 | 3300009094 | Bacteria | 2233 |
| 354 | Ga0111539_10261304 | 3300009094 | Bacteria | 2015 |
| 355 | Ga0105245_10090703 | 3300009098 | Bacteria | 2811 |
| 356 | Ga0105245_10178531 | 3300009098 | Bacteria | 2027 |
| 357 | Ga0105247_10025765 | 3300009101 | Bacteria | 3549 |
| 358 | Ga0105247_10066644 | 3300009101 | Bacteria | 2242 |
| 359 | Ga0105247_10103880 | 3300009101 | Bacteria | 1820 |
| 360 | Ga0114129_10000280 | 3300009147 | Bacteria | 58505 |
| 361 | Ga0114129_10027090 | 3300009147 | Bacteria | 8116 |
| 362 | Ga0114129_10040832 | 3300009147 | Bacteria | 6540 |
| 363 | Ga0114129_10041435 | 3300009147 | Bacteria | 6488 |
| 364 | Ga0114129_10048840 | 3300009147 | Bacteria | 5947 |
| 365 | Ga0114129_10063111 | 3300009147 | Bacteria | 5175 |
| 366 | Ga0114129_10068788 | 3300009147 | Bacteria | 4936 |
| 367 | Ga0114129_10081706 | 3300009147 | Bacteria | 4492 |
| 368 | Ga0114129_10179324 | 3300009147 | Bacteria | 2884 |
| 369 | Ga0114129_10233909 | 3300009147 | Bacteria | 2474 |
| 370 | Ga0114129_10391600 | 3300009147 | Bacteria | 1832 |
| 371 | Ga0105243_10088118 | 3300009148 | Bacteria | 2549 |
| 372 | Ga0105243_10139959 | 3300009148 | Bacteria | 2063 |
| 373 | Ga0105241_10016039 | 3300009174 | Bacteria | 5491 |
| 374 | Ga0105241_10031659 | 3300009174 | Bacteria | 3960 |
| 375 | Ga0105241_10050230 | 3300009174 | Bacteria | 3178 |
| 376 | Ga0105241_10051550 | 3300009174 | Bacteria | 3139 |
| 377 | Ga0105248_10047411 | 3300009177 | Bacteria | 4818 |
| 378 | Ga0105248_10071925 | 3300009177 | Bacteria | 3886 |
| 379 | Ga0105237_10010000 | 3300009545 | Bacteria | 10122 |
| 380 | Ga0105237_10018618 | 3300009545 | Bacteria | 7184 |
| 381 | Ga0105237_10028013 | 3300009545 | Bacteria | 5740 |
| 382 | Ga0105237_10036555 | 3300009545 | Bacteria | 4970 |
| 383 | Ga0105237_10054113 | 3300009545 | Bacteria | 4021 |
| 384 | Ga0105237_10057725 | 3300009545 | Bacteria | 3884 |
| 385 | Ga0105237_10059746 | 3300009545 | Bacteria | 3814 |
| 386 | Ga0105237_10129278 | 3300009545 | Bacteria | 2520 |
| 387 | Ga0105237_10143730 | 3300009545 | Bacteria | 2380 |
| 388 | Ga0105237_10170473 | 3300009545 | Bacteria | 2176 |
| 389 | Ga0105237_10200818 | 3300009545 | Bacteria | 1994 |
| 390 | Ga0105238_10026564 | 3300009551 | Bacteria | 5903 |
| 391 | Ga0105238_10045925 | 3300009551 | Bacteria | 4411 |
| 392 | Ga0105238_10046421 | 3300009551 | Bacteria | 4384 |
| 393 | Ga0105238_10049694 | 3300009551 | Bacteria | 4223 |
| 394 | Ga0105238_10074883 | 3300009551 | Bacteria | 3378 |
| 395 | Ga0105249_10021936 | 3300009553 | Bacteria | 5719 |
| 396 | Ga0105249_10103934 | 3300009553 | Bacteria | 2676 |
| 397 | Ga0105249_10119031 | 3300009553 | Bacteria | 2508 |
| 398 | Ga0105249_10194742 | 3300009553 | Bacteria | 1980 |
| 399 | Ga0099796_10007346 | 3300010159 | Bacteria | 2876 |
| 400 | Ga0099796_10022593 | 3300010159 | Bacteria | 1953 |
| 401 | Ga0105239_10059751 | 3300010375 | Bacteria | 4184 |
| 402 | Ga0105239_10080412 | 3300010375 | Bacteria | 3586 |
| 403 | Ga0105239_10148787 | 3300010375 | Bacteria | 2613 |
| 404 | Ga0105239_10193665 | 3300010375 | Bacteria | 2276 |
| 405 | Ga0105239_10215545 | 3300010375 | Bacteria | 2152 |
| 406 | Ga0105246_10010229 | 3300011119 | Bacteria | 5794 |
| 407 | Ga0105246_10101022 | 3300011119 | Bacteria | 2100 |
| 408 | Ga0157370_10009437 | 3300013104 | Bacteria | 10426 |
| 409 | Ga0157369_10009982 | 3300013105 | Bacteria | 10844 |
| 410 | Ga0157369_10013868 | 3300013105 | Bacteria | 9105 |
| 411 | Ga0157369_10076551 | 3300013105 | Bacteria | 3586 |
| 412 | Ga0157369_10087438 | 3300013105 | Bacteria | 3328 |
| 413 | Ga0157369_10132704 | 3300013105 | Bacteria | 2638 |
| 414 | Ga0157374_10010088 | 3300013296 | Bacteria | 8113 |
| 415 | Ga0157374_10056599 | 3300013296 | Bacteria | 3662 |
| 416 | Ga0157374_10158323 | 3300013296 | Bacteria | 2205 |
| 417 | Ga0157374_10351483 | 3300013296 | Bacteria | 1465 |
| 418 | Ga0157378_10001711 | 3300013297 | Bacteria | 19741 |
| 419 | Ga0157378_10085252 | 3300013297 | Bacteria | 2862 |
| 420 | Ga0157378_10108945 | 3300013297 | Bacteria | 2537 |
| 421 | Ga0157378_10185226 | 3300013297 | Bacteria | 1961 |
| 422 | Ga0163162_10036057 | 3300013306 | Bacteria | 4928 |
| 423 | Ga0163162_10072199 | 3300013306 | Bacteria | 3506 |
| 424 | Ga0163162_10170297 | 3300013306 | Bacteria | 2302 |
| 425 | Ga0163162_10173284 | 3300013306 | Bacteria | 2282 |
| 426 | Ga0163162_10235260 | 3300013306 | Bacteria | 1962 |
| 427 | Ga0157372_10232848 | 3300013307 | Bacteria | 2136 |
| 428 | Ga0157375_10002389 | 3300013308 | Bacteria | 16243 |
| 429 | Ga0157375_10028331 | 3300013308 | Bacteria | 5249 |
| 430 | Ga0157375_10129401 | 3300013308 | Bacteria | 2643 |
| 431 | Ga0157375_10174427 | 3300013308 | Bacteria | 2299 |
| 432 | Ga0157375_10216330 | 3300013308 | Bacteria | 2074 |
| 433 | Ga0157375_10279638 | 3300013308 | Bacteria | 1832 |
| 434 | Ga0157375_10320821 | 3300013308 | Bacteria | 1714 |
| 435 | Ga0157375_10335825 | 3300013308 | Bacteria | 1676 |
| 436 | Ga0157375_10335939 | 3300013308 | Bacteria | 1676 |
| 437 | Ga0163163_10005199 | 3300014325 | Bacteria | 11222 |
| 438 | Ga0163163_10012257 | 3300014325 | Bacteria | 7807 |
| 439 | Ga0163163_10030770 | 3300014325 | Bacteria | 5175 |
| 440 | Ga0163163_10034855 | 3300014325 | Bacteria | 4878 |
| 441 | Ga0163163_10223241 | 3300014325 | Bacteria | 1933 |
| 442 | Ga0157380_10053360 | 3300014326 | Bacteria | 3205 |
| 443 | Ga0157380_10111370 | 3300014326 | Bacteria | 2301 |
| 444 | Ga0182008_10028985 | 3300014497 | Bacteria | 2798 |
| 445 | Ga0157379_10081215 | 3300014968 | Bacteria | 2904 |
| 446 | Ga0157379_10143626 | 3300014968 | Bacteria | 2152 |
| 447 | Ga0157379_10199759 | 3300014968 | Bacteria | 1808 |
| 448 | Ga0157376_10075006 | 3300014969 | Bacteria | 2885 |
| 449 | Ga0157376_10075647 | 3300014969 | Bacteria | 2874 |
| 450 | Ga0157376_10092413 | 3300014969 | Bacteria | 2623 |
| 451 | Ga0157376_10120431 | 3300014969 | Bacteria | 2325 |
| 452 | Ga0163161_10042735 | 3300017792 | Bacteria | 3261 |
| 453 | Ga0163161_10045064 | 3300017792 | Bacteria | 3179 |
| 454 | Ga0197907_10619077 | 3300020069 | Bacteria | 1753 |
| 455 | Ga0206356_11161776 | 3300020070 | Bacteria | 1819 |
| 456 | Ga0206355_1316074 | 3300020076 | Bacteria | 2144 |
| 457 | Ga0206355_1578423 | 3300020076 | Bacteria | 1513 |
| 458 | Ga0206351_10575076 | 3300020077 | Bacteria | 1640 |
| 459 | Ga0206352_10061378 | 3300020078 | Bacteria | 1525 |
| 460 | Ga0206352_10089368 | 3300020078 | Bacteria | 1863 |
| 461 | Ga0206352_10222114 | 3300020078 | Bacteria | 1549 |
| 462 | Ga0206354_10280028 | 3300020081 | Bacteria | 1511 |
| 463 | Ga0206354_10650967 | 3300020081 | Bacteria | 1732 |
| 464 | Ga0206353_10469523 | 3300020082 | Bacteria | 1588 |
| 465 | Ga0206353_10483150 | 3300020082 | Bacteria | 1520 |
| 466 | Ga0214544_1000508 | 3300021320 | Bacteria | 71511 |
| 467 | Ga0214542_1000365 | 3300021321 | Bacteria | 78664 |
| 468 | Ga0214545_1000211 | 3300021324 | Bacteria | 78664 |
| 469 | Ga0214543_1005667 | 3300021327 | Bacteria | 22750 |
| 470 | Ga0213872_10037781 | 3300021361 | Bacteria | 2205 |
| 471 | Ga0213874_10027698 | 3300021377 | Bacteria | 1614 |
| 472 | Ga0213876_10018405 | 3300021384 | Bacteria | 3689 |
| 473 | Ga0213876_10040021 | 3300021384 | Bacteria | 2476 |
| 474 | Ga0213875_10000748 | 3300021388 | Bacteria | 24571 |
| 475 | Ga0213875_10003375 | 3300021388 | Bacteria | 9099 |
| 476 | Ga0213875_10003454 | 3300021388 | Bacteria | 8997 |
| 477 | Ga0213875_10011211 | 3300021388 | Bacteria | 4466 |
| 478 | Ga0213875_10046568 | 3300021388 | Bacteria | 2035 |
| 479 | Ga0213871_10000047 | 3300021441 | Bacteria | 9118 |
| 480 | Ga0224712_10022783 | 3300022467 | Bacteria | 2164 |
| 481 | Ga0224712_10023166 | 3300022467 | Bacteria | 2152 |
| 482 | Ga0209677_102475 | 3300025253 | Bacteria | 6913 |
| 483 | Ga0209677_104333 | 3300025253 | Bacteria | 4142 |
| 484 | Ga0209148_1000616 | 3300025254 | Bacteria | 31649 |
| 485 | Ga0209233_1005978 | 3300025261 | Bacteria | 3978 |
| 486 | Ga0209233_1009969 | 3300025261 | Bacteria | 2867 |
| 487 | Ga0209455_1000716 | 3300025272 | Bacteria | 19228 |
| 488 | Ga0209455_1007058 | 3300025272 | Bacteria | 3224 |
| 489 | Ga0209673_1019616 | 3300025273 | Bacteria | 2421 |
| 490 | Ga0209564_1004787 | 3300025295 | Bacteria | 8071 |
| 491 | Ga0209758_1000021 | 3300025297 | Bacteria | 697691 |
| 492 | Ga0209758_1000211 | 3300025297 | Bacteria | 127721 |
| 493 | Ga0209758_1002140 | 3300025297 | Bacteria | 20814 |
| 494 | Ga0209758_1002422 | 3300025297 | Bacteria | 19095 |
| 495 | Ga0209256_1015513 | 3300025299 | Bacteria | 2658 |
| 496 | Ga0207426_1000229 | 3300025302 | Bacteria | 128596 |
| 497 | Ga0207426_1000607 | 3300025302 | Bacteria | 46331 |
| 498 | Ga0207426_1014733 | 3300025302 | Bacteria | 2858 |
| 499 | Ga0207426_1027742 | 3300025302 | Bacteria | 1883 |
| 500 | Ga0209051_1037270 | 3300025303 | Bacteria | 1786 |
| 501 | Ga0209257_1000838 | 3300025304 | Bacteria | 44310 |
| 502 | Ga0209257_1008496 | 3300025304 | Bacteria | 5817 |
| 503 | Ga0209257_1019215 | 3300025304 | Bacteria | 2584 |
| 504 | Ga0207697_10012707 | 3300025315 | Bacteria | 3526 |
| 505 | Ga0207696_1022896 | 3300025711 | Bacteria | 1977 |
| 506 | Ga0207682_10004100 | 3300025893 | Bacteria | 6184 |
| 507 | Ga0207692_10000069 | 3300025898 | Bacteria | 30165 |
| 508 | Ga0207692_10001849 | 3300025898 | Bacteria | 8047 |
| 509 | Ga0207692_10047515 | 3300025898 | Bacteria | 2155 |
| 510 | Ga0207692_10122593 | 3300025898 | Bacteria | 1457 |
| 511 | Ga0207642_10033258 | 3300025899 | Bacteria | 2180 |
| 512 | Ga0207710_10017333 | 3300025900 | Bacteria | 3055 |
| 513 | Ga0207710_10023410 | 3300025900 | Bacteria | 2654 |
| 514 | Ga0207710_10028649 | 3300025900 | Bacteria | 2418 |
| 515 | Ga0207688_10001429 | 3300025901 | Bacteria | 12458 |
| 516 | Ga0207688_10071261 | 3300025901 | Bacteria | 1973 |
| 517 | Ga0207688_10078787 | 3300025901 | Bacteria | 1878 |
| 518 | Ga0207688_10080221 | 3300025901 | Bacteria | 1862 |
| 519 | Ga0207688_10097358 | 3300025901 | Bacteria | 1695 |
| 520 | Ga0207680_10091032 | 3300025903 | Bacteria | 1940 |
| 521 | Ga0207647_10001953 | 3300025904 | Bacteria | 15737 |
| 522 | Ga0207647_10035021 | 3300025904 | Bacteria | 3201 |
| 523 | Ga0207647_10082441 | 3300025904 | Bacteria | 1926 |
| 524 | Ga0207685_10009496 | 3300025905 | Bacteria | 2829 |
| 525 | Ga0207699_10000289 | 3300025906 | Bacteria | 27192 |
| 526 | Ga0207699_10008164 | 3300025906 | Bacteria | 5152 |
| 527 | Ga0207699_10013807 | 3300025906 | Bacteria | 4146 |
| 528 | Ga0207645_10034206 | 3300025907 | Bacteria | 3265 |
| 529 | Ga0207705_10049293 | 3300025909 | Bacteria | 3031 |
| 530 | Ga0207684_10029075 | 3300025910 | Bacteria | 4707 |
| 531 | Ga0207684_10208540 | 3300025910 | Bacteria | 1686 |
| 532 | Ga0207654_10019277 | 3300025911 | Bacteria | 3598 |
| 533 | Ga0207707_10001525 | 3300025912 | Bacteria | 21374 |
| 534 | Ga0207707_10010954 | 3300025912 | Bacteria | 7887 |
| 535 | Ga0207707_10013724 | 3300025912 | Bacteria | 7063 |
| 536 | Ga0207707_10023507 | 3300025912 | Bacteria | 5391 |
| 537 | Ga0207707_10039194 | 3300025912 | Bacteria | 4142 |
| 538 | Ga0207707_10259397 | 3300025912 | Bacteria | 1508 |
| 539 | Ga0207695_10000015 | 3300025913 | Bacteria | 803205 |
| 540 | Ga0207695_10044455 | 3300025913 | Bacteria | 4724 |
| 541 | Ga0207695_10058307 | 3300025913 | Bacteria | 4008 |
| 542 | Ga0207695_10137601 | 3300025913 | Bacteria | 2394 |
| 543 | Ga0207671_10008452 | 3300025914 | Bacteria | 8727 |
| 544 | Ga0207671_10008638 | 3300025914 | Bacteria | 8606 |
| 545 | Ga0207671_10037819 | 3300025914 | Bacteria | 3578 |
| 546 | Ga0207671_10054490 | 3300025914 | Bacteria | 2963 |
| 547 | Ga0207671_10061734 | 3300025914 | Bacteria | 2781 |
| 548 | Ga0207671_10110809 | 3300025914 | Bacteria | 2088 |
| 549 | Ga0207671_10144097 | 3300025914 | Bacteria | 1837 |
| 550 | Ga0207671_10147168 | 3300025914 | Bacteria | 1818 |
| 551 | Ga0207693_10000612 | 3300025915 | Bacteria | 31937 |
| 552 | Ga0207693_10001157 | 3300025915 | Bacteria | 23537 |
| 553 | Ga0207693_10002947 | 3300025915 | Bacteria | 14732 |
| 554 | Ga0207693_10008488 | 3300025915 | Bacteria | 8409 |
| 555 | Ga0207693_10016489 | 3300025915 | Bacteria | 5903 |
| 556 | Ga0207693_10032710 | 3300025915 | Bacteria | 4104 |
| 557 | Ga0207693_10160282 | 3300025915 | Bacteria | 1770 |
| 558 | Ga0207693_10164763 | 3300025915 | Bacteria | 1745 |
| 559 | Ga0207663_10001917 | 3300025916 | Bacteria | 9853 |
| 560 | Ga0207663_10002533 | 3300025916 | Bacteria | 8788 |
| 561 | Ga0207663_10005348 | 3300025916 | Bacteria | 6463 |
| 562 | Ga0207663_10006014 | 3300025916 | Bacteria | 6170 |
| 563 | Ga0207663_10018130 | 3300025916 | Bacteria | 3938 |
| 564 | Ga0207663_10035940 | 3300025916 | Bacteria | 2976 |
| 565 | Ga0207663_10103332 | 3300025916 | Bacteria | 1919 |
| 566 | Ga0207660_10001543 | 3300025917 | Bacteria | 15424 |
| 567 | Ga0207660_10057636 | 3300025917 | Bacteria | 2782 |
| 568 | Ga0207660_10075782 | 3300025917 | Bacteria | 2458 |
| 569 | Ga0207660_10090179 | 3300025917 | Bacteria | 2271 |
| 570 | Ga0207657_10019857 | 3300025919 | Bacteria | 6367 |
| 571 | Ga0207657_10130219 | 3300025919 | Bacteria | 2062 |
| 572 | Ga0207657_10146997 | 3300025919 | Bacteria | 1922 |
| 573 | Ga0207649_10044917 | 3300025920 | Bacteria | 2707 |
| 574 | Ga0207652_10006206 | 3300025921 | Bacteria | 9652 |
| 575 | Ga0207652_10059491 | 3300025921 | Bacteria | 3294 |
| 576 | Ga0207652_10067123 | 3300025921 | Bacteria | 3110 |
| 577 | Ga0207652_10071777 | 3300025921 | Bacteria | 3009 |
| 578 | Ga0207652_10075046 | 3300025921 | Bacteria | 2945 |
| 579 | Ga0207646_10283399 | 3300025922 | Unclassified | 1497 |
| 580 | Ga0207681_10142125 | 3300025923 | Bacteria | 1789 |
| 581 | Ga0207694_10025225 | 3300025924 | Bacteria | 4518 |
| 582 | Ga0207694_10059445 | 3300025924 | Bacteria | 2973 |
| 583 | Ga0207694_10065100 | 3300025924 | Bacteria | 2842 |
| 584 | Ga0207694_10069929 | 3300025924 | Bacteria | 2743 |
| 585 | Ga0207694_10173654 | 3300025924 | Bacteria | 1746 |
| 586 | Ga0207650_10009631 | 3300025925 | Bacteria | 6607 |
| 587 | Ga0207650_10049079 | 3300025925 | Bacteria | 3115 |
| 588 | Ga0207659_10013140 | 3300025926 | Bacteria | 5296 |
| 589 | Ga0207659_10143956 | 3300025926 | Bacteria | 1854 |
| 590 | Ga0207659_10169132 | 3300025926 | Bacteria | 1723 |
| 591 | Ga0207687_10033081 | 3300025927 | Bacteria | 3505 |
| 592 | Ga0207700_10003623 | 3300025928 | Bacteria | 9002 |
| 593 | Ga0207700_10013365 | 3300025928 | Bacteria | 5338 |
| 594 | Ga0207700_10015503 | 3300025928 | Bacteria | 5030 |
| 595 | Ga0207700_10025830 | 3300025928 | Bacteria | 4086 |
| 596 | Ga0207700_10062855 | 3300025928 | Bacteria | 2821 |
| 597 | Ga0207700_10084261 | 3300025928 | Bacteria | 2491 |
| 598 | Ga0207700_10114873 | 3300025928 | Bacteria | 2173 |
| 599 | Ga0207700_10198572 | 3300025928 | Bacteria | 1689 |
| 600 | Ga0207664_10005442 | 3300025929 | Bacteria | 8704 |
| 601 | Ga0207664_10005962 | 3300025929 | Bacteria | 8342 |
| 602 | Ga0207664_10006018 | 3300025929 | Bacteria | 8305 |
| 603 | Ga0207664_10023512 | 3300025929 | Bacteria | 4619 |
| 604 | Ga0207664_10068321 | 3300025929 | Bacteria | 2854 |
| 605 | Ga0207664_10121243 | 3300025929 | Bacteria | 2188 |
| 606 | Ga0207644_10057893 | 3300025931 | Bacteria | 2799 |
| 607 | Ga0207644_10083229 | 3300025931 | Bacteria | 2369 |
| 608 | Ga0207644_10113384 | 3300025931 | Bacteria | 2053 |
| 609 | Ga0207706_10017340 | 3300025933 | Bacteria | 6487 |
| 610 | Ga0207706_10037610 | 3300025933 | Bacteria | 4296 |
| 611 | Ga0207706_10073694 | 3300025933 | Bacteria | 3002 |
| 612 | Ga0207706_10092525 | 3300025933 | Bacteria | 2659 |
| 613 | Ga0207709_10076358 | 3300025935 | Bacteria | 2144 |
| 614 | Ga0207709_10080306 | 3300025935 | Bacteria | 2100 |
| 615 | Ga0207670_10054619 | 3300025936 | Bacteria | 2696 |
| 616 | Ga0207669_10001519 | 3300025937 | Bacteria | 9883 |
| 617 | Ga0207669_10001922 | 3300025937 | Bacteria | 8806 |
| 618 | Ga0207704_10172861 | 3300025938 | Bacteria | 1552 |
| 619 | Ga0207665_10005674 | 3300025939 | Bacteria | 8314 |
| 620 | Ga0207665_10016250 | 3300025939 | Bacteria | 4886 |
| 621 | Ga0207665_10044028 | 3300025939 | Bacteria | 2986 |
| 622 | Ga0207665_10062480 | 3300025939 | Bacteria | 2527 |
| 623 | Ga0207665_10139787 | 3300025939 | Bacteria | 1725 |
| 624 | Ga0207691_10000910 | 3300025940 | Bacteria | 29340 |
| 625 | Ga0207691_10008519 | 3300025940 | Bacteria | 9849 |
| 626 | Ga0207711_10115273 | 3300025941 | Bacteria | 2394 |
| 627 | Ga0207689_10008628 | 3300025942 | Bacteria | 8876 |
| 628 | Ga0207689_10019702 | 3300025942 | Bacteria | 5684 |
| 629 | Ga0207689_10112421 | 3300025942 | Bacteria | 2239 |
| 630 | Ga0207689_10124466 | 3300025942 | Bacteria | 2121 |
| 631 | Ga0207661_10000309 | 3300025944 | Bacteria | 31114 |
| 632 | Ga0207661_10010366 | 3300025944 | Bacteria | 6707 |
| 633 | Ga0207661_10038523 | 3300025944 | Bacteria | 3747 |
| 634 | Ga0207661_10131875 | 3300025944 | Bacteria | 2141 |
| 635 | Ga0207679_10170203 | 3300025945 | Bacteria | 1792 |
| 636 | Ga0207679_10247033 | 3300025945 | Bacteria | 1515 |
| 637 | Ga0207667_10037832 | 3300025949 | Bacteria | 5157 |
| 638 | Ga0207667_10047739 | 3300025949 | Bacteria | 4530 |
| 639 | Ga0207667_10134908 | 3300025949 | Bacteria | 2542 |
| 640 | Ga0207667_10225141 | 3300025949 | Bacteria | 1921 |
| 641 | Ga0207667_10297985 | 3300025949 | Bacteria | 1647 |
| 642 | Ga0207651_10070106 | 3300025960 | Bacteria | 2478 |
| 643 | Ga0207712_10006806 | 3300025961 | Bacteria | 7210 |
| 644 | Ga0207712_10036612 | 3300025961 | Bacteria | 3344 |
| 645 | Ga0207712_10105979 | 3300025961 | Bacteria | 2099 |
| 646 | Ga0207668_10006532 | 3300025972 | Bacteria | 6891 |
| 647 | Ga0207668_10013643 | 3300025972 | Bacteria | 5012 |
| 648 | Ga0207668_10066311 | 3300025972 | Bacteria | 2558 |
| 649 | Ga0207668_10075063 | 3300025972 | Bacteria | 2430 |
| 650 | Ga0207658_10142335 | 3300025986 | Bacteria | 1942 |
| 651 | Ga0207677_10058702 | 3300026023 | Bacteria | 2651 |
| 652 | Ga0207677_10061807 | 3300026023 | Bacteria | 2595 |
| 653 | Ga0207703_10020084 | 3300026035 | Bacteria | 5221 |
| 654 | Ga0207703_10039853 | 3300026035 | Bacteria | 3756 |
| 655 | Ga0207703_10154972 | 3300026035 | Bacteria | 2001 |
| 656 | Ga0207639_10044210 | 3300026041 | Bacteria | 3349 |
| 657 | Ga0207639_10076440 | 3300026041 | Bacteria | 2637 |
| 658 | Ga0207639_10088570 | 3300026041 | Bacteria | 2470 |
| 659 | Ga0207639_10124819 | 3300026041 | Bacteria | 2121 |
| 660 | Ga0207639_10138822 | 3300026041 | Bacteria | 2022 |
| 661 | Ga0207639_10143422 | 3300026041 | Bacteria | 1993 |
| 662 | Ga0207639_10182460 | 3300026041 | Bacteria | 1786 |
| 663 | Ga0207678_10021574 | 3300026067 | Bacteria | 5648 |
| 664 | Ga0207678_10023262 | 3300026067 | Bacteria | 5420 |
| 665 | Ga0207678_10032462 | 3300026067 | Bacteria | 4550 |
| 666 | Ga0207678_10055570 | 3300026067 | Bacteria | 3410 |
| 667 | Ga0207678_10088731 | 3300026067 | Bacteria | 2643 |
| 668 | Ga0207678_10118834 | 3300026067 | Bacteria | 2256 |
| 669 | Ga0207678_10190721 | 3300026067 | Bacteria | 1751 |
| 670 | Ga0207708_10013604 | 3300026075 | Bacteria | 6080 |
| 671 | Ga0207708_10019614 | 3300026075 | Bacteria | 5099 |
| 672 | Ga0207708_10100894 | 3300026075 | Bacteria | 2234 |
| 673 | Ga0207708_10133803 | 3300026075 | Bacteria | 1940 |
| 674 | Ga0207708_10161225 | 3300026075 | Bacteria | 1771 |
| 675 | Ga0207702_10003615 | 3300026078 | Bacteria | 14048 |
| 676 | Ga0207702_10009625 | 3300026078 | Bacteria | 8111 |
| 677 | Ga0207702_10167631 | 3300026078 | Bacteria | 2011 |
| 678 | Ga0207641_10123067 | 3300026088 | Bacteria | 2318 |
| 679 | Ga0207648_10026064 | 3300026089 | Bacteria | 5198 |
| 680 | Ga0207676_10041124 | 3300026095 | Bacteria | 3546 |
| 681 | Ga0207676_10051483 | 3300026095 | Bacteria | 3215 |
| 682 | Ga0207674_10003474 | 3300026116 | Bacteria | 19275 |
| 683 | Ga0207674_10078492 | 3300026116 | Bacteria | 3306 |
| 684 | Ga0207674_10098061 | 3300026116 | Bacteria | 2915 |
| 685 | Ga0207674_10119674 | 3300026116 | Bacteria | 2602 |
| 686 | Ga0207674_10138856 | 3300026116 | Bacteria | 2391 |
| 687 | Ga0207674_10157891 | 3300026116 | Bacteria | 2223 |
| 688 | Ga0207675_100022031 | 3300026118 | Bacteria | 5930 |
| 689 | Ga0207675_100040631 | 3300026118 | Bacteria | 4344 |
| 690 | Ga0207675_100043587 | 3300026118 | Bacteria | 4190 |
| 691 | Ga0207675_100047496 | 3300026118 | Bacteria | 4008 |
| 692 | Ga0207675_100077104 | 3300026118 | Bacteria | 3122 |
| 693 | Ga0207675_100196896 | 3300026118 | Bacteria | 1934 |
| 694 | Ga0207675_100229170 | 3300026118 | Bacteria | 1792 |
| 695 | Ga0207675_100235736 | 3300026118 | Bacteria | 1767 |
| 696 | Ga0207675_100376634 | 3300026118 | Bacteria | 1395 |
| 697 | Ga0207683_10001401 | 3300026121 | Bacteria | 21763 |
| 698 | Ga0207683_10043864 | 3300026121 | Bacteria | 3909 |
| 699 | Ga0207683_10065696 | 3300026121 | Bacteria | 3198 |
| 700 | Ga0207683_10102091 | 3300026121 | Bacteria | 2561 |
| 701 | Ga0207683_10116996 | 3300026121 | Bacteria | 2390 |
| 702 | Ga0209389_1000281 | 3300027296 | Bacteria | 32069 |
| 703 | Ga0209389_1000287 | 3300027296 | Bacteria | 31774 |
| 704 | Ga0209589_1000003 | 3300027357 | Bacteria | 629130 |
| 705 | Ga0209589_1000007 | 3300027357 | Bacteria | 425699 |
| 706 | Ga0209589_1000072 | 3300027357 | Bacteria | 98789 |
| 707 | Ga0209489_100003 | 3300027361 | Bacteria | 663105 |
| 708 | Ga0209489_100008 | 3300027361 | Bacteria | 425699 |
| 709 | Ga0209489_100031 | 3300027361 | Bacteria | 184074 |
| 710 | Ga0209489_108310 | 3300027361 | Bacteria | 14336 |
| 711 | Ga0209700_100003 | 3300027363 | Bacteria | 663105 |
| 712 | Ga0209700_100009 | 3300027363 | Bacteria | 425699 |
| 713 | Ga0209700_100010 | 3300027363 | Bacteria | 395269 |
| 714 | Ga0209179_1004665 | 3300027512 | Bacteria | 2087 |
| 715 | Ga0209588_1004526 | 3300027671 | Bacteria | 3927 |
| 716 | Ga0209588_1010758 | 3300027671 | Bacteria | 2756 |
| 717 | Ga0209813_10000619 | 3300027866 | Bacteria | 8265 |
| 718 | Ga0207428_10003035 | 3300027907 | Bacteria | 16519 |
| 719 | Ga0207428_10059247 | 3300027907 | Bacteria | 3036 |
| 720 | Ga0207428_10075145 | 3300027907 | Bacteria | 2649 |
| 721 | Ga0268266_10000857 | 3300028379 | Bacteria | 39606 |
| 722 | Ga0268266_10002192 | 3300028379 | Bacteria | 21357 |
| 723 | Ga0268266_10020753 | 3300028379 | Bacteria | 5601 |
| 724 | Ga0268266_10052158 | 3300028379 | Bacteria | 3512 |
| 725 | Ga0268266_10058109 | 3300028379 | Bacteria | 3330 |
| 726 | Ga0268265_10008419 | 3300028380 | Bacteria | 6963 |
| 727 | Ga0268265_10027002 | 3300028380 | Bacteria | 4091 |
| 728 | Ga0268265_10103498 | 3300028380 | Bacteria | 2305 |
| 729 | Ga0268265_10156865 | 3300028380 | Bacteria | 1927 |
| 730 | Ga0268265_10173959 | 3300028380 | Bacteria | 1843 |
| 731 | Ga0268264_10000162 | 3300028381 | Bacteria | 148472 |
| 732 | Ga0268264_10003345 | 3300028381 | Bacteria | 13859 |
| 733 | Ga0268264_10021446 | 3300028381 | Bacteria | 5274 |
| 734 | Ga0268264_10023769 | 3300028381 | Bacteria | 4999 |
| 735 | Ga0268264_10039768 | 3300028381 | Bacteria | 3885 |
| 736 | Ga0268264_10108822 | 3300028381 | Bacteria | 2423 |
| 737 | Ga0268264_10117309 | 3300028381 | Bacteria | 2341 |
| 738 | Ga0265334_10023379 | 3300028573 | Bacteria | 2513 |
| 739 | Ga0265318_10017367 | 3300028577 | Bacteria | 2955 |
| 740 | Ga0265323_10002402 | 3300028653 | Bacteria | 8615 |
| 741 | Ga0265336_10000443 | 3300028666 | Bacteria | 25347 |
| 742 | Ga0307515_10003270 | 3300028794 | Bacteria | 34266 |
| 743 | Ga0265338_10001194 | 3300028800 | Bacteria | 42941 |
| 744 | Ga0265338_10031136 | 3300028800 | Bacteria | 5234 |
| 745 | Ga0265332_10004308 | 3300031238 | Bacteria | 6713 |
| 746 | Ga0265325_10023987 | 3300031241 | Bacteria | 3321 |
| 747 | Ga0265340_10015157 | 3300031247 | Bacteria | 4009 |
| 748 | Ga0265339_10003343 | 3300031249 | Bacteria | 11232 |
| 749 | Ga0265316_10030447 | 3300031344 | Bacteria | 4423 |
| 750 | Ga0265316_10131217 | 3300031344 | Bacteria | 1887 |
| 751 | Ga0307513_10084490 | 3300031456 | Bacteria | 3260 |
| 752 | Ga0307509_10033205 | 3300031507 | Bacteria | 5680 |
| 753 | Ga0307509_10232821 | 3300031507 | Bacteria | 1643 |
| 754 | Ga0265313_10009133 | 3300031595 | Bacteria | 6480 |
| 755 | Ga0265314_10031327 | 3300031711 | Bacteria | 3928 |
| 756 | Ga0265342_10027525 | 3300031712 | Bacteria | 3551 |
| 757 | Ga0265342_10053678 | 3300031712 | Bacteria | 2397 |
| 758 | Ga0316578_10036599 | 3300031728 | Bacteria | 2825 |
| 759 | Ga0307516_10005336 | 3300031730 | Bacteria | 15451 |
| 760 | Ga0307516_10013317 | 3300031730 | Bacteria | 8778 |
| 761 | Ga0307410_10039451 | 3300031852 | Bacteria | 3101 |
| 762 | Ga0307406_10074689 | 3300031901 | Bacteria | 2233 |
| 763 | Ga0307416_100050158 | 3300032002 | Bacteria | 3325 |
| 764 | Ga0307510_10011576 | 3300033180 | Bacteria | 10466 |
| 765 | Ga0373929_0009323 | 3300035085 | Bacteria | 1819 |
| 766 | Ga0373934_0008480 | 3300035086 | Bacteria | 3831 |
| 767 | Ga0373940_0005502 | 3300035088 | Bacteria | 2750 |
| 768 | Ga0373944_0012984 | 3300035089 | Bacteria | 2304 |
| 769 | Ga0373949_0017409 | 3300035090 | Bacteria | 1620 |
| 770 | Ga0373923_0001387 | 3300035111 | Bacteria | 6901 |
| 771 | Ga0373923_0041798 | 3300035111 | Bacteria | 1891 |
| 772 | Ga0373932_0026524 | 3300035112 | Bacteria | 1577 |
| 773 | Ga0373936_0039797 | 3300035113 | Bacteria | 1882 |
| 774 | Ga0373939_0040342 | 3300035114 | Bacteria | 1401 |
| 775 | Ga0373945_0007800 | 3300035116 | Bacteria | 3473 |
| 776 | Ga0373945_0019537 | 3300035116 | Bacteria | 2314 |
| 777 | Ga0373945_0053648 | 3300035116 | Bacteria | 1489 |
| 778 | Ga0373953_0002318 | 3300035117 | Bacteria | 5724 |
| 779 | Ga0373953_0009137 | 3300035117 | Bacteria | 3393 |
| 780 | Ga0373954_0000575 | 3300035118 | Bacteria | 13881 |
| 781 | Ga0373954_0003873 | 3300035118 | Bacteria | 6400 |
| 782 | Ga0373956_0007433 | 3300035119 | Bacteria | 4413 |
| 783 | Ga0373957_0000310 | 3300035120 | Bacteria | 12240 |
| 784 | Ga0373957_0003550 | 3300035120 | Bacteria | 4629 |
| 785 | Ga0373943_0003064 | 3300035170 | Bacteria | 7594 |
| 786 | Ga0373943_0003092 | 3300035170 | Bacteria | 7558 |
| 787 | Ga0373943_0012722 | 3300035170 | Bacteria | 3794 |
| 788 | Ga0373943_0049705 | 3300035170 | Bacteria | 2059 |
| 789 | Ga0373943_0050899 | 3300035170 | Bacteria | 2037 |
| 790 | Ga0373946_0001574 | 3300035171 | Bacteria | 7947 |
| 791 | Ga0373946_0041444 | 3300035171 | Bacteria | 1888 |
| 792 | Ga0373955_0004813 | 3300035172 | Bacteria | 6012 |
| 793 | Ga0373955_0006580 | 3300035172 | Bacteria | 5300 |
| 794 | Ga0373955_0018941 | 3300035172 | Bacteria | 3433 |
| 795 | Ga0373942_0016516 | 3300035207 | Bacteria | 1811 |
| 796 | Ga0373942_0038396 | 3300035207 | Bacteria | 1298 |
| 797 | Ga0373961_0024902 | 3300035241 | Bacteria | 1622 |
| 798 | Ga0373962_0003154 | 3300035242 | Bacteria | 3953 |
| 799 | Ga0373962_0012004 | 3300035242 | Bacteria | 2178 |
| 800 | Ga0373962_0024449 | 3300035242 | Bacteria | 1615 |
| 801 | Ga0373924_0028362 | 3300035410 | Bacteria | 2231 |
| 802 | Ga0373924_0040288 | 3300035410 | Bacteria | 1911 |
| 803 | Ga0373931_0001359 | 3300035691 | Bacteria | 10471 |
| 804 | Ga0373931_0003293 | 3300035691 | Bacteria | 7229 |
| 805 | Ga0373931_0003521 | 3300035691 | Bacteria | 7054 |
| 806 | Ga0373931_0013106 | 3300035691 | Bacteria | 4031 |
| 807 | Ga0373931_0103293 | 3300035691 | Bacteria | 1606 |
| 808 | Ga0373935_0000468 | 3300035692 | Bacteria | 21049 |
| 809 | Ga0373935_0017306 | 3300035692 | Bacteria | 4370 |
| 810 | Ga0373935_0023585 | 3300035692 | Bacteria | 3782 |
| 811 | Ga0373935_0024652 | 3300035692 | Bacteria | 3704 |
| 812 | Ga0373935_0057971 | 3300035692 | Bacteria | 2472 |
| 813 | Ga0373935_0111111 | 3300035692 | Bacteria | 1819 |
| 814 | Ga0373927_0000801 | 3300035695 | Bacteria | 24039 |
| 815 | Ga0373927_0023630 | 3300035695 | Bacteria | 4023 |
| 816 | Ga0373927_0026896 | 3300035695 | Bacteria | 3760 |
| 817 | Ga0373927_0029396 | 3300035695 | Bacteria | 3581 |
| 818 | Ga0373927_0107655 | 3300035695 | Bacteria | 1816 |
| 819 | Ga0373933_0006978 | 3300035724 | Bacteria | 6156 |
| 820 | Ga0373933_0009634 | 3300035724 | Bacteria | 5277 |
| 821 | Ga0373933_0067689 | 3300035724 | Bacteria | 2167 |
| 822 | Ga0373947_0004970 | 3300035725 | Bacteria | 7781 |
| 823 | Ga0373947_0008677 | 3300035725 | Bacteria | 5848 |
| 824 | Ga0373947_0010715 | 3300035725 | Bacteria | 5262 |
| 825 | Ga0373947_0054014 | 3300035725 | Bacteria | 2424 |
| 826 | Ga0373947_0054510 | 3300035725 | Bacteria | 2413 |
| 827 | Ga0373937_0013442 | 3300036401 | Bacteria | 7210 |
| 828 | Ga0373937_0017298 | 3300036401 | Bacteria | 6420 |
| 829 | Ga0373925_0005078 | 3300037068 | Bacteria | 9849 |
| 830 | Ga0373925_0012194 | 3300037068 | Bacteria | 6222 |
| 831 | Ga0373925_0066373 | 3300037068 | Bacteria | 2720 |
| 832 | Ga0373925_0114015 | 3300037068 | Bacteria | 2091 |
| 833 | Ga0395899_0035966 | 3300037312 | Bacteria | 3716 |
| 834 | Ga0395900_0005908 | 3300037418 | Bacteria | 12779 |
| 835 | Ga0395900_0009959 | 3300037418 | Bacteria | 9731 |
| 836 | Ga0395900_0010114 | 3300037418 | Bacteria | 9648 |
| 837 | Ga0395900_0170696 | 3300037418 | Bacteria | 2215 |
| 838 | Ga0395898_0002979 | 3300037466 | Bacteria | 19242 |
| 839 | Ga0395898_0060531 | 3300037466 | Bacteria | 3679 |
| 840 | Ga0395898_0082027 | 3300037466 | Bacteria | 3109 |
| 841 | Ga0395898_0120358 | 3300037466 | Bacteria | 2515 |
| 842 | Ga0395898_0177688 | 3300037466 | Bacteria | 2034 |
| 843 | Ga0395898_0228178 | 3300037466 | Bacteria | 1776 |
| 844 | Ga0395905_0002573 | 3300037471 | Bacteria | 19993 |
| 845 | Ga0395905_0093671 | 3300037471 | Bacteria | 2817 |
| 846 | Ga0395905_0209939 | 3300037471 | Bacteria | 1824 |
| 847 | Ga0395905_0214454 | 3300037471 | Bacteria | 1803 |
| 848 | Ga0436364_0063853 | 3300037853 | Bacteria | 28863 |
| 849 | Ga0436364_0425406 | 3300037853 | Bacteria | 2118 |
| 850 | Ga0436364_0875825 | 3300037853 | Bacteria | 32110 |
| 851 | Ga0436364_0936501 | 3300037853 | Bacteria | 40899 |
| 852 | Ga0436364_1037748 | 3300037853 | Bacteria | 27359 |
| 853 | Ga0436364_1117332 | 3300037853 | Bacteria | 2373 |
| 854 | Ga0395901_0002009 | 3300038443 | Bacteria | 20939 |
| 855 | Ga0395901_0002583 | 3300038443 | Bacteria | 18359 |
| 856 | Ga0395901_0002729 | 3300038443 | Bacteria | 17807 |
| 857 | Ga0395901_0040271 | 3300038443 | Bacteria | 4839 |
| 858 | Ga0395901_0179180 | 3300038443 | Bacteria | 2222 |
| 859 | Ga0436365_0071656 | 3300039437 | Bacteria | 2393 |
| 860 | Ga0436365_0156834 | 3300039437 | Bacteria | 2628 |
| 861 | Ga0436365_0206643 | 3300039437 | Bacteria | 5981 |
| 862 | Ga0436365_1894746 | 3300039437 | Bacteria | 9037 |
| 863 | Ga0436360_0472871 | 3300039438 | Bacteria | 10155 |
| 864 | Ga0436360_0857979 | 3300039438 | Bacteria | 2093 |
| 865 | Ga0436361_0005645 | 3300039447 | Bacteria | 3005 |
| 866 | Ga0436361_0142586 | 3300039447 | Bacteria | 3259 |
| 867 | Ga0436361_0303930 | 3300039447 | Bacteria | 5146 |
| 868 | Ga0436361_0488607 | 3300039447 | Bacteria | 3791 |
| 869 | Ga0436363_1256145 | 3300039450 | Bacteria | 2251 |
| 870 | Ga0436363_1263636 | 3300039450 | Bacteria | 7386 |
| 871 | Ga0436362_0446479 | 3300039453 | Bacteria | 5719 |
| 872 | Ga0451793_0230553 | 3300041452 | Bacteria | 1936 |
| 873 | Ga0439435_0026053 | 3300042436 | Bacteria | 1554 |
| 874 | Ga0466969_0026253 | 3300044656 | Bacteria | 2988 |
| 875 | Ga0466972_0000238 | 3300044658 | Bacteria | 37807 |
| 876 | Ga0466972_0000728 | 3300044658 | Bacteria | 15731 |
| 877 | Ga0466965_0011418 | 3300044683 | Bacteria | 4163 |
| 878 | Ga0466966_0009776 | 3300044684 | Bacteria | 6357 |
| 879 | Ga0466961_0000007 | 3300044693 | Bacteria | 146374 |
| 880 | Ga0466961_0114167 | 3300044693 | Bacteria | 1698 |
| 881 | Ga0466963_0027947 | 3300044694 | Bacteria | 3616 |
| 882 | Ga0466963_0053755 | 3300044694 | Bacteria | 2675 |
| 883 | Ga0466963_0053828 | 3300044694 | Bacteria | 2673 |
| 884 | Ga0466968_0000531 | 3300044735 | Bacteria | 12939 |
| 885 | Ga0466957_0031508 | 3300044842 | Bacteria | 3169 |
| 886 | Ga0466960_0020241 | 3300044901 | Bacteria | 2944 |
| 887 | Ga0466959_0006767 | 3300045049 | Bacteria | 7985 |
| 888 | Ga0466959_0022085 | 3300045049 | Bacteria | 4701 |
| 889 | Ga0466959_0164384 | 3300045049 | Bacteria | 1559 |
| 890 | Ga0451576_0261718 | 3300045051 | Bacteria | 1808 |
| 891 | Ga0466967_0039701 | 3300045976 | Bacteria | 4048 |
| 892 | Ga0466967_0100148 | 3300045976 | Bacteria | 2647 |
| 893 | Ga0466967_0120775 | 3300045976 | Bacteria | 2420 |
| 894 | Ga0466967_0275862 | 3300045976 | Bacteria | 1612 |
| 895 | Ga0495617_003205 | 3300046452 | Bacteria | 6219 |
| 896 | Ga0495617_041209 | 3300046452 | Bacteria | 1544 |
| 897 | Ga0495592_0004934 | 3300046454 | Bacteria | 9821 |
| 898 | Ga0495592_0009635 | 3300046454 | Bacteria | 7268 |
| 899 | Ga0495592_0026990 | 3300046454 | Bacteria | 4354 |
| 900 | Ga0495592_0135214 | 3300046454 | Bacteria | 1720 |
| 901 | Ga0495603_0000076 | 3300046455 | Bacteria | 43518 |
| 902 | Ga0495603_0000298 | 3300046455 | Bacteria | 26417 |
| 903 | Ga0495603_0001807 | 3300046455 | Bacteria | 12628 |
| 904 | Ga0495603_0012503 | 3300046455 | Bacteria | 5139 |
| 905 | Ga0495603_0019236 | 3300046455 | Bacteria | 4135 |
| 906 | Ga0495603_0073286 | 3300046455 | Bacteria | 2012 |
| 907 | Ga0495603_0074272 | 3300046455 | Bacteria | 1996 |
| 908 | Ga0495590_0023171 | 3300046457 | Bacteria | 2194 |
| 909 | Ga0495590_0023720 | 3300046457 | Bacteria | 2164 |
| 910 | Ga0495629_0000087 | 3300046459 | Bacteria | 81337 |
| 911 | Ga0495629_0000274 | 3300046459 | Bacteria | 44731 |
| 912 | Ga0495629_0000336 | 3300046459 | Bacteria | 40110 |
| 913 | Ga0495629_0026723 | 3300046459 | Bacteria | 4099 |
| 914 | Ga0495629_0031544 | 3300046459 | Bacteria | 3752 |
| 915 | Ga0495629_0083933 | 3300046459 | Bacteria | 2223 |
| 916 | Ga0495638_0004997 | 3300046460 | Bacteria | 9950 |
| 917 | Ga0495638_0039519 | 3300046460 | Bacteria | 2995 |
| 918 | Ga0495641_0005191 | 3300046461 | Bacteria | 8890 |
| 919 | Ga0495641_0049337 | 3300046461 | Bacteria | 1927 |
| 920 | Ga0495651_0016316 | 3300046462 | Bacteria | 5751 |
| 921 | Ga0495651_0021993 | 3300046462 | Bacteria | 4959 |
| 922 | Ga0495651_0032043 | 3300046462 | Bacteria | 4100 |
| 923 | Ga0495653_0011688 | 3300046463 | Bacteria | 7164 |
| 924 | Ga0495653_0013726 | 3300046463 | Bacteria | 6602 |
| 925 | Ga0495650_0051151 | 3300046471 | Bacteria | 1704 |
| 926 | Ga0495580_0000735 | 3300046472 | Bacteria | 28060 |
| 927 | Ga0495580_0003367 | 3300046472 | Bacteria | 13663 |
| 928 | Ga0495580_0043997 | 3300046472 | Bacteria | 3176 |
| 929 | Ga0495582_0000101 | 3300046473 | Bacteria | 44353 |
| 930 | Ga0495582_0000134 | 3300046473 | Bacteria | 39810 |
| 931 | Ga0495582_0031888 | 3300046473 | Bacteria | 2898 |
| 932 | Ga0495582_0063318 | 3300046473 | Bacteria | 2043 |
| 933 | Ga0495605_0046305 | 3300046474 | Bacteria | 2139 |
| 934 | Ga0495639_0000022 | 3300046475 | Bacteria | 72037 |
| 935 | Ga0495639_0001106 | 3300046475 | Bacteria | 12153 |
| 936 | Ga0495639_0024238 | 3300046475 | Bacteria | 2670 |
| 937 | Ga0495639_0039535 | 3300046475 | Bacteria | 2121 |
| 938 | Ga0495662_0000460 | 3300046476 | Bacteria | 18380 |
| 939 | Ga0495662_0001392 | 3300046476 | Bacteria | 11990 |
| 940 | Ga0495662_0017387 | 3300046476 | Bacteria | 3481 |
| 941 | Ga0495662_0051973 | 3300046476 | Bacteria | 1978 |
| 942 | Ga0495664_0007291 | 3300046477 | Bacteria | 6135 |
| 943 | Ga0495664_0010312 | 3300046477 | Bacteria | 5244 |
| 944 | Ga0495664_0017317 | 3300046477 | Bacteria | 4117 |
| 945 | Ga0495664_0024065 | 3300046477 | Bacteria | 3537 |
| 946 | Ga0495664_0080243 | 3300046477 | Bacteria | 1955 |
| 947 | Ga0495584_0061733 | 3300046491 | Bacteria | 1884 |
| 948 | Ga0495584_0067052 | 3300046491 | Bacteria | 1805 |
| 949 | Ga0495585_0031744 | 3300046492 | Bacteria | 2997 |
| 950 | Ga0495594_0000176 | 3300046499 | Bacteria | 30884 |
| 951 | Ga0495594_0001316 | 3300046499 | Bacteria | 12934 |
| 952 | Ga0495594_0038830 | 3300046499 | Bacteria | 2601 |
| 953 | Ga0495607_0101529 | 3300046501 | Bacteria | 1540 |
| 954 | Ga0495608_0003122 | 3300046511 | Bacteria | 11828 |
| 955 | Ga0495608_0009651 | 3300046511 | Bacteria | 6734 |
| 956 | Ga0495608_0104948 | 3300046511 | Bacteria | 1820 |
| 957 | Ga0495616_0022143 | 3300046513 | Bacteria | 3434 |
| 958 | Ga0495628_0023257 | 3300046516 | Bacteria | 5088 |
| 959 | Ga0495628_0036847 | 3300046516 | Bacteria | 3923 |
| 960 | Ga0495628_0037986 | 3300046516 | Bacteria | 3858 |
| 961 | Ga0495628_0067721 | 3300046516 | Bacteria | 2787 |
| 962 | Ga0495628_0153080 | 3300046516 | Bacteria | 1756 |
| 963 | Ga0495630_0010164 | 3300046517 | Bacteria | 6784 |
| 964 | Ga0495630_0039291 | 3300046517 | Bacteria | 3539 |
| 965 | Ga0495631_0012833 | 3300046518 | Bacteria | 4080 |
| 966 | Ga0495631_0027377 | 3300046518 | Bacteria | 2609 |
| 967 | Ga0495632_0035619 | 3300046519 | Bacteria | 2538 |
| 968 | Ga0495632_0087382 | 3300046519 | Bacteria | 1482 |
| 969 | Ga0495643_0010781 | 3300046522 | Bacteria | 5607 |
| 970 | Ga0495643_0092925 | 3300046522 | Bacteria | 1554 |
| 971 | Ga0495642_0056860 | 3300046528 | Bacteria | 1617 |
| 972 | Ga0495652_0009267 | 3300046529 | Bacteria | 8946 |
| 973 | Ga0495652_0069724 | 3300046529 | Bacteria | 2941 |
| 974 | Ga0495665_0000064 | 3300046531 | Bacteria | 43712 |
| 975 | Ga0495665_0005050 | 3300046531 | Bacteria | 7116 |
| 976 | Ga0495640_0016218 | 3300046533 | Bacteria | 5577 |
| 977 | Ga0495640_0074143 | 3300046533 | Bacteria | 2277 |
| 978 | Ga0495586_0020121 | 3300046535 | Bacteria | 3555 |
| 979 | Ga0495587_0003309 | 3300046536 | Bacteria | 10759 |
| 980 | Ga0495587_0012587 | 3300046536 | Bacteria | 5320 |
| 981 | Ga0495598_0001513 | 3300046537 | Bacteria | 4636 |
| 982 | Ga0495621_0018107 | 3300046539 | Bacteria | 2284 |
| 983 | Ga0495645_0004289 | 3300046543 | Bacteria | 9740 |
| 984 | Ga0495645_0004431 | 3300046543 | Bacteria | 9588 |
| 985 | Ga0495645_0030408 | 3300046543 | Bacteria | 3932 |
| 986 | Ga0495622_0005549 | 3300046557 | Bacteria | 5849 |
| 987 | Ga0495633_0029447 | 3300046558 | Bacteria | 2672 |
| 988 | Ga0495633_0039800 | 3300046558 | Bacteria | 2242 |
| 989 | Ga0495667_0003046 | 3300046559 | Bacteria | 11238 |
| 990 | Ga0495667_0010132 | 3300046559 | Bacteria | 6380 |
| 991 | Ga0495667_0023182 | 3300046559 | Bacteria | 4183 |
| 992 | Ga0495667_0060668 | 3300046559 | Bacteria | 2480 |
| 993 | Ga0495667_0074446 | 3300046559 | Bacteria | 2211 |
| 994 | Ga0495656_0001407 | 3300046615 | Bacteria | 7860 |
| 995 | Ga0495656_0056488 | 3300046615 | Bacteria | 1696 |
| 996 | Ga0495656_0078571 | 3300046615 | Bacteria | 1483 |
| 997 | Ga0495668_0009325 | 3300046616 | Bacteria | 6034 |
| 998 | Ga0495668_0049236 | 3300046616 | Bacteria | 2337 |
| 999 | Ga0495668_0092581 | 3300046616 | Bacteria | 1656 |
| 1000 | Ga0495668_0126719 | 3300046616 | Bacteria | 1398 |
| 1001 | Ga0495634_0003296 | 3300046642 | Bacteria | 13017 |
| 1002 | Ga0495634_0007620 | 3300046642 | Bacteria | 8111 |
| 1003 | Ga0495634_0012312 | 3300046642 | Bacteria | 6198 |
| 1004 | Ga0495634_0024752 | 3300046642 | Bacteria | 4208 |
| 1005 | Ga0495611_0030727 | 3300046648 | Bacteria | 2363 |
| 1006 | Ga0495611_0048713 | 3300046648 | Bacteria | 1905 |
| 1007 | Ga0495611_0077511 | 3300046648 | Bacteria | 1524 |
| 1008 | Ga0495625_0114002 | 3300046660 | Bacteria | 1845 |
| 1009 | Ga0495625_0118548 | 3300046660 | Bacteria | 1803 |
| 1010 | Ga0495625_0174850 | 3300046660 | Bacteria | 1431 |
| 1011 | Ga0495635_0001496 | 3300046663 | Bacteria | 15658 |
| 1012 | Ga0495635_0005568 | 3300046663 | Bacteria | 8766 |
| 1013 | Ga0495635_0010556 | 3300046663 | Bacteria | 6466 |
| 1014 | Ga0495635_0030771 | 3300046663 | Bacteria | 3728 |
| 1015 | Ga0495635_0069381 | 3300046663 | Bacteria | 2416 |
| 1016 | Ga0495659_0037345 | 3300046664 | Bacteria | 1720 |
| 1017 | Ga0495661_0046229 | 3300046665 | Bacteria | 2659 |
| 1018 | Ga0495661_0113893 | 3300046665 | Bacteria | 1504 |
| 1019 | Ga0495661_0117935 | 3300046665 | Bacteria | 1470 |
| 1020 | Ga0495588_0005658 | 3300046674 | Bacteria | 5573 |
| 1021 | Ga0495588_0013711 | 3300046674 | Bacteria | 3865 |
| 1022 | Ga0495588_0080933 | 3300046674 | Bacteria | 1695 |
| 1023 | Ga0495657_0031437 | 3300046675 | Bacteria | 3711 |
| 1024 | Ga0495657_0037019 | 3300046675 | Bacteria | 3366 |
| 1025 | Ga0495599_0003798 | 3300046678 | Bacteria | 8867 |
| 1026 | Ga0495599_0013813 | 3300046678 | Bacteria | 4996 |
| 1027 | Ga0495599_0045639 | 3300046678 | Bacteria | 2748 |
| 1028 | Ga0495623_0005956 | 3300046679 | Bacteria | 7943 |
| 1029 | Ga0495623_0017851 | 3300046679 | Bacteria | 4582 |
| 1030 | Ga0495623_0085831 | 3300046679 | Bacteria | 1941 |
| 1031 | Ga0495646_0003838 | 3300046680 | Bacteria | 9391 |
| 1032 | Ga0495646_0008942 | 3300046680 | Bacteria | 6360 |
| 1033 | Ga0495647_0015228 | 3300046681 | Bacteria | 2691 |
| 1034 | Ga0495658_0000683 | 3300046683 | Bacteria | 18348 |
| 1035 | Ga0495658_0025843 | 3300046683 | Bacteria | 3142 |
| 1036 | Ga0495658_0028915 | 3300046683 | Bacteria | 2995 |
| 1037 | Ga0495669_0012768 | 3300046684 | Bacteria | 3575 |
| 1038 | Ga0495613_0037705 | 3300046689 | Bacteria | 3583 |
| 1039 | Ga0495613_0039134 | 3300046689 | Bacteria | 3515 |
| 1040 | Ga0495613_0083699 | 3300046689 | Bacteria | 2317 |
| 1041 | Ga0495613_0085961 | 3300046689 | Bacteria | 2281 |
| 1042 | Ga0495624_0006443 | 3300046690 | Bacteria | 8330 |
| 1043 | Ga0495624_0007443 | 3300046690 | Bacteria | 7685 |
| 1044 | Ga0495624_0012108 | 3300046690 | Bacteria | 5906 |
| 1045 | Ga0495671_0041331 | 3300046692 | Bacteria | 2322 |
| 1046 | Ga0495589_0071687 | 3300046794 | Bacteria | 1693 |
| 1047 | Ga0495600_0009105 | 3300046809 | Bacteria | 6122 |
| 1048 | Ga0495600_0020623 | 3300046809 | Bacteria | 4214 |
| 1049 | Ga0495600_0035649 | 3300046809 | Bacteria | 3233 |
| 1050 | Ga0495581_0000072 | 3300047315 | Bacteria | 39847 |
| 1051 | Ga0495581_0000139 | 3300047315 | Bacteria | 31769 |
| 1052 | Ga0495581_0010811 | 3300047315 | Bacteria | 5277 |
| 1053 | Ga0495581_0042718 | 3300047315 | Bacteria | 2623 |
| 1054 | Ga0495581_0064765 | 3300047315 | Bacteria | 2112 |
| 1055 | Ga0495604_0009620 | 3300047317 | Bacteria | 7645 |
| 1056 | Ga0495604_0039436 | 3300047317 | Bacteria | 3712 |
| 1057 | Ga0495604_0137177 | 3300047317 | Bacteria | 1752 |
| 1058 | Ga0495674_0000523 | 3300047319 | Bacteria | 35299 |
| 1059 | Ga0495674_0005593 | 3300047319 | Bacteria | 12048 |
| 1060 | Ga0495674_0008405 | 3300047319 | Bacteria | 9835 |
| 1061 | Ga0495674_0168013 | 3300047319 | Bacteria | 1832 |
| 1062 | Ga0495672_0016998 | 3300047320 | Bacteria | 4874 |
| 1063 | Ga0495676_0027504 | 3300047321 | Bacteria | 4874 |
| 1064 | Ga0495676_0040171 | 3300047321 | Bacteria | 3864 |
| 1065 | Ga0495676_0045413 | 3300047321 | Bacteria | 3576 |
| 1066 | Ga0495680_0013168 | 3300047322 | Bacteria | 7227 |
| 1067 | Ga0495680_0013969 | 3300047322 | Bacteria | 6980 |
| 1068 | Ga0495680_0031385 | 3300047322 | Bacteria | 4326 |
| 1069 | Ga0495680_0048590 | 3300047322 | Bacteria | 3331 |
| 1070 | Ga0495680_0109442 | 3300047322 | Bacteria | 2049 |
| 1071 | Ga0495675_0004139 | 3300047444 | Bacteria | 8780 |
| 1072 | Ga0495677_0032176 | 3300047445 | Bacteria | 1910 |
| 1073 | Ga0495673_0008685 | 3300047469 | Bacteria | 5681 |
| 1074 | Ga0495673_0038332 | 3300047469 | Bacteria | 2181 |
| 1075 | Ga0495673_0064470 | 3300047469 | Bacteria | 1558 |
| 1076 | Ga0495684_0000202 | 3300047471 | Bacteria | 45900 |
| 1077 | Ga0495684_0028162 | 3300047471 | Bacteria | 4315 |
| 1078 | Ga0495593_0000042 | 3300047673 | Bacteria | 51536 |
| 1079 | Ga0495593_0000094 | 3300047673 | Bacteria | 39807 |
| 1080 | Ga0495593_0012536 | 3300047673 | Bacteria | 4844 |
| 1081 | Ga0495602_0007342 | 3300048088 | Bacteria | 11539 |
| 1082 | Ga0495602_0091777 | 3300048088 | Bacteria | 2517 |
| 1083 | Ga0495614_0021380 | 3300048089 | Bacteria | 2794 |
| 1084 | Ga0495615_0022019 | 3300048090 | Bacteria | 1444 |
| 1085 | Ga0496100_0019519 | 3300048903 | Bacteria | 4046 |
| 1086 | Ga0496100_0029167 | 3300048903 | Bacteria | 3411 |
| 1087 | Ga0496100_0111092 | 3300048903 | Bacteria | 1904 |
| 1088 | Ga0496100_0184850 | 3300048903 | Bacteria | 1509 |
| 1089 | Ga0496101_0002175 | 3300048904 | Bacteria | 11962 |
| 1090 | Ga0496101_0019246 | 3300048904 | Bacteria | 4659 |
| 1091 | Ga0496101_0022549 | 3300048904 | Bacteria | 4336 |
| 1092 | Ga0496101_0077398 | 3300048904 | Bacteria | 2451 |
| 1093 | Ga0496101_0094017 | 3300048904 | Bacteria | 2234 |
| 1094 | Ga0496101_0230843 | 3300048904 | Bacteria | 1438 |
| 1095 | Ga0496102_0006629 | 3300048905 | Bacteria | 9896 |
| 1096 | Ga0496102_0007550 | 3300048905 | Bacteria | 9296 |
| 1097 | Ga0496102_0008862 | 3300048905 | Bacteria | 8634 |
| 1098 | Ga0496102_0029492 | 3300048905 | Bacteria | 4909 |
| 1099 | Ga0496102_0031856 | 3300048905 | Bacteria | 4733 |
| 1100 | Ga0496102_0039989 | 3300048905 | Bacteria | 4240 |
| 1101 | Ga0496102_0051093 | 3300048905 | Bacteria | 3766 |
| 1102 | Ga0496102_0089138 | 3300048905 | Bacteria | 2853 |
| 1103 | Ga0496102_0157699 | 3300048905 | Bacteria | 2134 |
| 1104 | Ga0496102_0175760 | 3300048905 | Bacteria | 2016 |
| 1105 | Ga0496102_0185476 | 3300048905 | Bacteria | 1961 |
| 1106 | Ga0496102_0213020 | 3300048905 | Bacteria | 1821 |
| 1107 | Ga0496103_0002556 | 3300048906 | Bacteria | 11401 |
| 1108 | Ga0496103_0010340 | 3300048906 | Bacteria | 5522 |
| 1109 | Ga0496103_0021662 | 3300048906 | Bacteria | 3868 |
| 1110 | Ga0496103_0043433 | 3300048906 | Bacteria | 2767 |
| 1111 | Ga0496103_0044178 | 3300048906 | Bacteria | 2745 |
| 1112 | Ga0496103_0116851 | 3300048906 | Bacteria | 1697 |
| 1113 | Ga0496104_0000253 | 3300048907 | Bacteria | 47525 |
| 1114 | Ga0496104_0001610 | 3300048907 | Bacteria | 19457 |
| 1115 | Ga0496104_0003135 | 3300048907 | Bacteria | 14260 |
| 1116 | Ga0496104_0003222 | 3300048907 | Bacteria | 14044 |
| 1117 | Ga0496104_0005489 | 3300048907 | Bacteria | 11106 |
| 1118 | Ga0496104_0027004 | 3300048907 | Bacteria | 5308 |
| 1119 | Ga0496104_0028169 | 3300048907 | Bacteria | 5206 |
| 1120 | Ga0496104_0037046 | 3300048907 | Bacteria | 4561 |
| 1121 | Ga0496104_0072608 | 3300048907 | Bacteria | 3272 |
| 1122 | Ga0496104_0097007 | 3300048907 | Bacteria | 2821 |
| 1123 | Ga0496104_0102705 | 3300048907 | Bacteria | 2738 |
| 1124 | Ga0496104_0106906 | 3300048907 | Bacteria | 2681 |
| 1125 | Ga0496104_0157241 | 3300048907 | Bacteria | 2181 |
| 1126 | Ga0496105_0001092 | 3300048908 | Bacteria | 18817 |
| 1127 | Ga0496105_0017241 | 3300048908 | Bacteria | 5786 |
| 1128 | Ga0496105_0040423 | 3300048908 | Bacteria | 3845 |
| 1129 | Ga0496105_0070980 | 3300048908 | Bacteria | 2879 |
| 1130 | Ga0496105_0071136 | 3300048908 | Bacteria | 2875 |
| 1131 | Ga0496105_0168430 | 3300048908 | Bacteria | 1796 |
| 1132 | Ga0496106_0000132 | 3300048909 | Bacteria | 56128 |
| 1133 | Ga0496106_0019127 | 3300048909 | Bacteria | 5077 |
| 1134 | Ga0496106_0021998 | 3300048909 | Bacteria | 4737 |
| 1135 | Ga0496106_0033130 | 3300048909 | Bacteria | 3854 |
| 1136 | Ga0496106_0037139 | 3300048909 | Bacteria | 3644 |
| 1137 | Ga0496106_0045531 | 3300048909 | Bacteria | 3295 |
| 1138 | Ga0496106_0070421 | 3300048909 | Bacteria | 2671 |
| 1139 | Ga0496106_0079272 | 3300048909 | Bacteria | 2521 |
| 1140 | Ga0496106_0119957 | 3300048909 | Bacteria | 2055 |
| 1141 | Ga0496107_0002892 | 3300048910 | Bacteria | 11349 |
| 1142 | Ga0496107_0018264 | 3300048910 | Bacteria | 4936 |
| 1143 | Ga0496107_0064733 | 3300048910 | Bacteria | 2650 |
| 1144 | Ga0496107_0122515 | 3300048910 | Bacteria | 1916 |
| 1145 | Ga0496108_0004593 | 3300048911 | Bacteria | 11119 |
| 1146 | Ga0496108_0006355 | 3300048911 | Bacteria | 9579 |
| 1147 | Ga0496108_0022087 | 3300048911 | Bacteria | 5231 |
| 1148 | Ga0496108_0022585 | 3300048911 | Bacteria | 5173 |
| 1149 | Ga0496108_0023873 | 3300048911 | Bacteria | 5034 |
| 1150 | Ga0496108_0045130 | 3300048911 | Bacteria | 3680 |
| 1151 | Ga0496108_0055852 | 3300048911 | Bacteria | 3316 |
| 1152 | Ga0496108_0132783 | 3300048911 | Bacteria | 2140 |
| 1153 | Ga0496108_0192153 | 3300048911 | Bacteria | 1769 |
| 1154 | Ga0496109_0000673 | 3300048912 | Bacteria | 28328 |
| 1155 | Ga0496109_0001562 | 3300048912 | Bacteria | 19079 |
| 1156 | Ga0496109_0014967 | 3300048912 | Bacteria | 6752 |
| 1157 | Ga0496109_0026829 | 3300048912 | Bacteria | 5138 |
| 1158 | Ga0496109_0040874 | 3300048912 | Bacteria | 4201 |
| 1159 | Ga0496109_0041345 | 3300048912 | Bacteria | 4175 |
| 1160 | Ga0496109_0054017 | 3300048912 | Bacteria | 3666 |
| 1161 | Ga0496109_0067710 | 3300048912 | Bacteria | 3272 |
| 1162 | Ga0496109_0107846 | 3300048912 | Bacteria | 2588 |
| 1163 | Ga0496109_0113482 | 3300048912 | Bacteria | 2520 |
| 1164 | Ga0496109_0131890 | 3300048912 | Bacteria | 2332 |
| 1165 | Ga0496109_0132733 | 3300048912 | Bacteria | 2325 |
| 1166 | Ga0496110_0003034 | 3300048913 | Bacteria | 12736 |
| 1167 | Ga0496110_0005312 | 3300048913 | Bacteria | 10085 |
| 1168 | Ga0496110_0007058 | 3300048913 | Bacteria | 8939 |
| 1169 | Ga0496110_0045039 | 3300048913 | Bacteria | 3854 |
| 1170 | Ga0496110_0053222 | 3300048913 | Bacteria | 3558 |
| 1171 | Ga0496110_0064167 | 3300048913 | Bacteria | 3245 |
| 1172 | Ga0496110_0088340 | 3300048913 | Bacteria | 2768 |
| 1173 | Ga0496110_0108320 | 3300048913 | Bacteria | 2494 |
| 1174 | Ga0496111_0000369 | 3300048914 | Bacteria | 22401 |
| 1175 | Ga0496111_0002538 | 3300048914 | Bacteria | 11024 |
| 1176 | Ga0496111_0004419 | 3300048914 | Bacteria | 8888 |
| 1177 | Ga0496111_0036571 | 3300048914 | Bacteria | 3511 |
| 1178 | Ga0496111_0042527 | 3300048914 | Bacteria | 3263 |
| 1179 | Ga0496111_0051182 | 3300048914 | Bacteria | 2982 |
| 1180 | Ga0496111_0072913 | 3300048914 | Bacteria | 2500 |
| 1181 | Ga0496111_0078870 | 3300048914 | Bacteria | 2402 |
| 1182 | Ga0496111_0171805 | 3300048914 | Bacteria | 1610 |
| 1183 | Ga0496111_0225133 | 3300048914 | Bacteria | 1393 |
| 1184 | Ga0496112_0005306 | 3300048915 | Bacteria | 11120 |
| 1185 | Ga0496112_0005651 | 3300048915 | Bacteria | 10856 |
| 1186 | Ga0496112_0013677 | 3300048915 | Bacteria | 7499 |
| 1187 | Ga0496112_0021205 | 3300048915 | Bacteria | 6175 |
| 1188 | Ga0496112_0024768 | 3300048915 | Bacteria | 5754 |
| 1189 | Ga0496112_0037584 | 3300048915 | Bacteria | 4725 |
| 1190 | Ga0496112_0048864 | 3300048915 | Bacteria | 4145 |
| 1191 | Ga0496112_0056255 | 3300048915 | Bacteria | 3871 |
| 1192 | Ga0496112_0056266 | 3300048915 | Bacteria | 3870 |
| 1193 | Ga0496112_0156945 | 3300048915 | Bacteria | 2242 |
| 1194 | Ga0496112_0191752 | 3300048915 | Bacteria | 2005 |
| 1195 | Ga0496112_0199172 | 3300048915 | Bacteria | 1962 |
| 1196 | Ga0496113_0000751 | 3300048916 | Bacteria | 16685 |
| 1197 | Ga0496113_0000917 | 3300048916 | Bacteria | 15578 |
| 1198 | Ga0496113_0003021 | 3300048916 | Bacteria | 9970 |
| 1199 | Ga0496113_0009451 | 3300048916 | Bacteria | 6397 |
| 1200 | Ga0496113_0015707 | 3300048916 | Bacteria | 5214 |
| 1201 | Ga0496113_0035751 | 3300048916 | Bacteria | 3635 |
| 1202 | Ga0496113_0045124 | 3300048916 | Bacteria | 3267 |
| 1203 | Ga0496113_0051573 | 3300048916 | Bacteria | 3071 |
| 1204 | Ga0496113_0057975 | 3300048916 | Bacteria | 2913 |
| 1205 | Ga0496114_0078870 | 3300048917 | Bacteria | 2778 |
| 1206 | Ga0496114_0205568 | 3300048917 | Bacteria | 1726 |
| 1207 | Ga0496114_0282317 | 3300048917 | Bacteria | 1464 |
| 1208 | Ga0496115_0009889 | 3300048918 | Bacteria | 7102 |
| 1209 | Ga0496115_0010748 | 3300048918 | Bacteria | 6846 |
| 1210 | Ga0496115_0017648 | 3300048918 | Bacteria | 5463 |
| 1211 | Ga0496115_0017758 | 3300048918 | Bacteria | 5446 |
| 1212 | Ga0496115_0018758 | 3300048918 | Bacteria | 5317 |
| 1213 | Ga0496115_0046941 | 3300048918 | Bacteria | 3453 |
| 1214 | Ga0496115_0196223 | 3300048918 | Bacteria | 1668 |
| 1215 | Ga0496116_0026312 | 3300048919 | Bacteria | 4259 |
| 1216 | Ga0496116_0054972 | 3300048919 | Bacteria | 2618 |
| 1217 | Ga0496117_0076731 | 3300048920 | Bacteria | 2214 |
| 1218 | Ga0496117_0115943 | 3300048920 | Bacteria | 1657 |
| 1219 | Ga0496118_0021212 | 3300048921 | Bacteria | 5727 |
| 1220 | Ga0496118_0067476 | 3300048921 | Bacteria | 2604 |
| 1221 | Ga0496119_0038742 | 3300048922 | Bacteria | 3075 |
| 1222 | Ga0496119_0055346 | 3300048922 | Bacteria | 2410 |
| 1223 | Ga0496120_0054003 | 3300048923 | Bacteria | 2280 |
| 1224 | Ga0496121_0026727 | 3300048924 | Bacteria | 5424 |
| 1225 | Ga0496121_0044704 | 3300048924 | Bacteria | 3815 |
| 1226 | Ga0496121_0059454 | 3300048924 | Bacteria | 3151 |
| 1227 | Ga0496121_0093115 | 3300048924 | Bacteria | 2347 |
| 1228 | Ga0496122_0016224 | 3300048925 | Bacteria | 7070 |
| 1229 | Ga0496124_0017261 | 3300048927 | Bacteria | 6808 |
| 1230 | Ga0496124_0089563 | 3300048927 | Bacteria | 2512 |
| 1231 | Ga0496125_0007099 | 3300048928 | Bacteria | 11960 |
| 1232 | Ga0496126_0010793 | 3300048929 | Bacteria | 9535 |
| 1233 | Ga0496126_0016460 | 3300048929 | Bacteria | 7393 |
| 1234 | Ga0496126_0046793 | 3300048929 | Bacteria | 3964 |
| 1235 | Ga0496126_0059880 | 3300048929 | Bacteria | 3428 |
| 1236 | Ga0496126_0065227 | 3300048929 | Bacteria | 3259 |
| 1237 | Ga0496126_0094303 | 3300048929 | Bacteria | 2627 |
| 1238 | Ga0496126_0129303 | 3300048929 | Bacteria | 2184 |
| 1239 | Ga0496126_0153909 | 3300048929 | Bacteria | 1969 |
| 1240 | Ga0501031_0004827 | 3300049568 | Bacteria | 8760 |
| 1241 | Ga0501032_0000054 | 3300049569 | Bacteria | 100621 |
| 1242 | Ga0501033_0000025 | 3300049570 | Bacteria | 173634 |
| 1243 | Ga0501034_0000177 | 3300049571 | Bacteria | 118966 |
| 1244 | Ga0501034_0004577 | 3300049571 | Bacteria | 15321 |
| 1245 | Ga0501034_0034959 | 3300049571 | Bacteria | 5096 |
| 1246 | Ga0501034_0042095 | 3300049571 | Bacteria | 4623 |
| 1247 | Ga0501034_0052306 | 3300049571 | Bacteria | 4115 |
| 1248 | Ga0501036_0000025 | 3300049572 | Bacteria | 106029 |
| 1249 | Ga0501036_0264380 | 3300049572 | Bacteria | 1441 |
| 1250 | Ga0501037_0000169 | 3300049573 | Bacteria | 61447 |
| 1251 | Ga0501038_0000029 | 3300049574 | Bacteria | 132861 |
| 1252 | Ga0501039_0000441 | 3300049575 | Bacteria | 30082 |
| 1253 | Ga0501039_0050696 | 3300049575 | Bacteria | 3212 |
| 1254 | Ga0501039_0243457 | 3300049575 | Bacteria | 1414 |
| 1255 | Ga0501043_0000067 | 3300049579 | Bacteria | 93232 |
| 1256 | Ga0501043_0217472 | 3300049579 | Bacteria | 1479 |
| 1257 | Ga0501046_0000556 | 3300049580 | Bacteria | 37044 |
| 1258 | Ga0501046_0133634 | 3300049580 | Bacteria | 1880 |
| 1259 | Ga0501047_0000061 | 3300049581 | Bacteria | 137341 |
| 1260 | Ga0501048_0000081 | 3300049582 | Bacteria | 49755 |
| 1261 | Ga0501067_0000337 | 3300049583 | Bacteria | 25535 |
| 1262 | Ga0501068_0001209 | 3300049584 | Bacteria | 13725 |
| 1263 | Ga0501069_0054953 | 3300049585 | Bacteria | 2217 |
| 1264 | Ga0501070_0004162 | 3300049586 | Bacteria | 12445 |
| 1265 | Ga0501070_0216517 | 3300049586 | Bacteria | 1571 |
| 1266 | Ga0501072_0024951 | 3300049588 | Bacteria | 4654 |
| 1267 | Ga0501074_0001483 | 3300049590 | Bacteria | 15785 |
| 1268 | Ga0501074_0056491 | 3300049590 | Bacteria | 2829 |
| 1269 | Ga0501076_0073707 | 3300049592 | Bacteria | 2734 |
| 1270 | Ga0501077_0048866 | 3300049593 | Bacteria | 2689 |
| 1271 | Ga0501079_0023853 | 3300049741 | Bacteria | 4694 |
| 1272 | Ga0501079_0070716 | 3300049741 | Bacteria | 2695 |
| 1273 | Ga0501079_0080081 | 3300049741 | Bacteria | 2525 |
| 1274 | Ga0501079_0114875 | 3300049741 | Bacteria | 2092 |
| 1275 | Ga0501080_0000786 | 3300049742 | Bacteria | 25861 |
| 1276 | Ga0501080_0109118 | 3300049742 | Bacteria | 2565 |
| 1277 | Ga0501080_0287126 | 3300049742 | Bacteria | 1495 |
| 1278 | Ga0501080_0323418 | 3300049742 | Bacteria | 1396 |
| 1279 | Ga0501081_0024624 | 3300049743 | Bacteria | 4043 |
| 1280 | Ga0501083_0007657 | 3300049744 | Bacteria | 7657 |
| 1281 | Ga0501083_0013787 | 3300049744 | Bacteria | 5650 |
| 1282 | Ga0501083_0082828 | 3300049744 | Bacteria | 2125 |
| 1283 | Ga0501035_0002419 | 3300049822 | Bacteria | 18259 |
| 1284 | Ga0501044_0000028 | 3300049823 | Bacteria | 179203 |
| 1285 | Ga0501044_0007082 | 3300049823 | Bacteria | 12344 |
| 1286 | Ga0501044_0108614 | 3300049823 | Bacteria | 2784 |
| 1287 | Ga0501045_0019197 | 3300049824 | Bacteria | 4870 |
| 1288 | Ga0501045_0032880 | 3300049824 | Bacteria | 3760 |
| 1289 | Ga0501045_0064794 | 3300049824 | Bacteria | 2683 |
| 1290 | nmdc:mga03683_9878_c1 | 3300050489 | Bacteria | 3408 |
| 1291 | nmdc:mga03n38_11146_c1 | 3300050490 | Bacteria | 3339 |
| 1292 | nmdc:mga03n38_695_c1 | 3300050490 | Bacteria | 8798 |
| 1293 | nmdc:mga00v17_16623_c1 | 3300050491 | Bacteria | 4148 |
| 1294 | nmdc:mga00v17_38636_c1 | 3300050491 | Bacteria | 2855 |
| 1295 | nmdc:mga0yw44_39798_c1 | 3300050492 | Bacteria | 2790 |
| 1296 | nmdc:mga0yw44_44903_c1 | 3300050492 | Bacteria | 2646 |
| 1297 | nmdc:mga0yw44_51127_c1 | 3300050492 | Bacteria | 2501 |
| 1298 | nmdc:mga0k408_114707_c1 | 3300050493 | Bacteria | 1593 |
| 1299 | nmdc:mga0k408_86760_c1 | 3300050493 | Bacteria | 1837 |
| 1300 | nmdc:mga06z11_1539_c1 | 3300050494 | Bacteria | 8561 |
| 1301 | nmdc:mga06z11_20021_c1 | 3300050494 | Bacteria | 3087 |
| 1302 | nmdc:mga06z11_2007_c1 | 3300050494 | Bacteria | 7706 |
| 1303 | nmdc:mga06z11_28038_c1 | 3300050494 | Bacteria | 2698 |
| 1304 | nmdc:mga06z11_29770_c1 | 3300050494 | Bacteria | 2634 |
| 1305 | nmdc:mga06z11_4599_c1 | 3300050494 | Bacteria | 5440 |
| 1306 | nmdc:mga06z11_53640_c1 | 3300050494 | Bacteria | 2074 |
| 1307 | nmdc:mga04h51_470_c1 | 3300050495 | Bacteria | 9683 |
| 1308 | nmdc:mga04h51_9004_c1 | 3300050495 | Bacteria | 2689 |
| 1309 | nmdc:mga07m45_78580_c1 | 3300050496 | Bacteria | 1883 |
| 1310 | nmdc:mga05p37_124276_c1 | 3300050507 | Bacteria | 3169 |
| 1311 | nmdc:mga05p37_138839_c1 | 3300050507 | Bacteria | 2978 |
| 1312 | nmdc:mga05p37_144619_c1 | 3300050507 | Bacteria | 2912 |
| 1313 | nmdc:mga05p37_166167_c1 | 3300050507 | Bacteria | 2693 |
| 1314 | nmdc:mga05p37_22011_c1 | 3300050507 | Bacteria | 7724 |
| 1315 | nmdc:mga05p37_223_c1 | 3300050507 | Bacteria | 57418 |
| 1316 | nmdc:mga05p37_23412_c1 | 3300050507 | Bacteria | 7493 |
| 1317 | nmdc:mga05p37_30636_c1 | 3300050507 | Bacteria | 6564 |
| 1318 | nmdc:mga05p37_98984_c1 | 3300050507 | Bacteria | 3592 |
| 1319 | nmdc:mga09592_227968_c1 | 3300050508 | Bacteria | 1614 |
| 1320 | nmdc:mga09592_9689_c1 | 3300050508 | Bacteria | 7827 |
| 1321 | nmdc:mga0qj67_170788_c1 | 3300050509 | Bacteria | 1765 |
| 1322 | nmdc:mga0qj67_92773_c1 | 3300050509 | Bacteria | 2428 |
| 1323 | nmdc:mga06r32_13798_c1 | 3300050510 | Bacteria | 7329 |
| 1324 | nmdc:mga06r32_186_c1 | 3300050510 | Bacteria | 49161 |
| 1325 | nmdc:mga06r32_24595_c1 | 3300050510 | Bacteria | 5593 |
| 1326 | nmdc:mga06r32_75770_c1 | 3300050510 | Bacteria | 3266 |
| 1327 | nmdc:mga08y16_157443_c1 | 3300050511 | Bacteria | 2361 |
| 1328 | nmdc:mga08y16_27939_c1 | 3300050511 | Bacteria | 5947 |
| 1329 | nmdc:mga08y16_287968_c1 | 3300050511 | Bacteria | 1694 |
| 1330 | nmdc:mga08y16_3000_c1 | 3300050511 | Bacteria | 17414 |
| 1331 | nmdc:mga08y16_322689_c1 | 3300050511 | Bacteria | 1589 |
| 1332 | nmdc:mga08y16_96821_c1 | 3300050511 | Bacteria | 3073 |
| 1333 | nmdc:mga0n895_127675_c1 | 3300050512 | Bacteria | 2567 |
| 1334 | nmdc:mga0n895_184131_c1 | 3300050512 | Bacteria | 2120 |
| 1335 | nmdc:mga0n895_26095_c1 | 3300050512 | Bacteria | 5528 |
| 1336 | nmdc:mga0n895_317314_c1 | 3300050512 | Bacteria | 1579 |
| 1337 | nmdc:mga0n895_4630_c1 | 3300050512 | Bacteria | 11342 |
| 1338 | nmdc:mga0n895_49140_c1 | 3300050512 | Bacteria | 4131 |
| 1339 | nmdc:mga0n895_90453_c1 | 3300050512 | Bacteria | 3062 |
| 1340 | nmdc:mga0n895_9754_c1 | 3300050512 | Bacteria | 8425 |
| 1341 | nmdc:mga0rr50_3143_c1 | 3300050513 | Bacteria | 9435 |
| 1342 | nmdc:mga0rr50_37091_c1 | 3300050513 | Bacteria | 3516 |
| 1343 | nmdc:mga0rr50_76664_c1 | 3300050513 | Bacteria | 2567 |
| 1344 | nmdc:mga08x19_10352_c1 | 3300050514 | Bacteria | 5598 |
| 1345 | nmdc:mga0a205_123281_c1 | 3300050515 | Bacteria | 2491 |
| 1346 | nmdc:mga0a205_141_c1 | 3300050515 | Bacteria | 45834 |
| 1347 | nmdc:mga0sz30_54497_c1 | 3300050516 | Bacteria | 1701 |
| 1348 | Ga0495601_0007154 | 3300053077 | Bacteria | 6543 |
| 1349 | Ga0495601_0007293 | 3300053077 | Bacteria | 6483 |
| 1350 | Ga0495601_0018011 | 3300053077 | Bacteria | 4293 |
| 1351 | Ga0495601_0065471 | 3300053077 | Bacteria | 2313 |
| 1352 | Ga0495601_0181048 | 3300053077 | Bacteria | 1378 |
| 1353 | Ga0495612_0001490 | 3300053078 | Bacteria | 9650 |
| 1354 | Ga0495612_0005916 | 3300053078 | Bacteria | 5043 |
| 1355 | Ga0495612_0008254 | 3300053078 | Bacteria | 4229 |
| 1356 | Ga0495595_0006424 | 3300053084 | Bacteria | 4794 |
| 1357 | Ga0495595_0006827 | 3300053084 | Bacteria | 4657 |
| 1358 | Ga0495619_0035265 | 3300053085 | Bacteria | 3253 |
| 1359 | Ga0495619_0044645 | 3300053085 | Bacteria | 2909 |
| 1360 | Ga0495619_0047977 | 3300053085 | Bacteria | 2813 |
| 1361 | Ga0500578_0064433 | 3300053086 | Bacteria | 2337 |
| 1362 | Ga0500578_0067858 | 3300053086 | Bacteria | 2274 |
| 1363 | Ga0500643_000056 | 3300053087 | Bacteria | 134839 |
| 1364 | Ga0500651_0037501 | 3300053093 | Bacteria | 3055 |
| 1365 | Ga0500566_0000031 | 3300053094 | Bacteria | 73906 |
| 1366 | Ga0500566_0000189 | 3300053094 | Bacteria | 31973 |
| 1367 | Ga0500640_008340 | 3300053095 | Bacteria | 4094 |
| 1368 | Ga0500641_0011622 | 3300053096 | Bacteria | 3199 |
| 1369 | Ga0500650_0089459 | 3300053098 | Bacteria | 1441 |
| 1370 | Ga0500555_000978 | 3300053103 | Bacteria | 9868 |
| 1371 | Ga0500556_0006746 | 3300053104 | Bacteria | 3264 |
| 1372 | Ga0500557_000002 | 3300053105 | Bacteria | 234207 |
| 1373 | Ga0500562_004486 | 3300053108 | Bacteria | 3529 |
| 1374 | Ga0500572_000108 | 3300053111 | Bacteria | 27424 |
| 1375 | Ga0500594_0014447 | 3300053118 | Bacteria | 1891 |
| 1376 | Ga0500595_000131 | 3300053119 | Bacteria | 49217 |
| 1377 | Ga0500595_007986 | 3300053119 | Bacteria | 4345 |
| 1378 | Ga0500614_004573 | 3300053123 | Bacteria | 2917 |
| 1379 | Ga0500642_0000266 | 3300053130 | Bacteria | 19551 |
| 1380 | Ga0500658_0024432 | 3300053134 | Bacteria | 2315 |
| 1381 | Ga0500559_0006373 | 3300053136 | Bacteria | 5328 |
| 1382 | Ga0500559_0038432 | 3300053136 | Bacteria | 2078 |
| 1383 | Ga0500568_0005900 | 3300053139 | Bacteria | 6235 |
| 1384 | Ga0500589_044942 | 3300053147 | Bacteria | 2057 |
| 1385 | Ga0500590_080985 | 3300053148 | Bacteria | 1594 |
| 1386 | Ga0500603_000160 | 3300053150 | Bacteria | 16710 |
| 1387 | Ga0500603_002161 | 3300053150 | Bacteria | 4341 |
| 1388 | Ga0500616_0006319 | 3300053153 | Bacteria | 7782 |
| 1389 | Ga0500619_028103 | 3300053154 | Bacteria | 1690 |
| 1390 | Ga0500622_0009192 | 3300053156 | Bacteria | 5485 |
| 1391 | Ga0500630_000427 | 3300053159 | Bacteria | 18148 |
| 1392 | Ga0500639_000008 | 3300053163 | Bacteria | 143238 |
| 1393 | Ga0500636_0000836 | 3300053177 | Bacteria | 16568 |
| 1394 | Ga0500637_0000086 | 3300053178 | Bacteria | 33336 |
| 1395 | Ga0500637_0000260 | 3300053178 | Bacteria | 19731 |
| 1396 | Ga0500637_0039628 | 3300053178 | Bacteria | 2658 |
| 1397 | Ga0500625_018517 | 3300053729 | Bacteria | 3263 |
| 1398 | Ga0500609_000673 | 3300053731 | Bacteria | 5186 |
| 1399 | Ga0500552_000522 | 3300053733 | Bacteria | 3575 |
| 1400 | Ga0500596_008474 | 3300053735 | Bacteria | 1637 |
| 1401 | Ga0500599_000229 | 3300053736 | Bacteria | 5282 |
| 1402 | Ga0500601_000566 | 3300053737 | Bacteria | 5405 |
| 1403 | Ga0501084_0014366 | 3300054114 | Bacteria | 6562 |
| 1404 | Ga0501084_0045573 | 3300054114 | Bacteria | 3672 |
| 1405 | Ga0501084_0203440 | 3300054114 | Bacteria | 1671 |
| 1406 | Ga0500661_000107 | 3300055283 | Bacteria | 13423 |
| 1407 | Ga0501082_0003510 | 3300060353 | Bacteria | 13687 |
| 1408 | Ga0501082_0013208 | 3300060353 | Bacteria | 7103 |
| 1409 | Ga0501082_0063979 | 3300060353 | Bacteria | 3167 |
| 1410 | Ga0501082_0073213 | 3300060353 | Bacteria | 2951 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035695 | Ga0373927_0107655 | Ga0373927_0107655_23_1246 | 387 |
| 2 | 3300009094 | Ga0111539_10149563 | Ga0111539_101495632 | 391 |
| 3 | 3300035207 | Ga0373942_0038396 | Ga0373942_0038396_83_1288 | 391 |
| 4 | 3300005439 | Ga0070711_100003919 | Ga0070711_1000039198 | 400 |
| 5 | 3300025916 | Ga0207663_10005348 | Ga0207663_100053484 | 400 |
| 6 | 3300053085 | Ga0495619_0044645 | Ga0495619_0044645_25_1239 | 400 |
| 7 | iso_pu_bacteria | 8016603502 | 8016610995 | 402 |
| 8 | 3300006186 | Ga0075369_10010929 | Ga0075369_100109293 | 403 |
| 9 | 3300006844 | Ga0075428_100104462 | Ga0075428_1001044622 | 404 |
| 10 | 3300006847 | Ga0075431_100007034 | Ga0075431_1000070346 | 404 |
| 11 | 3300009147 | Ga0114129_10027090 | Ga0114129_100270904 | 404 |
| 12 | 3300050507 | nmdc:mga05p37_22011_c1 | nmdc:mga05p37_22011_c1_1864_3195 | 404 |
| 13 | 3300050510 | nmdc:mga06r32_24595_c1 | nmdc:mga06r32_24595_c1_2777_4108 | 404 |
| 14 | 3300005347 | Ga0070668_100012418 | Ga0070668_1000124183 | 405 |
| 15 | 3300005355 | Ga0070671_100128026 | Ga0070671_1001280261 | 405 |
| 16 | 3300005435 | Ga0070714_100077233 | Ga0070714_1000772332 | 405 |
| 17 | 3300005459 | Ga0068867_100044726 | Ga0068867_1000447262 | 405 |
| 18 | 3300020078 | Ga0206352_10089368 | Ga0206352_100893681 | 405 |
| 19 | 3300021388 | Ga0213875_10003375 | Ga0213875_100033757 | 405 |
| 20 | 3300025931 | Ga0207644_10113384 | Ga0207644_101133842 | 405 |
| 21 | 3300026067 | Ga0207678_10032462 | Ga0207678_100324623 | 405 |
| 22 | 3300031730 | Ga0307516_10013317 | Ga0307516_100133178 | 405 |
| 23 | 3300037418 | Ga0395900_0170696 | Ga0395900_0170696_580_1911 | 405 |
| 24 | 3300037853 | Ga0436364_0936501 | Ga0436364_0936501_12913_14259 | 405 |
| 25 | 3300005330 | Ga0070690_100113925 | Ga0070690_1001139252 | 406 |
| 26 | 3300005356 | Ga0070674_100005092 | Ga0070674_1000050925 | 406 |
| 27 | 3300005364 | Ga0070673_100014280 | Ga0070673_1000142804 | 406 |
| 28 | 3300005456 | Ga0070678_100015679 | Ga0070678_1000156793 | 406 |
| 29 | 3300005457 | Ga0070662_100080877 | Ga0070662_1000808772 | 406 |
| 30 | 3300005545 | Ga0070695_100013475 | Ga0070695_1000134751 | 406 |
| 31 | 3300013297 | Ga0157378_10108945 | Ga0157378_101089452 | 406 |
| 32 | 3300021384 | Ga0213876_10018405 | Ga0213876_100184053 | 406 |
| 33 | 3300025926 | Ga0207659_10013140 | Ga0207659_100131402 | 406 |
| 34 | 3300025937 | Ga0207669_10001519 | Ga0207669_100015195 | 406 |
| 35 | 3300025940 | Ga0207691_10008519 | Ga0207691_100085196 | 406 |
| 36 | 3300025960 | Ga0207651_10070106 | Ga0207651_100701062 | 406 |
| 37 | 3300026121 | Ga0207683_10001401 | Ga0207683_1000140117 | 406 |
| 38 | 3300027907 | Ga0207428_10059247 | Ga0207428_100592472 | 406 |
| 39 | 3300039437 | Ga0436365_1894746 | Ga0436365_1894746_2288_3625 | 406 |
| 40 | 3300005614 | Ga0068856_100001981 | Ga0068856_10000198123 | 407 |
| 41 | 3300026078 | Ga0207702_10003615 | Ga0207702_1000361518 | 407 |
| 42 | 3300046455 | Ga0495603_0012503 | Ga0495603_0012503_1054_2514 | 407 |
| 43 | 3300003215 | JGI25153J46596_10002996 | JGI25153J46596_100029962 | 408 |
| 44 | 3300003354 | JGI25160J50197_1003045 | JGI25160J50197_10030457 | 408 |
| 45 | 3300005262 | Ga0065165_1008785 | Ga0065165_10087851 | 408 |
| 46 | 3300005334 | Ga0068869_100033410 | Ga0068869_1000334104 | 408 |
| 47 | 3300005338 | Ga0068868_100031098 | Ga0068868_1000310983 | 408 |
| 48 | 3300005530 | Ga0070679_100126412 | Ga0070679_1001264122 | 408 |
| 49 | 3300006051 | Ga0075364_10051980 | Ga0075364_100519803 | 408 |
| 50 | 3300006177 | Ga0075362_10023012 | Ga0075362_100230121 | 408 |
| 51 | 3300006353 | Ga0075370_10003411 | Ga0075370_100034116 | 408 |
| 52 | 3300006844 | Ga0075428_100190387 | Ga0075428_1001903871 | 408 |
| 53 | 3300021320 | Ga0214544_1000508 | Ga0214544_100050855 | 408 |
| 54 | 3300021321 | Ga0214542_1000365 | Ga0214542_100036555 | 408 |
| 55 | 3300021324 | Ga0214545_1000211 | Ga0214545_100021121 | 408 |
| 56 | 3300021327 | Ga0214543_1005667 | Ga0214543_100566716 | 408 |
| 57 | 3300025273 | Ga0209673_1019616 | Ga0209673_10196163 | 408 |
| 58 | 3300025295 | Ga0209564_1004787 | Ga0209564_10047877 | 408 |
| 59 | 3300025302 | Ga0207426_1000229 | Ga0207426_1000229111 | 408 |
| 60 | 3300025302 | Ga0207426_1027742 | Ga0207426_10277421 | 408 |
| 61 | 3300025304 | Ga0209257_1019215 | Ga0209257_10192152 | 408 |
| 62 | 3300025912 | Ga0207707_10023507 | Ga0207707_100235073 | 408 |
| 63 | 3300025913 | Ga0207695_10137601 | Ga0207695_101376012 | 408 |
| 64 | 3300025921 | Ga0207652_10059491 | Ga0207652_100594914 | 408 |
| 65 | 3300025942 | Ga0207689_10019702 | Ga0207689_100197024 | 408 |
| 66 | 3300026121 | Ga0207683_10102091 | Ga0207683_101020912 | 408 |
| 67 | 3300028379 | Ga0268266_10002192 | Ga0268266_1000219221 | 408 |
| 68 | 3300028380 | Ga0268265_10103498 | Ga0268265_101034981 | 408 |
| 69 | 3300031711 | Ga0265314_10031327 | Ga0265314_100313273 | 408 |
| 70 | 3300031852 | Ga0307410_10039451 | Ga0307410_100394512 | 408 |
| 71 | 3300031901 | Ga0307406_10074689 | Ga0307406_100746891 | 408 |
| 72 | 3300032002 | Ga0307416_100050158 | Ga0307416_1000501583 | 408 |
| 73 | 3300048922 | Ga0496119_0055346 | Ga0496119_0055346_355_1695 | 408 |
| 74 | 3300050492 | nmdc:mga0yw44_39798_c1 | nmdc:mga0yw44_39798_c1_204_1544 | 408 |
| 75 | 3300050492 | nmdc:mga0yw44_51127_c1 | nmdc:mga0yw44_51127_c1_516_1856 | 408 |
| 76 | 3300050494 | nmdc:mga06z11_29770_c1 | nmdc:mga06z11_29770_c1_1065_2405 | 408 |
| 77 | 3300053118 | Ga0500594_0014447 | Ga0500594_0014447_442_1782 | 408 |
| 78 | 3300053147 | Ga0500589_044942 | Ga0500589_044942_285_1625 | 408 |
| 79 | 3300005262 | Ga0065165_1003735 | Ga0065165_10037358 | 409 |
| 80 | 3300005338 | Ga0068868_100047016 | Ga0068868_1000470163 | 409 |
| 81 | 3300005347 | Ga0070668_100037529 | Ga0070668_1000375293 | 409 |
| 82 | 3300005366 | Ga0070659_100088432 | Ga0070659_1000884322 | 409 |
| 83 | 3300005435 | Ga0070714_100130127 | Ga0070714_1001301272 | 409 |
| 84 | 3300005466 | Ga0070685_10061590 | Ga0070685_100615902 | 409 |
| 85 | 3300005548 | Ga0070665_100011386 | Ga0070665_10001138611 | 409 |
| 86 | 3300005548 | Ga0070665_100014871 | Ga0070665_1000148715 | 409 |
| 87 | 3300005548 | Ga0070665_100047821 | Ga0070665_1000478213 | 409 |
| 88 | 3300005842 | Ga0068858_100019505 | Ga0068858_1000195055 | 409 |
| 89 | 3300005843 | Ga0068860_100032333 | Ga0068860_1000323331 | 409 |
| 90 | 3300006177 | Ga0075362_10006510 | Ga0075362_100065102 | 409 |
| 91 | 3300006186 | Ga0075369_10009219 | Ga0075369_100092192 | 409 |
| 92 | 3300009098 | Ga0105245_10090703 | Ga0105245_100907032 | 409 |
| 93 | 3300009101 | Ga0105247_10025765 | Ga0105247_100257652 | 409 |
| 94 | 3300009177 | Ga0105248_10071925 | Ga0105248_100719252 | 409 |
| 95 | 3300009553 | Ga0105249_10103934 | Ga0105249_101039342 | 409 |
| 96 | 3300013306 | Ga0163162_10170297 | Ga0163162_101702972 | 409 |
| 97 | 3300013308 | Ga0157375_10129401 | Ga0157375_101294012 | 409 |
| 98 | 3300013308 | Ga0157375_10174427 | Ga0157375_101744271 | 409 |
| 99 | 3300014326 | Ga0157380_10111370 | Ga0157380_101113702 | 409 |
| 100 | 3300014969 | Ga0157376_10075647 | Ga0157376_100756472 | 409 |
| 101 | 3300025302 | Ga0207426_1000607 | Ga0207426_10006078 | 409 |
| 102 | 3300025900 | Ga0207710_10017333 | Ga0207710_100173331 | 409 |
| 103 | 3300025931 | Ga0207644_10083229 | Ga0207644_100832292 | 409 |
| 104 | 3300025933 | Ga0207706_10037610 | Ga0207706_100376102 | 409 |
| 105 | 3300025939 | Ga0207665_10062480 | Ga0207665_100624801 | 409 |
| 106 | 3300025972 | Ga0207668_10013643 | Ga0207668_100136434 | 409 |
| 107 | 3300026035 | Ga0207703_10020084 | Ga0207703_100200843 | 409 |
| 108 | 3300026035 | Ga0207703_10154972 | Ga0207703_101549721 | 409 |
| 109 | 3300026041 | Ga0207639_10088570 | Ga0207639_100885701 | 409 |
| 110 | 3300026067 | Ga0207678_10021574 | Ga0207678_100215744 | 409 |
| 111 | 3300026088 | Ga0207641_10123067 | Ga0207641_101230671 | 409 |
| 112 | 3300026118 | Ga0207675_100229170 | Ga0207675_1002291701 | 409 |
| 113 | 3300028379 | Ga0268266_10000857 | Ga0268266_1000085711 | 409 |
| 114 | 3300028379 | Ga0268266_10052158 | Ga0268266_100521582 | 409 |
| 115 | 3300028380 | Ga0268265_10173959 | Ga0268265_101739593 | 409 |
| 116 | 3300039438 | Ga0436360_0472871 | Ga0436360_0472871_6625_7932 | 409 |
| 117 | 3300039447 | Ga0436361_0142586 | Ga0436361_0142586_193_1500 | 409 |
| 118 | 3300047315 | Ga0495581_0064765 | Ga0495581_0064765_322_1662 | 409 |
| 119 | 3300048905 | Ga0496102_0051093 | Ga0496102_0051093_195_1535 | 409 |
| 120 | 3300048909 | Ga0496106_0070421 | Ga0496106_0070421_204_1544 | 409 |
| 121 | 3300048914 | Ga0496111_0072913 | Ga0496111_0072913_307_1647 | 409 |
| 122 | 3300050512 | nmdc:mga0n895_184131_c1 | nmdc:mga0n895_184131_c1_297_1637 | 409 |
| 123 | 3300003215 | JGI25153J46596_10005350 | JGI25153J46596_100053507 | 410 |
| 124 | 3300005331 | Ga0070670_100272234 | Ga0070670_1002722341 | 410 |
| 125 | 3300005344 | Ga0070661_100028972 | Ga0070661_1000289723 | 410 |
| 126 | 3300005564 | Ga0070664_100026355 | Ga0070664_1000263553 | 410 |
| 127 | 3300005614 | Ga0068856_100017821 | Ga0068856_1000178218 | 410 |
| 128 | 3300005937 | Ga0081455_10009563 | Ga0081455_100095631 | 410 |
| 129 | 3300005981 | Ga0081538_10047966 | Ga0081538_100479662 | 410 |
| 130 | 3300005983 | Ga0081540_1001428 | Ga0081540_10014282 | 410 |
| 131 | 3300006871 | Ga0075434_100059695 | Ga0075434_1000596954 | 410 |
| 132 | 3300009093 | Ga0105240_10368367 | Ga0105240_103683672 | 410 |
| 133 | 3300009551 | Ga0105238_10026564 | Ga0105238_100265643 | 410 |
| 134 | 3300013105 | Ga0157369_10076551 | Ga0157369_100765514 | 410 |
| 135 | 3300020078 | Ga0206352_10222114 | Ga0206352_102221141 | 410 |
| 136 | 3300021441 | Ga0213871_10000047 | Ga0213871_100000473 | 410 |
| 137 | 3300025297 | Ga0209758_1002140 | Ga0209758_10021406 | 410 |
| 138 | 3300025901 | Ga0207688_10071261 | Ga0207688_100712612 | 410 |
| 139 | 3300025904 | Ga0207647_10082441 | Ga0207647_100824412 | 410 |
| 140 | 3300025914 | Ga0207671_10061734 | Ga0207671_100617342 | 410 |
| 141 | 3300025919 | Ga0207657_10130219 | Ga0207657_101302192 | 410 |
| 142 | 3300025924 | Ga0207694_10059445 | Ga0207694_100594452 | 410 |
| 143 | 3300025949 | Ga0207667_10047739 | Ga0207667_100477395 | 410 |
| 144 | 3300026041 | Ga0207639_10076440 | Ga0207639_100764402 | 410 |
| 145 | 3300026067 | Ga0207678_10088731 | Ga0207678_100887312 | 410 |
| 146 | 3300026067 | Ga0207678_10190721 | Ga0207678_101907212 | 410 |
| 147 | 3300031238 | Ga0265332_10004308 | Ga0265332_100043082 | 410 |
| 148 | 3300046452 | Ga0495617_003205 | Ga0495617_003205_4848_6188 | 410 |
| 149 | 3300046471 | Ga0495650_0051151 | Ga0495650_0051151_232_1638 | 410 |
| 150 | 3300046518 | Ga0495631_0012833 | Ga0495631_0012833_128_1468 | 410 |
| 151 | 3300046519 | Ga0495632_0035619 | Ga0495632_0035619_288_1694 | 410 |
| 152 | 3300046528 | Ga0495642_0056860 | Ga0495642_0056860_235_1575 | 410 |
| 153 | 3300046558 | Ga0495633_0029447 | Ga0495633_0029447_403_1743 | 410 |
| 154 | 3300046616 | Ga0495668_0092581 | Ga0495668_0092581_154_1494 | 410 |
| 155 | 3300046648 | Ga0495611_0048713 | Ga0495611_0048713_294_1700 | 410 |
| 156 | 3300046660 | Ga0495625_0118548 | Ga0495625_0118548_224_1564 | 410 |
| 157 | 3300046665 | Ga0495661_0117935 | Ga0495661_0117935_48_1454 | 410 |
| 158 | 3300048914 | Ga0496111_0078870 | Ga0496111_0078870_75_1307 | 410 |
| 159 | 3300048924 | Ga0496121_0093115 | Ga0496121_0093115_429_1769 | 410 |
| 160 | 3300003215 | JGI25153J46596_10000238 | JGI25153J46596_1000023820 | 411 |
| 161 | 3300003771 | Ga0055526_1020720 | Ga0055526_10207201 | 411 |
| 162 | 3300003794 | Ga0055531_10009794 | Ga0055531_100097943 | 411 |
| 163 | 3300003794 | Ga0055531_10012037 | Ga0055531_100120372 | 411 |
| 164 | 3300005536 | Ga0070697_100121297 | Ga0070697_1001212971 | 411 |
| 165 | 3300005985 | Ga0081539_10003922 | Ga0081539_1000392215 | 411 |
| 166 | 3300006943 | Ga0099822_1026245 | Ga0099822_10262451 | 411 |
| 167 | 3300021361 | Ga0213872_10037781 | Ga0213872_100377812 | 411 |
| 168 | 3300025253 | Ga0209677_104333 | Ga0209677_1043332 | 411 |
| 169 | 3300025261 | Ga0209233_1005978 | Ga0209233_10059784 | 411 |
| 170 | 3300025272 | Ga0209455_1007058 | Ga0209455_10070582 | 411 |
| 171 | 3300025297 | Ga0209758_1000021 | Ga0209758_1000021313 | 411 |
| 172 | 3300025299 | Ga0209256_1015513 | Ga0209256_10155131 | 411 |
| 173 | 3300025303 | Ga0209051_1037270 | Ga0209051_10372701 | 411 |
| 174 | 3300025304 | Ga0209257_1000838 | Ga0209257_100083817 | 411 |
| 175 | 3300025915 | Ga0207693_10160282 | Ga0207693_101602821 | 411 |
| 176 | 3300026078 | Ga0207702_10167631 | Ga0207702_101676311 | 411 |
| 177 | 3300027357 | Ga0209589_1000003 | Ga0209589_1000003282 | 411 |
| 178 | 3300027361 | Ga0209489_100003 | Ga0209489_100003333 | 411 |
| 179 | 3300027363 | Ga0209700_100003 | Ga0209700_100003333 | 411 |
| 180 | 3300031247 | Ga0265340_10015157 | Ga0265340_100151572 | 411 |
| 181 | 3300031712 | Ga0265342_10027525 | Ga0265342_100275254 | 411 |
| 182 | 3300037466 | Ga0395898_0002979 | Ga0395898_0002979_11939_13279 | 411 |
| 183 | 3300037471 | Ga0395905_0093671 | Ga0395905_0093671_925_2409 | 411 |
| 184 | 3300038443 | Ga0395901_0040271 | Ga0395901_0040271_1756_3096 | 411 |
| 185 | 3300039437 | Ga0436365_0156834 | Ga0436365_0156834_389_1729 | 411 |
| 186 | 3300044901 | Ga0466960_0020241 | Ga0466960_0020241_1502_2842 | 411 |
| 187 | 3300047317 | Ga0495604_0137177 | Ga0495604_0137177_233_1636 | 411 |
| 188 | 3300048903 | Ga0496100_0184850 | Ga0496100_0184850_138_1472 | 411 |
| 189 | 3300048925 | Ga0496122_0016224 | Ga0496122_0016224_1261_2601 | 411 |
| 190 | 3300049742 | Ga0501080_0287126 | Ga0501080_0287126_51_1385 | 411 |
| 191 | 3300003763 | Ga0055529_1006123 | Ga0055529_10061232 | 412 |
| 192 | 3300005262 | Ga0065165_1000394 | Ga0065165_100039449 | 412 |
| 193 | 3300005548 | Ga0070665_100049324 | Ga0070665_1000493245 | 412 |
| 194 | 3300006042 | Ga0075368_10008917 | Ga0075368_100089172 | 412 |
| 195 | 3300006051 | Ga0075364_10004859 | Ga0075364_100048593 | 412 |
| 196 | 3300006178 | Ga0075367_10018821 | Ga0075367_100188212 | 412 |
| 197 | 3300025253 | Ga0209677_102475 | Ga0209677_1024754 | 412 |
| 198 | 3300025254 | Ga0209148_1000616 | Ga0209148_100061623 | 412 |
| 199 | 3300025272 | Ga0209455_1000716 | Ga0209455_10007164 | 412 |
| 200 | 3300025915 | Ga0207693_10000612 | Ga0207693_100006122 | 412 |
| 201 | 3300028379 | Ga0268266_10020753 | Ga0268266_100207531 | 412 |
| 202 | 3300033180 | Ga0307510_10011576 | Ga0307510_100115769 | 412 |
| 203 | 3300035090 | Ga0373949_0017409 | Ga0373949_0017409_208_1548 | 412 |
| 204 | 3300037466 | Ga0395898_0228178 | Ga0395898_0228178_195_1535 | 412 |
| 205 | 3300050491 | nmdc:mga00v17_38636_c1 | nmdc:mga00v17_38636_c1_793_2130 | 412 |
| 206 | 3300050494 | nmdc:mga06z11_20021_c1 | nmdc:mga06z11_20021_c1_726_2063 | 412 |
| 207 | 3300050494 | nmdc:mga06z11_28038_c1 | nmdc:mga06z11_28038_c1_820_2157 | 412 |
| 208 | 3300003354 | JGI25160J50197_1001951 | JGI25160J50197_10019515 | 413 |
| 209 | 3300005539 | Ga0068853_100136854 | Ga0068853_1001368542 | 413 |
| 210 | 3300005577 | Ga0068857_100198595 | Ga0068857_1001985952 | 413 |
| 211 | 3300005983 | Ga0081540_1020770 | Ga0081540_10207704 | 413 |
| 212 | 3300006042 | Ga0075368_10001349 | Ga0075368_100013497 | 413 |
| 213 | 3300006178 | Ga0075367_10015063 | Ga0075367_100150635 | 413 |
| 214 | 3300006844 | Ga0075428_100001428 | Ga0075428_1000014287 | 413 |
| 215 | 3300006914 | Ga0075436_100022672 | Ga0075436_1000226724 | 413 |
| 216 | 3300006942 | Ga0099824_1013197 | Ga0099824_10131976 | 413 |
| 217 | 3300006943 | Ga0099822_1001406 | Ga0099822_100140612 | 413 |
| 218 | 3300007076 | Ga0075435_100064096 | Ga0075435_1000640965 | 413 |
| 219 | 3300009147 | Ga0114129_10048840 | Ga0114129_100488403 | 413 |
| 220 | 3300025302 | Ga0207426_1014733 | Ga0207426_10147332 | 413 |
| 221 | 3300025904 | Ga0207647_10035021 | Ga0207647_100350213 | 413 |
| 222 | 3300025912 | Ga0207707_10259397 | Ga0207707_102593971 | 413 |
| 223 | 3300026118 | Ga0207675_100040631 | Ga0207675_1000406315 | 413 |
| 224 | 3300027357 | Ga0209589_1000007 | Ga0209589_1000007254 | 413 |
| 225 | 3300027361 | Ga0209489_100008 | Ga0209489_100008254 | 413 |
| 226 | 3300027363 | Ga0209700_100009 | Ga0209700_100009254 | 413 |
| 227 | 3300027866 | Ga0209813_10000619 | Ga0209813_100006197 | 413 |
| 228 | 3300050490 | nmdc:mga03n38_695_c1 | nmdc:mga03n38_695_c1_3373_4680 | 413 |
| 229 | 3300050494 | nmdc:mga06z11_4599_c1 | nmdc:mga06z11_4599_c1_3646_4953 | 413 |
| 230 | 3300050495 | nmdc:mga04h51_470_c1 | nmdc:mga04h51_470_c1_6846_8153 | 413 |
| 231 | 3300050507 | nmdc:mga05p37_124276_c1 | nmdc:mga05p37_124276_c1_774_2114 | 413 |
| 232 | 3300050507 | nmdc:mga05p37_23412_c1 | nmdc:mga05p37_23412_c1_1432_2772 | 413 |
| 233 | 3300050509 | nmdc:mga0qj67_92773_c1 | nmdc:mga0qj67_92773_c1_477_1817 | 413 |
| 234 | 3300050510 | nmdc:mga06r32_13798_c1 | nmdc:mga06r32_13798_c1_4656_5996 | 413 |
| 235 | 3300053134 | Ga0500658_0024432 | Ga0500658_0024432_58_1398 | 413 |
| 236 | 3300003203 | JGI25406J46586_10018043 | JGI25406J46586_100180432 | 414 |
| 237 | 3300005843 | Ga0068860_100022514 | Ga0068860_1000225143 | 414 |
| 238 | 3300005985 | Ga0081539_10003922 | Ga0081539_1000392214 | 414 |
| 239 | 3300006847 | Ga0075431_100000132 | Ga0075431_10000013216 | 414 |
| 240 | 3300006847 | Ga0075431_100148314 | Ga0075431_1001483141 | 414 |
| 241 | 3300006880 | Ga0075429_100005605 | Ga0075429_1000056058 | 414 |
| 242 | 3300009094 | Ga0111539_10000933 | Ga0111539_100009339 | 414 |
| 243 | 3300009147 | Ga0114129_10000280 | Ga0114129_1000028016 | 414 |
| 244 | 3300025939 | Ga0207665_10139787 | Ga0207665_101397871 | 414 |
| 245 | 3300027671 | Ga0209588_1010758 | Ga0209588_10107582 | 414 |
| 246 | 3300027907 | Ga0207428_10003035 | Ga0207428_100030357 | 414 |
| 247 | 3300028381 | Ga0268264_10021446 | Ga0268264_100214464 | 414 |
| 248 | 3300039447 | Ga0436361_0488607 | Ga0436361_0488607_460_1800 | 414 |
| 249 | 3300046615 | Ga0495656_0056488 | Ga0495656_0056488_81_1421 | 414 |
| 250 | 3300048905 | Ga0496102_0157699 | Ga0496102_0157699_36_1376 | 414 |
| 251 | 3300048907 | Ga0496104_0005489 | Ga0496104_0005489_3502_4842 | 414 |
| 252 | 3300048907 | Ga0496104_0102705 | Ga0496104_0102705_1272_2579 | 414 |
| 253 | 3300048908 | Ga0496105_0017241 | Ga0496105_0017241_1447_2787 | 414 |
| 254 | 3300048911 | Ga0496108_0055852 | Ga0496108_0055852_1900_3240 | 414 |
| 255 | 3300048912 | Ga0496109_0001562 | Ga0496109_0001562_12496_13836 | 414 |
| 256 | 3300048913 | Ga0496110_0064167 | Ga0496110_0064167_1837_3177 | 414 |
| 257 | 3300048914 | Ga0496111_0002538 | Ga0496111_0002538_1673_3013 | 414 |
| 258 | 3300048915 | Ga0496112_0048864 | Ga0496112_0048864_2445_3785 | 414 |
| 259 | 3300048916 | Ga0496113_0000917 | Ga0496113_0000917_9545_10885 | 414 |
| 260 | 3300048918 | Ga0496115_0009889 | Ga0496115_0009889_1451_2791 | 414 |
| 261 | 3300049580 | Ga0501046_0133634 | Ga0501046_0133634_229_1629 | 414 |
| 262 | 3300049741 | Ga0501079_0114875 | Ga0501079_0114875_23_1423 | 414 |
| 263 | 3300049743 | Ga0501081_0024624 | Ga0501081_0024624_2331_3731 | 414 |
| 264 | 3300049824 | Ga0501045_0032880 | Ga0501045_0032880_2322_3722 | 414 |
| 265 | 3300050507 | nmdc:mga05p37_223_c1 | nmdc:mga05p37_223_c1_13828_15165 | 414 |
| 266 | 3300050508 | nmdc:mga09592_9689_c1 | nmdc:mga09592_9689_c1_5425_6762 | 414 |
| 267 | 3300050509 | nmdc:mga0qj67_170788_c1 | nmdc:mga0qj67_170788_c1_362_1693 | 414 |
| 268 | 3300050510 | nmdc:mga06r32_186_c1 | nmdc:mga06r32_186_c1_19280_20617 | 414 |
| 269 | 3300050511 | nmdc:mga08y16_3000_c1 | nmdc:mga08y16_3000_c1_8545_9882 | 414 |
| 270 | 3300053733 | Ga0500552_000522 | Ga0500552_000522_1470_2810 | 414 |
| 271 | 3300054114 | Ga0501084_0045573 | Ga0501084_0045573_1844_3244 | 414 |
| 272 | 3300060353 | Ga0501082_0073213 | Ga0501082_0073213_947_2347 | 414 |
| 273 | iso_pu_bacteria | 2524023210 | 2524470039 | 414 |
| 274 | 3300005354 | Ga0070675_100045128 | Ga0070675_1000451283 | 415 |
| 275 | 3300005364 | Ga0070673_100095817 | Ga0070673_1000958173 | 415 |
| 276 | 3300005535 | Ga0070684_100037495 | Ga0070684_1000374952 | 415 |
| 277 | 3300005548 | Ga0070665_100190207 | Ga0070665_1001902072 | 415 |
| 278 | 3300005549 | Ga0070704_100092017 | Ga0070704_1000920171 | 415 |
| 279 | 3300005617 | Ga0068859_100097252 | Ga0068859_1000972523 | 415 |
| 280 | 3300005841 | Ga0068863_100017655 | Ga0068863_1000176552 | 415 |
| 281 | 3300005842 | Ga0068858_100031077 | Ga0068858_1000310772 | 415 |
| 282 | 3300005844 | Ga0068862_100031277 | Ga0068862_1000312772 | 415 |
| 283 | 3300006237 | Ga0097621_100027617 | Ga0097621_1000276174 | 415 |
| 284 | 3300006358 | Ga0068871_100014804 | Ga0068871_1000148044 | 415 |
| 285 | 3300006847 | Ga0075431_100033979 | Ga0075431_1000339794 | 415 |
| 286 | 3300006931 | Ga0097620_100097255 | Ga0097620_1000972552 | 415 |
| 287 | 3300007265 | Ga0099794_10009900 | Ga0099794_100099004 | 415 |
| 288 | 3300009147 | Ga0114129_10040832 | Ga0114129_100408322 | 415 |
| 289 | 3300009177 | Ga0105248_10047411 | Ga0105248_100474114 | 415 |
| 290 | 3300013296 | Ga0157374_10351483 | Ga0157374_103514831 | 415 |
| 291 | 3300013307 | Ga0157372_10232848 | Ga0157372_102328482 | 415 |
| 292 | 3300014968 | Ga0157379_10081215 | Ga0157379_100812152 | 415 |
| 293 | 3300014969 | Ga0157376_10075006 | Ga0157376_100750061 | 415 |
| 294 | 3300025924 | Ga0207694_10069929 | Ga0207694_100699292 | 415 |
| 295 | 3300025942 | Ga0207689_10008628 | Ga0207689_100086285 | 415 |
| 296 | 3300025944 | Ga0207661_10010366 | Ga0207661_100103664 | 415 |
| 297 | 3300025945 | Ga0207679_10247033 | Ga0207679_102470331 | 415 |
| 298 | 3300048905 | Ga0496102_0185476 | Ga0496102_0185476_375_1724 | 415 |
| 299 | 3300050507 | nmdc:mga05p37_138839_c1 | nmdc:mga05p37_138839_c1_1476_2816 | 415 |
| 300 | 3300053096 | Ga0500641_0011622 | Ga0500641_0011622_994_2331 | 415 |
| 301 | 3300006852 | Ga0075433_10226729 | Ga0075433_102267291 | 416 |
| 302 | 3300006871 | Ga0075434_100015598 | Ga0075434_1000155988 | 416 |
| 303 | 3300028573 | Ga0265334_10023379 | Ga0265334_100233792 | 416 |
| 304 | 3300048914 | Ga0496111_0042527 | Ga0496111_0042527_153_1403 | 416 |
| 305 | 3300050512 | nmdc:mga0n895_90453_c1 | nmdc:mga0n895_90453_c1_408_1745 | 416 |
| 306 | 3300050512 | nmdc:mga0n895_9754_c1 | nmdc:mga0n895_9754_c1_2845_4185 | 416 |
| 307 | 3300050515 | nmdc:mga0a205_123281_c1 | nmdc:mga0a205_123281_c1_696_2033 | 416 |
| 308 | iso_pu_bacteria | 8019638758 | 8019644813 | 416 |
| 309 | 3300006871 | Ga0075434_100043871 | Ga0075434_1000438712 | 417 |
| 310 | 3300014325 | Ga0163163_10030770 | Ga0163163_100307704 | 417 |
| 311 | 3300025900 | Ga0207710_10023410 | Ga0207710_100234103 | 417 |
| 312 | 3300046648 | Ga0495611_0030727 | Ga0495611_0030727_1055_2347 | 417 |
| 313 | 3300046692 | Ga0495671_0041331 | Ga0495671_0041331_865_2157 | 417 |
| 314 | 3300047469 | Ga0495673_0038332 | Ga0495673_0038332_418_1710 | 417 |
| 315 | 3300048903 | Ga0496100_0019519 | Ga0496100_0019519_2692_3984 | 417 |
| 316 | 3300048904 | Ga0496101_0022549 | Ga0496101_0022549_2237_3529 | 417 |
| 317 | 3300048907 | Ga0496104_0028169 | Ga0496104_0028169_2658_3950 | 417 |
| 318 | 3300048908 | Ga0496105_0071136 | Ga0496105_0071136_1226_2518 | 417 |
| 319 | 3300048909 | Ga0496106_0021998 | Ga0496106_0021998_1885_3177 | 417 |
| 320 | 3300048910 | Ga0496107_0018264 | Ga0496107_0018264_918_2210 | 417 |
| 321 | 3300048916 | Ga0496113_0035751 | Ga0496113_0035751_1621_2913 | 417 |
| 322 | 3300048918 | Ga0496115_0018758 | Ga0496115_0018758_2915_4207 | 417 |
| 323 | 3300048919 | Ga0496116_0026312 | Ga0496116_0026312_949_2241 | 417 |
| 324 | 3300048921 | Ga0496118_0067476 | Ga0496118_0067476_1078_2370 | 417 |
| 325 | 3300048929 | Ga0496126_0010793 | Ga0496126_0010793_715_2055 | 417 |
| 326 | 3300048929 | Ga0496126_0065227 | Ga0496126_0065227_1370_2662 | 417 |
| 327 | 3300049590 | Ga0501074_0056491 | Ga0501074_0056491_503_1840 | 417 |
| 328 | 3300049741 | Ga0501079_0070716 | Ga0501079_0070716_399_1736 | 417 |
| 329 | 3300003575 | Ga0007409J51694_1040095 | Ga0007409J51694_10400951 | 418 |
| 330 | 3300005327 | Ga0070658_10006286 | Ga0070658_100062867 | 418 |
| 331 | 3300005339 | Ga0070660_100018526 | Ga0070660_1000185263 | 418 |
| 332 | 3300005341 | Ga0070691_10010001 | Ga0070691_100100012 | 418 |
| 333 | 3300005441 | Ga0070700_100041117 | Ga0070700_1000411171 | 418 |
| 334 | 3300005444 | Ga0070694_100025149 | Ga0070694_1000251493 | 418 |
| 335 | 3300005457 | Ga0070662_100067254 | Ga0070662_1000672542 | 418 |
| 336 | 3300005545 | Ga0070695_100004173 | Ga0070695_1000041735 | 418 |
| 337 | 3300005616 | Ga0068852_100268648 | Ga0068852_1002686481 | 418 |
| 338 | 3300005719 | Ga0068861_100183114 | Ga0068861_1001831142 | 418 |
| 339 | 3300005843 | Ga0068860_100022514 | Ga0068860_1000225144 | 418 |
| 340 | 3300006038 | Ga0075365_10052954 | Ga0075365_100529542 | 418 |
| 341 | 3300006942 | Ga0099824_1010056 | Ga0099824_10100569 | 418 |
| 342 | 3300017792 | Ga0163161_10045064 | Ga0163161_100450642 | 418 |
| 343 | 3300025909 | Ga0207705_10049293 | Ga0207705_100492932 | 418 |
| 344 | 3300025919 | Ga0207657_10019857 | Ga0207657_100198574 | 418 |
| 345 | 3300025920 | Ga0207649_10044917 | Ga0207649_100449172 | 418 |
| 346 | 3300025933 | Ga0207706_10092525 | Ga0207706_100925252 | 418 |
| 347 | 3300026041 | Ga0207639_10182460 | Ga0207639_101824601 | 418 |
| 348 | 3300026075 | Ga0207708_10013604 | Ga0207708_100136043 | 418 |
| 349 | 3300026118 | Ga0207675_100235736 | Ga0207675_1002357361 | 418 |
| 350 | 3300027296 | Ga0209389_1000281 | Ga0209389_100028116 | 418 |
| 351 | 3300027296 | Ga0209389_1000287 | Ga0209389_100028715 | 418 |
| 352 | 3300027357 | Ga0209589_1000072 | Ga0209589_100007245 | 418 |
| 353 | 3300027361 | Ga0209489_100031 | Ga0209489_10003167 | 418 |
| 354 | 3300027361 | Ga0209489_108310 | Ga0209489_10831015 | 418 |
| 355 | 3300027363 | Ga0209700_100010 | Ga0209700_100010268 | 418 |
| 356 | 3300028794 | Ga0307515_10003270 | Ga0307515_1000327028 | 418 |
| 357 | 3300031241 | Ga0265325_10023987 | Ga0265325_100239873 | 418 |
| 358 | 3300031247 | Ga0265340_10015157 | Ga0265340_100151573 | 418 |
| 359 | 3300031712 | Ga0265342_10053678 | Ga0265342_100536782 | 418 |
| 360 | 3300039447 | Ga0436361_0005645 | Ga0436361_0005645_659_2062 | 418 |
| 361 | 3300046616 | Ga0495668_0126719 | Ga0495668_0126719_44_1384 | 418 |
| 362 | 3300053139 | Ga0500568_0005900 | Ga0500568_0005900_2793_4130 | 418 |
| 363 | iso_pu_bacteria | 8019597564 | 8019601519 | 418 |
| 364 | 3300005535 | Ga0070684_100001889 | Ga0070684_10000188910 | 419 |
| 365 | 3300005937 | Ga0081455_10000338 | Ga0081455_1000033828 | 419 |
| 366 | 3300009101 | Ga0105247_10066644 | Ga0105247_100666442 | 419 |
| 367 | 3300013308 | Ga0157375_10335825 | Ga0157375_103358252 | 419 |
| 368 | 3300025944 | Ga0207661_10000309 | Ga0207661_100003095 | 419 |
| 369 | 3300031344 | Ga0265316_10030447 | Ga0265316_100304471 | 419 |
| 370 | 3300031595 | Ga0265313_10009133 | Ga0265313_100091333 | 419 |
| 371 | 3300035170 | Ga0373943_0049705 | Ga0373943_0049705_493_1830 | 419 |
| 372 | 3300037068 | Ga0373925_0114015 | Ga0373925_0114015_442_1779 | 419 |
| 373 | 3300046455 | Ga0495603_0073286 | Ga0495603_0073286_587_1924 | 419 |
| 374 | 3300046474 | Ga0495605_0046305 | Ga0495605_0046305_81_1541 | 419 |
| 375 | 3300046539 | Ga0495621_0018107 | Ga0495621_0018107_174_1595 | 419 |
| 376 | 3300046674 | Ga0495588_0080933 | Ga0495588_0080933_242_1579 | 419 |
| 377 | 3300047469 | Ga0495673_0064470 | Ga0495673_0064470_286_1545 | 419 |
| 378 | 3300048929 | Ga0496126_0153909 | Ga0496126_0153909_639_1898 | 419 |
| 379 | 3300049572 | Ga0501036_0264380 | Ga0501036_0264380_149_1408 | 419 |
| 380 | 3300050493 | nmdc:mga0k408_114707_c1 | nmdc:mga0k408_114707_c1_76_1416 | 419 |
| 381 | 3300005937 | Ga0081455_10001113 | Ga0081455_100011138 | 420 |
| 382 | 3300009147 | Ga0114129_10179324 | Ga0114129_101793243 | 420 |
| 383 | 3300028577 | Ga0265318_10017367 | Ga0265318_100173672 | 420 |
| 384 | 3300035691 | Ga0373931_0003521 | Ga0373931_0003521_2440_3747 | 420 |
| 385 | 3300005329 | Ga0070683_100033523 | Ga0070683_1000335235 | 421 |
| 386 | 3300005333 | Ga0070677_10016646 | Ga0070677_100166462 | 421 |
| 387 | 3300005335 | Ga0070666_10086431 | Ga0070666_100864311 | 421 |
| 388 | 3300005353 | Ga0070669_100058601 | Ga0070669_1000586012 | 421 |
| 389 | 3300005355 | Ga0070671_100158558 | Ga0070671_1001585581 | 421 |
| 390 | 3300005356 | Ga0070674_100005092 | Ga0070674_1000050924 | 421 |
| 391 | 3300005456 | Ga0070678_100015679 | Ga0070678_1000156792 | 421 |
| 392 | 3300005466 | Ga0070685_10062932 | Ga0070685_100629321 | 421 |
| 393 | 3300009093 | Ga0105240_10122827 | Ga0105240_101228272 | 421 |
| 394 | 3300009551 | Ga0105238_10074883 | Ga0105238_100748832 | 421 |
| 395 | 3300013297 | Ga0157378_10001711 | Ga0157378_100017116 | 421 |
| 396 | 3300021384 | Ga0213876_10040021 | Ga0213876_100400211 | 421 |
| 397 | 3300025893 | Ga0207682_10004100 | Ga0207682_100041006 | 421 |
| 398 | 3300025900 | Ga0207710_10028649 | Ga0207710_100286491 | 421 |
| 399 | 3300025901 | Ga0207688_10080221 | Ga0207688_100802212 | 421 |
| 400 | 3300025903 | Ga0207680_10091032 | Ga0207680_100910322 | 421 |
| 401 | 3300025907 | Ga0207645_10034206 | Ga0207645_100342062 | 421 |
| 402 | 3300025924 | Ga0207694_10065100 | Ga0207694_100651003 | 421 |
| 403 | 3300025925 | Ga0207650_10049079 | Ga0207650_100490794 | 421 |
| 404 | 3300025937 | Ga0207669_10001519 | Ga0207669_100015196 | 421 |
| 405 | 3300025940 | Ga0207691_10008519 | Ga0207691_100085197 | 421 |
| 406 | 3300025944 | Ga0207661_10010366 | Ga0207661_100103665 | 421 |
| 407 | 3300026089 | Ga0207648_10026064 | Ga0207648_100260642 | 421 |
| 408 | 3300026121 | Ga0207683_10001401 | Ga0207683_1000140116 | 421 |
| 409 | 3300037466 | Ga0395898_0082027 | Ga0395898_0082027_274_1641 | 421 |
| 410 | 3300039437 | Ga0436365_0206643 | Ga0436365_0206643_2319_3626 | 421 |
| 411 | 3300048920 | Ga0496117_0076731 | Ga0496117_0076731_612_1952 | 421 |
| 412 | 3300048921 | Ga0496118_0021212 | Ga0496118_0021212_1893_3233 | 421 |
| 413 | 3300048924 | Ga0496121_0044704 | Ga0496121_0044704_2034_3374 | 421 |
| 414 | 3300005615 | Ga0070702_100104368 | Ga0070702_1001043681 | 422 |
| 415 | 3300005718 | Ga0068866_10011643 | Ga0068866_100116434 | 422 |
| 416 | 3300005983 | Ga0081540_1003431 | Ga0081540_10034319 | 422 |
| 417 | 3300006038 | Ga0075365_10057357 | Ga0075365_100573572 | 422 |
| 418 | 3300006847 | Ga0075431_100000132 | Ga0075431_10000013215 | 422 |
| 419 | 3300006880 | Ga0075429_100005605 | Ga0075429_1000056057 | 422 |
| 420 | 3300009094 | Ga0111539_10000933 | Ga0111539_1000093310 | 422 |
| 421 | 3300009147 | Ga0114129_10000280 | Ga0114129_1000028015 | 422 |
| 422 | 3300026075 | Ga0207708_10019614 | Ga0207708_100196145 | 422 |
| 423 | 3300027907 | Ga0207428_10003035 | Ga0207428_100030356 | 422 |
| 424 | 3300031730 | Ga0307516_10005336 | Ga0307516_1000533616 | 422 |
| 425 | 3300035085 | Ga0373929_0009323 | Ga0373929_0009323_65_1333 | 422 |
| 426 | 3300045051 | Ga0451576_0261718 | Ga0451576_0261718_15_1364 | 422 |
| 427 | 3300046648 | Ga0495611_0077511 | Ga0495611_0077511_57_1466 | 422 |
| 428 | 3300047319 | Ga0495674_0168013 | Ga0495674_0168013_22_1290 | 422 |
| 429 | 3300049579 | Ga0501043_0217472 | Ga0501043_0217472_164_1432 | 422 |
| 430 | 3300050507 | nmdc:mga05p37_223_c1 | nmdc:mga05p37_223_c1_12229_13566 | 422 |
| 431 | 3300050508 | nmdc:mga09592_9689_c1 | nmdc:mga09592_9689_c1_3826_5163 | 422 |
| 432 | 3300050510 | nmdc:mga06r32_186_c1 | nmdc:mga06r32_186_c1_20879_22216 | 422 |
| 433 | 3300050511 | nmdc:mga08y16_3000_c1 | nmdc:mga08y16_3000_c1_10144_11481 | 422 |
| 434 | 3300053077 | Ga0495601_0181048 | Ga0495601_0181048_62_1330 | 422 |
| 435 | 3300009094 | Ga0111539_10006076 | Ga0111539_100060766 | 423 |
| 436 | 3300009147 | Ga0114129_10041435 | Ga0114129_100414355 | 423 |
| 437 | 3300009147 | Ga0114129_10068788 | Ga0114129_100687883 | 423 |
| 438 | 3300009147 | Ga0114129_10391600 | Ga0114129_103916001 | 423 |
| 439 | 3300013306 | Ga0163162_10072199 | Ga0163162_100721993 | 423 |
| 440 | 3300035088 | Ga0373940_0005502 | Ga0373940_0005502_805_2145 | 423 |
| 441 | 3300035242 | Ga0373962_0024449 | Ga0373962_0024449_247_1587 | 423 |
| 442 | 3300035691 | Ga0373931_0003293 | Ga0373931_0003293_2506_3846 | 423 |
| 443 | 3300046455 | Ga0495603_0019236 | Ga0495603_0019236_2651_4111 | 423 |
| 444 | 3300046475 | Ga0495639_0039535 | Ga0495639_0039535_540_2000 | 423 |
| 445 | 3300046499 | Ga0495594_0038830 | Ga0495594_0038830_38_1498 | 423 |
| 446 | 3300046518 | Ga0495631_0027377 | Ga0495631_0027377_300_1760 | 423 |
| 447 | 3300046684 | Ga0495669_0012768 | Ga0495669_0012768_2041_3501 | 423 |
| 448 | 3300050507 | nmdc:mga05p37_144619_c1 | nmdc:mga05p37_144619_c1_574_1914 | 423 |
| 449 | 3300050507 | nmdc:mga05p37_98984_c1 | nmdc:mga05p37_98984_c1_188_1459 | 423 |
| 450 | 3300050511 | nmdc:mga08y16_96821_c1 | nmdc:mga08y16_96821_c1_991_2331 | 423 |
| 451 | 3300005983 | Ga0081540_1000287 | Ga0081540_10002873 | 424 |
| 452 | 3300006852 | Ga0075433_10009387 | Ga0075433_100093872 | 424 |
| 453 | 3300007076 | Ga0075435_100009425 | Ga0075435_1000094255 | 424 |
| 454 | 3300009094 | Ga0111539_10010044 | Ga0111539_1001004411 | 424 |
| 455 | 3300013308 | Ga0157375_10320821 | Ga0157375_103208211 | 424 |
| 456 | 3300026118 | Ga0207675_100196896 | Ga0207675_1001968962 | 424 |
| 457 | 3300027907 | Ga0207428_10075145 | Ga0207428_100751453 | 424 |
| 458 | 3300035242 | Ga0373962_0012004 | Ga0373962_0012004_226_1581 | 424 |
| 459 | 3300037466 | Ga0395898_0060531 | Ga0395898_0060531_1300_2574 | 424 |
| 460 | 3300047469 | Ga0495673_0008685 | Ga0495673_0008685_4319_5593 | 424 |
| 461 | 3300048090 | Ga0495615_0022019 | Ga0495615_0022019_25_1434 | 424 |
| 462 | 3300048912 | Ga0496109_0107846 | Ga0496109_0107846_339_1619 | 424 |
| 463 | 3300048914 | Ga0496111_0036571 | Ga0496111_0036571_799_2079 | 424 |
| 464 | 3300048916 | Ga0496113_0057975 | Ga0496113_0057975_1513_2793 | 424 |
| 465 | 3300049823 | Ga0501044_0108614 | Ga0501044_0108614_20_1294 | 424 |
| 466 | 3300050511 | nmdc:mga08y16_287968_c1 | nmdc:mga08y16_287968_c1_45_1385 | 424 |
| 467 | 3300050512 | nmdc:mga0n895_26095_c1 | nmdc:mga0n895_26095_c1_2768_4108 | 424 |
| 468 | 3300050513 | nmdc:mga0rr50_37091_c1 | nmdc:mga0rr50_37091_c1_1313_2653 | 424 |
| 469 | 3300050515 | nmdc:mga0a205_141_c1 | nmdc:mga0a205_141_c1_34303_35643 | 424 |
| 470 | 3300005355 | Ga0070671_100048650 | Ga0070671_1000486502 | 425 |
| 471 | 3300005458 | Ga0070681_10026875 | Ga0070681_100268754 | 425 |
| 472 | 3300005616 | Ga0068852_100118205 | Ga0068852_1001182052 | 425 |
| 473 | 3300005937 | Ga0081455_10087480 | Ga0081455_100874802 | 425 |
| 474 | 3300006852 | Ga0075433_10007507 | Ga0075433_100075075 | 425 |
| 475 | 3300006871 | Ga0075434_100010545 | Ga0075434_1000105453 | 425 |
| 476 | 3300009093 | Ga0105240_10018472 | Ga0105240_100184723 | 425 |
| 477 | 3300009094 | Ga0111539_10010044 | Ga0111539_1001004412 | 425 |
| 478 | 3300009094 | Ga0111539_10131104 | Ga0111539_101311041 | 425 |
| 479 | 3300009545 | Ga0105237_10059746 | Ga0105237_100597462 | 425 |
| 480 | 3300009545 | Ga0105237_10143730 | Ga0105237_101437301 | 425 |
| 481 | 3300009551 | Ga0105238_10046421 | Ga0105238_100464212 | 425 |
| 482 | 3300009551 | Ga0105238_10049694 | Ga0105238_100496944 | 425 |
| 483 | 3300013104 | Ga0157370_10009437 | Ga0157370_100094379 | 425 |
| 484 | 3300013105 | Ga0157369_10013868 | Ga0157369_100138688 | 425 |
| 485 | 3300013105 | Ga0157369_10087438 | Ga0157369_100874383 | 425 |
| 486 | 3300013296 | Ga0157374_10056599 | Ga0157374_100565992 | 425 |
| 487 | 3300013308 | Ga0157375_10002389 | Ga0157375_100023892 | 425 |
| 488 | 3300014969 | Ga0157376_10120431 | Ga0157376_101204311 | 425 |
| 489 | 3300025912 | Ga0207707_10039194 | Ga0207707_100391941 | 425 |
| 490 | 3300025913 | Ga0207695_10044455 | Ga0207695_100444554 | 425 |
| 491 | 3300025914 | Ga0207671_10144097 | Ga0207671_101440971 | 425 |
| 492 | 3300025931 | Ga0207644_10057893 | Ga0207644_100578932 | 425 |
| 493 | 3300025949 | Ga0207667_10037832 | Ga0207667_100378323 | 425 |
| 494 | 3300026041 | Ga0207639_10124819 | Ga0207639_101248192 | 425 |
| 495 | 3300035086 | Ga0373934_0008480 | Ga0373934_0008480_55_1332 | 425 |
| 496 | 3300035111 | Ga0373923_0001387 | Ga0373923_0001387_2370_3647 | 425 |
| 497 | 3300035112 | Ga0373932_0026524 | Ga0373932_0026524_234_1511 | 425 |
| 498 | 3300035114 | Ga0373939_0040342 | Ga0373939_0040342_47_1324 | 425 |
| 499 | 3300035117 | Ga0373953_0002318 | Ga0373953_0002318_1193_2470 | 425 |
| 500 | 3300035118 | Ga0373954_0000575 | Ga0373954_0000575_4475_5752 | 425 |
| 501 | 3300035120 | Ga0373957_0000310 | Ga0373957_0000310_371_1648 | 425 |
| 502 | 3300035170 | Ga0373943_0003092 | Ga0373943_0003092_4517_5794 | 425 |
| 503 | 3300035172 | Ga0373955_0004813 | Ga0373955_0004813_1481_2758 | 425 |
| 504 | 3300035207 | Ga0373942_0016516 | Ga0373942_0016516_36_1313 | 425 |
| 505 | 3300035241 | Ga0373961_0024902 | Ga0373961_0024902_237_1577 | 425 |
| 506 | 3300035242 | Ga0373962_0003154 | Ga0373962_0003154_1929_3206 | 425 |
| 507 | 3300035410 | Ga0373924_0028362 | Ga0373924_0028362_803_2080 | 425 |
| 508 | 3300035691 | Ga0373931_0013106 | Ga0373931_0013106_2314_3654 | 425 |
| 509 | 3300035724 | Ga0373933_0009634 | Ga0373933_0009634_746_2023 | 425 |
| 510 | 3300035725 | Ga0373947_0010715 | Ga0373947_0010715_2269_3546 | 425 |
| 511 | 3300036401 | Ga0373937_0017298 | Ga0373937_0017298_178_1455 | 425 |
| 512 | 3300037068 | Ga0373925_0012194 | Ga0373925_0012194_4340_5617 | 425 |
| 513 | 3300044694 | Ga0466963_0053828 | Ga0466963_0053828_128_1405 | 425 |
| 514 | 3300045976 | Ga0466967_0039701 | Ga0466967_0039701_1218_2495 | 425 |
| 515 | 3300046454 | Ga0495592_0004934 | Ga0495592_0004934_5289_6566 | 425 |
| 516 | 3300046459 | Ga0495629_0000274 | Ga0495629_0000274_5832_7109 | 425 |
| 517 | 3300046459 | Ga0495629_0083933 | Ga0495629_0083933_665_1942 | 425 |
| 518 | 3300046462 | Ga0495651_0021993 | Ga0495651_0021993_1310_2587 | 425 |
| 519 | 3300046463 | Ga0495653_0011688 | Ga0495653_0011688_4450_5727 | 425 |
| 520 | 3300046472 | Ga0495580_0043997 | Ga0495580_0043997_286_1563 | 425 |
| 521 | 3300046473 | Ga0495582_0031888 | Ga0495582_0031888_1428_2705 | 425 |
| 522 | 3300046475 | Ga0495639_0024238 | Ga0495639_0024238_497_1774 | 425 |
| 523 | 3300046477 | Ga0495664_0007291 | Ga0495664_0007291_334_1611 | 425 |
| 524 | 3300046511 | Ga0495608_0003122 | Ga0495608_0003122_6851_8128 | 425 |
| 525 | 3300046511 | Ga0495608_0104948 | Ga0495608_0104948_228_1505 | 425 |
| 526 | 3300046516 | Ga0495628_0037986 | Ga0495628_0037986_662_1939 | 425 |
| 527 | 3300046529 | Ga0495652_0069724 | Ga0495652_0069724_1558_2835 | 425 |
| 528 | 3300046536 | Ga0495587_0003309 | Ga0495587_0003309_3732_5009 | 425 |
| 529 | 3300046543 | Ga0495645_0004289 | Ga0495645_0004289_2166_3443 | 425 |
| 530 | 3300046559 | Ga0495667_0003046 | Ga0495667_0003046_111_1388 | 425 |
| 531 | 3300046642 | Ga0495634_0003296 | Ga0495634_0003296_9335_10612 | 425 |
| 532 | 3300046663 | Ga0495635_0005568 | Ga0495635_0005568_3331_4608 | 425 |
| 533 | 3300046678 | Ga0495599_0013813 | Ga0495599_0013813_1017_2294 | 425 |
| 534 | 3300046679 | Ga0495623_0017851 | Ga0495623_0017851_178_1455 | 425 |
| 535 | 3300046680 | Ga0495646_0003838 | Ga0495646_0003838_7290_8567 | 425 |
| 536 | 3300046689 | Ga0495613_0083699 | Ga0495613_0083699_675_1952 | 425 |
| 537 | 3300046809 | Ga0495600_0009105 | Ga0495600_0009105_1846_3123 | 425 |
| 538 | 3300047315 | Ga0495581_0010811 | Ga0495581_0010811_160_1437 | 425 |
| 539 | 3300047322 | Ga0495680_0013969 | Ga0495680_0013969_5593_6870 | 425 |
| 540 | 3300047471 | Ga0495684_0000202 | Ga0495684_0000202_41624_42901 | 425 |
| 541 | 3300047673 | Ga0495593_0012536 | Ga0495593_0012536_3516_4793 | 425 |
| 542 | 3300048088 | Ga0495602_0091777 | Ga0495602_0091777_419_1696 | 425 |
| 543 | 3300048903 | Ga0496100_0029167 | Ga0496100_0029167_1398_2798 | 425 |
| 544 | 3300048905 | Ga0496102_0006629 | Ga0496102_0006629_917_2317 | 425 |
| 545 | 3300048905 | Ga0496102_0039989 | Ga0496102_0039989_1863_3140 | 425 |
| 546 | 3300048906 | Ga0496103_0021662 | Ga0496103_0021662_1580_2980 | 425 |
| 547 | 3300048909 | Ga0496106_0000132 | Ga0496106_0000132_44112_45389 | 425 |
| 548 | 3300048909 | Ga0496106_0033130 | Ga0496106_0033130_1211_2611 | 425 |
| 549 | 3300048910 | Ga0496107_0002892 | Ga0496107_0002892_6853_8130 | 425 |
| 550 | 3300048911 | Ga0496108_0006355 | Ga0496108_0006355_7827_9227 | 425 |
| 551 | 3300048915 | Ga0496112_0056266 | Ga0496112_0056266_1841_3241 | 425 |
| 552 | 3300048915 | Ga0496112_0191752 | Ga0496112_0191752_601_1878 | 425 |
| 553 | 3300048918 | Ga0496115_0010748 | Ga0496115_0010748_1533_2933 | 425 |
| 554 | 3300050511 | nmdc:mga08y16_157443_c1 | nmdc:mga08y16_157443_c1_155_1432 | 425 |
| 555 | 3300050512 | nmdc:mga0n895_26095_c1 | nmdc:mga0n895_26095_c1_1317_2594 | 425 |
| 556 | 3300050515 | nmdc:mga0a205_141_c1 | nmdc:mga0a205_141_c1_32852_34129 | 425 |
| 557 | 3300053077 | Ga0495601_0007293 | Ga0495601_0007293_1962_3239 | 425 |
| 558 | 3300053078 | Ga0495612_0005916 | Ga0495612_0005916_3648_4925 | 425 |
| 559 | 3300053084 | Ga0495595_0006827 | Ga0495595_0006827_1854_3131 | 425 |
| 560 | 3300005467 | Ga0070706_100018218 | Ga0070706_1000182182 | 426 |
| 561 | 3300005468 | Ga0070707_100039960 | Ga0070707_1000399604 | 426 |
| 562 | 3300009094 | Ga0111539_10261304 | Ga0111539_102613041 | 426 |
| 563 | 3300009553 | Ga0105249_10194742 | Ga0105249_101947422 | 426 |
| 564 | 3300026116 | Ga0207674_10157891 | Ga0207674_101578912 | 426 |
| 565 | 3300028800 | Ga0265338_10031136 | Ga0265338_100311362 | 426 |
| 566 | 3300035725 | Ga0373947_0054510 | Ga0373947_0054510_831_2165 | 426 |
| 567 | iso_pu_bacteria | 2885383462 | 2885386343 | 426 |
| 568 | iso_pu_bacteria | 2903768456 | 2903771419 | 426 |
| 569 | 3300005331 | Ga0070670_100046283 | Ga0070670_1000462832 | 427 |
| 570 | 3300005355 | Ga0070671_100014313 | Ga0070671_1000143134 | 427 |
| 571 | 3300005367 | Ga0070667_100029473 | Ga0070667_1000294735 | 427 |
| 572 | 3300005539 | Ga0068853_100106779 | Ga0068853_1001067792 | 427 |
| 573 | 3300005563 | Ga0068855_100081702 | Ga0068855_1000817022 | 427 |
| 574 | 3300005618 | Ga0068864_100225765 | Ga0068864_1002257652 | 427 |
| 575 | 3300006042 | Ga0075368_10002574 | Ga0075368_100025745 | 427 |
| 576 | 3300006048 | Ga0075363_100010469 | Ga0075363_1000104695 | 427 |
| 577 | 3300006178 | Ga0075367_10007196 | Ga0075367_100071964 | 427 |
| 578 | 3300006195 | Ga0075366_10027505 | Ga0075366_100275053 | 427 |
| 579 | 3300006353 | Ga0075370_10011339 | Ga0075370_100113393 | 427 |
| 580 | 3300006871 | Ga0075434_100018868 | Ga0075434_1000188682 | 427 |
| 581 | 3300006871 | Ga0075434_100056584 | Ga0075434_1000565843 | 427 |
| 582 | 3300009093 | Ga0105240_10104887 | Ga0105240_101048872 | 427 |
| 583 | 3300009147 | Ga0114129_10063111 | Ga0114129_100631114 | 427 |
| 584 | 3300009174 | Ga0105241_10016039 | Ga0105241_100160392 | 427 |
| 585 | 3300009545 | Ga0105237_10018618 | Ga0105237_100186186 | 427 |
| 586 | 3300009551 | Ga0105238_10045925 | Ga0105238_100459255 | 427 |
| 587 | 3300010375 | Ga0105239_10215545 | Ga0105239_102155452 | 427 |
| 588 | 3300011119 | Ga0105246_10010229 | Ga0105246_100102294 | 427 |
| 589 | 3300013296 | Ga0157374_10010088 | Ga0157374_100100886 | 427 |
| 590 | 3300013308 | Ga0157375_10279638 | Ga0157375_102796381 | 427 |
| 591 | 3300025304 | Ga0209257_1008496 | Ga0209257_10084962 | 427 |
| 592 | 3300025315 | Ga0207697_10012707 | Ga0207697_100127072 | 427 |
| 593 | 3300025904 | Ga0207647_10001953 | Ga0207647_100019535 | 427 |
| 594 | 3300025914 | Ga0207671_10008638 | Ga0207671_100086384 | 427 |
| 595 | 3300025925 | Ga0207650_10009631 | Ga0207650_100096313 | 427 |
| 596 | 3300025941 | Ga0207711_10115273 | Ga0207711_101152732 | 427 |
| 597 | 3300025945 | Ga0207679_10170203 | Ga0207679_101702031 | 427 |
| 598 | 3300025949 | Ga0207667_10297985 | Ga0207667_102979851 | 427 |
| 599 | 3300025972 | Ga0207668_10075063 | Ga0207668_100750631 | 427 |
| 600 | 3300035691 | Ga0373931_0103293 | Ga0373931_0103293_188_1573 | 427 |
| 601 | 3300035725 | Ga0373947_0054014 | Ga0373947_0054014_85_1470 | 427 |
| 602 | 3300039437 | Ga0436365_0071656 | Ga0436365_0071656_842_2221 | 427 |
| 603 | 3300046457 | Ga0495590_0023720 | Ga0495590_0023720_541_1824 | 427 |
| 604 | 3300046459 | Ga0495629_0026723 | Ga0495629_0026723_1471_2802 | 427 |
| 605 | 3300046460 | Ga0495638_0039519 | Ga0495638_0039519_1235_2518 | 427 |
| 606 | 3300046476 | Ga0495662_0051973 | Ga0495662_0051973_192_1577 | 427 |
| 607 | 3300046519 | Ga0495632_0087382 | Ga0495632_0087382_80_1420 | 427 |
| 608 | 3300046522 | Ga0495643_0010781 | Ga0495643_0010781_968_2308 | 427 |
| 609 | 3300046616 | Ga0495668_0009325 | Ga0495668_0009325_1358_2698 | 427 |
| 610 | 3300046660 | Ga0495625_0174850 | Ga0495625_0174850_118_1401 | 427 |
| 611 | 3300046794 | Ga0495589_0071687 | Ga0495589_0071687_158_1441 | 427 |
| 612 | 3300048905 | Ga0496102_0007550 | Ga0496102_0007550_3029_4369 | 427 |
| 613 | 3300048905 | Ga0496102_0029492 | Ga0496102_0029492_1272_2657 | 427 |
| 614 | 3300048906 | Ga0496103_0002556 | Ga0496103_0002556_6471_7811 | 427 |
| 615 | 3300048906 | Ga0496103_0010340 | Ga0496103_0010340_4012_5397 | 427 |
| 616 | 3300048907 | Ga0496104_0001610 | Ga0496104_0001610_15745_17130 | 427 |
| 617 | 3300048908 | Ga0496105_0001092 | Ga0496105_0001092_11455_12840 | 427 |
| 618 | 3300048911 | Ga0496108_0004593 | Ga0496108_0004593_5207_6592 | 427 |
| 619 | 3300048911 | Ga0496108_0045130 | Ga0496108_0045130_32_1372 | 427 |
| 620 | 3300048912 | Ga0496109_0000673 | Ga0496109_0000673_6326_7711 | 427 |
| 621 | 3300048913 | Ga0496110_0005312 | Ga0496110_0005312_8208_9593 | 427 |
| 622 | 3300048914 | Ga0496111_0000369 | Ga0496111_0000369_397_1782 | 427 |
| 623 | 3300048915 | Ga0496112_0005651 | Ga0496112_0005651_3768_5153 | 427 |
| 624 | 3300048915 | Ga0496112_0021205 | Ga0496112_0021205_1518_2858 | 427 |
| 625 | 3300048916 | Ga0496113_0003021 | Ga0496113_0003021_4479_5864 | 427 |
| 626 | 3300048919 | Ga0496116_0054972 | Ga0496116_0054972_1077_2417 | 427 |
| 627 | 3300048922 | Ga0496119_0038742 | Ga0496119_0038742_203_1543 | 427 |
| 628 | 3300050490 | nmdc:mga03n38_11146_c1 | nmdc:mga03n38_11146_c1_40_1380 | 427 |
| 629 | 3300050491 | nmdc:mga00v17_16623_c1 | nmdc:mga00v17_16623_c1_229_1569 | 427 |
| 630 | 3300050494 | nmdc:mga06z11_2007_c1 | nmdc:mga06z11_2007_c1_3333_4673 | 427 |
| 631 | 3300050495 | nmdc:mga04h51_9004_c1 | nmdc:mga04h51_9004_c1_953_2293 | 427 |
| 632 | 3300050496 | nmdc:mga07m45_78580_c1 | nmdc:mga07m45_78580_c1_335_1675 | 427 |
| 633 | 3300050507 | nmdc:mga05p37_166167_c1 | nmdc:mga05p37_166167_c1_494_1879 | 427 |
| 634 | 3300050512 | nmdc:mga0n895_127675_c1 | nmdc:mga0n895_127675_c1_834_2219 | 427 |
| 635 | 3300050512 | nmdc:mga0n895_49140_c1 | nmdc:mga0n895_49140_c1_1519_2850 | 427 |
| 636 | 3300050513 | nmdc:mga0rr50_3143_c1 | nmdc:mga0rr50_3143_c1_2792_4123 | 427 |
| 637 | 3300053085 | Ga0495619_0035265 | Ga0495619_0035265_1835_3166 | 427 |
| 638 | 3300003911 | JGI25405J52794_10015703 | JGI25405J52794_100157031 | 428 |
| 639 | 3300005331 | Ga0070670_100099224 | Ga0070670_1000992241 | 428 |
| 640 | 3300005338 | Ga0068868_100097141 | Ga0068868_1000971412 | 428 |
| 641 | 3300005341 | Ga0070691_10028244 | Ga0070691_100282444 | 428 |
| 642 | 3300005341 | Ga0070691_10068140 | Ga0070691_100681401 | 428 |
| 643 | 3300005354 | Ga0070675_100136493 | Ga0070675_1001364932 | 428 |
| 644 | 3300005355 | Ga0070671_100035594 | Ga0070671_1000355943 | 428 |
| 645 | 3300005355 | Ga0070671_100059844 | Ga0070671_1000598443 | 428 |
| 646 | 3300005364 | Ga0070673_100099578 | Ga0070673_1000995782 | 428 |
| 647 | 3300005366 | Ga0070659_100211410 | Ga0070659_1002114101 | 428 |
| 648 | 3300005434 | Ga0070709_10018900 | Ga0070709_100189002 | 428 |
| 649 | 3300005435 | Ga0070714_100057926 | Ga0070714_1000579263 | 428 |
| 650 | 3300005435 | Ga0070714_100118276 | Ga0070714_1001182763 | 428 |
| 651 | 3300005436 | Ga0070713_100019235 | Ga0070713_1000192353 | 428 |
| 652 | 3300005436 | Ga0070713_100122414 | Ga0070713_1001224142 | 428 |
| 653 | 3300005437 | Ga0070710_10002845 | Ga0070710_100028459 | 428 |
| 654 | 3300005437 | Ga0070710_10005520 | Ga0070710_100055205 | 428 |
| 655 | 3300005439 | Ga0070711_100008227 | Ga0070711_1000082272 | 428 |
| 656 | 3300005439 | Ga0070711_100252171 | Ga0070711_1002521711 | 428 |
| 657 | 3300005456 | Ga0070678_100025653 | Ga0070678_1000256531 | 428 |
| 658 | 3300005458 | Ga0070681_10034038 | Ga0070681_100340382 | 428 |
| 659 | 3300005468 | Ga0070707_100351765 | Ga0070707_1003517651 | 428 |
| 660 | 3300005518 | Ga0070699_100007741 | Ga0070699_1000077417 | 428 |
| 661 | 3300005535 | Ga0070684_100061460 | Ga0070684_1000614601 | 428 |
| 662 | 3300005536 | Ga0070697_100056813 | Ga0070697_1000568134 | 428 |
| 663 | 3300005539 | Ga0068853_100048509 | Ga0068853_1000485091 | 428 |
| 664 | 3300005545 | Ga0070695_100005577 | Ga0070695_1000055774 | 428 |
| 665 | 3300005548 | Ga0070665_100030822 | Ga0070665_1000308222 | 428 |
| 666 | 3300005548 | Ga0070665_100140512 | Ga0070665_1001405122 | 428 |
| 667 | 3300005563 | Ga0068855_100060250 | Ga0068855_1000602503 | 428 |
| 668 | 3300005563 | Ga0068855_100221306 | Ga0068855_1002213062 | 428 |
| 669 | 3300005563 | Ga0068855_100232942 | Ga0068855_1002329423 | 428 |
| 670 | 3300005564 | Ga0070664_100100905 | Ga0070664_1001009052 | 428 |
| 671 | 3300005577 | Ga0068857_100038200 | Ga0068857_1000382005 | 428 |
| 672 | 3300005577 | Ga0068857_100063354 | Ga0068857_1000633541 | 428 |
| 673 | 3300005614 | Ga0068856_100088218 | Ga0068856_1000882182 | 428 |
| 674 | 3300005614 | Ga0068856_100158056 | Ga0068856_1001580562 | 428 |
| 675 | 3300005616 | Ga0068852_100011636 | Ga0068852_1000116367 | 428 |
| 676 | 3300005617 | Ga0068859_100230741 | Ga0068859_1002307411 | 428 |
| 677 | 3300005617 | Ga0068859_100402698 | Ga0068859_1004026981 | 428 |
| 678 | 3300005718 | Ga0068866_10038826 | Ga0068866_100388262 | 428 |
| 679 | 3300005842 | Ga0068858_100016019 | Ga0068858_1000160193 | 428 |
| 680 | 3300005844 | Ga0068862_100068284 | Ga0068862_1000682842 | 428 |
| 681 | 3300005937 | Ga0081455_10000062 | Ga0081455_1000006211 | 428 |
| 682 | 3300005937 | Ga0081455_10020033 | Ga0081455_100200333 | 428 |
| 683 | 3300005937 | Ga0081455_10037459 | Ga0081455_100374592 | 428 |
| 684 | 3300006028 | Ga0070717_10002845 | Ga0070717_100028459 | 428 |
| 685 | 3300006028 | Ga0070717_10051833 | Ga0070717_100518333 | 428 |
| 686 | 3300006028 | Ga0070717_10071679 | Ga0070717_100716792 | 428 |
| 687 | 3300006028 | Ga0070717_10076155 | Ga0070717_100761552 | 428 |
| 688 | 3300006175 | Ga0070712_100012738 | Ga0070712_1000127383 | 428 |
| 689 | 3300006175 | Ga0070712_100016856 | Ga0070712_1000168565 | 428 |
| 690 | 3300006237 | Ga0097621_100063586 | Ga0097621_1000635862 | 428 |
| 691 | 3300006844 | Ga0075428_100074030 | Ga0075428_1000740301 | 428 |
| 692 | 3300006931 | Ga0097620_100230741 | Ga0097620_1002307412 | 428 |
| 693 | 3300006931 | Ga0097620_100402694 | Ga0097620_1004026941 | 428 |
| 694 | 3300007265 | Ga0099794_10003585 | Ga0099794_100035855 | 428 |
| 695 | 3300009092 | Ga0105250_10049173 | Ga0105250_100491731 | 428 |
| 696 | 3300009148 | Ga0105243_10139959 | Ga0105243_101399592 | 428 |
| 697 | 3300009174 | Ga0105241_10050230 | Ga0105241_100502302 | 428 |
| 698 | 3300009545 | Ga0105237_10028013 | Ga0105237_100280132 | 428 |
| 699 | 3300010375 | Ga0105239_10080412 | Ga0105239_100804124 | 428 |
| 700 | 3300010375 | Ga0105239_10193665 | Ga0105239_101936652 | 428 |
| 701 | 3300011119 | Ga0105246_10101022 | Ga0105246_101010222 | 428 |
| 702 | 3300013105 | Ga0157369_10132704 | Ga0157369_101327042 | 428 |
| 703 | 3300013296 | Ga0157374_10158323 | Ga0157374_101583232 | 428 |
| 704 | 3300013297 | Ga0157378_10185226 | Ga0157378_101852262 | 428 |
| 705 | 3300013306 | Ga0163162_10173284 | Ga0163162_101732842 | 428 |
| 706 | 3300013308 | Ga0157375_10216330 | Ga0157375_102163302 | 428 |
| 707 | 3300014497 | Ga0182008_10028985 | Ga0182008_100289852 | 428 |
| 708 | 3300014968 | Ga0157379_10199759 | Ga0157379_101997592 | 428 |
| 709 | 3300021377 | Ga0213874_10027698 | Ga0213874_100276982 | 428 |
| 710 | 3300021388 | Ga0213875_10000748 | Ga0213875_1000074813 | 428 |
| 711 | 3300021388 | Ga0213875_10003454 | Ga0213875_1000345411 | 428 |
| 712 | 3300021388 | Ga0213875_10046568 | Ga0213875_100465682 | 428 |
| 713 | 3300025261 | Ga0209233_1009969 | Ga0209233_10099692 | 428 |
| 714 | 3300025297 | Ga0209758_1002422 | Ga0209758_100242215 | 428 |
| 715 | 3300025898 | Ga0207692_10001849 | Ga0207692_100018498 | 428 |
| 716 | 3300025901 | Ga0207688_10001429 | Ga0207688_100014298 | 428 |
| 717 | 3300025910 | Ga0207684_10029075 | Ga0207684_100290753 | 428 |
| 718 | 3300025913 | Ga0207695_10000015 | Ga0207695_10000015485 | 428 |
| 719 | 3300025914 | Ga0207671_10008452 | Ga0207671_100084528 | 428 |
| 720 | 3300025914 | Ga0207671_10110809 | Ga0207671_101108092 | 428 |
| 721 | 3300025915 | Ga0207693_10001157 | Ga0207693_100011579 | 428 |
| 722 | 3300025916 | Ga0207663_10006014 | Ga0207663_100060146 | 428 |
| 723 | 3300025917 | Ga0207660_10075782 | Ga0207660_100757822 | 428 |
| 724 | 3300025919 | Ga0207657_10146997 | Ga0207657_101469971 | 428 |
| 725 | 3300025922 | Ga0207646_10283399 | Ga0207646_102833991 | 428 |
| 726 | 3300025923 | Ga0207681_10142125 | Ga0207681_101421251 | 428 |
| 727 | 3300025924 | Ga0207694_10173654 | Ga0207694_101736541 | 428 |
| 728 | 3300025926 | Ga0207659_10143956 | Ga0207659_101439562 | 428 |
| 729 | 3300025926 | Ga0207659_10169132 | Ga0207659_101691322 | 428 |
| 730 | 3300025928 | Ga0207700_10062855 | Ga0207700_100628553 | 428 |
| 731 | 3300025928 | Ga0207700_10084261 | Ga0207700_100842613 | 428 |
| 732 | 3300025928 | Ga0207700_10198572 | Ga0207700_101985722 | 428 |
| 733 | 3300025929 | Ga0207664_10121243 | Ga0207664_101212431 | 428 |
| 734 | 3300025939 | Ga0207665_10044028 | Ga0207665_100440282 | 428 |
| 735 | 3300025940 | Ga0207691_10000910 | Ga0207691_1000091023 | 428 |
| 736 | 3300025942 | Ga0207689_10112421 | Ga0207689_101124212 | 428 |
| 737 | 3300025944 | Ga0207661_10131875 | Ga0207661_101318752 | 428 |
| 738 | 3300025949 | Ga0207667_10225141 | Ga0207667_102251412 | 428 |
| 739 | 3300026023 | Ga0207677_10058702 | Ga0207677_100587022 | 428 |
| 740 | 3300026023 | Ga0207677_10061807 | Ga0207677_100618072 | 428 |
| 741 | 3300026035 | Ga0207703_10039853 | Ga0207703_100398532 | 428 |
| 742 | 3300026041 | Ga0207639_10138822 | Ga0207639_101388222 | 428 |
| 743 | 3300026067 | Ga0207678_10055570 | Ga0207678_100555702 | 428 |
| 744 | 3300026078 | Ga0207702_10009625 | Ga0207702_100096252 | 428 |
| 745 | 3300026116 | Ga0207674_10078492 | Ga0207674_100784923 | 428 |
| 746 | 3300026116 | Ga0207674_10098061 | Ga0207674_100980612 | 428 |
| 747 | 3300026118 | Ga0207675_100043587 | Ga0207675_1000435873 | 428 |
| 748 | 3300026121 | Ga0207683_10065696 | Ga0207683_100656962 | 428 |
| 749 | 3300028380 | Ga0268265_10156865 | Ga0268265_101568652 | 428 |
| 750 | 3300035089 | Ga0373944_0012984 | Ga0373944_0012984_533_1882 | 428 |
| 751 | 3300035116 | Ga0373945_0019537 | Ga0373945_0019537_463_1812 | 428 |
| 752 | 3300035170 | Ga0373943_0050899 | Ga0373943_0050899_429_1778 | 428 |
| 753 | 3300035171 | Ga0373946_0041444 | Ga0373946_0041444_283_1632 | 428 |
| 754 | 3300035692 | Ga0373935_0023585 | Ga0373935_0023585_2417_3766 | 428 |
| 755 | 3300035692 | Ga0373935_0024652 | Ga0373935_0024652_207_1553 | 428 |
| 756 | 3300035695 | Ga0373927_0023630 | Ga0373927_0023630_1137_2486 | 428 |
| 757 | 3300035695 | Ga0373927_0026896 | Ga0373927_0026896_872_2218 | 428 |
| 758 | 3300037418 | Ga0395900_0009959 | Ga0395900_0009959_2227_3561 | 428 |
| 759 | 3300037471 | Ga0395905_0214454 | Ga0395905_0214454_52_1401 | 428 |
| 760 | 3300037853 | Ga0436364_0063853 | Ga0436364_0063853_11091_12443 | 428 |
| 761 | 3300037853 | Ga0436364_0425406 | Ga0436364_0425406_174_1520 | 428 |
| 762 | 3300037853 | Ga0436364_1037748 | Ga0436364_1037748_17659_19008 | 428 |
| 763 | 3300038443 | Ga0395901_0002729 | Ga0395901_0002729_2706_4040 | 428 |
| 764 | 3300039447 | Ga0436361_0303930 | Ga0436361_0303930_3054_4385 | 428 |
| 765 | 3300039450 | Ga0436363_1256145 | Ga0436363_1256145_515_1861 | 428 |
| 766 | 3300044694 | Ga0466963_0053755 | Ga0466963_0053755_544_1878 | 428 |
| 767 | 3300044842 | Ga0466957_0031508 | Ga0466957_0031508_1381_2715 | 428 |
| 768 | 3300045976 | Ga0466967_0275862 | Ga0466967_0275862_15_1346 | 428 |
| 769 | 3300046452 | Ga0495617_041209 | Ga0495617_041209_153_1487 | 428 |
| 770 | 3300046455 | Ga0495603_0074272 | Ga0495603_0074272_444_1793 | 428 |
| 771 | 3300046461 | Ga0495641_0049337 | Ga0495641_0049337_191_1540 | 428 |
| 772 | 3300046473 | Ga0495582_0063318 | Ga0495582_0063318_282_1631 | 428 |
| 773 | 3300046476 | Ga0495662_0017387 | Ga0495662_0017387_597_1946 | 428 |
| 774 | 3300046491 | Ga0495584_0067052 | Ga0495584_0067052_351_1700 | 428 |
| 775 | 3300046492 | Ga0495585_0031744 | Ga0495585_0031744_776_2125 | 428 |
| 776 | 3300046501 | Ga0495607_0101529 | Ga0495607_0101529_60_1409 | 428 |
| 777 | 3300046513 | Ga0495616_0022143 | Ga0495616_0022143_820_2169 | 428 |
| 778 | 3300046517 | Ga0495630_0039291 | Ga0495630_0039291_2035_3384 | 428 |
| 779 | 3300046537 | Ga0495598_0001513 | Ga0495598_0001513_2525_3874 | 428 |
| 780 | 3300046558 | Ga0495633_0039800 | Ga0495633_0039800_617_1966 | 428 |
| 781 | 3300046615 | Ga0495656_0001407 | Ga0495656_0001407_4615_5964 | 428 |
| 782 | 3300046664 | Ga0495659_0037345 | Ga0495659_0037345_227_1576 | 428 |
| 783 | 3300046665 | Ga0495661_0046229 | Ga0495661_0046229_1152_2501 | 428 |
| 784 | 3300046674 | Ga0495588_0005658 | Ga0495588_0005658_229_1578 | 428 |
| 785 | 3300046683 | Ga0495658_0028915 | Ga0495658_0028915_650_1999 | 428 |
| 786 | 3300046689 | Ga0495613_0085961 | Ga0495613_0085961_339_1688 | 428 |
| 787 | 3300046690 | Ga0495624_0012108 | Ga0495624_0012108_2075_3424 | 428 |
| 788 | 3300047315 | Ga0495581_0042718 | Ga0495581_0042718_740_2089 | 428 |
| 789 | 3300047321 | Ga0495676_0040171 | Ga0495676_0040171_300_1649 | 428 |
| 790 | 3300047445 | Ga0495677_0032176 | Ga0495677_0032176_43_1392 | 428 |
| 791 | 3300048906 | Ga0496103_0043433 | Ga0496103_0043433_371_1705 | 428 |
| 792 | 3300048907 | Ga0496104_0072608 | Ga0496104_0072608_12_1361 | 428 |
| 793 | 3300048908 | Ga0496105_0040423 | Ga0496105_0040423_1627_2961 | 428 |
| 794 | 3300048909 | Ga0496106_0045531 | Ga0496106_0045531_1812_3146 | 428 |
| 795 | 3300048911 | Ga0496108_0022585 | Ga0496108_0022585_1574_2908 | 428 |
| 796 | 3300048912 | Ga0496109_0041345 | Ga0496109_0041345_930_2264 | 428 |
| 797 | 3300048912 | Ga0496109_0067710 | Ga0496109_0067710_1541_2878 | 428 |
| 798 | 3300048914 | Ga0496111_0171805 | Ga0496111_0171805_32_1444 | 428 |
| 799 | 3300048915 | Ga0496112_0024768 | Ga0496112_0024768_929_2263 | 428 |
| 800 | 3300048916 | Ga0496113_0009451 | Ga0496113_0009451_3599_4957 | 428 |
| 801 | 3300048916 | Ga0496113_0045124 | Ga0496113_0045124_22_1356 | 428 |
| 802 | 3300048917 | Ga0496114_0078870 | Ga0496114_0078870_1431_2765 | 428 |
| 803 | 3300048918 | Ga0496115_0017648 | Ga0496115_0017648_2450_3784 | 428 |
| 804 | 3300049571 | Ga0501034_0052306 | Ga0501034_0052306_1354_2688 | 428 |
| 805 | 3300049586 | Ga0501070_0216517 | Ga0501070_0216517_73_1419 | 428 |
| 806 | 3300049742 | Ga0501080_0109118 | Ga0501080_0109118_84_1430 | 428 |
| 807 | 3300049744 | Ga0501083_0007657 | Ga0501083_0007657_1073_2419 | 428 |
| 808 | 3300060353 | Ga0501082_0013208 | Ga0501082_0013208_977_2323 | 428 |
| 809 | 3300005441 | Ga0070700_100077236 | Ga0070700_1000772362 | 429 |
| 810 | 3300005456 | Ga0070678_100125581 | Ga0070678_1001255811 | 429 |
| 811 | 3300005539 | Ga0068853_100214198 | Ga0068853_1002141982 | 429 |
| 812 | 3300005545 | Ga0070695_100002243 | Ga0070695_1000022435 | 429 |
| 813 | 3300005563 | Ga0068855_100196308 | Ga0068855_1001963081 | 429 |
| 814 | 3300005937 | Ga0081455_10129657 | Ga0081455_101296572 | 429 |
| 815 | 3300005981 | Ga0081538_10004691 | Ga0081538_100046912 | 429 |
| 816 | 3300005983 | Ga0081540_1001096 | Ga0081540_10010968 | 429 |
| 817 | 3300006175 | Ga0070712_100224482 | Ga0070712_1002244821 | 429 |
| 818 | 3300006178 | Ga0075367_10139849 | Ga0075367_101398491 | 429 |
| 819 | 3300006844 | Ga0075428_100025075 | Ga0075428_1000250754 | 429 |
| 820 | 3300006844 | Ga0075428_100233246 | Ga0075428_1002332463 | 429 |
| 821 | 3300006847 | Ga0075431_100144185 | Ga0075431_1001441852 | 429 |
| 822 | 3300006871 | Ga0075434_100003469 | Ga0075434_1000034694 | 429 |
| 823 | 3300006871 | Ga0075434_100010716 | Ga0075434_1000107163 | 429 |
| 824 | 3300007076 | Ga0075435_100029324 | Ga0075435_1000293244 | 429 |
| 825 | 3300009094 | Ga0111539_10019554 | Ga0111539_100195543 | 429 |
| 826 | 3300009147 | Ga0114129_10081706 | Ga0114129_100817065 | 429 |
| 827 | 3300009147 | Ga0114129_10233909 | Ga0114129_102339091 | 429 |
| 828 | 3300021388 | Ga0213875_10011211 | Ga0213875_100112113 | 429 |
| 829 | 3300026121 | Ga0207683_10116996 | Ga0207683_101169962 | 429 |
| 830 | 3300031728 | Ga0316578_10036599 | Ga0316578_100365991 | 429 |
| 831 | 3300035691 | Ga0373931_0001359 | Ga0373931_0001359_8337_9677 | 429 |
| 832 | 3300037418 | Ga0395900_0005908 | Ga0395900_0005908_9568_10905 | 429 |
| 833 | 3300037853 | Ga0436364_0875825 | Ga0436364_0875825_5004_6353 | 429 |
| 834 | 3300037853 | Ga0436364_1117332 | Ga0436364_1117332_490_1854 | 429 |
| 835 | 3300038443 | Ga0395901_0002583 | Ga0395901_0002583_9636_10973 | 429 |
| 836 | 3300038443 | Ga0395901_0179180 | Ga0395901_0179180_299_1636 | 429 |
| 837 | 3300039438 | Ga0436360_0857979 | Ga0436360_0857979_727_2076 | 429 |
| 838 | 3300044694 | Ga0466963_0027947 | Ga0466963_0027947_1212_2549 | 429 |
| 839 | 3300045976 | Ga0466967_0120775 | Ga0466967_0120775_995_2332 | 429 |
| 840 | 3300046454 | Ga0495592_0026990 | Ga0495592_0026990_2738_4087 | 429 |
| 841 | 3300046535 | Ga0495586_0020121 | Ga0495586_0020121_1164_2513 | 429 |
| 842 | 3300046559 | Ga0495667_0023182 | Ga0495667_0023182_1336_2685 | 429 |
| 843 | 3300046559 | Ga0495667_0074446 | Ga0495667_0074446_596_1927 | 429 |
| 844 | 3300046615 | Ga0495656_0078571 | Ga0495656_0078571_68_1405 | 429 |
| 845 | 3300046663 | Ga0495635_0069381 | Ga0495635_0069381_967_2316 | 429 |
| 846 | 3300047321 | Ga0495676_0027504 | Ga0495676_0027504_1742_3202 | 429 |
| 847 | 3300047322 | Ga0495680_0048590 | Ga0495680_0048590_1008_2357 | 429 |
| 848 | 3300048904 | Ga0496101_0002175 | Ga0496101_0002175_5196_6530 | 429 |
| 849 | 3300048904 | Ga0496101_0230843 | Ga0496101_0230843_60_1400 | 429 |
| 850 | 3300048905 | Ga0496102_0008862 | Ga0496102_0008862_4319_5653 | 429 |
| 851 | 3300048907 | Ga0496104_0000253 | Ga0496104_0000253_23472_24809 | 429 |
| 852 | 3300048907 | Ga0496104_0003222 | Ga0496104_0003222_5161_6498 | 429 |
| 853 | 3300048907 | Ga0496104_0027004 | Ga0496104_0027004_217_1551 | 429 |
| 854 | 3300048907 | Ga0496104_0106906 | Ga0496104_0106906_679_2019 | 429 |
| 855 | 3300048908 | Ga0496105_0070980 | Ga0496105_0070980_336_1673 | 429 |
| 856 | 3300048909 | Ga0496106_0019127 | Ga0496106_0019127_1612_2946 | 429 |
| 857 | 3300048909 | Ga0496106_0119957 | Ga0496106_0119957_237_1574 | 429 |
| 858 | 3300048910 | Ga0496107_0122515 | Ga0496107_0122515_471_1811 | 429 |
| 859 | 3300048911 | Ga0496108_0022087 | Ga0496108_0022087_1538_2872 | 429 |
| 860 | 3300048911 | Ga0496108_0132783 | Ga0496108_0132783_654_2108 | 429 |
| 861 | 3300048912 | Ga0496109_0026829 | Ga0496109_0026829_1323_2657 | 429 |
| 862 | 3300048912 | Ga0496109_0040874 | Ga0496109_0040874_911_2251 | 429 |
| 863 | 3300048913 | Ga0496110_0003034 | Ga0496110_0003034_9140_10474 | 429 |
| 864 | 3300048913 | Ga0496110_0088340 | Ga0496110_0088340_1161_2501 | 429 |
| 865 | 3300048913 | Ga0496110_0108320 | Ga0496110_0108320_160_1494 | 429 |
| 866 | 3300048914 | Ga0496111_0004419 | Ga0496111_0004419_6080_7414 | 429 |
| 867 | 3300048915 | Ga0496112_0037584 | Ga0496112_0037584_2635_3969 | 429 |
| 868 | 3300048915 | Ga0496112_0156945 | Ga0496112_0156945_238_1578 | 429 |
| 869 | 3300048916 | Ga0496113_0015707 | Ga0496113_0015707_143_1477 | 429 |
| 870 | 3300048917 | Ga0496114_0282317 | Ga0496114_0282317_111_1445 | 429 |
| 871 | 3300048918 | Ga0496115_0046941 | Ga0496115_0046941_1610_2950 | 429 |
| 872 | 3300049568 | Ga0501031_0004827 | Ga0501031_0004827_4296_5633 | 429 |
| 873 | 3300049569 | Ga0501032_0000054 | Ga0501032_0000054_26268_27605 | 429 |
| 874 | 3300049570 | Ga0501033_0000025 | Ga0501033_0000025_130782_132119 | 429 |
| 875 | 3300049571 | Ga0501034_0000177 | Ga0501034_0000177_40445_41782 | 429 |
| 876 | 3300049571 | Ga0501034_0004577 | Ga0501034_0004577_9662_10999 | 429 |
| 877 | 3300049571 | Ga0501034_0034959 | Ga0501034_0034959_2484_3821 | 429 |
| 878 | 3300049572 | Ga0501036_0000025 | Ga0501036_0000025_73241_74578 | 429 |
| 879 | 3300049573 | Ga0501037_0000169 | Ga0501037_0000169_36282_37619 | 429 |
| 880 | 3300049574 | Ga0501038_0000029 | Ga0501038_0000029_57321_58658 | 429 |
| 881 | 3300049575 | Ga0501039_0000441 | Ga0501039_0000441_14655_15992 | 429 |
| 882 | 3300049575 | Ga0501039_0243457 | Ga0501039_0243457_50_1387 | 429 |
| 883 | 3300049579 | Ga0501043_0000067 | Ga0501043_0000067_18576_19913 | 429 |
| 884 | 3300049580 | Ga0501046_0000556 | Ga0501046_0000556_26687_28024 | 429 |
| 885 | 3300049581 | Ga0501047_0000061 | Ga0501047_0000061_105017_106354 | 429 |
| 886 | 3300049582 | Ga0501048_0000081 | Ga0501048_0000081_19250_20587 | 429 |
| 887 | 3300049583 | Ga0501067_0000337 | Ga0501067_0000337_12581_13918 | 429 |
| 888 | 3300049584 | Ga0501068_0001209 | Ga0501068_0001209_4694_6031 | 429 |
| 889 | 3300049586 | Ga0501070_0004162 | Ga0501070_0004162_140_1477 | 429 |
| 890 | 3300049588 | Ga0501072_0024951 | Ga0501072_0024951_3254_4591 | 429 |
| 891 | 3300049590 | Ga0501074_0001483 | Ga0501074_0001483_3496_4833 | 429 |
| 892 | 3300049592 | Ga0501076_0073707 | Ga0501076_0073707_908_2416 | 429 |
| 893 | 3300049593 | Ga0501077_0048866 | Ga0501077_0048866_590_1942 | 429 |
| 894 | 3300049741 | Ga0501079_0023853 | Ga0501079_0023853_2029_3366 | 429 |
| 895 | 3300049741 | Ga0501079_0080081 | Ga0501079_0080081_579_1916 | 429 |
| 896 | 3300049742 | Ga0501080_0000786 | Ga0501080_0000786_6881_8218 | 429 |
| 897 | 3300049744 | Ga0501083_0013787 | Ga0501083_0013787_675_2012 | 429 |
| 898 | 3300049822 | Ga0501035_0002419 | Ga0501035_0002419_53_1390 | 429 |
| 899 | 3300049823 | Ga0501044_0000028 | Ga0501044_0000028_133258_134595 | 429 |
| 900 | 3300049823 | Ga0501044_0007082 | Ga0501044_0007082_3628_4965 | 429 |
| 901 | 3300049824 | Ga0501045_0019197 | Ga0501045_0019197_1103_2440 | 429 |
| 902 | 3300049824 | Ga0501045_0064794 | Ga0501045_0064794_287_1639 | 429 |
| 903 | 3300050494 | nmdc:mga06z11_1539_c1 | nmdc:mga06z11_1539_c1_2916_4253 | 429 |
| 904 | 3300050507 | nmdc:mga05p37_30636_c1 | nmdc:mga05p37_30636_c1_78_1436 | 429 |
| 905 | 3300050510 | nmdc:mga06r32_75770_c1 | nmdc:mga06r32_75770_c1_1126_2463 | 429 |
| 906 | 3300050511 | nmdc:mga08y16_322689_c1 | nmdc:mga08y16_322689_c1_207_1511 | 429 |
| 907 | 3300050512 | nmdc:mga0n895_317314_c1 | nmdc:mga0n895_317314_c1_45_1379 | 429 |
| 908 | 3300050512 | nmdc:mga0n895_4630_c1 | nmdc:mga0n895_4630_c1_3138_4475 | 429 |
| 909 | 3300050513 | nmdc:mga0rr50_76664_c1 | nmdc:mga0rr50_76664_c1_321_1661 | 429 |
| 910 | 3300053077 | Ga0495601_0018011 | Ga0495601_0018011_1540_2889 | 429 |
| 911 | 3300053084 | Ga0495595_0006424 | Ga0495595_0006424_1414_2763 | 429 |
| 912 | 3300054114 | Ga0501084_0014366 | Ga0501084_0014366_610_1947 | 429 |
| 913 | 3300060353 | Ga0501082_0003510 | Ga0501082_0003510_9137_10474 | 429 |
| 914 | 3300060353 | Ga0501082_0063979 | Ga0501082_0063979_1723_3060 | 429 |
| 915 | iso_pu_bacteria | 2524023205 | 2524443658 | 429 |
| 916 | iso_pu_bacteria | 2935975950 | 2935981829 | 429 |
| 917 | iso_pu_bacteria | 8019629233 | 8019629586 | 429 |
| 918 | 3300002070 | JGI24750J21931_1004125 | JGI24750J21931_10041251 | 430 |
| 919 | 3300003215 | JGI25153J46596_10000235 | JGI25153J46596_1000023530 | 430 |
| 920 | 3300003911 | JGI25405J52794_10007662 | JGI25405J52794_100076621 | 430 |
| 921 | 3300004800 | Ga0058861_12054439 | Ga0058861_120544392 | 430 |
| 922 | 3300004803 | Ga0058862_12877440 | Ga0058862_128774402 | 430 |
| 923 | 3300005329 | Ga0070683_100021672 | Ga0070683_1000216724 | 430 |
| 924 | 3300005330 | Ga0070690_100088389 | Ga0070690_1000883892 | 430 |
| 925 | 3300005334 | Ga0068869_100023870 | Ga0068869_1000238704 | 430 |
| 926 | 3300005336 | Ga0070680_100005272 | Ga0070680_1000052728 | 430 |
| 927 | 3300005341 | Ga0070691_10010001 | Ga0070691_100100013 | 430 |
| 928 | 3300005347 | Ga0070668_100090201 | Ga0070668_1000902011 | 430 |
| 929 | 3300005353 | Ga0070669_100025193 | Ga0070669_1000251933 | 430 |
| 930 | 3300005367 | Ga0070667_100093206 | Ga0070667_1000932062 | 430 |
| 931 | 3300005406 | Ga0070703_10004788 | Ga0070703_100047884 | 430 |
| 932 | 3300005434 | Ga0070709_10001133 | Ga0070709_1000113311 | 430 |
| 933 | 3300005434 | Ga0070709_10004033 | Ga0070709_100040337 | 430 |
| 934 | 3300005434 | Ga0070709_10004449 | Ga0070709_100044495 | 430 |
| 935 | 3300005434 | Ga0070709_10021517 | Ga0070709_100215171 | 430 |
| 936 | 3300005435 | Ga0070714_100016189 | Ga0070714_1000161894 | 430 |
| 937 | 3300005435 | Ga0070714_100018552 | Ga0070714_1000185521 | 430 |
| 938 | 3300005435 | Ga0070714_100022544 | Ga0070714_1000225443 | 430 |
| 939 | 3300005436 | Ga0070713_100009541 | Ga0070713_1000095417 | 430 |
| 940 | 3300005436 | Ga0070713_100031677 | Ga0070713_1000316773 | 430 |
| 941 | 3300005436 | Ga0070713_100035565 | Ga0070713_1000355652 | 430 |
| 942 | 3300005436 | Ga0070713_100066685 | Ga0070713_1000666852 | 430 |
| 943 | 3300005436 | Ga0070713_100068483 | Ga0070713_1000684832 | 430 |
| 944 | 3300005437 | Ga0070710_10000179 | Ga0070710_1000017928 | 430 |
| 945 | 3300005437 | Ga0070710_10004558 | Ga0070710_100045582 | 430 |
| 946 | 3300005437 | Ga0070710_10005105 | Ga0070710_100051053 | 430 |
| 947 | 3300005439 | Ga0070711_100001224 | Ga0070711_10000122413 | 430 |
| 948 | 3300005439 | Ga0070711_100004199 | Ga0070711_1000041992 | 430 |
| 949 | 3300005439 | Ga0070711_100020059 | Ga0070711_1000200593 | 430 |
| 950 | 3300005439 | Ga0070711_100038988 | Ga0070711_1000389884 | 430 |
| 951 | 3300005440 | Ga0070705_100000027 | Ga0070705_10000002730 | 430 |
| 952 | 3300005441 | Ga0070700_100047463 | Ga0070700_1000474633 | 430 |
| 953 | 3300005441 | Ga0070700_100075207 | Ga0070700_1000752071 | 430 |
| 954 | 3300005444 | Ga0070694_100001546 | Ga0070694_1000015462 | 430 |
| 955 | 3300005444 | Ga0070694_100078086 | Ga0070694_1000780862 | 430 |
| 956 | 3300005457 | Ga0070662_100064764 | Ga0070662_1000647642 | 430 |
| 957 | 3300005457 | Ga0070662_100071696 | Ga0070662_1000716961 | 430 |
| 958 | 3300005458 | Ga0070681_10006430 | Ga0070681_100064306 | 430 |
| 959 | 3300005458 | Ga0070681_10026034 | Ga0070681_100260344 | 430 |
| 960 | 3300005458 | Ga0070681_10302006 | Ga0070681_103020061 | 430 |
| 961 | 3300005471 | Ga0070698_100054114 | Ga0070698_1000541142 | 430 |
| 962 | 3300005471 | Ga0070698_100131370 | Ga0070698_1001313702 | 430 |
| 963 | 3300005518 | Ga0070699_100003991 | Ga0070699_1000039916 | 430 |
| 964 | 3300005530 | Ga0070679_100027477 | Ga0070679_1000274774 | 430 |
| 965 | 3300005530 | Ga0070679_100111127 | Ga0070679_1001111271 | 430 |
| 966 | 3300005530 | Ga0070679_100129485 | Ga0070679_1001294852 | 430 |
| 967 | 3300005535 | Ga0070684_100030989 | Ga0070684_1000309893 | 430 |
| 968 | 3300005536 | Ga0070697_100025958 | Ga0070697_1000259583 | 430 |
| 969 | 3300005536 | Ga0070697_100121048 | Ga0070697_1001210482 | 430 |
| 970 | 3300005536 | Ga0070697_100164971 | Ga0070697_1001649712 | 430 |
| 971 | 3300005539 | Ga0068853_100031548 | Ga0068853_1000315484 | 430 |
| 972 | 3300005539 | Ga0068853_100160130 | Ga0068853_1001601301 | 430 |
| 973 | 3300005545 | Ga0070695_100001000 | Ga0070695_1000010004 | 430 |
| 974 | 3300005545 | Ga0070695_100004173 | Ga0070695_1000041734 | 430 |
| 975 | 3300005545 | Ga0070695_100021613 | Ga0070695_1000216132 | 430 |
| 976 | 3300005546 | Ga0070696_100000051 | Ga0070696_10000005151 | 430 |
| 977 | 3300005547 | Ga0070693_100004723 | Ga0070693_1000047236 | 430 |
| 978 | 3300005548 | Ga0070665_100141978 | Ga0070665_1001419782 | 430 |
| 979 | 3300005548 | Ga0070665_100220563 | Ga0070665_1002205632 | 430 |
| 980 | 3300005549 | Ga0070704_100005564 | Ga0070704_1000055642 | 430 |
| 981 | 3300005563 | Ga0068855_100096599 | Ga0068855_1000965994 | 430 |
| 982 | 3300005563 | Ga0068855_100238516 | Ga0068855_1002385161 | 430 |
| 983 | 3300005577 | Ga0068857_100009387 | Ga0068857_1000093877 | 430 |
| 984 | 3300005577 | Ga0068857_100014381 | Ga0068857_1000143813 | 430 |
| 985 | 3300005577 | Ga0068857_100063272 | Ga0068857_1000632722 | 430 |
| 986 | 3300005578 | Ga0068854_100100188 | Ga0068854_1001001882 | 430 |
| 987 | 3300005615 | Ga0070702_100051167 | Ga0070702_1000511672 | 430 |
| 988 | 3300005616 | Ga0068852_100314108 | Ga0068852_1003141081 | 430 |
| 989 | 3300005617 | Ga0068859_100017457 | Ga0068859_1000174575 | 430 |
| 990 | 3300005618 | Ga0068864_100040051 | Ga0068864_1000400511 | 430 |
| 991 | 3300005618 | Ga0068864_100074697 | Ga0068864_1000746972 | 430 |
| 992 | 3300005618 | Ga0068864_100149492 | Ga0068864_1001494922 | 430 |
| 993 | 3300005719 | Ga0068861_100050681 | Ga0068861_1000506812 | 430 |
| 994 | 3300005719 | Ga0068861_100060475 | Ga0068861_1000604752 | 430 |
| 995 | 3300005719 | Ga0068861_100151861 | Ga0068861_1001518612 | 430 |
| 996 | 3300005841 | Ga0068863_100093227 | Ga0068863_1000932271 | 430 |
| 997 | 3300005843 | Ga0068860_100000375 | Ga0068860_1000003754 | 430 |
| 998 | 3300005843 | Ga0068860_100001599 | Ga0068860_10000159916 | 430 |
| 999 | 3300005843 | Ga0068860_100013303 | Ga0068860_1000133034 | 430 |
| 1000 | 3300005843 | Ga0068860_100155199 | Ga0068860_1001551991 | 430 |
| 1001 | 3300005844 | Ga0068862_100001717 | Ga0068862_1000017174 | 430 |
| 1002 | 3300005844 | Ga0068862_100162667 | Ga0068862_1001626672 | 430 |
| 1003 | 3300005937 | Ga0081455_10000087 | Ga0081455_1000008710 | 430 |
| 1004 | 3300005937 | Ga0081455_10001255 | Ga0081455_1000125525 | 430 |
| 1005 | 3300005937 | Ga0081455_10003384 | Ga0081455_1000338419 | 430 |
| 1006 | 3300005983 | Ga0081540_1000413 | Ga0081540_100041341 | 430 |
| 1007 | 3300005983 | Ga0081540_1000629 | Ga0081540_10006299 | 430 |
| 1008 | 3300005983 | Ga0081540_1000794 | Ga0081540_100079419 | 430 |
| 1009 | 3300005983 | Ga0081540_1001058 | Ga0081540_100105823 | 430 |
| 1010 | 3300005983 | Ga0081540_1002242 | Ga0081540_10022423 | 430 |
| 1011 | 3300005983 | Ga0081540_1036043 | Ga0081540_10360432 | 430 |
| 1012 | 3300005983 | Ga0081540_1053418 | Ga0081540_10534181 | 430 |
| 1013 | 3300005985 | Ga0081539_10000080 | Ga0081539_1000008043 | 430 |
| 1014 | 3300005985 | Ga0081539_10003020 | Ga0081539_1000302023 | 430 |
| 1015 | 3300005985 | Ga0081539_10007934 | Ga0081539_100079346 | 430 |
| 1016 | 3300005985 | Ga0081539_10007934 | Ga0081539_100079347 | 430 |
| 1017 | 3300006028 | Ga0070717_10000770 | Ga0070717_1000077025 | 430 |
| 1018 | 3300006028 | Ga0070717_10006584 | Ga0070717_100065844 | 430 |
| 1019 | 3300006028 | Ga0070717_10018908 | Ga0070717_100189085 | 430 |
| 1020 | 3300006028 | Ga0070717_10040171 | Ga0070717_100401713 | 430 |
| 1021 | 3300006028 | Ga0070717_10051665 | Ga0070717_100516652 | 430 |
| 1022 | 3300006163 | Ga0070715_10000402 | Ga0070715_100004028 | 430 |
| 1023 | 3300006173 | Ga0070716_100012546 | Ga0070716_1000125461 | 430 |
| 1024 | 3300006173 | Ga0070716_100014813 | Ga0070716_1000148131 | 430 |
| 1025 | 3300006175 | Ga0070712_100022570 | Ga0070712_1000225704 | 430 |
| 1026 | 3300006175 | Ga0070712_100033570 | Ga0070712_1000335703 | 430 |
| 1027 | 3300006175 | Ga0070712_100076998 | Ga0070712_1000769981 | 430 |
| 1028 | 3300006175 | Ga0070712_100204214 | Ga0070712_1002042141 | 430 |
| 1029 | 3300006178 | Ga0075367_10015925 | Ga0075367_100159255 | 430 |
| 1030 | 3300006186 | Ga0075369_10006148 | Ga0075369_100061483 | 430 |
| 1031 | 3300006186 | Ga0075369_10021878 | Ga0075369_100218782 | 430 |
| 1032 | 3300006237 | Ga0097621_100122434 | Ga0097621_1001224342 | 430 |
| 1033 | 3300006358 | Ga0068871_100226887 | Ga0068871_1002268871 | 430 |
| 1034 | 3300006847 | Ga0075431_100141290 | Ga0075431_1001412902 | 430 |
| 1035 | 3300006852 | Ga0075433_10009387 | Ga0075433_100093873 | 430 |
| 1036 | 3300006852 | Ga0075433_10063791 | Ga0075433_100637912 | 430 |
| 1037 | 3300006871 | Ga0075434_100002046 | Ga0075434_1000020462 | 430 |
| 1038 | 3300006880 | Ga0075429_100125906 | Ga0075429_1001259062 | 430 |
| 1039 | 3300006914 | Ga0075436_100078249 | Ga0075436_1000782491 | 430 |
| 1040 | 3300006931 | Ga0097620_100017457 | Ga0097620_1000174575 | 430 |
| 1041 | 3300006931 | Ga0097620_100117315 | Ga0097620_1001173152 | 430 |
| 1042 | 3300007076 | Ga0075435_100009425 | Ga0075435_1000094254 | 430 |
| 1043 | 3300007265 | Ga0099794_10015670 | Ga0099794_100156703 | 430 |
| 1044 | 3300007788 | Ga0099795_10003491 | Ga0099795_100034912 | 430 |
| 1045 | 3300007788 | Ga0099795_10005064 | Ga0099795_100050641 | 430 |
| 1046 | 3300009092 | Ga0105250_10030645 | Ga0105250_100306451 | 430 |
| 1047 | 3300009093 | Ga0105240_10016315 | Ga0105240_100163154 | 430 |
| 1048 | 3300009094 | Ga0111539_10006076 | Ga0111539_100060767 | 430 |
| 1049 | 3300009094 | Ga0111539_10103652 | Ga0111539_101036521 | 430 |
| 1050 | 3300009094 | Ga0111539_10216054 | Ga0111539_102160542 | 430 |
| 1051 | 3300009098 | Ga0105245_10178531 | Ga0105245_101785311 | 430 |
| 1052 | 3300009101 | Ga0105247_10103880 | Ga0105247_101038801 | 430 |
| 1053 | 3300009147 | Ga0114129_10041435 | Ga0114129_100414354 | 430 |
| 1054 | 3300009148 | Ga0105243_10088118 | Ga0105243_100881181 | 430 |
| 1055 | 3300009174 | Ga0105241_10031659 | Ga0105241_100316592 | 430 |
| 1056 | 3300009174 | Ga0105241_10051550 | Ga0105241_100515501 | 430 |
| 1057 | 3300009545 | Ga0105237_10010000 | Ga0105237_100100009 | 430 |
| 1058 | 3300009545 | Ga0105237_10036555 | Ga0105237_100365552 | 430 |
| 1059 | 3300009545 | Ga0105237_10054113 | Ga0105237_100541132 | 430 |
| 1060 | 3300009545 | Ga0105237_10057725 | Ga0105237_100577252 | 430 |
| 1061 | 3300009545 | Ga0105237_10129278 | Ga0105237_101292781 | 430 |
| 1062 | 3300009545 | Ga0105237_10170473 | Ga0105237_101704731 | 430 |
| 1063 | 3300009545 | Ga0105237_10200818 | Ga0105237_102008182 | 430 |
| 1064 | 3300009553 | Ga0105249_10021936 | Ga0105249_100219365 | 430 |
| 1065 | 3300009553 | Ga0105249_10119031 | Ga0105249_101190312 | 430 |
| 1066 | 3300010159 | Ga0099796_10007346 | Ga0099796_100073463 | 430 |
| 1067 | 3300010159 | Ga0099796_10022593 | Ga0099796_100225931 | 430 |
| 1068 | 3300010375 | Ga0105239_10059751 | Ga0105239_100597516 | 430 |
| 1069 | 3300010375 | Ga0105239_10148787 | Ga0105239_101487872 | 430 |
| 1070 | 3300013105 | Ga0157369_10009982 | Ga0157369_100099823 | 430 |
| 1071 | 3300013297 | Ga0157378_10085252 | Ga0157378_100852522 | 430 |
| 1072 | 3300013306 | Ga0163162_10036057 | Ga0163162_100360572 | 430 |
| 1073 | 3300013306 | Ga0163162_10072199 | Ga0163162_100721992 | 430 |
| 1074 | 3300013306 | Ga0163162_10235260 | Ga0163162_102352602 | 430 |
| 1075 | 3300013308 | Ga0157375_10028331 | Ga0157375_100283312 | 430 |
| 1076 | 3300013308 | Ga0157375_10335939 | Ga0157375_103359391 | 430 |
| 1077 | 3300014325 | Ga0163163_10005199 | Ga0163163_100051997 | 430 |
| 1078 | 3300014325 | Ga0163163_10012257 | Ga0163163_100122575 | 430 |
| 1079 | 3300014325 | Ga0163163_10034855 | Ga0163163_100348553 | 430 |
| 1080 | 3300014325 | Ga0163163_10223241 | Ga0163163_102232412 | 430 |
| 1081 | 3300014326 | Ga0157380_10053360 | Ga0157380_100533601 | 430 |
| 1082 | 3300014968 | Ga0157379_10143626 | Ga0157379_101436261 | 430 |
| 1083 | 3300014969 | Ga0157376_10092413 | Ga0157376_100924132 | 430 |
| 1084 | 3300017792 | Ga0163161_10042735 | Ga0163161_100427352 | 430 |
| 1085 | 3300020069 | Ga0197907_10619077 | Ga0197907_106190772 | 430 |
| 1086 | 3300020070 | Ga0206356_11161776 | Ga0206356_111617762 | 430 |
| 1087 | 3300020076 | Ga0206355_1316074 | Ga0206355_13160742 | 430 |
| 1088 | 3300020076 | Ga0206355_1578423 | Ga0206355_15784231 | 430 |
| 1089 | 3300020077 | Ga0206351_10575076 | Ga0206351_105750761 | 430 |
| 1090 | 3300020078 | Ga0206352_10061378 | Ga0206352_100613782 | 430 |
| 1091 | 3300020081 | Ga0206354_10280028 | Ga0206354_102800281 | 430 |
| 1092 | 3300020081 | Ga0206354_10650967 | Ga0206354_106509672 | 430 |
| 1093 | 3300020082 | Ga0206353_10469523 | Ga0206353_104695231 | 430 |
| 1094 | 3300020082 | Ga0206353_10483150 | Ga0206353_104831501 | 430 |
| 1095 | 3300022467 | Ga0224712_10022783 | Ga0224712_100227832 | 430 |
| 1096 | 3300022467 | Ga0224712_10023166 | Ga0224712_100231662 | 430 |
| 1097 | 3300025297 | Ga0209758_1000211 | Ga0209758_100021118 | 430 |
| 1098 | 3300025711 | Ga0207696_1022896 | Ga0207696_10228961 | 430 |
| 1099 | 3300025898 | Ga0207692_10000069 | Ga0207692_1000006912 | 430 |
| 1100 | 3300025898 | Ga0207692_10047515 | Ga0207692_100475151 | 430 |
| 1101 | 3300025898 | Ga0207692_10122593 | Ga0207692_101225931 | 430 |
| 1102 | 3300025899 | Ga0207642_10033258 | Ga0207642_100332581 | 430 |
| 1103 | 3300025901 | Ga0207688_10078787 | Ga0207688_100787871 | 430 |
| 1104 | 3300025901 | Ga0207688_10097358 | Ga0207688_100973581 | 430 |
| 1105 | 3300025905 | Ga0207685_10009496 | Ga0207685_100094962 | 430 |
| 1106 | 3300025906 | Ga0207699_10000289 | Ga0207699_1000028924 | 430 |
| 1107 | 3300025906 | Ga0207699_10008164 | Ga0207699_100081641 | 430 |
| 1108 | 3300025906 | Ga0207699_10013807 | Ga0207699_100138072 | 430 |
| 1109 | 3300025910 | Ga0207684_10208540 | Ga0207684_102085402 | 430 |
| 1110 | 3300025911 | Ga0207654_10019277 | Ga0207654_100192772 | 430 |
| 1111 | 3300025912 | Ga0207707_10001525 | Ga0207707_100015255 | 430 |
| 1112 | 3300025912 | Ga0207707_10010954 | Ga0207707_100109544 | 430 |
| 1113 | 3300025912 | Ga0207707_10013724 | Ga0207707_100137243 | 430 |
| 1114 | 3300025913 | Ga0207695_10058307 | Ga0207695_100583074 | 430 |
| 1115 | 3300025914 | Ga0207671_10037819 | Ga0207671_100378192 | 430 |
| 1116 | 3300025914 | Ga0207671_10054490 | Ga0207671_100544902 | 430 |
| 1117 | 3300025914 | Ga0207671_10147168 | Ga0207671_101471681 | 430 |
| 1118 | 3300025915 | Ga0207693_10002947 | Ga0207693_100029479 | 430 |
| 1119 | 3300025915 | Ga0207693_10008488 | Ga0207693_100084884 | 430 |
| 1120 | 3300025915 | Ga0207693_10016489 | Ga0207693_100164896 | 430 |
| 1121 | 3300025915 | Ga0207693_10032710 | Ga0207693_100327101 | 430 |
| 1122 | 3300025915 | Ga0207693_10164763 | Ga0207693_101647631 | 430 |
| 1123 | 3300025916 | Ga0207663_10001917 | Ga0207663_1000191712 | 430 |
| 1124 | 3300025916 | Ga0207663_10002533 | Ga0207663_100025336 | 430 |
| 1125 | 3300025916 | Ga0207663_10018130 | Ga0207663_100181304 | 430 |
| 1126 | 3300025916 | Ga0207663_10035940 | Ga0207663_100359402 | 430 |
| 1127 | 3300025916 | Ga0207663_10103332 | Ga0207663_101033322 | 430 |
| 1128 | 3300025917 | Ga0207660_10001543 | Ga0207660_100015438 | 430 |
| 1129 | 3300025917 | Ga0207660_10057636 | Ga0207660_100576362 | 430 |
| 1130 | 3300025917 | Ga0207660_10090179 | Ga0207660_100901792 | 430 |
| 1131 | 3300025921 | Ga0207652_10006206 | Ga0207652_100062063 | 430 |
| 1132 | 3300025921 | Ga0207652_10067123 | Ga0207652_100671233 | 430 |
| 1133 | 3300025921 | Ga0207652_10071777 | Ga0207652_100717773 | 430 |
| 1134 | 3300025921 | Ga0207652_10075046 | Ga0207652_100750463 | 430 |
| 1135 | 3300025924 | Ga0207694_10025225 | Ga0207694_100252252 | 430 |
| 1136 | 3300025927 | Ga0207687_10033081 | Ga0207687_100330813 | 430 |
| 1137 | 3300025928 | Ga0207700_10003623 | Ga0207700_100036235 | 430 |
| 1138 | 3300025928 | Ga0207700_10013365 | Ga0207700_100133655 | 430 |
| 1139 | 3300025928 | Ga0207700_10015503 | Ga0207700_100155036 | 430 |
| 1140 | 3300025928 | Ga0207700_10025830 | Ga0207700_100258302 | 430 |
| 1141 | 3300025928 | Ga0207700_10114873 | Ga0207700_101148731 | 430 |
| 1142 | 3300025929 | Ga0207664_10005442 | Ga0207664_100054427 | 430 |
| 1143 | 3300025929 | Ga0207664_10005962 | Ga0207664_100059627 | 430 |
| 1144 | 3300025929 | Ga0207664_10006018 | Ga0207664_100060183 | 430 |
| 1145 | 3300025929 | Ga0207664_10023512 | Ga0207664_100235121 | 430 |
| 1146 | 3300025929 | Ga0207664_10068321 | Ga0207664_100683211 | 430 |
| 1147 | 3300025933 | Ga0207706_10017340 | Ga0207706_100173401 | 430 |
| 1148 | 3300025933 | Ga0207706_10073694 | Ga0207706_100736942 | 430 |
| 1149 | 3300025935 | Ga0207709_10076358 | Ga0207709_100763581 | 430 |
| 1150 | 3300025935 | Ga0207709_10080306 | Ga0207709_100803061 | 430 |
| 1151 | 3300025936 | Ga0207670_10054619 | Ga0207670_100546194 | 430 |
| 1152 | 3300025937 | Ga0207669_10001922 | Ga0207669_100019224 | 430 |
| 1153 | 3300025938 | Ga0207704_10172861 | Ga0207704_101728611 | 430 |
| 1154 | 3300025939 | Ga0207665_10005674 | Ga0207665_100056744 | 430 |
| 1155 | 3300025939 | Ga0207665_10016250 | Ga0207665_100162503 | 430 |
| 1156 | 3300025942 | Ga0207689_10124466 | Ga0207689_101244661 | 430 |
| 1157 | 3300025944 | Ga0207661_10038523 | Ga0207661_100385231 | 430 |
| 1158 | 3300025949 | Ga0207667_10134908 | Ga0207667_101349082 | 430 |
| 1159 | 3300025961 | Ga0207712_10006806 | Ga0207712_100068062 | 430 |
| 1160 | 3300025961 | Ga0207712_10036612 | Ga0207712_100366122 | 430 |
| 1161 | 3300025961 | Ga0207712_10105979 | Ga0207712_101059792 | 430 |
| 1162 | 3300025972 | Ga0207668_10006532 | Ga0207668_100065321 | 430 |
| 1163 | 3300025972 | Ga0207668_10066311 | Ga0207668_100663111 | 430 |
| 1164 | 3300025986 | Ga0207658_10142335 | Ga0207658_101423351 | 430 |
| 1165 | 3300026041 | Ga0207639_10044210 | Ga0207639_100442102 | 430 |
| 1166 | 3300026041 | Ga0207639_10143422 | Ga0207639_101434221 | 430 |
| 1167 | 3300026067 | Ga0207678_10023262 | Ga0207678_100232622 | 430 |
| 1168 | 3300026067 | Ga0207678_10118834 | Ga0207678_101188342 | 430 |
| 1169 | 3300026075 | Ga0207708_10013604 | Ga0207708_100136044 | 430 |
| 1170 | 3300026075 | Ga0207708_10100894 | Ga0207708_101008942 | 430 |
| 1171 | 3300026075 | Ga0207708_10133803 | Ga0207708_101338031 | 430 |
| 1172 | 3300026075 | Ga0207708_10161225 | Ga0207708_101612252 | 430 |
| 1173 | 3300026095 | Ga0207676_10041124 | Ga0207676_100411243 | 430 |
| 1174 | 3300026095 | Ga0207676_10051483 | Ga0207676_100514832 | 430 |
| 1175 | 3300026116 | Ga0207674_10003474 | Ga0207674_100034743 | 430 |
| 1176 | 3300026116 | Ga0207674_10119674 | Ga0207674_101196742 | 430 |
| 1177 | 3300026116 | Ga0207674_10138856 | Ga0207674_101388561 | 430 |
| 1178 | 3300026118 | Ga0207675_100022031 | Ga0207675_1000220312 | 430 |
| 1179 | 3300026118 | Ga0207675_100047496 | Ga0207675_1000474962 | 430 |
| 1180 | 3300026118 | Ga0207675_100077104 | Ga0207675_1000771042 | 430 |
| 1181 | 3300026118 | Ga0207675_100376634 | Ga0207675_1003766341 | 430 |
| 1182 | 3300026121 | Ga0207683_10043864 | Ga0207683_100438643 | 430 |
| 1183 | 3300027512 | Ga0209179_1004665 | Ga0209179_10046651 | 430 |
| 1184 | 3300027671 | Ga0209588_1004526 | Ga0209588_10045264 | 430 |
| 1185 | 3300028379 | Ga0268266_10058109 | Ga0268266_100581092 | 430 |
| 1186 | 3300028380 | Ga0268265_10008419 | Ga0268265_100084191 | 430 |
| 1187 | 3300028380 | Ga0268265_10027002 | Ga0268265_100270022 | 430 |
| 1188 | 3300028381 | Ga0268264_10000162 | Ga0268264_1000016287 | 430 |
| 1189 | 3300028381 | Ga0268264_10003345 | Ga0268264_1000334513 | 430 |
| 1190 | 3300028381 | Ga0268264_10023769 | Ga0268264_100237693 | 430 |
| 1191 | 3300028381 | Ga0268264_10039768 | Ga0268264_100397682 | 430 |
| 1192 | 3300028381 | Ga0268264_10108822 | Ga0268264_101088222 | 430 |
| 1193 | 3300028381 | Ga0268264_10117309 | Ga0268264_101173092 | 430 |
| 1194 | 3300028653 | Ga0265323_10002402 | Ga0265323_100024029 | 430 |
| 1195 | 3300028666 | Ga0265336_10000443 | Ga0265336_1000044311 | 430 |
| 1196 | 3300028800 | Ga0265338_10001194 | Ga0265338_1000119427 | 430 |
| 1197 | 3300031249 | Ga0265339_10003343 | Ga0265339_1000334311 | 430 |
| 1198 | 3300031344 | Ga0265316_10131217 | Ga0265316_101312172 | 430 |
| 1199 | 3300031456 | Ga0307513_10084490 | Ga0307513_100844902 | 430 |
| 1200 | 3300031507 | Ga0307509_10033205 | Ga0307509_100332054 | 430 |
| 1201 | 3300031507 | Ga0307509_10232821 | Ga0307509_102328211 | 430 |
| 1202 | 3300035111 | Ga0373923_0041798 | Ga0373923_0041798_301_1641 | 430 |
| 1203 | 3300035113 | Ga0373936_0039797 | Ga0373936_0039797_458_1798 | 430 |
| 1204 | 3300035116 | Ga0373945_0007800 | Ga0373945_0007800_1631_2923 | 430 |
| 1205 | 3300035116 | Ga0373945_0053648 | Ga0373945_0053648_137_1474 | 430 |
| 1206 | 3300035117 | Ga0373953_0009137 | Ga0373953_0009137_456_1796 | 430 |
| 1207 | 3300035118 | Ga0373954_0003873 | Ga0373954_0003873_4955_6295 | 430 |
| 1208 | 3300035119 | Ga0373956_0007433 | Ga0373956_0007433_2031_3371 | 430 |
| 1209 | 3300035120 | Ga0373957_0003550 | Ga0373957_0003550_555_1895 | 430 |
| 1210 | 3300035170 | Ga0373943_0003064 | Ga0373943_0003064_6207_7547 | 430 |
| 1211 | 3300035170 | Ga0373943_0012722 | Ga0373943_0012722_2293_3585 | 430 |
| 1212 | 3300035171 | Ga0373946_0001574 | Ga0373946_0001574_5852_7192 | 430 |
| 1213 | 3300035172 | Ga0373955_0006580 | Ga0373955_0006580_925_2265 | 430 |
| 1214 | 3300035172 | Ga0373955_0018941 | Ga0373955_0018941_1016_2308 | 430 |
| 1215 | 3300035410 | Ga0373924_0040288 | Ga0373924_0040288_407_1747 | 430 |
| 1216 | 3300035692 | Ga0373935_0000468 | Ga0373935_0000468_9632_10972 | 430 |
| 1217 | 3300035692 | Ga0373935_0017306 | Ga0373935_0017306_1755_3047 | 430 |
| 1218 | 3300035692 | Ga0373935_0057971 | Ga0373935_0057971_731_2071 | 430 |
| 1219 | 3300035692 | Ga0373935_0111111 | Ga0373935_0111111_366_1706 | 430 |
| 1220 | 3300035695 | Ga0373927_0000801 | Ga0373927_0000801_5269_6609 | 430 |
| 1221 | 3300035695 | Ga0373927_0029396 | Ga0373927_0029396_1602_2894 | 430 |
| 1222 | 3300035724 | Ga0373933_0006978 | Ga0373933_0006978_4135_5475 | 430 |
| 1223 | 3300035724 | Ga0373933_0067689 | Ga0373933_0067689_104_1444 | 430 |
| 1224 | 3300035725 | Ga0373947_0004970 | Ga0373947_0004970_6279_7619 | 430 |
| 1225 | 3300035725 | Ga0373947_0008677 | Ga0373947_0008677_410_1702 | 430 |
| 1226 | 3300036401 | Ga0373937_0013442 | Ga0373937_0013442_1704_3044 | 430 |
| 1227 | 3300037068 | Ga0373925_0005078 | Ga0373925_0005078_5314_6606 | 430 |
| 1228 | 3300037068 | Ga0373925_0066373 | Ga0373925_0066373_622_1965 | 430 |
| 1229 | 3300037312 | Ga0395899_0035966 | Ga0395899_0035966_2073_3413 | 430 |
| 1230 | 3300037418 | Ga0395900_0010114 | Ga0395900_0010114_585_1925 | 430 |
| 1231 | 3300037466 | Ga0395898_0120358 | Ga0395898_0120358_702_2045 | 430 |
| 1232 | 3300037466 | Ga0395898_0177688 | Ga0395898_0177688_635_1975 | 430 |
| 1233 | 3300037471 | Ga0395905_0002573 | Ga0395905_0002573_8393_9685 | 430 |
| 1234 | 3300037471 | Ga0395905_0209939 | Ga0395905_0209939_359_1651 | 430 |
| 1235 | 3300038443 | Ga0395901_0002009 | Ga0395901_0002009_16199_17539 | 430 |
| 1236 | 3300039450 | Ga0436363_1263636 | Ga0436363_1263636_2727_4064 | 430 |
| 1237 | 3300039453 | Ga0436362_0446479 | Ga0436362_0446479_3332_4624 | 430 |
| 1238 | 3300041452 | Ga0451793_0230553 | Ga0451793_0230553_378_1670 | 430 |
| 1239 | 3300042436 | Ga0439435_0026053 | Ga0439435_0026053_168_1508 | 430 |
| 1240 | 3300044656 | Ga0466969_0026253 | Ga0466969_0026253_1030_2322 | 430 |
| 1241 | 3300044658 | Ga0466972_0000238 | Ga0466972_0000238_10900_12192 | 430 |
| 1242 | 3300044658 | Ga0466972_0000728 | Ga0466972_0000728_7415_8707 | 430 |
| 1243 | 3300044683 | Ga0466965_0011418 | Ga0466965_0011418_488_1795 | 430 |
| 1244 | 3300044684 | Ga0466966_0009776 | Ga0466966_0009776_2654_3946 | 430 |
| 1245 | 3300044693 | Ga0466961_0000007 | Ga0466961_0000007_107439_108731 | 430 |
| 1246 | 3300044693 | Ga0466961_0114167 | Ga0466961_0114167_110_1651 | 430 |
| 1247 | 3300044735 | Ga0466968_0000531 | Ga0466968_0000531_6074_7366 | 430 |
| 1248 | 3300045049 | Ga0466959_0006767 | Ga0466959_0006767_904_2196 | 430 |
| 1249 | 3300045049 | Ga0466959_0022085 | Ga0466959_0022085_558_2099 | 430 |
| 1250 | 3300045049 | Ga0466959_0164384 | Ga0466959_0164384_49_1392 | 430 |
| 1251 | 3300045976 | Ga0466967_0100148 | Ga0466967_0100148_558_1850 | 430 |
| 1252 | 3300046454 | Ga0495592_0009635 | Ga0495592_0009635_5382_6722 | 430 |
| 1253 | 3300046454 | Ga0495592_0135214 | Ga0495592_0135214_204_1544 | 430 |
| 1254 | 3300046455 | Ga0495603_0000076 | Ga0495603_0000076_23799_25139 | 430 |
| 1255 | 3300046455 | Ga0495603_0000298 | Ga0495603_0000298_3988_5280 | 430 |
| 1256 | 3300046455 | Ga0495603_0001807 | Ga0495603_0001807_6283_7623 | 430 |
| 1257 | 3300046457 | Ga0495590_0023171 | Ga0495590_0023171_669_1961 | 430 |
| 1258 | 3300046459 | Ga0495629_0000087 | Ga0495629_0000087_63661_65001 | 430 |
| 1259 | 3300046459 | Ga0495629_0000336 | Ga0495629_0000336_34716_36008 | 430 |
| 1260 | 3300046459 | Ga0495629_0031544 | Ga0495629_0031544_1869_3209 | 430 |
| 1261 | 3300046460 | Ga0495638_0004997 | Ga0495638_0004997_6120_7412 | 430 |
| 1262 | 3300046461 | Ga0495641_0005191 | Ga0495641_0005191_2458_3750 | 430 |
| 1263 | 3300046462 | Ga0495651_0016316 | Ga0495651_0016316_2836_4176 | 430 |
| 1264 | 3300046462 | Ga0495651_0032043 | Ga0495651_0032043_2283_3575 | 430 |
| 1265 | 3300046463 | Ga0495653_0013726 | Ga0495653_0013726_1494_2834 | 430 |
| 1266 | 3300046472 | Ga0495580_0000735 | Ga0495580_0000735_8389_9729 | 430 |
| 1267 | 3300046472 | Ga0495580_0003367 | Ga0495580_0003367_4136_5428 | 430 |
| 1268 | 3300046473 | Ga0495582_0000101 | Ga0495582_0000101_17366_18706 | 430 |
| 1269 | 3300046473 | Ga0495582_0000134 | Ga0495582_0000134_34383_35675 | 430 |
| 1270 | 3300046475 | Ga0495639_0000022 | Ga0495639_0000022_1674_3014 | 430 |
| 1271 | 3300046475 | Ga0495639_0001106 | Ga0495639_0001106_4392_5684 | 430 |
| 1272 | 3300046476 | Ga0495662_0000460 | Ga0495662_0000460_9269_10609 | 430 |
| 1273 | 3300046476 | Ga0495662_0001392 | Ga0495662_0001392_3940_5232 | 430 |
| 1274 | 3300046477 | Ga0495664_0010312 | Ga0495664_0010312_1530_2870 | 430 |
| 1275 | 3300046477 | Ga0495664_0017317 | Ga0495664_0017317_295_1635 | 430 |
| 1276 | 3300046477 | Ga0495664_0024065 | Ga0495664_0024065_1851_3143 | 430 |
| 1277 | 3300046477 | Ga0495664_0080243 | Ga0495664_0080243_595_1935 | 430 |
| 1278 | 3300046491 | Ga0495584_0061733 | Ga0495584_0061733_106_1398 | 430 |
| 1279 | 3300046499 | Ga0495594_0000176 | Ga0495594_0000176_25303_26643 | 430 |
| 1280 | 3300046499 | Ga0495594_0001316 | Ga0495594_0001316_4164_5456 | 430 |
| 1281 | 3300046511 | Ga0495608_0009651 | Ga0495608_0009651_1980_3320 | 430 |
| 1282 | 3300046516 | Ga0495628_0023257 | Ga0495628_0023257_1899_3239 | 430 |
| 1283 | 3300046516 | Ga0495628_0036847 | Ga0495628_0036847_2599_3891 | 430 |
| 1284 | 3300046516 | Ga0495628_0067721 | Ga0495628_0067721_300_1592 | 430 |
| 1285 | 3300046516 | Ga0495628_0153080 | Ga0495628_0153080_386_1678 | 430 |
| 1286 | 3300046517 | Ga0495630_0010164 | Ga0495630_0010164_867_2159 | 430 |
| 1287 | 3300046522 | Ga0495643_0092925 | Ga0495643_0092925_144_1436 | 430 |
| 1288 | 3300046529 | Ga0495652_0009267 | Ga0495652_0009267_1299_2639 | 430 |
| 1289 | 3300046531 | Ga0495665_0000064 | Ga0495665_0000064_12778_14118 | 430 |
| 1290 | 3300046531 | Ga0495665_0005050 | Ga0495665_0005050_3349_4641 | 430 |
| 1291 | 3300046533 | Ga0495640_0016218 | Ga0495640_0016218_2702_4042 | 430 |
| 1292 | 3300046533 | Ga0495640_0074143 | Ga0495640_0074143_881_2173 | 430 |
| 1293 | 3300046536 | Ga0495587_0012587 | Ga0495587_0012587_2300_3640 | 430 |
| 1294 | 3300046543 | Ga0495645_0004431 | Ga0495645_0004431_7826_9166 | 430 |
| 1295 | 3300046543 | Ga0495645_0030408 | Ga0495645_0030408_1207_2547 | 430 |
| 1296 | 3300046557 | Ga0495622_0005549 | Ga0495622_0005549_3381_4673 | 430 |
| 1297 | 3300046559 | Ga0495667_0010132 | Ga0495667_0010132_4775_6115 | 430 |
| 1298 | 3300046559 | Ga0495667_0060668 | Ga0495667_0060668_19_1311 | 430 |
| 1299 | 3300046616 | Ga0495668_0049236 | Ga0495668_0049236_704_2044 | 430 |
| 1300 | 3300046642 | Ga0495634_0007620 | Ga0495634_0007620_4000_5292 | 430 |
| 1301 | 3300046642 | Ga0495634_0012312 | Ga0495634_0012312_2294_3634 | 430 |
| 1302 | 3300046642 | Ga0495634_0024752 | Ga0495634_0024752_2523_3863 | 430 |
| 1303 | 3300046660 | Ga0495625_0114002 | Ga0495625_0114002_467_1759 | 430 |
| 1304 | 3300046663 | Ga0495635_0001496 | Ga0495635_0001496_11165_12505 | 430 |
| 1305 | 3300046663 | Ga0495635_0010556 | Ga0495635_0010556_4461_5801 | 430 |
| 1306 | 3300046663 | Ga0495635_0030771 | Ga0495635_0030771_996_2288 | 430 |
| 1307 | 3300046665 | Ga0495661_0113893 | Ga0495661_0113893_56_1393 | 430 |
| 1308 | 3300046674 | Ga0495588_0013711 | Ga0495588_0013711_440_1732 | 430 |
| 1309 | 3300046675 | Ga0495657_0031437 | Ga0495657_0031437_1861_3153 | 430 |
| 1310 | 3300046675 | Ga0495657_0037019 | Ga0495657_0037019_914_2254 | 430 |
| 1311 | 3300046678 | Ga0495599_0003798 | Ga0495599_0003798_154_1494 | 430 |
| 1312 | 3300046678 | Ga0495599_0045639 | Ga0495599_0045639_1181_2473 | 430 |
| 1313 | 3300046679 | Ga0495623_0005956 | Ga0495623_0005956_1689_3029 | 430 |
| 1314 | 3300046679 | Ga0495623_0085831 | Ga0495623_0085831_224_1567 | 430 |
| 1315 | 3300046680 | Ga0495646_0008942 | Ga0495646_0008942_4196_5536 | 430 |
| 1316 | 3300046681 | Ga0495647_0015228 | Ga0495647_0015228_878_2170 | 430 |
| 1317 | 3300046683 | Ga0495658_0000683 | Ga0495658_0000683_5684_7024 | 430 |
| 1318 | 3300046683 | Ga0495658_0025843 | Ga0495658_0025843_1367_2659 | 430 |
| 1319 | 3300046689 | Ga0495613_0037705 | Ga0495613_0037705_28_1320 | 430 |
| 1320 | 3300046689 | Ga0495613_0039134 | Ga0495613_0039134_2095_3435 | 430 |
| 1321 | 3300046690 | Ga0495624_0006443 | Ga0495624_0006443_2733_4025 | 430 |
| 1322 | 3300046690 | Ga0495624_0007443 | Ga0495624_0007443_36_1376 | 430 |
| 1323 | 3300046809 | Ga0495600_0020623 | Ga0495600_0020623_1576_2916 | 430 |
| 1324 | 3300046809 | Ga0495600_0035649 | Ga0495600_0035649_1494_2786 | 430 |
| 1325 | 3300047315 | Ga0495581_0000072 | Ga0495581_0000072_34392_35684 | 430 |
| 1326 | 3300047315 | Ga0495581_0000139 | Ga0495581_0000139_3423_4763 | 430 |
| 1327 | 3300047317 | Ga0495604_0009620 | Ga0495604_0009620_1845_3185 | 430 |
| 1328 | 3300047317 | Ga0495604_0039436 | Ga0495604_0039436_2186_3478 | 430 |
| 1329 | 3300047319 | Ga0495674_0000523 | Ga0495674_0000523_18044_19384 | 430 |
| 1330 | 3300047319 | Ga0495674_0005593 | Ga0495674_0005593_5550_6890 | 430 |
| 1331 | 3300047319 | Ga0495674_0008405 | Ga0495674_0008405_6206_7498 | 430 |
| 1332 | 3300047320 | Ga0495672_0016998 | Ga0495672_0016998_689_2029 | 430 |
| 1333 | 3300047321 | Ga0495676_0045413 | Ga0495676_0045413_204_1499 | 430 |
| 1334 | 3300047322 | Ga0495680_0013168 | Ga0495680_0013168_2852_4192 | 430 |
| 1335 | 3300047322 | Ga0495680_0031385 | Ga0495680_0031385_1667_2959 | 430 |
| 1336 | 3300047322 | Ga0495680_0109442 | Ga0495680_0109442_747_2039 | 430 |
| 1337 | 3300047444 | Ga0495675_0004139 | Ga0495675_0004139_4703_6043 | 430 |
| 1338 | 3300047471 | Ga0495684_0028162 | Ga0495684_0028162_807_2099 | 430 |
| 1339 | 3300047673 | Ga0495593_0000042 | Ga0495593_0000042_8262_9602 | 430 |
| 1340 | 3300047673 | Ga0495593_0000094 | Ga0495593_0000094_34380_35672 | 430 |
| 1341 | 3300048088 | Ga0495602_0007342 | Ga0495602_0007342_5310_6650 | 430 |
| 1342 | 3300048089 | Ga0495614_0021380 | Ga0495614_0021380_981_2321 | 430 |
| 1343 | 3300048903 | Ga0496100_0111092 | Ga0496100_0111092_470_1807 | 430 |
| 1344 | 3300048904 | Ga0496101_0019246 | Ga0496101_0019246_34_1374 | 430 |
| 1345 | 3300048904 | Ga0496101_0077398 | Ga0496101_0077398_427_1767 | 430 |
| 1346 | 3300048904 | Ga0496101_0094017 | Ga0496101_0094017_41_1378 | 430 |
| 1347 | 3300048905 | Ga0496102_0031856 | Ga0496102_0031856_681_2018 | 430 |
| 1348 | 3300048905 | Ga0496102_0089138 | Ga0496102_0089138_192_1529 | 430 |
| 1349 | 3300048905 | Ga0496102_0175760 | Ga0496102_0175760_329_1621 | 430 |
| 1350 | 3300048905 | Ga0496102_0213020 | Ga0496102_0213020_204_1544 | 430 |
| 1351 | 3300048906 | Ga0496103_0044178 | Ga0496103_0044178_598_1905 | 430 |
| 1352 | 3300048906 | Ga0496103_0116851 | Ga0496103_0116851_122_1414 | 430 |
| 1353 | 3300048907 | Ga0496104_0003135 | Ga0496104_0003135_1136_2476 | 430 |
| 1354 | 3300048907 | Ga0496104_0037046 | Ga0496104_0037046_1636_2928 | 430 |
| 1355 | 3300048907 | Ga0496104_0097007 | Ga0496104_0097007_1022_2365 | 430 |
| 1356 | 3300048907 | Ga0496104_0157241 | Ga0496104_0157241_763_2103 | 430 |
| 1357 | 3300048908 | Ga0496105_0168430 | Ga0496105_0168430_53_1396 | 430 |
| 1358 | 3300048909 | Ga0496106_0037139 | Ga0496106_0037139_323_1663 | 430 |
| 1359 | 3300048909 | Ga0496106_0079272 | Ga0496106_0079272_452_1795 | 430 |
| 1360 | 3300048910 | Ga0496107_0064733 | Ga0496107_0064733_14_1354 | 430 |
| 1361 | 3300048911 | Ga0496108_0023873 | Ga0496108_0023873_1379_2719 | 430 |
| 1362 | 3300048911 | Ga0496108_0192153 | Ga0496108_0192153_194_1486 | 430 |
| 1363 | 3300048912 | Ga0496109_0014967 | Ga0496109_0014967_5031_6371 | 430 |
| 1364 | 3300048912 | Ga0496109_0054017 | Ga0496109_0054017_62_1402 | 430 |
| 1365 | 3300048912 | Ga0496109_0113482 | Ga0496109_0113482_955_2247 | 430 |
| 1366 | 3300048912 | Ga0496109_0131890 | Ga0496109_0131890_406_1749 | 430 |
| 1367 | 3300048912 | Ga0496109_0132733 | Ga0496109_0132733_530_1867 | 430 |
| 1368 | 3300048913 | Ga0496110_0007058 | Ga0496110_0007058_3581_4921 | 430 |
| 1369 | 3300048913 | Ga0496110_0045039 | Ga0496110_0045039_2114_3406 | 430 |
| 1370 | 3300048913 | Ga0496110_0053222 | Ga0496110_0053222_1337_2629 | 430 |
| 1371 | 3300048914 | Ga0496111_0051182 | Ga0496111_0051182_631_1971 | 430 |
| 1372 | 3300048914 | Ga0496111_0225133 | Ga0496111_0225133_91_1383 | 430 |
| 1373 | 3300048915 | Ga0496112_0005306 | Ga0496112_0005306_620_1963 | 430 |
| 1374 | 3300048915 | Ga0496112_0013677 | Ga0496112_0013677_4535_5875 | 430 |
| 1375 | 3300048915 | Ga0496112_0056255 | Ga0496112_0056255_1999_3339 | 430 |
| 1376 | 3300048915 | Ga0496112_0199172 | Ga0496112_0199172_595_1932 | 430 |
| 1377 | 3300048916 | Ga0496113_0000751 | Ga0496113_0000751_37_1377 | 430 |
| 1378 | 3300048916 | Ga0496113_0051573 | Ga0496113_0051573_468_1811 | 430 |
| 1379 | 3300048917 | Ga0496114_0205568 | Ga0496114_0205568_341_1681 | 430 |
| 1380 | 3300048918 | Ga0496115_0017758 | Ga0496115_0017758_3562_4902 | 430 |
| 1381 | 3300048918 | Ga0496115_0196223 | Ga0496115_0196223_163_1500 | 430 |
| 1382 | 3300048920 | Ga0496117_0115943 | Ga0496117_0115943_84_1376 | 430 |
| 1383 | 3300048923 | Ga0496120_0054003 | Ga0496120_0054003_860_2152 | 430 |
| 1384 | 3300048924 | Ga0496121_0026727 | Ga0496121_0026727_3857_5263 | 430 |
| 1385 | 3300048924 | Ga0496121_0059454 | Ga0496121_0059454_905_2254 | 430 |
| 1386 | 3300048927 | Ga0496124_0017261 | Ga0496124_0017261_261_1601 | 430 |
| 1387 | 3300048927 | Ga0496124_0089563 | Ga0496124_0089563_842_2182 | 430 |
| 1388 | 3300048928 | Ga0496125_0007099 | Ga0496125_0007099_28_1320 | 430 |
| 1389 | 3300048929 | Ga0496126_0016460 | Ga0496126_0016460_2035_3327 | 430 |
| 1390 | 3300048929 | Ga0496126_0046793 | Ga0496126_0046793_2443_3945 | 430 |
| 1391 | 3300048929 | Ga0496126_0059880 | Ga0496126_0059880_436_1776 | 430 |
| 1392 | 3300048929 | Ga0496126_0094303 | Ga0496126_0094303_677_2014 | 430 |
| 1393 | 3300048929 | Ga0496126_0129303 | Ga0496126_0129303_611_1951 | 430 |
| 1394 | 3300049571 | Ga0501034_0042095 | Ga0501034_0042095_850_2190 | 430 |
| 1395 | 3300049575 | Ga0501039_0050696 | Ga0501039_0050696_1173_2513 | 430 |
| 1396 | 3300049585 | Ga0501069_0054953 | Ga0501069_0054953_184_1524 | 430 |
| 1397 | 3300049742 | Ga0501080_0323418 | Ga0501080_0323418_34_1359 | 430 |
| 1398 | 3300049744 | Ga0501083_0082828 | Ga0501083_0082828_615_1940 | 430 |
| 1399 | 3300050489 | nmdc:mga03683_9878_c1 | nmdc:mga03683_9878_c1_466_1803 | 430 |
| 1400 | 3300050492 | nmdc:mga0yw44_44903_c1 | nmdc:mga0yw44_44903_c1_522_1814 | 430 |
| 1401 | 3300050493 | nmdc:mga0k408_86760_c1 | nmdc:mga0k408_86760_c1_226_1518 | 430 |
| 1402 | 3300050494 | nmdc:mga06z11_53640_c1 | nmdc:mga06z11_53640_c1_180_1523 | 430 |
| 1403 | 3300050508 | nmdc:mga09592_227968_c1 | nmdc:mga09592_227968_c1_215_1555 | 430 |
| 1404 | 3300050511 | nmdc:mga08y16_27939_c1 | nmdc:mga08y16_27939_c1_395_1702 | 430 |
| 1405 | 3300050514 | nmdc:mga08x19_10352_c1 | nmdc:mga08x19_10352_c1_3427_4770 | 430 |
| 1406 | 3300050516 | nmdc:mga0sz30_54497_c1 | nmdc:mga0sz30_54497_c1_189_1481 | 430 |
| 1407 | 3300053077 | Ga0495601_0007154 | Ga0495601_0007154_4238_5578 | 430 |
| 1408 | 3300053077 | Ga0495601_0065471 | Ga0495601_0065471_709_2046 | 430 |
| 1409 | 3300053078 | Ga0495612_0001490 | Ga0495612_0001490_3317_4657 | 430 |
| 1410 | 3300053078 | Ga0495612_0008254 | Ga0495612_0008254_1697_3037 | 430 |
| 1411 | 3300053085 | Ga0495619_0047977 | Ga0495619_0047977_1243_2583 | 430 |
| 1412 | 3300053086 | Ga0500578_0064433 | Ga0500578_0064433_891_2183 | 430 |
| 1413 | 3300053086 | Ga0500578_0067858 | Ga0500578_0067858_337_1629 | 430 |
| 1414 | 3300053087 | Ga0500643_000056 | Ga0500643_000056_101719_103011 | 430 |
| 1415 | 3300053093 | Ga0500651_0037501 | Ga0500651_0037501_600_1892 | 430 |
| 1416 | 3300053094 | Ga0500566_0000031 | Ga0500566_0000031_49914_51254 | 430 |
| 1417 | 3300053094 | Ga0500566_0000189 | Ga0500566_0000189_15592_16884 | 430 |
| 1418 | 3300053095 | Ga0500640_008340 | Ga0500640_008340_614_1954 | 430 |
| 1419 | 3300053098 | Ga0500650_0089459 | Ga0500650_0089459_80_1372 | 430 |
| 1420 | 3300053103 | Ga0500555_000978 | Ga0500555_000978_7821_9113 | 430 |
| 1421 | 3300053104 | Ga0500556_0006746 | Ga0500556_0006746_810_2102 | 430 |
| 1422 | 3300053105 | Ga0500557_000002 | Ga0500557_000002_72_1364 | 430 |
| 1423 | 3300053108 | Ga0500562_004486 | Ga0500562_004486_1788_3080 | 430 |
| 1424 | 3300053111 | Ga0500572_000108 | Ga0500572_000108_17746_19086 | 430 |
| 1425 | 3300053119 | Ga0500595_000131 | Ga0500595_000131_1710_3050 | 430 |
| 1426 | 3300053119 | Ga0500595_007986 | Ga0500595_007986_2225_3784 | 430 |
| 1427 | 3300053123 | Ga0500614_004573 | Ga0500614_004573_1516_2856 | 430 |
| 1428 | 3300053130 | Ga0500642_0000266 | Ga0500642_0000266_1634_2926 | 430 |
| 1429 | 3300053136 | Ga0500559_0006373 | Ga0500559_0006373_1459_2799 | 430 |
| 1430 | 3300053136 | Ga0500559_0038432 | Ga0500559_0038432_529_1821 | 430 |
| 1431 | 3300053148 | Ga0500590_080985 | Ga0500590_080985_221_1513 | 430 |
| 1432 | 3300053150 | Ga0500603_000160 | Ga0500603_000160_11186_12526 | 430 |
| 1433 | 3300053150 | Ga0500603_002161 | Ga0500603_002161_1756_3093 | 430 |
| 1434 | 3300053153 | Ga0500616_0006319 | Ga0500616_0006319_5046_6386 | 430 |
| 1435 | 3300053154 | Ga0500619_028103 | Ga0500619_028103_95_1387 | 430 |
| 1436 | 3300053156 | Ga0500622_0009192 | Ga0500622_0009192_2977_4269 | 430 |
| 1437 | 3300053159 | Ga0500630_000427 | Ga0500630_000427_1937_3277 | 430 |
| 1438 | 3300053163 | Ga0500639_000008 | Ga0500639_000008_133580_134920 | 430 |
| 1439 | 3300053177 | Ga0500636_0000836 | Ga0500636_0000836_5319_6611 | 430 |
| 1440 | 3300053178 | Ga0500637_0000086 | Ga0500637_0000086_30525_31865 | 430 |
| 1441 | 3300053178 | Ga0500637_0000260 | Ga0500637_0000260_1756_3093 | 430 |
| 1442 | 3300053178 | Ga0500637_0039628 | Ga0500637_0039628_802_2142 | 430 |
| 1443 | 3300053729 | Ga0500625_018517 | Ga0500625_018517_42_1334 | 430 |
| 1444 | 3300053731 | Ga0500609_000673 | Ga0500609_000673_2996_4288 | 430 |
| 1445 | 3300053735 | Ga0500596_008474 | Ga0500596_008474_31_1371 | 430 |
| 1446 | 3300053736 | Ga0500599_000229 | Ga0500599_000229_3901_5193 | 430 |
| 1447 | 3300053737 | Ga0500601_000566 | Ga0500601_000566_1894_3186 | 430 |
| 1448 | 3300054114 | Ga0501084_0203440 | Ga0501084_0203440_232_1572 | 430 |
| 1449 | 3300055283 | Ga0500661_000107 | Ga0500661_000107_2162_3502 | 430 |
| 1450 | iso_pu_bacteria | 2507262055 | 2507509037 | 430 |
| 1451 | iso_pu_bacteria | 2508501009 | 2508543121 | 430 |
| 1452 | iso_pu_bacteria | 2508501042 | 2508691127 | 430 |
| 1453 | iso_pu_bacteria | 2508501128 | 2509146663 | 430 |
| 1454 | iso_pu_bacteria | 2508501128 | 2509151760 | 430 |
| 1455 | iso_pu_bacteria | 2511231028 | 2511393368 | 430 |
| 1456 | iso_pu_bacteria | 2513237092 | 2513624402 | 430 |
| 1457 | iso_pu_bacteria | 2513237095 | 2513650153 | 430 |
| 1458 | iso_pu_bacteria | 2513237096 | 2513654409 | 430 |
| 1459 | iso_pu_bacteria | 2513237098 | 2513673969 | 430 |
| 1460 | iso_pu_bacteria | 2513237098 | 2513676547 | 430 |
| 1461 | iso_pu_bacteria | 2513237101 | 2513692139 | 430 |
| 1462 | iso_pu_bacteria | 2513237102 | 2513703125 | 430 |
| 1463 | iso_pu_bacteria | 2513237104 | 2513718066 | 430 |
| 1464 | iso_pu_bacteria | 2513237137 | 2513859205 | 430 |
| 1465 | iso_pu_bacteria | 2513237139 | 2513872389 | 430 |
| 1466 | iso_pu_bacteria | 2513237141 | 2513887490 | 430 |
| 1467 | iso_pu_bacteria | 2513237141 | 2513893513 | 430 |
| 1468 | iso_pu_bacteria | 2513237145 | 2513915412 | 430 |
| 1469 | iso_pu_bacteria | 2513237161 | 2514014116 | 430 |
| 1470 | iso_pu_bacteria | 2515154112 | 2515626468 | 430 |
| 1471 | iso_pu_bacteria | 2517093001 | 2517101659 | 430 |
| 1472 | iso_pu_bacteria | 2517572143 | 2517892726 | 430 |
| 1473 | iso_pu_bacteria | 2524023205 | 2524436895 | 430 |
| 1474 | iso_pu_bacteria | 2524023210 | 2524464581 | 430 |
| 1475 | iso_pu_bacteria | 2524023228 | 2524538114 | 430 |
| 1476 | iso_pu_bacteria | 2528768022 | 2528850093 | 430 |
| 1477 | iso_pu_bacteria | 2617270735 | 2617351446 | 430 |
| 1478 | iso_pu_bacteria | 2617270741 | 2617376164 | 430 |
| 1479 | iso_pu_bacteria | 2667528175 | 2671117436 | 430 |
| 1480 | iso_pu_bacteria | 2721755755 | 2723845489 | 430 |
| 1481 | iso_pu_bacteria | 2728368998 | 2728748598 | 430 |
| 1482 | iso_pu_bacteria | 2744054633 | 2745080164 | 430 |
| 1483 | iso_pu_bacteria | 2791355196 | 2793063751 | 430 |
| 1484 | iso_pu_bacteria | 2791355197 | 2793068269 | 430 |
| 1485 | iso_pu_bacteria | 2791355199 | 2793083324 | 430 |
| 1486 | iso_pu_bacteria | 2802429603 | 2805918007 | 430 |
| 1487 | iso_pu_bacteria | 2816332527 | 2818243105 | 430 |
| 1488 | iso_pu_bacteria | 2824600985 | 2824608339 | 430 |
| 1489 | iso_pu_bacteria | 2824609381 | 2824616268 | 430 |
| 1490 | iso_pu_bacteria | 2824617872 | 2824625680 | 430 |
| 1491 | iso_pu_bacteria | 2824626560 | 2824631339 | 430 |
| 1492 | iso_pu_bacteria | 2824635225 | 2824641810 | 430 |
| 1493 | iso_pu_bacteria | 2824644064 | 2824649088 | 430 |
| 1494 | iso_pu_bacteria | 2824653114 | 2824660025 | 430 |
| 1495 | iso_pu_bacteria | 2824671348 | 2824677453 | 430 |
| 1496 | iso_pu_bacteria | 2824687955 | 2824693940 | 430 |
| 1497 | iso_pu_bacteria | 2824696289 | 2824702142 | 430 |
| 1498 | iso_pu_bacteria | 2824704595 | 2824710608 | 430 |
| 1499 | iso_pu_bacteria | 2824714736 | 2824720691 | 430 |
| 1500 | iso_pu_bacteria | 2824723954 | 2824729355 | 430 |
| 1501 | iso_pu_bacteria | 2824732956 | 2824738016 | 430 |
| 1502 | iso_pu_bacteria | 2824746037 | 2824752946 | 430 |
| 1503 | iso_pu_bacteria | 2824753945 | 2824757273 | 430 |
| 1504 | iso_pu_bacteria | 2824763712 | 2824766871 | 430 |
| 1505 | iso_pu_bacteria | 2824773399 | 2824776403 | 430 |
| 1506 | iso_pu_bacteria | 2838122688 | 2838126193 | 430 |
| 1507 | iso_pu_bacteria | 2841941048 | 2841943718 | 430 |
| 1508 | iso_pu_bacteria | 2841949485 | 2841950268 | 430 |
| 1509 | iso_pu_bacteria | 2841957949 | 2841958298 | 430 |
| 1510 | iso_pu_bacteria | 2841966195 | 2841966647 | 430 |
| 1511 | iso_pu_bacteria | 2841974524 | 2841975406 | 430 |
| 1512 | iso_pu_bacteria | 2841983080 | 2841988455 | 430 |
| 1513 | iso_pu_bacteria | 2842038055 | 2842039461 | 430 |
| 1514 | iso_pu_bacteria | 2842045827 | 2842047593 | 430 |
| 1515 | iso_pu_bacteria | 2844315083 | 2844318676 | 430 |
| 1516 | iso_pu_bacteria | 2847930680 | 2847935784 | 430 |
| 1517 | iso_pu_bacteria | 2847939898 | 2847946173 | 430 |
| 1518 | iso_pu_bacteria | 2849076700 | 2849079684 | 430 |
| 1519 | iso_pu_bacteria | 2857509624 | 2857513891 | 430 |
| 1520 | iso_pu_bacteria | 2874590934 | 2874597173 | 430 |
| 1521 | iso_pu_bacteria | 2874604998 | 2874607619 | 430 |
| 1522 | iso_pu_bacteria | 2874612657 | 2874616186 | 430 |
| 1523 | iso_pu_bacteria | 2874620515 | 2874627493 | 430 |
| 1524 | iso_pu_bacteria | 2874628541 | 2874629734 | 430 |
| 1525 | iso_pu_bacteria | 2874645413 | 2874645540 | 430 |
| 1526 | iso_pu_bacteria | 2876761206 | 2876764714 | 430 |
| 1527 | iso_pu_bacteria | 2876761206 | 2876767373 | 430 |
| 1528 | iso_pu_bacteria | 2876771140 | 2876771355 | 430 |
| 1529 | iso_pu_bacteria | 2876808645 | 2876813002 | 430 |
| 1530 | iso_pu_bacteria | 2876818435 | 2876818662 | 430 |
| 1531 | iso_pu_bacteria | 2879074833 | 2879075126 | 430 |
| 1532 | iso_pu_bacteria | 2879083081 | 2879085172 | 430 |
| 1533 | iso_pu_bacteria | 2879099564 | 2879100932 | 430 |
| 1534 | iso_pu_bacteria | 2879110137 | 2879115357 | 430 |
| 1535 | iso_pu_bacteria | 2879127579 | 2879127683 | 430 |
| 1536 | iso_pu_bacteria | 2879142872 | 2879143195 | 430 |
| 1537 | iso_pu_bacteria | 2881364244 | 2881366981 | 430 |
| 1538 | iso_pu_bacteria | 2881665667 | 2881666384 | 430 |
| 1539 | iso_pu_bacteria | 2885366525 | 2885372124 | 430 |
| 1540 | iso_pu_bacteria | 2885374607 | 2885377001 | 430 |
| 1541 | iso_pu_bacteria | 2885383462 | 2885385262 | 430 |
| 1542 | iso_pu_bacteria | 2885409591 | 2885417675 | 430 |
| 1543 | iso_pu_bacteria | 2888378607 | 2888383659 | 430 |
| 1544 | iso_pu_bacteria | 2888419890 | 2888424075 | 430 |
| 1545 | iso_pu_bacteria | 2889033259 | 2889040262 | 430 |
| 1546 | iso_pu_bacteria | 2903727486 | 2903728785 | 430 |
| 1547 | iso_pu_bacteria | 2903748898 | 2903756251 | 430 |
| 1548 | iso_pu_bacteria | 2903768456 | 2903773406 | 430 |
| 1549 | iso_pu_bacteria | 2904666416 | 2904670989 | 430 |
| 1550 | iso_pu_bacteria | 2904699407 | 2904702856 | 430 |
| 1551 | iso_pu_bacteria | 2904711408 | 2904717489 | 430 |
| 1552 | iso_pu_bacteria | 2906602504 | 2906604495 | 430 |
| 1553 | iso_pu_bacteria | 2906610324 | 2906618270 | 430 |
| 1554 | iso_pu_bacteria | 2906626472 | 2906629161 | 430 |
| 1555 | iso_pu_bacteria | 2906635258 | 2906643270 | 430 |
| 1556 | iso_pu_bacteria | 2906643746 | 2906650923 | 430 |
| 1557 | iso_pu_bacteria | 2906660503 | 2906664348 | 430 |
| 1558 | iso_pu_bacteria | 2908739725 | 2908743084 | 430 |
| 1559 | iso_pu_bacteria | 2908775508 | 2908779713 | 430 |
| 1560 | iso_pu_bacteria | 2922361189 | 2922368163 | 430 |
| 1561 | iso_pu_bacteria | 2922368715 | 2922373878 | 430 |
| 1562 | iso_pu_bacteria | 2922386360 | 2922388365 | 430 |
| 1563 | iso_pu_bacteria | 2922393267 | 2922399604 | 430 |
| 1564 | iso_pu_bacteria | 2922425934 | 2922429820 | 430 |
| 1565 | iso_pu_bacteria | 2929615660 | 2929617585 | 430 |
| 1566 | iso_pu_bacteria | 2929624759 | 2929627290 | 430 |
| 1567 | iso_pu_bacteria | 2932784394 | 2932787369 | 430 |
| 1568 | iso_pu_bacteria | 2932794094 | 2932798512 | 430 |
| 1569 | iso_pu_bacteria | 2932801729 | 2932803190 | 430 |
| 1570 | iso_pu_bacteria | 2932809354 | 2932815177 | 430 |
| 1571 | iso_pu_bacteria | 2932818245 | 2932820625 | 430 |
| 1572 | iso_pu_bacteria | 2932828146 | 2932831676 | 430 |
| 1573 | iso_pu_bacteria | 2933577622 | 2933579541 | 430 |
| 1574 | iso_pu_bacteria | 2935608549 | 2935612088 | 430 |
| 1575 | iso_pu_bacteria | 2935616580 | 2935622272 | 430 |
| 1576 | iso_pu_bacteria | 2935630451 | 2935633452 | 430 |
| 1577 | iso_pu_bacteria | 2935638405 | 2935642911 | 430 |
| 1578 | iso_pu_bacteria | 2935648319 | 2935649682 | 430 |
| 1579 | iso_pu_bacteria | 2935656913 | 2935658803 | 430 |
| 1580 | iso_pu_bacteria | 2935665750 | 2935668012 | 430 |
| 1581 | iso_pu_bacteria | 2935675223 | 2935678916 | 430 |
| 1582 | iso_pu_bacteria | 2935684952 | 2935688760 | 430 |
| 1583 | iso_pu_bacteria | 2935694250 | 2935696114 | 430 |
| 1584 | iso_pu_bacteria | 2935703347 | 2935706881 | 430 |
| 1585 | iso_pu_bacteria | 2935713505 | 2935715779 | 430 |
| 1586 | iso_pu_bacteria | 2935722832 | 2935725657 | 430 |
| 1587 | iso_pu_bacteria | 2935732158 | 2935738064 | 430 |
| 1588 | iso_pu_bacteria | 2935741537 | 2935747439 | 430 |
| 1589 | iso_pu_bacteria | 2935750917 | 2935753986 | 430 |
| 1590 | iso_pu_bacteria | 2935760218 | 2935762990 | 430 |
| 1591 | iso_pu_bacteria | 2935769743 | 2935772474 | 430 |
| 1592 | iso_pu_bacteria | 2935769743 | 2935777192 | 430 |
| 1593 | iso_pu_bacteria | 2935777560 | 2935782603 | 430 |
| 1594 | iso_pu_bacteria | 2935785616 | 2935791807 | 430 |
| 1595 | iso_pu_bacteria | 2935793552 | 2935799533 | 430 |
| 1596 | iso_pu_bacteria | 2935801545 | 2935808531 | 430 |
| 1597 | iso_pu_bacteria | 2935810662 | 2935812773 | 430 |
| 1598 | iso_pu_bacteria | 2935819856 | 2935821561 | 430 |
| 1599 | iso_pu_bacteria | 2935827899 | 2935830424 | 430 |
| 1600 | iso_pu_bacteria | 2935837841 | 2935840455 | 430 |
| 1601 | iso_pu_bacteria | 2935847175 | 2935850170 | 430 |
| 1602 | iso_pu_bacteria | 2935855204 | 2935860660 | 430 |
| 1603 | iso_pu_bacteria | 2935864058 | 2935865306 | 430 |
| 1604 | iso_pu_bacteria | 2935873716 | 2935877903 | 430 |
| 1605 | iso_pu_bacteria | 2935883170 | 2935887965 | 430 |
| 1606 | iso_pu_bacteria | 2935908558 | 2935914241 | 430 |
| 1607 | iso_pu_bacteria | 2935916978 | 2935924593 | 430 |
| 1608 | iso_pu_bacteria | 2935926038 | 2935931897 | 430 |
| 1609 | iso_pu_bacteria | 2935926038 | 2935932851 | 430 |
| 1610 | iso_pu_bacteria | 2935934488 | 2935940495 | 430 |
| 1611 | iso_pu_bacteria | 2935934488 | 2935941537 | 430 |
| 1612 | iso_pu_bacteria | 2935942939 | 2935948437 | 430 |
| 1613 | iso_pu_bacteria | 2935942939 | 2935949626 | 430 |
| 1614 | iso_pu_bacteria | 2935951376 | 2935957092 | 430 |
| 1615 | iso_pu_bacteria | 2935951376 | 2935958321 | 430 |
| 1616 | iso_pu_bacteria | 2935959822 | 2935960119 | 430 |
| 1617 | iso_pu_bacteria | 2935967501 | 2935973690 | 430 |
| 1618 | iso_pu_bacteria | 2935967501 | 2935974509 | 430 |
| 1619 | iso_pu_bacteria | 2935975950 | 2935977367 | 430 |
| 1620 | iso_pu_bacteria | 2935984226 | 2935988564 | 430 |
| 1621 | iso_pu_bacteria | 2935992306 | 2935996145 | 430 |
| 1622 | iso_pu_bacteria | 2936002035 | 2936006279 | 430 |
| 1623 | iso_pu_bacteria | 2936011229 | 2936012836 | 430 |
| 1624 | iso_pu_bacteria | 2936019824 | 2936021400 | 430 |
| 1625 | iso_pu_bacteria | 2936028420 | 2936030129 | 430 |
| 1626 | iso_pu_bacteria | 2936037263 | 2936041361 | 430 |
| 1627 | iso_pu_bacteria | 2936046547 | 2936047594 | 430 |
| 1628 | iso_pu_bacteria | 2936055302 | 2936057248 | 430 |
| 1629 | iso_pu_bacteria | 2940556831 | 2940560638 | 430 |
| 1630 | iso_pu_bacteria | 2941507105 | 2941510343 | 430 |
| 1631 | iso_pu_bacteria | 2941515067 | 2941517920 | 430 |
| 1632 | iso_pu_bacteria | 2941523033 | 2941525936 | 430 |
| 1633 | iso_pu_bacteria | 2941531003 | 2941534429 | 430 |
| 1634 | iso_pu_bacteria | 2941538514 | 2941541414 | 430 |
| 1635 | iso_pu_bacteria | 3005474847 | 3005479836 | 430 |
| 1636 | iso_pu_bacteria | 3005483717 | 3005486892 | 430 |
| 1637 | iso_pu_bacteria | 3005506211 | 3005509964 | 430 |
| 1638 | iso_pu_bacteria | 3005587118 | 3005593285 | 430 |
| 1639 | iso_pu_bacteria | 3005594810 | 3005598834 | 430 |
| 1640 | iso_pu_bacteria | 3005710791 | 3005714462 | 430 |
| 1641 | iso_pu_bacteria | 3005718088 | 3005721976 | 430 |
| 1642 | iso_pu_bacteria | 8006926726 | 8006933235 | 430 |
| 1643 | iso_pu_bacteria | 8006933436 | 8006940989 | 430 |
| 1644 | iso_pu_bacteria | 8006964411 | 8006970756 | 430 |
| 1645 | iso_pu_bacteria | 8006973647 | 8006980810 | 430 |
| 1646 | iso_pu_bacteria | 8006984368 | 8006985604 | 430 |
| 1647 | iso_pu_bacteria | 8006994254 | 8007000157 | 430 |
| 1648 | iso_pu_bacteria | 8006994254 | 8007000724 | 430 |
| 1649 | iso_pu_bacteria | 8006994254 | 8007000991 | 430 |
| 1650 | iso_pu_bacteria | 8016511872 | 8016513805 | 430 |
| 1651 | iso_pu_bacteria | 8016522445 | 8016530066 | 430 |
| 1652 | iso_pu_bacteria | 8016539877 | 8016548514 | 430 |
| 1653 | iso_pu_bacteria | 8016548790 | 8016553616 | 430 |
| 1654 | iso_pu_bacteria | 8016557553 | 8016561997 | 430 |
| 1655 | iso_pu_bacteria | 8016566248 | 8016573642 | 430 |
| 1656 | iso_pu_bacteria | 8016583857 | 8016592370 | 430 |
| 1657 | iso_pu_bacteria | 8016595262 | 8016599822 | 430 |
| 1658 | iso_pu_bacteria | 8016603502 | 8016611348 | 430 |
| 1659 | iso_pu_bacteria | 8016613128 | 8016613976 | 430 |
| 1660 | iso_pu_bacteria | 8016622563 | 8016627426 | 430 |
| 1661 | iso_pu_bacteria | 8016630954 | 8016631445 | 430 |
| 1662 | iso_pu_bacteria | 8017057580 | 8017062667 | 430 |
| 1663 | iso_pu_bacteria | 8019530166 | 8019535053 | 430 |
| 1664 | iso_pu_bacteria | 8019547302 | 8019554223 | 430 |
| 1665 | iso_pu_bacteria | 8019547302 | 8019554526 | 430 |
| 1666 | iso_pu_bacteria | 8019555841 | 8019557149 | 430 |
| 1667 | iso_pu_bacteria | 8019586578 | 8019589756 | 430 |
| 1668 | iso_pu_bacteria | 8019608314 | 8019617039 | 430 |
| 1669 | iso_pu_bacteria | 8019619141 | 8019627659 | 430 |
| 1670 | iso_pu_bacteria | 8019648815 | 8019657893 | 430 |
| 1671 | iso_pu_bacteria | 8019659431 | 8019662747 | 430 |
| 1672 | iso_pu_bacteria | 8019668869 | 8019672357 | 430 |
| 1673 | iso_pu_bacteria | 8019678201 | 8019683848 | 430 |
| 1674 | iso_pu_bacteria | 8019687851 | 8019689099 | 430 |
| 1675 | iso_pu_bacteria | 8019687851 | 8019689564 | 430 |
| 1676 | iso_pu_bacteria | 8055742211 | 8055746800 | 430 |
| 1677 | iso_pu_bacteria | 8056673599 | 8056674221 | 430 |
| 1678 | iso_pu_bacteria | 8056681323 | 8056685451 | 430 |
| 1679 | iso_pu_bacteria | 8056967851 | 8056973043 | 430 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6dtr-assembly1.cif.gz_A | apo t. maritima male3 | 0.8347 | 20 | 430 |
| 6dtr-assembly1.cif.gz_A | apo t. maritima male3 | 0.8289 | 20 | 430 |
| 6wpn-assembly2.cif.gz_B | crystal structure of a putative oligosaccharide periplasmic-binding protein from synechococcus sp. mits9220 | 0.8076 | 20 | 429 |
| 7nbz-assembly1.cif.gz_A | crystal structure of ligand free open conformation of sulfoquinovosyl binding protein (sqbp) from agrobacterium tumefaciens | 0.8071 | 20 | 429 |
| 7v09-assembly2.cif.gz_B | crystal structure of ecl_rs08780, putative sugar transport system periplasmic sugar-binding protein | 0.8028 | 20 | 430 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4rk9B01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8046 | 20 | 130 | 3.40.190.10 |
| 2gh9A01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8045 | 23 | 352 | 3.40.190.10 |
| af_P76042_18_428_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.7895 | 4 | 428 | 3.40.190.10 |
| af_P76042_18_428_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.786 | 4 | 428 | 3.40.190.10 |
| 1eu8A01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.7844 | 19 | 130 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537J5U0-F1-model_v4 | Extracellular solute-binding protein | 0.9878 | 37 | 427 |
|
| AF-M4ZU59-F1-model_v4 | ABC transporter substrate-binding protein, periplasmic component | 0.9832 | 6 | 430 |
GO:0042597
|
| AF-A0A537WVK1-F1-model_v4 | ABC transporter substrate-binding protein | 0.9821 | 228 | 370 |
GO:0042597
|
| AF-A0A537U2M9-F1-model_v4 | Extracellular solute-binding protein | 0.9809 | 89 | 430 |
GO:0042597
|
| AF-M4ZU59-F1-model_v4 | ABC transporter substrate-binding protein, periplasmic component | 0.9809 | 6 | 430 |
GO:0042597
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar