F495307

General Info

Members Datasets Scaffolds Average Seq Length
1679 714 1410 438

Family's Representative Sequence

Representative Sequence 3300053119|Ga0500595_007986|Ga0500595_007986_2225_3784
Length 519
Sequence LTIRKKDIVAPAVRNFHATLVQCRQPLCFLDRGKQFWSDLITKISAGRRLLTAPRRTETKNKKQNLAQQRGDVMLRKKLSRRQFVAATALSSAALISAPYVRGAHAAGKLTIGFWDHWVPGANKASTDLVNEWAEKEKVEVTIDYIPSQGNKNLLTIAAEAQAKSGHDIFAMPTWWAHANAEQLEDVADIMGPIIAENGEVNGTVTYLGKAGNKWLGVPACVGSQIKGPCSRIDLMKKHAGIDVQEMYPAGAEPKADNWTLETFLKAAEACHKGGVPFGIGLGETTDNVDTAGAIFLSFGAQLVDAKGNLTVKTDAVRQALEYYKKLISFLPPDVAAWDDASNNKWLVSGRGAMIMNPPSAWAVAKRDAPQVAEQCWTHGFPAGPKGRFAPYLPYYWSIWNFSKNKEAAKRLLVQLSKPAAIEKMVTASGGYDLPAYEKLTTLKVWQEEGPPKGTLYHYPNPYKHQTLSIAASPAPPKIAQQIYAQATLTKMCLRYHQGEAMEKTLAWAEGECEGFMRS

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
8 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
9 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
10 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
11 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
12 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
13 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
14 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
15 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
16 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
17 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
18 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
19 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
20 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
21 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
22 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
23 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
24 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
25 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
26 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
27 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
28 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
29 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
30 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
31 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
32 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
33 2791355199
34 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
35 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
36 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
37 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
38 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
39 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
40 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
41 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
42 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
43 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
44 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
45 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
46 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
47 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
48 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
49 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
50 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
51 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
52 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
53 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
54 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
55 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
56 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
57 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
58 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
59 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
60 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
61 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
62 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
63 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
64 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
65 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
66 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
67 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
68 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
69 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
70 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
71 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
72 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
73 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
74 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
75 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
76 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
77 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
78 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
79 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
80 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
81 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
82 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
83 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
84 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
85 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
86 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
87 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
88 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
89 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
90 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
91 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
92 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
93 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
94 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
95 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
96 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
97 2904699407
98 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
99 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
100 2906610324
101 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
102 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
103 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
104 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
105 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
106 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
107 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
108 2922368715
109 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
110 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
111 2922425934
112 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
113 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
114 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
115 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
116 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
117 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
118 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
119 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
120 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
121 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
122 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
123 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
124 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
125 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
126 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
127 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
128 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
129 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
130 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
131 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
132 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
133 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
134 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
135 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
136 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
137 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
138 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
139 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
140 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
141 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
142 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
143 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
144 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
145 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
146 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
147 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
148 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
149 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
150 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
151 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
152 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
153 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
154 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
155 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
156 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
157 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
158 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
159 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
160 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
161 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
162 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
163 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
164 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
165 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
166 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
167 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
168 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
169 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
170 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
171 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
172 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
173 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
174 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
175 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
176 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
177 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
178 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
179 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
180 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
181 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
182 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
183 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
184 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
185 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
186 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
187 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
188 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
189 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
190 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
191 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
192 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
195 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
196 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
197 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
198 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
199 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
200 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
201 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
202 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
203 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
204 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
205 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
206 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
207 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
208 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
209 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
210 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
211 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
212 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
213 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
214 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
215 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
216 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
217 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
218 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
219 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
220 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
221 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
222 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
223 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
224 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
225 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
226 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
227 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
228 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
229 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
230 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
231 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
232 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
233 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
234 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
235 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
236 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
237 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
238 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
239 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
240 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
241 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
242 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
243 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
244 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
245 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
246 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
247 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
248 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
249 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
250 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
251 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
252 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
253 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
254 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
255 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
256 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
257 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
258 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
259 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
260 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
261 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
262 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
263 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
264 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
265 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
266 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
267 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
268 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
269 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
270 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
271 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
272 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
273 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
274 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
275 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
276 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
277 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
278 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
279 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
280 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
281 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
282 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
283 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
284 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
285 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
286 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
287 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
288 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
289 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
290 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
291 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
292 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
293 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
294 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
295 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
296 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
297 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
298 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
299 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
300 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
301 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
302 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
303 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
304 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
305 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
306 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
307 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
308 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
309 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
310 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
311 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
312 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
313 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
314 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
315 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
316 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
317 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
318 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
319 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
320 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
321 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
322 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
323 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
324 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
325 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
326 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
327 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
328 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
329 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
330 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
331 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
332 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
333 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
334 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
335 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
336 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
337 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
338 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
339 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
340 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
341 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
342 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
343 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
344 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
394 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
395 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
396 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
398 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
399 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
400 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
401 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
402 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
403 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
404 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
405 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
406 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
407 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
408 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
409 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
410 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
411 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
412 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
413 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
414 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
415 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
416 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
417 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
418 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
419 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
420 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
421 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
422 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
423 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
424 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
425 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
426 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
427 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
428 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
429 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
430 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
431 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
432 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
433 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
434 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
435 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
436 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
437 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
438 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
439 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
440 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
441 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
442 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
443 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
444 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
445 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
446 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
447 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
448 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
449 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
450 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
451 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
452 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
453 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
454 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
455 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
456 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
457 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
458 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
459 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
460 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
461 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
462 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
463 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
464 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
465 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
466 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
467 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
468 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
469 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
470 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
471 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
472 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
473 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
474 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
475 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
476 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
477 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
478 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
479 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
480 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
481 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
482 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
483 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
484 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
485 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
486 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
487 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
488 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
489 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
490 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
491 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
492 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
493 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
494 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
495 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
496 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
497 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
498 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
499 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
500 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
501 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
502 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
503 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
504 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
505 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
506 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
507 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
508 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
509 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
510 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
511 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
512 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
513 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
514 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
515 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
516 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
517 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
518 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
519 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
520 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
521 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
522 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
523 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
524 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
525 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
526 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
527 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
528 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
529 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
530 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
531 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
532 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
533 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
534 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
535 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
536 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
537 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
538 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
539 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
540 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
541 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
542 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
543 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
544 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
545 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
546 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
547 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
548 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
549 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
550 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
551 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
552 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
553 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
554 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
555 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
556 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
557 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
558 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
559 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
560 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
561 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
562 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
563 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
564 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
565 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
566 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
567 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
568 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
569 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
570 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
571 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
572 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
573 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
574 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
575 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
576 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
577 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
578 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
579 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
580 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
581 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
582 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
583 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
584 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
585 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
586 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
587 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
588 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
589 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
590 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
591 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
592 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
593 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
594 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
595 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
596 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
597 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
598 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
599 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
600 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
601 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
602 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
603 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
604 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
605 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
606 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
607 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
608 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
609 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
610 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
611 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
612 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
613 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
614 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
615 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
616 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
617 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
618 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
619 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
620 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
621 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
622 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
623 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
624 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
625 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
626 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
627 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
628 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
629 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
630 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
631 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
632 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
633 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
634 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
635 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
636 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
637 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
638 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
639 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
640 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
641 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
642 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
643 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
644 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
645 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
646 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
647 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
648 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
649 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
650 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
651 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
652 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
653 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
654 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
655 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
656 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
657 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
658 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
659 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
660 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
661 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
662 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
663 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
664 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
665 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
666 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
667 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
668 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
669 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
670 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
671 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
672 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
673 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
674 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
675 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
676 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
677 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
678 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
679 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
680 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
681 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
682 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
683 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
684 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
685 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
686 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
687 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
688 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
689 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
690 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
691 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
692 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
693 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
694 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
695 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
696 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
697 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
698 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
699 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
700 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
701 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
702 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
703 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
704 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
705 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
706 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
707 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
708 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
709 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
710 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
711 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
712 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
713 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
714 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.01
Metatranscriptomes 1.02
Isolates 13.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.27
Nodule 11.73
Rhizoplane 7.86
Rhizosphere 66.47
Stem 0
Stem Tuber 0
Unclassified 6.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24750J21931_1004125 3300002070 Bacteria 1752
2 JGI25406J46586_10018043 3300003203 Bacteria 2904
3 JGI25153J46596_10000235 3300003215 Bacteria 46542
4 JGI25153J46596_10000238 3300003215 Bacteria 46211
5 JGI25153J46596_10002996 3300003215 Bacteria 9557
6 JGI25153J46596_10005350 3300003215 Bacteria 6743
7 JGI25160J50197_1001951 3300003354 Bacteria 9849
8 JGI25160J50197_1003045 3300003354 Bacteria 7648
9 Ga0007409J51694_1040095 3300003575 Bacteria 1583
10 Ga0055529_1006123 3300003763 Bacteria 1699
11 Ga0055526_1020720 3300003771 Bacteria 2321
12 Ga0055531_10009794 3300003794 Bacteria 4857
13 Ga0055531_10012037 3300003794 Bacteria 4106
14 JGI25405J52794_10007662 3300003911 Bacteria 1996
15 JGI25405J52794_10015703 3300003911 Bacteria 1490
16 Ga0058861_12054439 3300004800 Bacteria 1823
17 Ga0058862_12877440 3300004803 Bacteria 2148
18 Ga0065165_1000394 3300005262 Bacteria 70991
19 Ga0065165_1003735 3300005262 Bacteria 10263
20 Ga0065165_1008785 3300005262 Bacteria 4655
21 Ga0070658_10006286 3300005327 Bacteria 9622
22 Ga0070683_100021672 3300005329 Bacteria 5736
23 Ga0070683_100033523 3300005329 Bacteria 4683
24 Ga0070690_100088389 3300005330 Bacteria 2037
25 Ga0070690_100113925 3300005330 Bacteria 1807
26 Ga0070670_100046283 3300005331 Bacteria 3741
27 Ga0070670_100099224 3300005331 Bacteria 2506
28 Ga0070670_100272234 3300005331 Bacteria 1478
29 Ga0070677_10016646 3300005333 Bacteria 2620
30 Ga0068869_100023870 3300005334 Bacteria 4232
31 Ga0068869_100033410 3300005334 Bacteria 3631
32 Ga0070666_10086431 3300005335 Bacteria 2149
33 Ga0070680_100005272 3300005336 Bacteria 9776
34 Ga0068868_100031098 3300005338 Bacteria 4097
35 Ga0068868_100047016 3300005338 Bacteria 3379
36 Ga0068868_100097141 3300005338 Bacteria 2380
37 Ga0070660_100018526 3300005339 Bacteria 5088
38 Ga0070691_10010001 3300005341 Bacteria 4322
39 Ga0070691_10028244 3300005341 Bacteria 2619
40 Ga0070691_10068140 3300005341 Bacteria 1722
41 Ga0070661_100028972 3300005344 Bacteria 3995
42 Ga0070668_100012418 3300005347 Bacteria 6343
43 Ga0070668_100037529 3300005347 Bacteria 3700
44 Ga0070668_100090201 3300005347 Bacteria 2415
45 Ga0070669_100025193 3300005353 Bacteria 4271
46 Ga0070669_100058601 3300005353 Bacteria 2826
47 Ga0070675_100045128 3300005354 Bacteria 3606
48 Ga0070675_100136493 3300005354 Bacteria 2093
49 Ga0070671_100014313 3300005355 Bacteria 6407
50 Ga0070671_100035594 3300005355 Bacteria 4125
51 Ga0070671_100048650 3300005355 Bacteria 3526
52 Ga0070671_100059844 3300005355 Bacteria 3171
53 Ga0070671_100128026 3300005355 Bacteria 2138
54 Ga0070671_100158558 3300005355 Bacteria 1913
55 Ga0070674_100005092 3300005356 Bacteria 7557
56 Ga0070673_100014280 3300005364 Bacteria 5524
57 Ga0070673_100095817 3300005364 Bacteria 2434
58 Ga0070673_100099578 3300005364 Bacteria 2391
59 Ga0070659_100088432 3300005366 Bacteria 2481
60 Ga0070659_100211410 3300005366 Bacteria 1599
61 Ga0070667_100029473 3300005367 Bacteria 4572
62 Ga0070667_100093206 3300005367 Bacteria 2593
63 Ga0070703_10004788 3300005406 Bacteria 3786
64 Ga0070709_10001133 3300005434 Bacteria 14680
65 Ga0070709_10004033 3300005434 Bacteria 7920
66 Ga0070709_10004449 3300005434 Bacteria 7562
67 Ga0070709_10018900 3300005434 Bacteria 3976
68 Ga0070709_10021517 3300005434 Bacteria 3757
69 Ga0070714_100016189 3300005435 Bacteria 6016
70 Ga0070714_100018552 3300005435 Bacteria 5654
71 Ga0070714_100022544 3300005435 Bacteria 5164
72 Ga0070714_100057926 3300005435 Bacteria 3317
73 Ga0070714_100077233 3300005435 Bacteria 2892
74 Ga0070714_100118276 3300005435 Bacteria 2354
75 Ga0070714_100130127 3300005435 Bacteria 2249
76 Ga0070713_100009541 3300005436 Bacteria 6957
77 Ga0070713_100019235 3300005436 Bacteria 5208
78 Ga0070713_100031677 3300005436 Bacteria 4215
79 Ga0070713_100035565 3300005436 Bacteria 4011
80 Ga0070713_100066685 3300005436 Bacteria 3027
81 Ga0070713_100068483 3300005436 Bacteria 2990
82 Ga0070713_100122414 3300005436 Bacteria 2283
83 Ga0070710_10000179 3300005437 Bacteria 29185
84 Ga0070710_10002845 3300005437 Bacteria 8248
85 Ga0070710_10004558 3300005437 Bacteria 6549
86 Ga0070710_10005105 3300005437 Bacteria 6209
87 Ga0070710_10005520 3300005437 Bacteria 6015
88 Ga0070711_100001224 3300005439 Bacteria 13852
89 Ga0070711_100003919 3300005439 Bacteria 8742
90 Ga0070711_100004199 3300005439 Bacteria 8466
91 Ga0070711_100008227 3300005439 Bacteria 6381
92 Ga0070711_100020059 3300005439 Bacteria 4301
93 Ga0070711_100038988 3300005439 Bacteria 3197
94 Ga0070711_100252171 3300005439 Bacteria 1385
95 Ga0070705_100000027 3300005440 Bacteria 77032
96 Ga0070700_100041117 3300005441 Bacteria 2833
97 Ga0070700_100047463 3300005441 Bacteria 2657
98 Ga0070700_100075207 3300005441 Bacteria 2166
99 Ga0070700_100077236 3300005441 Bacteria 2141
100 Ga0070694_100001546 3300005444 Bacteria 13533
101 Ga0070694_100025149 3300005444 Bacteria 3851
102 Ga0070694_100078086 3300005444 Bacteria 2295
103 Ga0070678_100015679 3300005456 Bacteria 4824
104 Ga0070678_100025653 3300005456 Bacteria 3970
105 Ga0070678_100125581 3300005456 Bacteria 2030
106 Ga0070662_100064764 3300005457 Bacteria 2677
107 Ga0070662_100067254 3300005457 Bacteria 2631
108 Ga0070662_100071696 3300005457 Bacteria 2555
109 Ga0070662_100080877 3300005457 Bacteria 2420
110 Ga0070681_10006430 3300005458 Bacteria 11436
111 Ga0070681_10026034 3300005458 Bacteria 5881
112 Ga0070681_10026875 3300005458 Bacteria 5786
113 Ga0070681_10034038 3300005458 Bacteria 5117
114 Ga0070681_10302006 3300005458 Bacteria 1510
115 Ga0068867_100044726 3300005459 Bacteria 3244
116 Ga0070685_10061590 3300005466 Bacteria 2198
117 Ga0070685_10062932 3300005466 Bacteria 2177
118 Ga0070706_100018218 3300005467 Bacteria 6479
119 Ga0070707_100039960 3300005468 Bacteria 4486
120 Ga0070707_100351765 3300005468 Bacteria 1431
121 Ga0070698_100054114 3300005471 Bacteria 4077
122 Ga0070698_100131370 3300005471 Bacteria 2459
123 Ga0070699_100003991 3300005518 Bacteria 13036
124 Ga0070699_100007741 3300005518 Bacteria 9337
125 Ga0070679_100027477 3300005530 Bacteria 5601
126 Ga0070679_100111127 3300005530 Bacteria 2727
127 Ga0070679_100126412 3300005530 Bacteria 2539
128 Ga0070679_100129485 3300005530 Bacteria 2505
129 Ga0070684_100001889 3300005535 Bacteria 15348
130 Ga0070684_100030989 3300005535 Bacteria 4549
131 Ga0070684_100037495 3300005535 Bacteria 4158
132 Ga0070684_100061460 3300005535 Bacteria 3288
133 Ga0070697_100025958 3300005536 Bacteria 4674
134 Ga0070697_100056813 3300005536 Bacteria 3184
135 Ga0070697_100121048 3300005536 Bacteria 2189
136 Ga0070697_100121297 3300005536 Bacteria 2187
137 Ga0070697_100164971 3300005536 Bacteria 1873
138 Ga0068853_100031548 3300005539 Bacteria 4482
139 Ga0068853_100048509 3300005539 Bacteria 3648
140 Ga0068853_100106779 3300005539 Bacteria 2482
141 Ga0068853_100136854 3300005539 Bacteria 2196
142 Ga0068853_100160130 3300005539 Bacteria 2031
143 Ga0068853_100214198 3300005539 Bacteria 1757
144 Ga0070695_100001000 3300005545 Bacteria 15394
145 Ga0070695_100002243 3300005545 Bacteria 11068
146 Ga0070695_100004173 3300005545 Bacteria 8448
147 Ga0070695_100005577 3300005545 Bacteria 7411
148 Ga0070695_100013475 3300005545 Bacteria 4915
149 Ga0070695_100021613 3300005545 Bacteria 3940
150 Ga0070696_100000051 3300005546 Bacteria 54480
151 Ga0070693_100004723 3300005547 Bacteria 6477
152 Ga0070665_100011386 3300005548 Bacteria 8993
153 Ga0070665_100014871 3300005548 Bacteria 7812
154 Ga0070665_100030822 3300005548 Bacteria 5397
155 Ga0070665_100047821 3300005548 Bacteria 4293
156 Ga0070665_100049324 3300005548 Bacteria 4224
157 Ga0070665_100140512 3300005548 Bacteria 2418
158 Ga0070665_100141978 3300005548 Bacteria 2404
159 Ga0070665_100190207 3300005548 Bacteria 2054
160 Ga0070665_100220563 3300005548 Bacteria 1897
161 Ga0070704_100005564 3300005549 Bacteria 7349
162 Ga0070704_100092017 3300005549 Bacteria 2263
163 Ga0068855_100060250 3300005563 Bacteria 4440
164 Ga0068855_100081702 3300005563 Bacteria 3745
165 Ga0068855_100096599 3300005563 Bacteria 3403
166 Ga0068855_100196308 3300005563 Bacteria 2274
167 Ga0068855_100221306 3300005563 Bacteria 2122
168 Ga0068855_100232942 3300005563 Bacteria 2061
169 Ga0068855_100238516 3300005563 Bacteria 2033
170 Ga0070664_100026355 3300005564 Bacteria 4822
171 Ga0070664_100100905 3300005564 Bacteria 2509
172 Ga0068857_100009387 3300005577 Bacteria 8490
173 Ga0068857_100014381 3300005577 Bacteria 6900
174 Ga0068857_100038200 3300005577 Bacteria 4252
175 Ga0068857_100063272 3300005577 Bacteria 3289
176 Ga0068857_100063354 3300005577 Bacteria 3287
177 Ga0068857_100198595 3300005577 Bacteria 1828
178 Ga0068854_100100188 3300005578 Bacteria 2171
179 Ga0068856_100001981 3300005614 Bacteria 21353
180 Ga0068856_100017821 3300005614 Bacteria 6888
181 Ga0068856_100088218 3300005614 Unclassified 3084
182 Ga0068856_100158056 3300005614 Bacteria 2277
183 Ga0070702_100051167 3300005615 Bacteria 2364
184 Ga0070702_100104368 3300005615 Bacteria 1745
185 Ga0068852_100011636 3300005616 Bacteria 6636
186 Ga0068852_100118205 3300005616 Bacteria 2422
187 Ga0068852_100268648 3300005616 Bacteria 1640
188 Ga0068852_100314108 3300005616 Bacteria 1520
189 Ga0068859_100017457 3300005617 Bacteria 7214
190 Ga0068859_100097252 3300005617 Bacteria 2997
191 Ga0068859_100230741 3300005617 Bacteria 1939
192 Ga0068859_100402698 3300005617 Bacteria 1464
193 Ga0068864_100040051 3300005618 Bacteria 4008
194 Ga0068864_100074697 3300005618 Bacteria 2958
195 Ga0068864_100149492 3300005618 Bacteria 2114
196 Ga0068864_100225765 3300005618 Bacteria 1730
197 Ga0068866_10011643 3300005718 Bacteria 3813
198 Ga0068866_10038826 3300005718 Bacteria 2347
199 Ga0068861_100050681 3300005719 Bacteria 3149
200 Ga0068861_100060475 3300005719 Bacteria 2903
201 Ga0068861_100151861 3300005719 Bacteria 1901
202 Ga0068861_100183114 3300005719 Bacteria 1745
203 Ga0068863_100017655 3300005841 Bacteria 6833
204 Ga0068863_100093227 3300005841 Bacteria 2858
205 Ga0068858_100016019 3300005842 Bacteria 7041
206 Ga0068858_100019505 3300005842 Bacteria 6341
207 Ga0068858_100031077 3300005842 Bacteria 4959
208 Ga0068860_100000375 3300005843 Bacteria 58502
209 Ga0068860_100001599 3300005843 Bacteria 24324
210 Ga0068860_100013303 3300005843 Bacteria 8068
211 Ga0068860_100022514 3300005843 Bacteria 6094
212 Ga0068860_100032333 3300005843 Bacteria 5027
213 Ga0068860_100155199 3300005843 Bacteria 2206
214 Ga0068862_100001717 3300005844 Bacteria 19834
215 Ga0068862_100031277 3300005844 Bacteria 4492
216 Ga0068862_100068284 3300005844 Bacteria 3066
217 Ga0068862_100162667 3300005844 Bacteria 1993
218 Ga0081455_10000062 3300005937 Bacteria 115850
219 Ga0081455_10000087 3300005937 Bacteria 99627
220 Ga0081455_10000338 3300005937 Bacteria 61504
221 Ga0081455_10001113 3300005937 Bacteria 33715
222 Ga0081455_10001255 3300005937 Bacteria 31699
223 Ga0081455_10003384 3300005937 Bacteria 18370
224 Ga0081455_10009563 3300005937 Bacteria 9956
225 Ga0081455_10020033 3300005937 Bacteria 6314
226 Ga0081455_10037459 3300005937 Bacteria 4307
227 Ga0081455_10087480 3300005937 Bacteria 2535
228 Ga0081455_10129657 3300005937 Bacteria 1974
229 Ga0081538_10004691 3300005981 Bacteria 12517
230 Ga0081538_10047966 3300005981 Bacteria 2612
231 Ga0081540_1000287 3300005983 Bacteria 52759
232 Ga0081540_1000413 3300005983 Bacteria 42230
233 Ga0081540_1000629 3300005983 Bacteria 33549
234 Ga0081540_1000794 3300005983 Bacteria 28989
235 Ga0081540_1001058 3300005983 Bacteria 24522
236 Ga0081540_1001096 3300005983 Bacteria 23968
237 Ga0081540_1001428 3300005983 Bacteria 20666
238 Ga0081540_1002242 3300005983 Bacteria 15915
239 Ga0081540_1003431 3300005983 Bacteria 12521
240 Ga0081540_1020770 3300005983 Bacteria 3935
241 Ga0081540_1036043 3300005983 Bacteria 2644
242 Ga0081540_1053418 3300005983 Unclassified 1981
243 Ga0081539_10000080 3300005985 Bacteria 222745
244 Ga0081539_10003020 3300005985 Bacteria 21846
245 Ga0081539_10003922 3300005985 Bacteria 17277
246 Ga0081539_10007934 3300005985 Bacteria 9450
247 Ga0070717_10000770 3300006028 Bacteria 20953
248 Ga0070717_10002845 3300006028 Bacteria 12269
249 Ga0070717_10006584 3300006028 Bacteria 8559
250 Ga0070717_10018908 3300006028 Bacteria 5391
251 Ga0070717_10040171 3300006028 Bacteria 3810
252 Ga0070717_10051665 3300006028 Bacteria 3384
253 Ga0070717_10051833 3300006028 Bacteria 3379
254 Ga0070717_10071679 3300006028 Bacteria 2891
255 Ga0070717_10076155 3300006028 Bacteria 2807
256 Ga0075365_10052954 3300006038 Bacteria 2686
257 Ga0075365_10057357 3300006038 Bacteria 2590
258 Ga0075368_10001349 3300006042 Bacteria 7809
259 Ga0075368_10002574 3300006042 Bacteria 5946
260 Ga0075368_10008917 3300006042 Bacteria 3596
261 Ga0075363_100010469 3300006048 Bacteria 4407
262 Ga0075364_10004859 3300006051 Bacteria 7785
263 Ga0075364_10051980 3300006051 Bacteria 2676
264 Ga0070715_10000402 3300006163 Bacteria 10966
265 Ga0070716_100012546 3300006173 Bacteria 4298
266 Ga0070716_100014813 3300006173 Bacteria 3999
267 Ga0070712_100012738 3300006175 Bacteria 5354
268 Ga0070712_100016856 3300006175 Bacteria 4724
269 Ga0070712_100022570 3300006175 Bacteria 4148
270 Ga0070712_100033570 3300006175 Bacteria 3473
271 Ga0070712_100076998 3300006175 Bacteria 2403
272 Ga0070712_100204214 3300006175 Bacteria 1554
273 Ga0070712_100224482 3300006175 Bacteria 1489
274 Ga0075362_10006510 3300006177 Bacteria 4359
275 Ga0075362_10023012 3300006177 Bacteria 2631
276 Ga0075367_10007196 3300006178 Bacteria 5681
277 Ga0075367_10015063 3300006178 Bacteria 4193
278 Ga0075367_10015925 3300006178 Bacteria 4097
279 Ga0075367_10018821 3300006178 Bacteria 3817
280 Ga0075367_10139849 3300006178 Bacteria 1500
281 Ga0075369_10006148 3300006186 Bacteria 4529
282 Ga0075369_10009219 3300006186 Bacteria 3827
283 Ga0075369_10010929 3300006186 Bacteria 3558
284 Ga0075369_10021878 3300006186 Bacteria 2633
285 Ga0075366_10027505 3300006195 Bacteria 3337
286 Ga0097621_100027617 3300006237 Bacteria 4466
287 Ga0097621_100063586 3300006237 Bacteria 3033
288 Ga0097621_100122434 3300006237 Bacteria 2207
289 Ga0075370_10003411 3300006353 Bacteria 7559
290 Ga0075370_10011339 3300006353 Bacteria 4681
291 Ga0068871_100014804 3300006358 Bacteria 5823
292 Ga0068871_100226887 3300006358 Bacteria 1620
293 Ga0075428_100001428 3300006844 Bacteria 25473
294 Ga0075428_100025075 3300006844 Bacteria 6597
295 Ga0075428_100074030 3300006844 Bacteria 3720
296 Ga0075428_100104462 3300006844 Bacteria 3089
297 Ga0075428_100190387 3300006844 Bacteria 2219
298 Ga0075428_100233246 3300006844 Bacteria 1986
299 Ga0075431_100000132 3300006847 Bacteria 49934
300 Ga0075431_100007034 3300006847 Bacteria 11174
301 Ga0075431_100033979 3300006847 Bacteria 5255
302 Ga0075431_100141290 3300006847 Bacteria 2482
303 Ga0075431_100144185 3300006847 Bacteria 2454
304 Ga0075431_100148314 3300006847 Bacteria 2416
305 Ga0075433_10007507 3300006852 Bacteria 8654
306 Ga0075433_10009387 3300006852 Bacteria 7816
307 Ga0075433_10063791 3300006852 Bacteria 3228
308 Ga0075433_10226729 3300006852 Bacteria 1659
309 Ga0075434_100002046 3300006871 Bacteria 17502
310 Ga0075434_100003469 3300006871 Bacteria 14096
311 Ga0075434_100010545 3300006871 Bacteria 8670
312 Ga0075434_100010716 3300006871 Bacteria 8608
313 Ga0075434_100015598 3300006871 Bacteria 7292
314 Ga0075434_100018868 3300006871 Bacteria 6666
315 Ga0075434_100043871 3300006871 Bacteria 4436
316 Ga0075434_100056584 3300006871 Bacteria 3898
317 Ga0075434_100059695 3300006871 Bacteria 3792
318 Ga0075429_100005605 3300006880 Bacteria 10821
319 Ga0075429_100125906 3300006880 Bacteria 2241
320 Ga0075436_100022672 3300006914 Bacteria 4314
321 Ga0075436_100078249 3300006914 Bacteria 2291
322 Ga0097620_100017457 3300006931 Bacteria 7214
323 Ga0097620_100097255 3300006931 Bacteria 2997
324 Ga0097620_100117315 3300006931 Bacteria 2727
325 Ga0097620_100230741 3300006931 Bacteria 1939
326 Ga0097620_100402694 3300006931 Bacteria 1464
327 Ga0099824_1010056 3300006942 Bacteria 11367
328 Ga0099824_1013197 3300006942 Bacteria 8676
329 Ga0099822_1001406 3300006943 Bacteria 27885
330 Ga0099822_1026245 3300006943 Bacteria 4955
331 Ga0075435_100009425 3300007076 Bacteria 7068
332 Ga0075435_100029324 3300007076 Bacteria 4318
333 Ga0075435_100064096 3300007076 Bacteria 2986
334 Ga0099794_10003585 3300007265 Bacteria 5951
335 Ga0099794_10009900 3300007265 Bacteria 4030
336 Ga0099794_10015670 3300007265 Bacteria 3351
337 Ga0099795_10003491 3300007788 Bacteria 3899
338 Ga0099795_10005064 3300007788 Bacteria 3469
339 Ga0105250_10030645 3300009092 Bacteria 2162
340 Ga0105250_10049173 3300009092 Bacteria 1691
341 Ga0105240_10016315 3300009093 Bacteria 10060
342 Ga0105240_10018472 3300009093 Bacteria 9360
343 Ga0105240_10104887 3300009093 Bacteria 3432
344 Ga0105240_10122827 3300009093 Bacteria 3125
345 Ga0105240_10368367 3300009093 Bacteria 1625
346 Ga0111539_10000933 3300009094 Bacteria 38278
347 Ga0111539_10006076 3300009094 Bacteria 15592
348 Ga0111539_10010044 3300009094 Bacteria 11930
349 Ga0111539_10019554 3300009094 Bacteria 8355
350 Ga0111539_10103652 3300009094 Bacteria 3338
351 Ga0111539_10131104 3300009094 Bacteria 2935
352 Ga0111539_10149563 3300009094 Bacteria 2733
353 Ga0111539_10216054 3300009094 Bacteria 2233
354 Ga0111539_10261304 3300009094 Bacteria 2015
355 Ga0105245_10090703 3300009098 Bacteria 2811
356 Ga0105245_10178531 3300009098 Bacteria 2027
357 Ga0105247_10025765 3300009101 Bacteria 3549
358 Ga0105247_10066644 3300009101 Bacteria 2242
359 Ga0105247_10103880 3300009101 Bacteria 1820
360 Ga0114129_10000280 3300009147 Bacteria 58505
361 Ga0114129_10027090 3300009147 Bacteria 8116
362 Ga0114129_10040832 3300009147 Bacteria 6540
363 Ga0114129_10041435 3300009147 Bacteria 6488
364 Ga0114129_10048840 3300009147 Bacteria 5947
365 Ga0114129_10063111 3300009147 Bacteria 5175
366 Ga0114129_10068788 3300009147 Bacteria 4936
367 Ga0114129_10081706 3300009147 Bacteria 4492
368 Ga0114129_10179324 3300009147 Bacteria 2884
369 Ga0114129_10233909 3300009147 Bacteria 2474
370 Ga0114129_10391600 3300009147 Bacteria 1832
371 Ga0105243_10088118 3300009148 Bacteria 2549
372 Ga0105243_10139959 3300009148 Bacteria 2063
373 Ga0105241_10016039 3300009174 Bacteria 5491
374 Ga0105241_10031659 3300009174 Bacteria 3960
375 Ga0105241_10050230 3300009174 Bacteria 3178
376 Ga0105241_10051550 3300009174 Bacteria 3139
377 Ga0105248_10047411 3300009177 Bacteria 4818
378 Ga0105248_10071925 3300009177 Bacteria 3886
379 Ga0105237_10010000 3300009545 Bacteria 10122
380 Ga0105237_10018618 3300009545 Bacteria 7184
381 Ga0105237_10028013 3300009545 Bacteria 5740
382 Ga0105237_10036555 3300009545 Bacteria 4970
383 Ga0105237_10054113 3300009545 Bacteria 4021
384 Ga0105237_10057725 3300009545 Bacteria 3884
385 Ga0105237_10059746 3300009545 Bacteria 3814
386 Ga0105237_10129278 3300009545 Bacteria 2520
387 Ga0105237_10143730 3300009545 Bacteria 2380
388 Ga0105237_10170473 3300009545 Bacteria 2176
389 Ga0105237_10200818 3300009545 Bacteria 1994
390 Ga0105238_10026564 3300009551 Bacteria 5903
391 Ga0105238_10045925 3300009551 Bacteria 4411
392 Ga0105238_10046421 3300009551 Bacteria 4384
393 Ga0105238_10049694 3300009551 Bacteria 4223
394 Ga0105238_10074883 3300009551 Bacteria 3378
395 Ga0105249_10021936 3300009553 Bacteria 5719
396 Ga0105249_10103934 3300009553 Bacteria 2676
397 Ga0105249_10119031 3300009553 Bacteria 2508
398 Ga0105249_10194742 3300009553 Bacteria 1980
399 Ga0099796_10007346 3300010159 Bacteria 2876
400 Ga0099796_10022593 3300010159 Bacteria 1953
401 Ga0105239_10059751 3300010375 Bacteria 4184
402 Ga0105239_10080412 3300010375 Bacteria 3586
403 Ga0105239_10148787 3300010375 Bacteria 2613
404 Ga0105239_10193665 3300010375 Bacteria 2276
405 Ga0105239_10215545 3300010375 Bacteria 2152
406 Ga0105246_10010229 3300011119 Bacteria 5794
407 Ga0105246_10101022 3300011119 Bacteria 2100
408 Ga0157370_10009437 3300013104 Bacteria 10426
409 Ga0157369_10009982 3300013105 Bacteria 10844
410 Ga0157369_10013868 3300013105 Bacteria 9105
411 Ga0157369_10076551 3300013105 Bacteria 3586
412 Ga0157369_10087438 3300013105 Bacteria 3328
413 Ga0157369_10132704 3300013105 Bacteria 2638
414 Ga0157374_10010088 3300013296 Bacteria 8113
415 Ga0157374_10056599 3300013296 Bacteria 3662
416 Ga0157374_10158323 3300013296 Bacteria 2205
417 Ga0157374_10351483 3300013296 Bacteria 1465
418 Ga0157378_10001711 3300013297 Bacteria 19741
419 Ga0157378_10085252 3300013297 Bacteria 2862
420 Ga0157378_10108945 3300013297 Bacteria 2537
421 Ga0157378_10185226 3300013297 Bacteria 1961
422 Ga0163162_10036057 3300013306 Bacteria 4928
423 Ga0163162_10072199 3300013306 Bacteria 3506
424 Ga0163162_10170297 3300013306 Bacteria 2302
425 Ga0163162_10173284 3300013306 Bacteria 2282
426 Ga0163162_10235260 3300013306 Bacteria 1962
427 Ga0157372_10232848 3300013307 Bacteria 2136
428 Ga0157375_10002389 3300013308 Bacteria 16243
429 Ga0157375_10028331 3300013308 Bacteria 5249
430 Ga0157375_10129401 3300013308 Bacteria 2643
431 Ga0157375_10174427 3300013308 Bacteria 2299
432 Ga0157375_10216330 3300013308 Bacteria 2074
433 Ga0157375_10279638 3300013308 Bacteria 1832
434 Ga0157375_10320821 3300013308 Bacteria 1714
435 Ga0157375_10335825 3300013308 Bacteria 1676
436 Ga0157375_10335939 3300013308 Bacteria 1676
437 Ga0163163_10005199 3300014325 Bacteria 11222
438 Ga0163163_10012257 3300014325 Bacteria 7807
439 Ga0163163_10030770 3300014325 Bacteria 5175
440 Ga0163163_10034855 3300014325 Bacteria 4878
441 Ga0163163_10223241 3300014325 Bacteria 1933
442 Ga0157380_10053360 3300014326 Bacteria 3205
443 Ga0157380_10111370 3300014326 Bacteria 2301
444 Ga0182008_10028985 3300014497 Bacteria 2798
445 Ga0157379_10081215 3300014968 Bacteria 2904
446 Ga0157379_10143626 3300014968 Bacteria 2152
447 Ga0157379_10199759 3300014968 Bacteria 1808
448 Ga0157376_10075006 3300014969 Bacteria 2885
449 Ga0157376_10075647 3300014969 Bacteria 2874
450 Ga0157376_10092413 3300014969 Bacteria 2623
451 Ga0157376_10120431 3300014969 Bacteria 2325
452 Ga0163161_10042735 3300017792 Bacteria 3261
453 Ga0163161_10045064 3300017792 Bacteria 3179
454 Ga0197907_10619077 3300020069 Bacteria 1753
455 Ga0206356_11161776 3300020070 Bacteria 1819
456 Ga0206355_1316074 3300020076 Bacteria 2144
457 Ga0206355_1578423 3300020076 Bacteria 1513
458 Ga0206351_10575076 3300020077 Bacteria 1640
459 Ga0206352_10061378 3300020078 Bacteria 1525
460 Ga0206352_10089368 3300020078 Bacteria 1863
461 Ga0206352_10222114 3300020078 Bacteria 1549
462 Ga0206354_10280028 3300020081 Bacteria 1511
463 Ga0206354_10650967 3300020081 Bacteria 1732
464 Ga0206353_10469523 3300020082 Bacteria 1588
465 Ga0206353_10483150 3300020082 Bacteria 1520
466 Ga0214544_1000508 3300021320 Bacteria 71511
467 Ga0214542_1000365 3300021321 Bacteria 78664
468 Ga0214545_1000211 3300021324 Bacteria 78664
469 Ga0214543_1005667 3300021327 Bacteria 22750
470 Ga0213872_10037781 3300021361 Bacteria 2205
471 Ga0213874_10027698 3300021377 Bacteria 1614
472 Ga0213876_10018405 3300021384 Bacteria 3689
473 Ga0213876_10040021 3300021384 Bacteria 2476
474 Ga0213875_10000748 3300021388 Bacteria 24571
475 Ga0213875_10003375 3300021388 Bacteria 9099
476 Ga0213875_10003454 3300021388 Bacteria 8997
477 Ga0213875_10011211 3300021388 Bacteria 4466
478 Ga0213875_10046568 3300021388 Bacteria 2035
479 Ga0213871_10000047 3300021441 Bacteria 9118
480 Ga0224712_10022783 3300022467 Bacteria 2164
481 Ga0224712_10023166 3300022467 Bacteria 2152
482 Ga0209677_102475 3300025253 Bacteria 6913
483 Ga0209677_104333 3300025253 Bacteria 4142
484 Ga0209148_1000616 3300025254 Bacteria 31649
485 Ga0209233_1005978 3300025261 Bacteria 3978
486 Ga0209233_1009969 3300025261 Bacteria 2867
487 Ga0209455_1000716 3300025272 Bacteria 19228
488 Ga0209455_1007058 3300025272 Bacteria 3224
489 Ga0209673_1019616 3300025273 Bacteria 2421
490 Ga0209564_1004787 3300025295 Bacteria 8071
491 Ga0209758_1000021 3300025297 Bacteria 697691
492 Ga0209758_1000211 3300025297 Bacteria 127721
493 Ga0209758_1002140 3300025297 Bacteria 20814
494 Ga0209758_1002422 3300025297 Bacteria 19095
495 Ga0209256_1015513 3300025299 Bacteria 2658
496 Ga0207426_1000229 3300025302 Bacteria 128596
497 Ga0207426_1000607 3300025302 Bacteria 46331
498 Ga0207426_1014733 3300025302 Bacteria 2858
499 Ga0207426_1027742 3300025302 Bacteria 1883
500 Ga0209051_1037270 3300025303 Bacteria 1786
501 Ga0209257_1000838 3300025304 Bacteria 44310
502 Ga0209257_1008496 3300025304 Bacteria 5817
503 Ga0209257_1019215 3300025304 Bacteria 2584
504 Ga0207697_10012707 3300025315 Bacteria 3526
505 Ga0207696_1022896 3300025711 Bacteria 1977
506 Ga0207682_10004100 3300025893 Bacteria 6184
507 Ga0207692_10000069 3300025898 Bacteria 30165
508 Ga0207692_10001849 3300025898 Bacteria 8047
509 Ga0207692_10047515 3300025898 Bacteria 2155
510 Ga0207692_10122593 3300025898 Bacteria 1457
511 Ga0207642_10033258 3300025899 Bacteria 2180
512 Ga0207710_10017333 3300025900 Bacteria 3055
513 Ga0207710_10023410 3300025900 Bacteria 2654
514 Ga0207710_10028649 3300025900 Bacteria 2418
515 Ga0207688_10001429 3300025901 Bacteria 12458
516 Ga0207688_10071261 3300025901 Bacteria 1973
517 Ga0207688_10078787 3300025901 Bacteria 1878
518 Ga0207688_10080221 3300025901 Bacteria 1862
519 Ga0207688_10097358 3300025901 Bacteria 1695
520 Ga0207680_10091032 3300025903 Bacteria 1940
521 Ga0207647_10001953 3300025904 Bacteria 15737
522 Ga0207647_10035021 3300025904 Bacteria 3201
523 Ga0207647_10082441 3300025904 Bacteria 1926
524 Ga0207685_10009496 3300025905 Bacteria 2829
525 Ga0207699_10000289 3300025906 Bacteria 27192
526 Ga0207699_10008164 3300025906 Bacteria 5152
527 Ga0207699_10013807 3300025906 Bacteria 4146
528 Ga0207645_10034206 3300025907 Bacteria 3265
529 Ga0207705_10049293 3300025909 Bacteria 3031
530 Ga0207684_10029075 3300025910 Bacteria 4707
531 Ga0207684_10208540 3300025910 Bacteria 1686
532 Ga0207654_10019277 3300025911 Bacteria 3598
533 Ga0207707_10001525 3300025912 Bacteria 21374
534 Ga0207707_10010954 3300025912 Bacteria 7887
535 Ga0207707_10013724 3300025912 Bacteria 7063
536 Ga0207707_10023507 3300025912 Bacteria 5391
537 Ga0207707_10039194 3300025912 Bacteria 4142
538 Ga0207707_10259397 3300025912 Bacteria 1508
539 Ga0207695_10000015 3300025913 Bacteria 803205
540 Ga0207695_10044455 3300025913 Bacteria 4724
541 Ga0207695_10058307 3300025913 Bacteria 4008
542 Ga0207695_10137601 3300025913 Bacteria 2394
543 Ga0207671_10008452 3300025914 Bacteria 8727
544 Ga0207671_10008638 3300025914 Bacteria 8606
545 Ga0207671_10037819 3300025914 Bacteria 3578
546 Ga0207671_10054490 3300025914 Bacteria 2963
547 Ga0207671_10061734 3300025914 Bacteria 2781
548 Ga0207671_10110809 3300025914 Bacteria 2088
549 Ga0207671_10144097 3300025914 Bacteria 1837
550 Ga0207671_10147168 3300025914 Bacteria 1818
551 Ga0207693_10000612 3300025915 Bacteria 31937
552 Ga0207693_10001157 3300025915 Bacteria 23537
553 Ga0207693_10002947 3300025915 Bacteria 14732
554 Ga0207693_10008488 3300025915 Bacteria 8409
555 Ga0207693_10016489 3300025915 Bacteria 5903
556 Ga0207693_10032710 3300025915 Bacteria 4104
557 Ga0207693_10160282 3300025915 Bacteria 1770
558 Ga0207693_10164763 3300025915 Bacteria 1745
559 Ga0207663_10001917 3300025916 Bacteria 9853
560 Ga0207663_10002533 3300025916 Bacteria 8788
561 Ga0207663_10005348 3300025916 Bacteria 6463
562 Ga0207663_10006014 3300025916 Bacteria 6170
563 Ga0207663_10018130 3300025916 Bacteria 3938
564 Ga0207663_10035940 3300025916 Bacteria 2976
565 Ga0207663_10103332 3300025916 Bacteria 1919
566 Ga0207660_10001543 3300025917 Bacteria 15424
567 Ga0207660_10057636 3300025917 Bacteria 2782
568 Ga0207660_10075782 3300025917 Bacteria 2458
569 Ga0207660_10090179 3300025917 Bacteria 2271
570 Ga0207657_10019857 3300025919 Bacteria 6367
571 Ga0207657_10130219 3300025919 Bacteria 2062
572 Ga0207657_10146997 3300025919 Bacteria 1922
573 Ga0207649_10044917 3300025920 Bacteria 2707
574 Ga0207652_10006206 3300025921 Bacteria 9652
575 Ga0207652_10059491 3300025921 Bacteria 3294
576 Ga0207652_10067123 3300025921 Bacteria 3110
577 Ga0207652_10071777 3300025921 Bacteria 3009
578 Ga0207652_10075046 3300025921 Bacteria 2945
579 Ga0207646_10283399 3300025922 Unclassified 1497
580 Ga0207681_10142125 3300025923 Bacteria 1789
581 Ga0207694_10025225 3300025924 Bacteria 4518
582 Ga0207694_10059445 3300025924 Bacteria 2973
583 Ga0207694_10065100 3300025924 Bacteria 2842
584 Ga0207694_10069929 3300025924 Bacteria 2743
585 Ga0207694_10173654 3300025924 Bacteria 1746
586 Ga0207650_10009631 3300025925 Bacteria 6607
587 Ga0207650_10049079 3300025925 Bacteria 3115
588 Ga0207659_10013140 3300025926 Bacteria 5296
589 Ga0207659_10143956 3300025926 Bacteria 1854
590 Ga0207659_10169132 3300025926 Bacteria 1723
591 Ga0207687_10033081 3300025927 Bacteria 3505
592 Ga0207700_10003623 3300025928 Bacteria 9002
593 Ga0207700_10013365 3300025928 Bacteria 5338
594 Ga0207700_10015503 3300025928 Bacteria 5030
595 Ga0207700_10025830 3300025928 Bacteria 4086
596 Ga0207700_10062855 3300025928 Bacteria 2821
597 Ga0207700_10084261 3300025928 Bacteria 2491
598 Ga0207700_10114873 3300025928 Bacteria 2173
599 Ga0207700_10198572 3300025928 Bacteria 1689
600 Ga0207664_10005442 3300025929 Bacteria 8704
601 Ga0207664_10005962 3300025929 Bacteria 8342
602 Ga0207664_10006018 3300025929 Bacteria 8305
603 Ga0207664_10023512 3300025929 Bacteria 4619
604 Ga0207664_10068321 3300025929 Bacteria 2854
605 Ga0207664_10121243 3300025929 Bacteria 2188
606 Ga0207644_10057893 3300025931 Bacteria 2799
607 Ga0207644_10083229 3300025931 Bacteria 2369
608 Ga0207644_10113384 3300025931 Bacteria 2053
609 Ga0207706_10017340 3300025933 Bacteria 6487
610 Ga0207706_10037610 3300025933 Bacteria 4296
611 Ga0207706_10073694 3300025933 Bacteria 3002
612 Ga0207706_10092525 3300025933 Bacteria 2659
613 Ga0207709_10076358 3300025935 Bacteria 2144
614 Ga0207709_10080306 3300025935 Bacteria 2100
615 Ga0207670_10054619 3300025936 Bacteria 2696
616 Ga0207669_10001519 3300025937 Bacteria 9883
617 Ga0207669_10001922 3300025937 Bacteria 8806
618 Ga0207704_10172861 3300025938 Bacteria 1552
619 Ga0207665_10005674 3300025939 Bacteria 8314
620 Ga0207665_10016250 3300025939 Bacteria 4886
621 Ga0207665_10044028 3300025939 Bacteria 2986
622 Ga0207665_10062480 3300025939 Bacteria 2527
623 Ga0207665_10139787 3300025939 Bacteria 1725
624 Ga0207691_10000910 3300025940 Bacteria 29340
625 Ga0207691_10008519 3300025940 Bacteria 9849
626 Ga0207711_10115273 3300025941 Bacteria 2394
627 Ga0207689_10008628 3300025942 Bacteria 8876
628 Ga0207689_10019702 3300025942 Bacteria 5684
629 Ga0207689_10112421 3300025942 Bacteria 2239
630 Ga0207689_10124466 3300025942 Bacteria 2121
631 Ga0207661_10000309 3300025944 Bacteria 31114
632 Ga0207661_10010366 3300025944 Bacteria 6707
633 Ga0207661_10038523 3300025944 Bacteria 3747
634 Ga0207661_10131875 3300025944 Bacteria 2141
635 Ga0207679_10170203 3300025945 Bacteria 1792
636 Ga0207679_10247033 3300025945 Bacteria 1515
637 Ga0207667_10037832 3300025949 Bacteria 5157
638 Ga0207667_10047739 3300025949 Bacteria 4530
639 Ga0207667_10134908 3300025949 Bacteria 2542
640 Ga0207667_10225141 3300025949 Bacteria 1921
641 Ga0207667_10297985 3300025949 Bacteria 1647
642 Ga0207651_10070106 3300025960 Bacteria 2478
643 Ga0207712_10006806 3300025961 Bacteria 7210
644 Ga0207712_10036612 3300025961 Bacteria 3344
645 Ga0207712_10105979 3300025961 Bacteria 2099
646 Ga0207668_10006532 3300025972 Bacteria 6891
647 Ga0207668_10013643 3300025972 Bacteria 5012
648 Ga0207668_10066311 3300025972 Bacteria 2558
649 Ga0207668_10075063 3300025972 Bacteria 2430
650 Ga0207658_10142335 3300025986 Bacteria 1942
651 Ga0207677_10058702 3300026023 Bacteria 2651
652 Ga0207677_10061807 3300026023 Bacteria 2595
653 Ga0207703_10020084 3300026035 Bacteria 5221
654 Ga0207703_10039853 3300026035 Bacteria 3756
655 Ga0207703_10154972 3300026035 Bacteria 2001
656 Ga0207639_10044210 3300026041 Bacteria 3349
657 Ga0207639_10076440 3300026041 Bacteria 2637
658 Ga0207639_10088570 3300026041 Bacteria 2470
659 Ga0207639_10124819 3300026041 Bacteria 2121
660 Ga0207639_10138822 3300026041 Bacteria 2022
661 Ga0207639_10143422 3300026041 Bacteria 1993
662 Ga0207639_10182460 3300026041 Bacteria 1786
663 Ga0207678_10021574 3300026067 Bacteria 5648
664 Ga0207678_10023262 3300026067 Bacteria 5420
665 Ga0207678_10032462 3300026067 Bacteria 4550
666 Ga0207678_10055570 3300026067 Bacteria 3410
667 Ga0207678_10088731 3300026067 Bacteria 2643
668 Ga0207678_10118834 3300026067 Bacteria 2256
669 Ga0207678_10190721 3300026067 Bacteria 1751
670 Ga0207708_10013604 3300026075 Bacteria 6080
671 Ga0207708_10019614 3300026075 Bacteria 5099
672 Ga0207708_10100894 3300026075 Bacteria 2234
673 Ga0207708_10133803 3300026075 Bacteria 1940
674 Ga0207708_10161225 3300026075 Bacteria 1771
675 Ga0207702_10003615 3300026078 Bacteria 14048
676 Ga0207702_10009625 3300026078 Bacteria 8111
677 Ga0207702_10167631 3300026078 Bacteria 2011
678 Ga0207641_10123067 3300026088 Bacteria 2318
679 Ga0207648_10026064 3300026089 Bacteria 5198
680 Ga0207676_10041124 3300026095 Bacteria 3546
681 Ga0207676_10051483 3300026095 Bacteria 3215
682 Ga0207674_10003474 3300026116 Bacteria 19275
683 Ga0207674_10078492 3300026116 Bacteria 3306
684 Ga0207674_10098061 3300026116 Bacteria 2915
685 Ga0207674_10119674 3300026116 Bacteria 2602
686 Ga0207674_10138856 3300026116 Bacteria 2391
687 Ga0207674_10157891 3300026116 Bacteria 2223
688 Ga0207675_100022031 3300026118 Bacteria 5930
689 Ga0207675_100040631 3300026118 Bacteria 4344
690 Ga0207675_100043587 3300026118 Bacteria 4190
691 Ga0207675_100047496 3300026118 Bacteria 4008
692 Ga0207675_100077104 3300026118 Bacteria 3122
693 Ga0207675_100196896 3300026118 Bacteria 1934
694 Ga0207675_100229170 3300026118 Bacteria 1792
695 Ga0207675_100235736 3300026118 Bacteria 1767
696 Ga0207675_100376634 3300026118 Bacteria 1395
697 Ga0207683_10001401 3300026121 Bacteria 21763
698 Ga0207683_10043864 3300026121 Bacteria 3909
699 Ga0207683_10065696 3300026121 Bacteria 3198
700 Ga0207683_10102091 3300026121 Bacteria 2561
701 Ga0207683_10116996 3300026121 Bacteria 2390
702 Ga0209389_1000281 3300027296 Bacteria 32069
703 Ga0209389_1000287 3300027296 Bacteria 31774
704 Ga0209589_1000003 3300027357 Bacteria 629130
705 Ga0209589_1000007 3300027357 Bacteria 425699
706 Ga0209589_1000072 3300027357 Bacteria 98789
707 Ga0209489_100003 3300027361 Bacteria 663105
708 Ga0209489_100008 3300027361 Bacteria 425699
709 Ga0209489_100031 3300027361 Bacteria 184074
710 Ga0209489_108310 3300027361 Bacteria 14336
711 Ga0209700_100003 3300027363 Bacteria 663105
712 Ga0209700_100009 3300027363 Bacteria 425699
713 Ga0209700_100010 3300027363 Bacteria 395269
714 Ga0209179_1004665 3300027512 Bacteria 2087
715 Ga0209588_1004526 3300027671 Bacteria 3927
716 Ga0209588_1010758 3300027671 Bacteria 2756
717 Ga0209813_10000619 3300027866 Bacteria 8265
718 Ga0207428_10003035 3300027907 Bacteria 16519
719 Ga0207428_10059247 3300027907 Bacteria 3036
720 Ga0207428_10075145 3300027907 Bacteria 2649
721 Ga0268266_10000857 3300028379 Bacteria 39606
722 Ga0268266_10002192 3300028379 Bacteria 21357
723 Ga0268266_10020753 3300028379 Bacteria 5601
724 Ga0268266_10052158 3300028379 Bacteria 3512
725 Ga0268266_10058109 3300028379 Bacteria 3330
726 Ga0268265_10008419 3300028380 Bacteria 6963
727 Ga0268265_10027002 3300028380 Bacteria 4091
728 Ga0268265_10103498 3300028380 Bacteria 2305
729 Ga0268265_10156865 3300028380 Bacteria 1927
730 Ga0268265_10173959 3300028380 Bacteria 1843
731 Ga0268264_10000162 3300028381 Bacteria 148472
732 Ga0268264_10003345 3300028381 Bacteria 13859
733 Ga0268264_10021446 3300028381 Bacteria 5274
734 Ga0268264_10023769 3300028381 Bacteria 4999
735 Ga0268264_10039768 3300028381 Bacteria 3885
736 Ga0268264_10108822 3300028381 Bacteria 2423
737 Ga0268264_10117309 3300028381 Bacteria 2341
738 Ga0265334_10023379 3300028573 Bacteria 2513
739 Ga0265318_10017367 3300028577 Bacteria 2955
740 Ga0265323_10002402 3300028653 Bacteria 8615
741 Ga0265336_10000443 3300028666 Bacteria 25347
742 Ga0307515_10003270 3300028794 Bacteria 34266
743 Ga0265338_10001194 3300028800 Bacteria 42941
744 Ga0265338_10031136 3300028800 Bacteria 5234
745 Ga0265332_10004308 3300031238 Bacteria 6713
746 Ga0265325_10023987 3300031241 Bacteria 3321
747 Ga0265340_10015157 3300031247 Bacteria 4009
748 Ga0265339_10003343 3300031249 Bacteria 11232
749 Ga0265316_10030447 3300031344 Bacteria 4423
750 Ga0265316_10131217 3300031344 Bacteria 1887
751 Ga0307513_10084490 3300031456 Bacteria 3260
752 Ga0307509_10033205 3300031507 Bacteria 5680
753 Ga0307509_10232821 3300031507 Bacteria 1643
754 Ga0265313_10009133 3300031595 Bacteria 6480
755 Ga0265314_10031327 3300031711 Bacteria 3928
756 Ga0265342_10027525 3300031712 Bacteria 3551
757 Ga0265342_10053678 3300031712 Bacteria 2397
758 Ga0316578_10036599 3300031728 Bacteria 2825
759 Ga0307516_10005336 3300031730 Bacteria 15451
760 Ga0307516_10013317 3300031730 Bacteria 8778
761 Ga0307410_10039451 3300031852 Bacteria 3101
762 Ga0307406_10074689 3300031901 Bacteria 2233
763 Ga0307416_100050158 3300032002 Bacteria 3325
764 Ga0307510_10011576 3300033180 Bacteria 10466
765 Ga0373929_0009323 3300035085 Bacteria 1819
766 Ga0373934_0008480 3300035086 Bacteria 3831
767 Ga0373940_0005502 3300035088 Bacteria 2750
768 Ga0373944_0012984 3300035089 Bacteria 2304
769 Ga0373949_0017409 3300035090 Bacteria 1620
770 Ga0373923_0001387 3300035111 Bacteria 6901
771 Ga0373923_0041798 3300035111 Bacteria 1891
772 Ga0373932_0026524 3300035112 Bacteria 1577
773 Ga0373936_0039797 3300035113 Bacteria 1882
774 Ga0373939_0040342 3300035114 Bacteria 1401
775 Ga0373945_0007800 3300035116 Bacteria 3473
776 Ga0373945_0019537 3300035116 Bacteria 2314
777 Ga0373945_0053648 3300035116 Bacteria 1489
778 Ga0373953_0002318 3300035117 Bacteria 5724
779 Ga0373953_0009137 3300035117 Bacteria 3393
780 Ga0373954_0000575 3300035118 Bacteria 13881
781 Ga0373954_0003873 3300035118 Bacteria 6400
782 Ga0373956_0007433 3300035119 Bacteria 4413
783 Ga0373957_0000310 3300035120 Bacteria 12240
784 Ga0373957_0003550 3300035120 Bacteria 4629
785 Ga0373943_0003064 3300035170 Bacteria 7594
786 Ga0373943_0003092 3300035170 Bacteria 7558
787 Ga0373943_0012722 3300035170 Bacteria 3794
788 Ga0373943_0049705 3300035170 Bacteria 2059
789 Ga0373943_0050899 3300035170 Bacteria 2037
790 Ga0373946_0001574 3300035171 Bacteria 7947
791 Ga0373946_0041444 3300035171 Bacteria 1888
792 Ga0373955_0004813 3300035172 Bacteria 6012
793 Ga0373955_0006580 3300035172 Bacteria 5300
794 Ga0373955_0018941 3300035172 Bacteria 3433
795 Ga0373942_0016516 3300035207 Bacteria 1811
796 Ga0373942_0038396 3300035207 Bacteria 1298
797 Ga0373961_0024902 3300035241 Bacteria 1622
798 Ga0373962_0003154 3300035242 Bacteria 3953
799 Ga0373962_0012004 3300035242 Bacteria 2178
800 Ga0373962_0024449 3300035242 Bacteria 1615
801 Ga0373924_0028362 3300035410 Bacteria 2231
802 Ga0373924_0040288 3300035410 Bacteria 1911
803 Ga0373931_0001359 3300035691 Bacteria 10471
804 Ga0373931_0003293 3300035691 Bacteria 7229
805 Ga0373931_0003521 3300035691 Bacteria 7054
806 Ga0373931_0013106 3300035691 Bacteria 4031
807 Ga0373931_0103293 3300035691 Bacteria 1606
808 Ga0373935_0000468 3300035692 Bacteria 21049
809 Ga0373935_0017306 3300035692 Bacteria 4370
810 Ga0373935_0023585 3300035692 Bacteria 3782
811 Ga0373935_0024652 3300035692 Bacteria 3704
812 Ga0373935_0057971 3300035692 Bacteria 2472
813 Ga0373935_0111111 3300035692 Bacteria 1819
814 Ga0373927_0000801 3300035695 Bacteria 24039
815 Ga0373927_0023630 3300035695 Bacteria 4023
816 Ga0373927_0026896 3300035695 Bacteria 3760
817 Ga0373927_0029396 3300035695 Bacteria 3581
818 Ga0373927_0107655 3300035695 Bacteria 1816
819 Ga0373933_0006978 3300035724 Bacteria 6156
820 Ga0373933_0009634 3300035724 Bacteria 5277
821 Ga0373933_0067689 3300035724 Bacteria 2167
822 Ga0373947_0004970 3300035725 Bacteria 7781
823 Ga0373947_0008677 3300035725 Bacteria 5848
824 Ga0373947_0010715 3300035725 Bacteria 5262
825 Ga0373947_0054014 3300035725 Bacteria 2424
826 Ga0373947_0054510 3300035725 Bacteria 2413
827 Ga0373937_0013442 3300036401 Bacteria 7210
828 Ga0373937_0017298 3300036401 Bacteria 6420
829 Ga0373925_0005078 3300037068 Bacteria 9849
830 Ga0373925_0012194 3300037068 Bacteria 6222
831 Ga0373925_0066373 3300037068 Bacteria 2720
832 Ga0373925_0114015 3300037068 Bacteria 2091
833 Ga0395899_0035966 3300037312 Bacteria 3716
834 Ga0395900_0005908 3300037418 Bacteria 12779
835 Ga0395900_0009959 3300037418 Bacteria 9731
836 Ga0395900_0010114 3300037418 Bacteria 9648
837 Ga0395900_0170696 3300037418 Bacteria 2215
838 Ga0395898_0002979 3300037466 Bacteria 19242
839 Ga0395898_0060531 3300037466 Bacteria 3679
840 Ga0395898_0082027 3300037466 Bacteria 3109
841 Ga0395898_0120358 3300037466 Bacteria 2515
842 Ga0395898_0177688 3300037466 Bacteria 2034
843 Ga0395898_0228178 3300037466 Bacteria 1776
844 Ga0395905_0002573 3300037471 Bacteria 19993
845 Ga0395905_0093671 3300037471 Bacteria 2817
846 Ga0395905_0209939 3300037471 Bacteria 1824
847 Ga0395905_0214454 3300037471 Bacteria 1803
848 Ga0436364_0063853 3300037853 Bacteria 28863
849 Ga0436364_0425406 3300037853 Bacteria 2118
850 Ga0436364_0875825 3300037853 Bacteria 32110
851 Ga0436364_0936501 3300037853 Bacteria 40899
852 Ga0436364_1037748 3300037853 Bacteria 27359
853 Ga0436364_1117332 3300037853 Bacteria 2373
854 Ga0395901_0002009 3300038443 Bacteria 20939
855 Ga0395901_0002583 3300038443 Bacteria 18359
856 Ga0395901_0002729 3300038443 Bacteria 17807
857 Ga0395901_0040271 3300038443 Bacteria 4839
858 Ga0395901_0179180 3300038443 Bacteria 2222
859 Ga0436365_0071656 3300039437 Bacteria 2393
860 Ga0436365_0156834 3300039437 Bacteria 2628
861 Ga0436365_0206643 3300039437 Bacteria 5981
862 Ga0436365_1894746 3300039437 Bacteria 9037
863 Ga0436360_0472871 3300039438 Bacteria 10155
864 Ga0436360_0857979 3300039438 Bacteria 2093
865 Ga0436361_0005645 3300039447 Bacteria 3005
866 Ga0436361_0142586 3300039447 Bacteria 3259
867 Ga0436361_0303930 3300039447 Bacteria 5146
868 Ga0436361_0488607 3300039447 Bacteria 3791
869 Ga0436363_1256145 3300039450 Bacteria 2251
870 Ga0436363_1263636 3300039450 Bacteria 7386
871 Ga0436362_0446479 3300039453 Bacteria 5719
872 Ga0451793_0230553 3300041452 Bacteria 1936
873 Ga0439435_0026053 3300042436 Bacteria 1554
874 Ga0466969_0026253 3300044656 Bacteria 2988
875 Ga0466972_0000238 3300044658 Bacteria 37807
876 Ga0466972_0000728 3300044658 Bacteria 15731
877 Ga0466965_0011418 3300044683 Bacteria 4163
878 Ga0466966_0009776 3300044684 Bacteria 6357
879 Ga0466961_0000007 3300044693 Bacteria 146374
880 Ga0466961_0114167 3300044693 Bacteria 1698
881 Ga0466963_0027947 3300044694 Bacteria 3616
882 Ga0466963_0053755 3300044694 Bacteria 2675
883 Ga0466963_0053828 3300044694 Bacteria 2673
884 Ga0466968_0000531 3300044735 Bacteria 12939
885 Ga0466957_0031508 3300044842 Bacteria 3169
886 Ga0466960_0020241 3300044901 Bacteria 2944
887 Ga0466959_0006767 3300045049 Bacteria 7985
888 Ga0466959_0022085 3300045049 Bacteria 4701
889 Ga0466959_0164384 3300045049 Bacteria 1559
890 Ga0451576_0261718 3300045051 Bacteria 1808
891 Ga0466967_0039701 3300045976 Bacteria 4048
892 Ga0466967_0100148 3300045976 Bacteria 2647
893 Ga0466967_0120775 3300045976 Bacteria 2420
894 Ga0466967_0275862 3300045976 Bacteria 1612
895 Ga0495617_003205 3300046452 Bacteria 6219
896 Ga0495617_041209 3300046452 Bacteria 1544
897 Ga0495592_0004934 3300046454 Bacteria 9821
898 Ga0495592_0009635 3300046454 Bacteria 7268
899 Ga0495592_0026990 3300046454 Bacteria 4354
900 Ga0495592_0135214 3300046454 Bacteria 1720
901 Ga0495603_0000076 3300046455 Bacteria 43518
902 Ga0495603_0000298 3300046455 Bacteria 26417
903 Ga0495603_0001807 3300046455 Bacteria 12628
904 Ga0495603_0012503 3300046455 Bacteria 5139
905 Ga0495603_0019236 3300046455 Bacteria 4135
906 Ga0495603_0073286 3300046455 Bacteria 2012
907 Ga0495603_0074272 3300046455 Bacteria 1996
908 Ga0495590_0023171 3300046457 Bacteria 2194
909 Ga0495590_0023720 3300046457 Bacteria 2164
910 Ga0495629_0000087 3300046459 Bacteria 81337
911 Ga0495629_0000274 3300046459 Bacteria 44731
912 Ga0495629_0000336 3300046459 Bacteria 40110
913 Ga0495629_0026723 3300046459 Bacteria 4099
914 Ga0495629_0031544 3300046459 Bacteria 3752
915 Ga0495629_0083933 3300046459 Bacteria 2223
916 Ga0495638_0004997 3300046460 Bacteria 9950
917 Ga0495638_0039519 3300046460 Bacteria 2995
918 Ga0495641_0005191 3300046461 Bacteria 8890
919 Ga0495641_0049337 3300046461 Bacteria 1927
920 Ga0495651_0016316 3300046462 Bacteria 5751
921 Ga0495651_0021993 3300046462 Bacteria 4959
922 Ga0495651_0032043 3300046462 Bacteria 4100
923 Ga0495653_0011688 3300046463 Bacteria 7164
924 Ga0495653_0013726 3300046463 Bacteria 6602
925 Ga0495650_0051151 3300046471 Bacteria 1704
926 Ga0495580_0000735 3300046472 Bacteria 28060
927 Ga0495580_0003367 3300046472 Bacteria 13663
928 Ga0495580_0043997 3300046472 Bacteria 3176
929 Ga0495582_0000101 3300046473 Bacteria 44353
930 Ga0495582_0000134 3300046473 Bacteria 39810
931 Ga0495582_0031888 3300046473 Bacteria 2898
932 Ga0495582_0063318 3300046473 Bacteria 2043
933 Ga0495605_0046305 3300046474 Bacteria 2139
934 Ga0495639_0000022 3300046475 Bacteria 72037
935 Ga0495639_0001106 3300046475 Bacteria 12153
936 Ga0495639_0024238 3300046475 Bacteria 2670
937 Ga0495639_0039535 3300046475 Bacteria 2121
938 Ga0495662_0000460 3300046476 Bacteria 18380
939 Ga0495662_0001392 3300046476 Bacteria 11990
940 Ga0495662_0017387 3300046476 Bacteria 3481
941 Ga0495662_0051973 3300046476 Bacteria 1978
942 Ga0495664_0007291 3300046477 Bacteria 6135
943 Ga0495664_0010312 3300046477 Bacteria 5244
944 Ga0495664_0017317 3300046477 Bacteria 4117
945 Ga0495664_0024065 3300046477 Bacteria 3537
946 Ga0495664_0080243 3300046477 Bacteria 1955
947 Ga0495584_0061733 3300046491 Bacteria 1884
948 Ga0495584_0067052 3300046491 Bacteria 1805
949 Ga0495585_0031744 3300046492 Bacteria 2997
950 Ga0495594_0000176 3300046499 Bacteria 30884
951 Ga0495594_0001316 3300046499 Bacteria 12934
952 Ga0495594_0038830 3300046499 Bacteria 2601
953 Ga0495607_0101529 3300046501 Bacteria 1540
954 Ga0495608_0003122 3300046511 Bacteria 11828
955 Ga0495608_0009651 3300046511 Bacteria 6734
956 Ga0495608_0104948 3300046511 Bacteria 1820
957 Ga0495616_0022143 3300046513 Bacteria 3434
958 Ga0495628_0023257 3300046516 Bacteria 5088
959 Ga0495628_0036847 3300046516 Bacteria 3923
960 Ga0495628_0037986 3300046516 Bacteria 3858
961 Ga0495628_0067721 3300046516 Bacteria 2787
962 Ga0495628_0153080 3300046516 Bacteria 1756
963 Ga0495630_0010164 3300046517 Bacteria 6784
964 Ga0495630_0039291 3300046517 Bacteria 3539
965 Ga0495631_0012833 3300046518 Bacteria 4080
966 Ga0495631_0027377 3300046518 Bacteria 2609
967 Ga0495632_0035619 3300046519 Bacteria 2538
968 Ga0495632_0087382 3300046519 Bacteria 1482
969 Ga0495643_0010781 3300046522 Bacteria 5607
970 Ga0495643_0092925 3300046522 Bacteria 1554
971 Ga0495642_0056860 3300046528 Bacteria 1617
972 Ga0495652_0009267 3300046529 Bacteria 8946
973 Ga0495652_0069724 3300046529 Bacteria 2941
974 Ga0495665_0000064 3300046531 Bacteria 43712
975 Ga0495665_0005050 3300046531 Bacteria 7116
976 Ga0495640_0016218 3300046533 Bacteria 5577
977 Ga0495640_0074143 3300046533 Bacteria 2277
978 Ga0495586_0020121 3300046535 Bacteria 3555
979 Ga0495587_0003309 3300046536 Bacteria 10759
980 Ga0495587_0012587 3300046536 Bacteria 5320
981 Ga0495598_0001513 3300046537 Bacteria 4636
982 Ga0495621_0018107 3300046539 Bacteria 2284
983 Ga0495645_0004289 3300046543 Bacteria 9740
984 Ga0495645_0004431 3300046543 Bacteria 9588
985 Ga0495645_0030408 3300046543 Bacteria 3932
986 Ga0495622_0005549 3300046557 Bacteria 5849
987 Ga0495633_0029447 3300046558 Bacteria 2672
988 Ga0495633_0039800 3300046558 Bacteria 2242
989 Ga0495667_0003046 3300046559 Bacteria 11238
990 Ga0495667_0010132 3300046559 Bacteria 6380
991 Ga0495667_0023182 3300046559 Bacteria 4183
992 Ga0495667_0060668 3300046559 Bacteria 2480
993 Ga0495667_0074446 3300046559 Bacteria 2211
994 Ga0495656_0001407 3300046615 Bacteria 7860
995 Ga0495656_0056488 3300046615 Bacteria 1696
996 Ga0495656_0078571 3300046615 Bacteria 1483
997 Ga0495668_0009325 3300046616 Bacteria 6034
998 Ga0495668_0049236 3300046616 Bacteria 2337
999 Ga0495668_0092581 3300046616 Bacteria 1656
1000 Ga0495668_0126719 3300046616 Bacteria 1398
1001 Ga0495634_0003296 3300046642 Bacteria 13017
1002 Ga0495634_0007620 3300046642 Bacteria 8111
1003 Ga0495634_0012312 3300046642 Bacteria 6198
1004 Ga0495634_0024752 3300046642 Bacteria 4208
1005 Ga0495611_0030727 3300046648 Bacteria 2363
1006 Ga0495611_0048713 3300046648 Bacteria 1905
1007 Ga0495611_0077511 3300046648 Bacteria 1524
1008 Ga0495625_0114002 3300046660 Bacteria 1845
1009 Ga0495625_0118548 3300046660 Bacteria 1803
1010 Ga0495625_0174850 3300046660 Bacteria 1431
1011 Ga0495635_0001496 3300046663 Bacteria 15658
1012 Ga0495635_0005568 3300046663 Bacteria 8766
1013 Ga0495635_0010556 3300046663 Bacteria 6466
1014 Ga0495635_0030771 3300046663 Bacteria 3728
1015 Ga0495635_0069381 3300046663 Bacteria 2416
1016 Ga0495659_0037345 3300046664 Bacteria 1720
1017 Ga0495661_0046229 3300046665 Bacteria 2659
1018 Ga0495661_0113893 3300046665 Bacteria 1504
1019 Ga0495661_0117935 3300046665 Bacteria 1470
1020 Ga0495588_0005658 3300046674 Bacteria 5573
1021 Ga0495588_0013711 3300046674 Bacteria 3865
1022 Ga0495588_0080933 3300046674 Bacteria 1695
1023 Ga0495657_0031437 3300046675 Bacteria 3711
1024 Ga0495657_0037019 3300046675 Bacteria 3366
1025 Ga0495599_0003798 3300046678 Bacteria 8867
1026 Ga0495599_0013813 3300046678 Bacteria 4996
1027 Ga0495599_0045639 3300046678 Bacteria 2748
1028 Ga0495623_0005956 3300046679 Bacteria 7943
1029 Ga0495623_0017851 3300046679 Bacteria 4582
1030 Ga0495623_0085831 3300046679 Bacteria 1941
1031 Ga0495646_0003838 3300046680 Bacteria 9391
1032 Ga0495646_0008942 3300046680 Bacteria 6360
1033 Ga0495647_0015228 3300046681 Bacteria 2691
1034 Ga0495658_0000683 3300046683 Bacteria 18348
1035 Ga0495658_0025843 3300046683 Bacteria 3142
1036 Ga0495658_0028915 3300046683 Bacteria 2995
1037 Ga0495669_0012768 3300046684 Bacteria 3575
1038 Ga0495613_0037705 3300046689 Bacteria 3583
1039 Ga0495613_0039134 3300046689 Bacteria 3515
1040 Ga0495613_0083699 3300046689 Bacteria 2317
1041 Ga0495613_0085961 3300046689 Bacteria 2281
1042 Ga0495624_0006443 3300046690 Bacteria 8330
1043 Ga0495624_0007443 3300046690 Bacteria 7685
1044 Ga0495624_0012108 3300046690 Bacteria 5906
1045 Ga0495671_0041331 3300046692 Bacteria 2322
1046 Ga0495589_0071687 3300046794 Bacteria 1693
1047 Ga0495600_0009105 3300046809 Bacteria 6122
1048 Ga0495600_0020623 3300046809 Bacteria 4214
1049 Ga0495600_0035649 3300046809 Bacteria 3233
1050 Ga0495581_0000072 3300047315 Bacteria 39847
1051 Ga0495581_0000139 3300047315 Bacteria 31769
1052 Ga0495581_0010811 3300047315 Bacteria 5277
1053 Ga0495581_0042718 3300047315 Bacteria 2623
1054 Ga0495581_0064765 3300047315 Bacteria 2112
1055 Ga0495604_0009620 3300047317 Bacteria 7645
1056 Ga0495604_0039436 3300047317 Bacteria 3712
1057 Ga0495604_0137177 3300047317 Bacteria 1752
1058 Ga0495674_0000523 3300047319 Bacteria 35299
1059 Ga0495674_0005593 3300047319 Bacteria 12048
1060 Ga0495674_0008405 3300047319 Bacteria 9835
1061 Ga0495674_0168013 3300047319 Bacteria 1832
1062 Ga0495672_0016998 3300047320 Bacteria 4874
1063 Ga0495676_0027504 3300047321 Bacteria 4874
1064 Ga0495676_0040171 3300047321 Bacteria 3864
1065 Ga0495676_0045413 3300047321 Bacteria 3576
1066 Ga0495680_0013168 3300047322 Bacteria 7227
1067 Ga0495680_0013969 3300047322 Bacteria 6980
1068 Ga0495680_0031385 3300047322 Bacteria 4326
1069 Ga0495680_0048590 3300047322 Bacteria 3331
1070 Ga0495680_0109442 3300047322 Bacteria 2049
1071 Ga0495675_0004139 3300047444 Bacteria 8780
1072 Ga0495677_0032176 3300047445 Bacteria 1910
1073 Ga0495673_0008685 3300047469 Bacteria 5681
1074 Ga0495673_0038332 3300047469 Bacteria 2181
1075 Ga0495673_0064470 3300047469 Bacteria 1558
1076 Ga0495684_0000202 3300047471 Bacteria 45900
1077 Ga0495684_0028162 3300047471 Bacteria 4315
1078 Ga0495593_0000042 3300047673 Bacteria 51536
1079 Ga0495593_0000094 3300047673 Bacteria 39807
1080 Ga0495593_0012536 3300047673 Bacteria 4844
1081 Ga0495602_0007342 3300048088 Bacteria 11539
1082 Ga0495602_0091777 3300048088 Bacteria 2517
1083 Ga0495614_0021380 3300048089 Bacteria 2794
1084 Ga0495615_0022019 3300048090 Bacteria 1444
1085 Ga0496100_0019519 3300048903 Bacteria 4046
1086 Ga0496100_0029167 3300048903 Bacteria 3411
1087 Ga0496100_0111092 3300048903 Bacteria 1904
1088 Ga0496100_0184850 3300048903 Bacteria 1509
1089 Ga0496101_0002175 3300048904 Bacteria 11962
1090 Ga0496101_0019246 3300048904 Bacteria 4659
1091 Ga0496101_0022549 3300048904 Bacteria 4336
1092 Ga0496101_0077398 3300048904 Bacteria 2451
1093 Ga0496101_0094017 3300048904 Bacteria 2234
1094 Ga0496101_0230843 3300048904 Bacteria 1438
1095 Ga0496102_0006629 3300048905 Bacteria 9896
1096 Ga0496102_0007550 3300048905 Bacteria 9296
1097 Ga0496102_0008862 3300048905 Bacteria 8634
1098 Ga0496102_0029492 3300048905 Bacteria 4909
1099 Ga0496102_0031856 3300048905 Bacteria 4733
1100 Ga0496102_0039989 3300048905 Bacteria 4240
1101 Ga0496102_0051093 3300048905 Bacteria 3766
1102 Ga0496102_0089138 3300048905 Bacteria 2853
1103 Ga0496102_0157699 3300048905 Bacteria 2134
1104 Ga0496102_0175760 3300048905 Bacteria 2016
1105 Ga0496102_0185476 3300048905 Bacteria 1961
1106 Ga0496102_0213020 3300048905 Bacteria 1821
1107 Ga0496103_0002556 3300048906 Bacteria 11401
1108 Ga0496103_0010340 3300048906 Bacteria 5522
1109 Ga0496103_0021662 3300048906 Bacteria 3868
1110 Ga0496103_0043433 3300048906 Bacteria 2767
1111 Ga0496103_0044178 3300048906 Bacteria 2745
1112 Ga0496103_0116851 3300048906 Bacteria 1697
1113 Ga0496104_0000253 3300048907 Bacteria 47525
1114 Ga0496104_0001610 3300048907 Bacteria 19457
1115 Ga0496104_0003135 3300048907 Bacteria 14260
1116 Ga0496104_0003222 3300048907 Bacteria 14044
1117 Ga0496104_0005489 3300048907 Bacteria 11106
1118 Ga0496104_0027004 3300048907 Bacteria 5308
1119 Ga0496104_0028169 3300048907 Bacteria 5206
1120 Ga0496104_0037046 3300048907 Bacteria 4561
1121 Ga0496104_0072608 3300048907 Bacteria 3272
1122 Ga0496104_0097007 3300048907 Bacteria 2821
1123 Ga0496104_0102705 3300048907 Bacteria 2738
1124 Ga0496104_0106906 3300048907 Bacteria 2681
1125 Ga0496104_0157241 3300048907 Bacteria 2181
1126 Ga0496105_0001092 3300048908 Bacteria 18817
1127 Ga0496105_0017241 3300048908 Bacteria 5786
1128 Ga0496105_0040423 3300048908 Bacteria 3845
1129 Ga0496105_0070980 3300048908 Bacteria 2879
1130 Ga0496105_0071136 3300048908 Bacteria 2875
1131 Ga0496105_0168430 3300048908 Bacteria 1796
1132 Ga0496106_0000132 3300048909 Bacteria 56128
1133 Ga0496106_0019127 3300048909 Bacteria 5077
1134 Ga0496106_0021998 3300048909 Bacteria 4737
1135 Ga0496106_0033130 3300048909 Bacteria 3854
1136 Ga0496106_0037139 3300048909 Bacteria 3644
1137 Ga0496106_0045531 3300048909 Bacteria 3295
1138 Ga0496106_0070421 3300048909 Bacteria 2671
1139 Ga0496106_0079272 3300048909 Bacteria 2521
1140 Ga0496106_0119957 3300048909 Bacteria 2055
1141 Ga0496107_0002892 3300048910 Bacteria 11349
1142 Ga0496107_0018264 3300048910 Bacteria 4936
1143 Ga0496107_0064733 3300048910 Bacteria 2650
1144 Ga0496107_0122515 3300048910 Bacteria 1916
1145 Ga0496108_0004593 3300048911 Bacteria 11119
1146 Ga0496108_0006355 3300048911 Bacteria 9579
1147 Ga0496108_0022087 3300048911 Bacteria 5231
1148 Ga0496108_0022585 3300048911 Bacteria 5173
1149 Ga0496108_0023873 3300048911 Bacteria 5034
1150 Ga0496108_0045130 3300048911 Bacteria 3680
1151 Ga0496108_0055852 3300048911 Bacteria 3316
1152 Ga0496108_0132783 3300048911 Bacteria 2140
1153 Ga0496108_0192153 3300048911 Bacteria 1769
1154 Ga0496109_0000673 3300048912 Bacteria 28328
1155 Ga0496109_0001562 3300048912 Bacteria 19079
1156 Ga0496109_0014967 3300048912 Bacteria 6752
1157 Ga0496109_0026829 3300048912 Bacteria 5138
1158 Ga0496109_0040874 3300048912 Bacteria 4201
1159 Ga0496109_0041345 3300048912 Bacteria 4175
1160 Ga0496109_0054017 3300048912 Bacteria 3666
1161 Ga0496109_0067710 3300048912 Bacteria 3272
1162 Ga0496109_0107846 3300048912 Bacteria 2588
1163 Ga0496109_0113482 3300048912 Bacteria 2520
1164 Ga0496109_0131890 3300048912 Bacteria 2332
1165 Ga0496109_0132733 3300048912 Bacteria 2325
1166 Ga0496110_0003034 3300048913 Bacteria 12736
1167 Ga0496110_0005312 3300048913 Bacteria 10085
1168 Ga0496110_0007058 3300048913 Bacteria 8939
1169 Ga0496110_0045039 3300048913 Bacteria 3854
1170 Ga0496110_0053222 3300048913 Bacteria 3558
1171 Ga0496110_0064167 3300048913 Bacteria 3245
1172 Ga0496110_0088340 3300048913 Bacteria 2768
1173 Ga0496110_0108320 3300048913 Bacteria 2494
1174 Ga0496111_0000369 3300048914 Bacteria 22401
1175 Ga0496111_0002538 3300048914 Bacteria 11024
1176 Ga0496111_0004419 3300048914 Bacteria 8888
1177 Ga0496111_0036571 3300048914 Bacteria 3511
1178 Ga0496111_0042527 3300048914 Bacteria 3263
1179 Ga0496111_0051182 3300048914 Bacteria 2982
1180 Ga0496111_0072913 3300048914 Bacteria 2500
1181 Ga0496111_0078870 3300048914 Bacteria 2402
1182 Ga0496111_0171805 3300048914 Bacteria 1610
1183 Ga0496111_0225133 3300048914 Bacteria 1393
1184 Ga0496112_0005306 3300048915 Bacteria 11120
1185 Ga0496112_0005651 3300048915 Bacteria 10856
1186 Ga0496112_0013677 3300048915 Bacteria 7499
1187 Ga0496112_0021205 3300048915 Bacteria 6175
1188 Ga0496112_0024768 3300048915 Bacteria 5754
1189 Ga0496112_0037584 3300048915 Bacteria 4725
1190 Ga0496112_0048864 3300048915 Bacteria 4145
1191 Ga0496112_0056255 3300048915 Bacteria 3871
1192 Ga0496112_0056266 3300048915 Bacteria 3870
1193 Ga0496112_0156945 3300048915 Bacteria 2242
1194 Ga0496112_0191752 3300048915 Bacteria 2005
1195 Ga0496112_0199172 3300048915 Bacteria 1962
1196 Ga0496113_0000751 3300048916 Bacteria 16685
1197 Ga0496113_0000917 3300048916 Bacteria 15578
1198 Ga0496113_0003021 3300048916 Bacteria 9970
1199 Ga0496113_0009451 3300048916 Bacteria 6397
1200 Ga0496113_0015707 3300048916 Bacteria 5214
1201 Ga0496113_0035751 3300048916 Bacteria 3635
1202 Ga0496113_0045124 3300048916 Bacteria 3267
1203 Ga0496113_0051573 3300048916 Bacteria 3071
1204 Ga0496113_0057975 3300048916 Bacteria 2913
1205 Ga0496114_0078870 3300048917 Bacteria 2778
1206 Ga0496114_0205568 3300048917 Bacteria 1726
1207 Ga0496114_0282317 3300048917 Bacteria 1464
1208 Ga0496115_0009889 3300048918 Bacteria 7102
1209 Ga0496115_0010748 3300048918 Bacteria 6846
1210 Ga0496115_0017648 3300048918 Bacteria 5463
1211 Ga0496115_0017758 3300048918 Bacteria 5446
1212 Ga0496115_0018758 3300048918 Bacteria 5317
1213 Ga0496115_0046941 3300048918 Bacteria 3453
1214 Ga0496115_0196223 3300048918 Bacteria 1668
1215 Ga0496116_0026312 3300048919 Bacteria 4259
1216 Ga0496116_0054972 3300048919 Bacteria 2618
1217 Ga0496117_0076731 3300048920 Bacteria 2214
1218 Ga0496117_0115943 3300048920 Bacteria 1657
1219 Ga0496118_0021212 3300048921 Bacteria 5727
1220 Ga0496118_0067476 3300048921 Bacteria 2604
1221 Ga0496119_0038742 3300048922 Bacteria 3075
1222 Ga0496119_0055346 3300048922 Bacteria 2410
1223 Ga0496120_0054003 3300048923 Bacteria 2280
1224 Ga0496121_0026727 3300048924 Bacteria 5424
1225 Ga0496121_0044704 3300048924 Bacteria 3815
1226 Ga0496121_0059454 3300048924 Bacteria 3151
1227 Ga0496121_0093115 3300048924 Bacteria 2347
1228 Ga0496122_0016224 3300048925 Bacteria 7070
1229 Ga0496124_0017261 3300048927 Bacteria 6808
1230 Ga0496124_0089563 3300048927 Bacteria 2512
1231 Ga0496125_0007099 3300048928 Bacteria 11960
1232 Ga0496126_0010793 3300048929 Bacteria 9535
1233 Ga0496126_0016460 3300048929 Bacteria 7393
1234 Ga0496126_0046793 3300048929 Bacteria 3964
1235 Ga0496126_0059880 3300048929 Bacteria 3428
1236 Ga0496126_0065227 3300048929 Bacteria 3259
1237 Ga0496126_0094303 3300048929 Bacteria 2627
1238 Ga0496126_0129303 3300048929 Bacteria 2184
1239 Ga0496126_0153909 3300048929 Bacteria 1969
1240 Ga0501031_0004827 3300049568 Bacteria 8760
1241 Ga0501032_0000054 3300049569 Bacteria 100621
1242 Ga0501033_0000025 3300049570 Bacteria 173634
1243 Ga0501034_0000177 3300049571 Bacteria 118966
1244 Ga0501034_0004577 3300049571 Bacteria 15321
1245 Ga0501034_0034959 3300049571 Bacteria 5096
1246 Ga0501034_0042095 3300049571 Bacteria 4623
1247 Ga0501034_0052306 3300049571 Bacteria 4115
1248 Ga0501036_0000025 3300049572 Bacteria 106029
1249 Ga0501036_0264380 3300049572 Bacteria 1441
1250 Ga0501037_0000169 3300049573 Bacteria 61447
1251 Ga0501038_0000029 3300049574 Bacteria 132861
1252 Ga0501039_0000441 3300049575 Bacteria 30082
1253 Ga0501039_0050696 3300049575 Bacteria 3212
1254 Ga0501039_0243457 3300049575 Bacteria 1414
1255 Ga0501043_0000067 3300049579 Bacteria 93232
1256 Ga0501043_0217472 3300049579 Bacteria 1479
1257 Ga0501046_0000556 3300049580 Bacteria 37044
1258 Ga0501046_0133634 3300049580 Bacteria 1880
1259 Ga0501047_0000061 3300049581 Bacteria 137341
1260 Ga0501048_0000081 3300049582 Bacteria 49755
1261 Ga0501067_0000337 3300049583 Bacteria 25535
1262 Ga0501068_0001209 3300049584 Bacteria 13725
1263 Ga0501069_0054953 3300049585 Bacteria 2217
1264 Ga0501070_0004162 3300049586 Bacteria 12445
1265 Ga0501070_0216517 3300049586 Bacteria 1571
1266 Ga0501072_0024951 3300049588 Bacteria 4654
1267 Ga0501074_0001483 3300049590 Bacteria 15785
1268 Ga0501074_0056491 3300049590 Bacteria 2829
1269 Ga0501076_0073707 3300049592 Bacteria 2734
1270 Ga0501077_0048866 3300049593 Bacteria 2689
1271 Ga0501079_0023853 3300049741 Bacteria 4694
1272 Ga0501079_0070716 3300049741 Bacteria 2695
1273 Ga0501079_0080081 3300049741 Bacteria 2525
1274 Ga0501079_0114875 3300049741 Bacteria 2092
1275 Ga0501080_0000786 3300049742 Bacteria 25861
1276 Ga0501080_0109118 3300049742 Bacteria 2565
1277 Ga0501080_0287126 3300049742 Bacteria 1495
1278 Ga0501080_0323418 3300049742 Bacteria 1396
1279 Ga0501081_0024624 3300049743 Bacteria 4043
1280 Ga0501083_0007657 3300049744 Bacteria 7657
1281 Ga0501083_0013787 3300049744 Bacteria 5650
1282 Ga0501083_0082828 3300049744 Bacteria 2125
1283 Ga0501035_0002419 3300049822 Bacteria 18259
1284 Ga0501044_0000028 3300049823 Bacteria 179203
1285 Ga0501044_0007082 3300049823 Bacteria 12344
1286 Ga0501044_0108614 3300049823 Bacteria 2784
1287 Ga0501045_0019197 3300049824 Bacteria 4870
1288 Ga0501045_0032880 3300049824 Bacteria 3760
1289 Ga0501045_0064794 3300049824 Bacteria 2683
1290 nmdc:mga03683_9878_c1 3300050489 Bacteria 3408
1291 nmdc:mga03n38_11146_c1 3300050490 Bacteria 3339
1292 nmdc:mga03n38_695_c1 3300050490 Bacteria 8798
1293 nmdc:mga00v17_16623_c1 3300050491 Bacteria 4148
1294 nmdc:mga00v17_38636_c1 3300050491 Bacteria 2855
1295 nmdc:mga0yw44_39798_c1 3300050492 Bacteria 2790
1296 nmdc:mga0yw44_44903_c1 3300050492 Bacteria 2646
1297 nmdc:mga0yw44_51127_c1 3300050492 Bacteria 2501
1298 nmdc:mga0k408_114707_c1 3300050493 Bacteria 1593
1299 nmdc:mga0k408_86760_c1 3300050493 Bacteria 1837
1300 nmdc:mga06z11_1539_c1 3300050494 Bacteria 8561
1301 nmdc:mga06z11_20021_c1 3300050494 Bacteria 3087
1302 nmdc:mga06z11_2007_c1 3300050494 Bacteria 7706
1303 nmdc:mga06z11_28038_c1 3300050494 Bacteria 2698
1304 nmdc:mga06z11_29770_c1 3300050494 Bacteria 2634
1305 nmdc:mga06z11_4599_c1 3300050494 Bacteria 5440
1306 nmdc:mga06z11_53640_c1 3300050494 Bacteria 2074
1307 nmdc:mga04h51_470_c1 3300050495 Bacteria 9683
1308 nmdc:mga04h51_9004_c1 3300050495 Bacteria 2689
1309 nmdc:mga07m45_78580_c1 3300050496 Bacteria 1883
1310 nmdc:mga05p37_124276_c1 3300050507 Bacteria 3169
1311 nmdc:mga05p37_138839_c1 3300050507 Bacteria 2978
1312 nmdc:mga05p37_144619_c1 3300050507 Bacteria 2912
1313 nmdc:mga05p37_166167_c1 3300050507 Bacteria 2693
1314 nmdc:mga05p37_22011_c1 3300050507 Bacteria 7724
1315 nmdc:mga05p37_223_c1 3300050507 Bacteria 57418
1316 nmdc:mga05p37_23412_c1 3300050507 Bacteria 7493
1317 nmdc:mga05p37_30636_c1 3300050507 Bacteria 6564
1318 nmdc:mga05p37_98984_c1 3300050507 Bacteria 3592
1319 nmdc:mga09592_227968_c1 3300050508 Bacteria 1614
1320 nmdc:mga09592_9689_c1 3300050508 Bacteria 7827
1321 nmdc:mga0qj67_170788_c1 3300050509 Bacteria 1765
1322 nmdc:mga0qj67_92773_c1 3300050509 Bacteria 2428
1323 nmdc:mga06r32_13798_c1 3300050510 Bacteria 7329
1324 nmdc:mga06r32_186_c1 3300050510 Bacteria 49161
1325 nmdc:mga06r32_24595_c1 3300050510 Bacteria 5593
1326 nmdc:mga06r32_75770_c1 3300050510 Bacteria 3266
1327 nmdc:mga08y16_157443_c1 3300050511 Bacteria 2361
1328 nmdc:mga08y16_27939_c1 3300050511 Bacteria 5947
1329 nmdc:mga08y16_287968_c1 3300050511 Bacteria 1694
1330 nmdc:mga08y16_3000_c1 3300050511 Bacteria 17414
1331 nmdc:mga08y16_322689_c1 3300050511 Bacteria 1589
1332 nmdc:mga08y16_96821_c1 3300050511 Bacteria 3073
1333 nmdc:mga0n895_127675_c1 3300050512 Bacteria 2567
1334 nmdc:mga0n895_184131_c1 3300050512 Bacteria 2120
1335 nmdc:mga0n895_26095_c1 3300050512 Bacteria 5528
1336 nmdc:mga0n895_317314_c1 3300050512 Bacteria 1579
1337 nmdc:mga0n895_4630_c1 3300050512 Bacteria 11342
1338 nmdc:mga0n895_49140_c1 3300050512 Bacteria 4131
1339 nmdc:mga0n895_90453_c1 3300050512 Bacteria 3062
1340 nmdc:mga0n895_9754_c1 3300050512 Bacteria 8425
1341 nmdc:mga0rr50_3143_c1 3300050513 Bacteria 9435
1342 nmdc:mga0rr50_37091_c1 3300050513 Bacteria 3516
1343 nmdc:mga0rr50_76664_c1 3300050513 Bacteria 2567
1344 nmdc:mga08x19_10352_c1 3300050514 Bacteria 5598
1345 nmdc:mga0a205_123281_c1 3300050515 Bacteria 2491
1346 nmdc:mga0a205_141_c1 3300050515 Bacteria 45834
1347 nmdc:mga0sz30_54497_c1 3300050516 Bacteria 1701
1348 Ga0495601_0007154 3300053077 Bacteria 6543
1349 Ga0495601_0007293 3300053077 Bacteria 6483
1350 Ga0495601_0018011 3300053077 Bacteria 4293
1351 Ga0495601_0065471 3300053077 Bacteria 2313
1352 Ga0495601_0181048 3300053077 Bacteria 1378
1353 Ga0495612_0001490 3300053078 Bacteria 9650
1354 Ga0495612_0005916 3300053078 Bacteria 5043
1355 Ga0495612_0008254 3300053078 Bacteria 4229
1356 Ga0495595_0006424 3300053084 Bacteria 4794
1357 Ga0495595_0006827 3300053084 Bacteria 4657
1358 Ga0495619_0035265 3300053085 Bacteria 3253
1359 Ga0495619_0044645 3300053085 Bacteria 2909
1360 Ga0495619_0047977 3300053085 Bacteria 2813
1361 Ga0500578_0064433 3300053086 Bacteria 2337
1362 Ga0500578_0067858 3300053086 Bacteria 2274
1363 Ga0500643_000056 3300053087 Bacteria 134839
1364 Ga0500651_0037501 3300053093 Bacteria 3055
1365 Ga0500566_0000031 3300053094 Bacteria 73906
1366 Ga0500566_0000189 3300053094 Bacteria 31973
1367 Ga0500640_008340 3300053095 Bacteria 4094
1368 Ga0500641_0011622 3300053096 Bacteria 3199
1369 Ga0500650_0089459 3300053098 Bacteria 1441
1370 Ga0500555_000978 3300053103 Bacteria 9868
1371 Ga0500556_0006746 3300053104 Bacteria 3264
1372 Ga0500557_000002 3300053105 Bacteria 234207
1373 Ga0500562_004486 3300053108 Bacteria 3529
1374 Ga0500572_000108 3300053111 Bacteria 27424
1375 Ga0500594_0014447 3300053118 Bacteria 1891
1376 Ga0500595_000131 3300053119 Bacteria 49217
1377 Ga0500595_007986 3300053119 Bacteria 4345
1378 Ga0500614_004573 3300053123 Bacteria 2917
1379 Ga0500642_0000266 3300053130 Bacteria 19551
1380 Ga0500658_0024432 3300053134 Bacteria 2315
1381 Ga0500559_0006373 3300053136 Bacteria 5328
1382 Ga0500559_0038432 3300053136 Bacteria 2078
1383 Ga0500568_0005900 3300053139 Bacteria 6235
1384 Ga0500589_044942 3300053147 Bacteria 2057
1385 Ga0500590_080985 3300053148 Bacteria 1594
1386 Ga0500603_000160 3300053150 Bacteria 16710
1387 Ga0500603_002161 3300053150 Bacteria 4341
1388 Ga0500616_0006319 3300053153 Bacteria 7782
1389 Ga0500619_028103 3300053154 Bacteria 1690
1390 Ga0500622_0009192 3300053156 Bacteria 5485
1391 Ga0500630_000427 3300053159 Bacteria 18148
1392 Ga0500639_000008 3300053163 Bacteria 143238
1393 Ga0500636_0000836 3300053177 Bacteria 16568
1394 Ga0500637_0000086 3300053178 Bacteria 33336
1395 Ga0500637_0000260 3300053178 Bacteria 19731
1396 Ga0500637_0039628 3300053178 Bacteria 2658
1397 Ga0500625_018517 3300053729 Bacteria 3263
1398 Ga0500609_000673 3300053731 Bacteria 5186
1399 Ga0500552_000522 3300053733 Bacteria 3575
1400 Ga0500596_008474 3300053735 Bacteria 1637
1401 Ga0500599_000229 3300053736 Bacteria 5282
1402 Ga0500601_000566 3300053737 Bacteria 5405
1403 Ga0501084_0014366 3300054114 Bacteria 6562
1404 Ga0501084_0045573 3300054114 Bacteria 3672
1405 Ga0501084_0203440 3300054114 Bacteria 1671
1406 Ga0500661_000107 3300055283 Bacteria 13423
1407 Ga0501082_0003510 3300060353 Bacteria 13687
1408 Ga0501082_0013208 3300060353 Bacteria 7103
1409 Ga0501082_0063979 3300060353 Bacteria 3167
1410 Ga0501082_0073213 3300060353 Bacteria 2951

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035695 Ga0373927_0107655 Ga0373927_0107655_23_1246 387
2 3300009094 Ga0111539_10149563 Ga0111539_101495632 391
3 3300035207 Ga0373942_0038396 Ga0373942_0038396_83_1288 391
4 3300005439 Ga0070711_100003919 Ga0070711_1000039198 400
5 3300025916 Ga0207663_10005348 Ga0207663_100053484 400
6 3300053085 Ga0495619_0044645 Ga0495619_0044645_25_1239 400
7 iso_pu_bacteria 8016603502 8016610995 402
8 3300006186 Ga0075369_10010929 Ga0075369_100109293 403
9 3300006844 Ga0075428_100104462 Ga0075428_1001044622 404
10 3300006847 Ga0075431_100007034 Ga0075431_1000070346 404
11 3300009147 Ga0114129_10027090 Ga0114129_100270904 404
12 3300050507 nmdc:mga05p37_22011_c1 nmdc:mga05p37_22011_c1_1864_3195 404
13 3300050510 nmdc:mga06r32_24595_c1 nmdc:mga06r32_24595_c1_2777_4108 404
14 3300005347 Ga0070668_100012418 Ga0070668_1000124183 405
15 3300005355 Ga0070671_100128026 Ga0070671_1001280261 405
16 3300005435 Ga0070714_100077233 Ga0070714_1000772332 405
17 3300005459 Ga0068867_100044726 Ga0068867_1000447262 405
18 3300020078 Ga0206352_10089368 Ga0206352_100893681 405
19 3300021388 Ga0213875_10003375 Ga0213875_100033757 405
20 3300025931 Ga0207644_10113384 Ga0207644_101133842 405
21 3300026067 Ga0207678_10032462 Ga0207678_100324623 405
22 3300031730 Ga0307516_10013317 Ga0307516_100133178 405
23 3300037418 Ga0395900_0170696 Ga0395900_0170696_580_1911 405
24 3300037853 Ga0436364_0936501 Ga0436364_0936501_12913_14259 405
25 3300005330 Ga0070690_100113925 Ga0070690_1001139252 406
26 3300005356 Ga0070674_100005092 Ga0070674_1000050925 406
27 3300005364 Ga0070673_100014280 Ga0070673_1000142804 406
28 3300005456 Ga0070678_100015679 Ga0070678_1000156793 406
29 3300005457 Ga0070662_100080877 Ga0070662_1000808772 406
30 3300005545 Ga0070695_100013475 Ga0070695_1000134751 406
31 3300013297 Ga0157378_10108945 Ga0157378_101089452 406
32 3300021384 Ga0213876_10018405 Ga0213876_100184053 406
33 3300025926 Ga0207659_10013140 Ga0207659_100131402 406
34 3300025937 Ga0207669_10001519 Ga0207669_100015195 406
35 3300025940 Ga0207691_10008519 Ga0207691_100085196 406
36 3300025960 Ga0207651_10070106 Ga0207651_100701062 406
37 3300026121 Ga0207683_10001401 Ga0207683_1000140117 406
38 3300027907 Ga0207428_10059247 Ga0207428_100592472 406
39 3300039437 Ga0436365_1894746 Ga0436365_1894746_2288_3625 406
40 3300005614 Ga0068856_100001981 Ga0068856_10000198123 407
41 3300026078 Ga0207702_10003615 Ga0207702_1000361518 407
42 3300046455 Ga0495603_0012503 Ga0495603_0012503_1054_2514 407
43 3300003215 JGI25153J46596_10002996 JGI25153J46596_100029962 408
44 3300003354 JGI25160J50197_1003045 JGI25160J50197_10030457 408
45 3300005262 Ga0065165_1008785 Ga0065165_10087851 408
46 3300005334 Ga0068869_100033410 Ga0068869_1000334104 408
47 3300005338 Ga0068868_100031098 Ga0068868_1000310983 408
48 3300005530 Ga0070679_100126412 Ga0070679_1001264122 408
49 3300006051 Ga0075364_10051980 Ga0075364_100519803 408
50 3300006177 Ga0075362_10023012 Ga0075362_100230121 408
51 3300006353 Ga0075370_10003411 Ga0075370_100034116 408
52 3300006844 Ga0075428_100190387 Ga0075428_1001903871 408
53 3300021320 Ga0214544_1000508 Ga0214544_100050855 408
54 3300021321 Ga0214542_1000365 Ga0214542_100036555 408
55 3300021324 Ga0214545_1000211 Ga0214545_100021121 408
56 3300021327 Ga0214543_1005667 Ga0214543_100566716 408
57 3300025273 Ga0209673_1019616 Ga0209673_10196163 408
58 3300025295 Ga0209564_1004787 Ga0209564_10047877 408
59 3300025302 Ga0207426_1000229 Ga0207426_1000229111 408
60 3300025302 Ga0207426_1027742 Ga0207426_10277421 408
61 3300025304 Ga0209257_1019215 Ga0209257_10192152 408
62 3300025912 Ga0207707_10023507 Ga0207707_100235073 408
63 3300025913 Ga0207695_10137601 Ga0207695_101376012 408
64 3300025921 Ga0207652_10059491 Ga0207652_100594914 408
65 3300025942 Ga0207689_10019702 Ga0207689_100197024 408
66 3300026121 Ga0207683_10102091 Ga0207683_101020912 408
67 3300028379 Ga0268266_10002192 Ga0268266_1000219221 408
68 3300028380 Ga0268265_10103498 Ga0268265_101034981 408
69 3300031711 Ga0265314_10031327 Ga0265314_100313273 408
70 3300031852 Ga0307410_10039451 Ga0307410_100394512 408
71 3300031901 Ga0307406_10074689 Ga0307406_100746891 408
72 3300032002 Ga0307416_100050158 Ga0307416_1000501583 408
73 3300048922 Ga0496119_0055346 Ga0496119_0055346_355_1695 408
74 3300050492 nmdc:mga0yw44_39798_c1 nmdc:mga0yw44_39798_c1_204_1544 408
75 3300050492 nmdc:mga0yw44_51127_c1 nmdc:mga0yw44_51127_c1_516_1856 408
76 3300050494 nmdc:mga06z11_29770_c1 nmdc:mga06z11_29770_c1_1065_2405 408
77 3300053118 Ga0500594_0014447 Ga0500594_0014447_442_1782 408
78 3300053147 Ga0500589_044942 Ga0500589_044942_285_1625 408
79 3300005262 Ga0065165_1003735 Ga0065165_10037358 409
80 3300005338 Ga0068868_100047016 Ga0068868_1000470163 409
81 3300005347 Ga0070668_100037529 Ga0070668_1000375293 409
82 3300005366 Ga0070659_100088432 Ga0070659_1000884322 409
83 3300005435 Ga0070714_100130127 Ga0070714_1001301272 409
84 3300005466 Ga0070685_10061590 Ga0070685_100615902 409
85 3300005548 Ga0070665_100011386 Ga0070665_10001138611 409
86 3300005548 Ga0070665_100014871 Ga0070665_1000148715 409
87 3300005548 Ga0070665_100047821 Ga0070665_1000478213 409
88 3300005842 Ga0068858_100019505 Ga0068858_1000195055 409
89 3300005843 Ga0068860_100032333 Ga0068860_1000323331 409
90 3300006177 Ga0075362_10006510 Ga0075362_100065102 409
91 3300006186 Ga0075369_10009219 Ga0075369_100092192 409
92 3300009098 Ga0105245_10090703 Ga0105245_100907032 409
93 3300009101 Ga0105247_10025765 Ga0105247_100257652 409
94 3300009177 Ga0105248_10071925 Ga0105248_100719252 409
95 3300009553 Ga0105249_10103934 Ga0105249_101039342 409
96 3300013306 Ga0163162_10170297 Ga0163162_101702972 409
97 3300013308 Ga0157375_10129401 Ga0157375_101294012 409
98 3300013308 Ga0157375_10174427 Ga0157375_101744271 409
99 3300014326 Ga0157380_10111370 Ga0157380_101113702 409
100 3300014969 Ga0157376_10075647 Ga0157376_100756472 409
101 3300025302 Ga0207426_1000607 Ga0207426_10006078 409
102 3300025900 Ga0207710_10017333 Ga0207710_100173331 409
103 3300025931 Ga0207644_10083229 Ga0207644_100832292 409
104 3300025933 Ga0207706_10037610 Ga0207706_100376102 409
105 3300025939 Ga0207665_10062480 Ga0207665_100624801 409
106 3300025972 Ga0207668_10013643 Ga0207668_100136434 409
107 3300026035 Ga0207703_10020084 Ga0207703_100200843 409
108 3300026035 Ga0207703_10154972 Ga0207703_101549721 409
109 3300026041 Ga0207639_10088570 Ga0207639_100885701 409
110 3300026067 Ga0207678_10021574 Ga0207678_100215744 409
111 3300026088 Ga0207641_10123067 Ga0207641_101230671 409
112 3300026118 Ga0207675_100229170 Ga0207675_1002291701 409
113 3300028379 Ga0268266_10000857 Ga0268266_1000085711 409
114 3300028379 Ga0268266_10052158 Ga0268266_100521582 409
115 3300028380 Ga0268265_10173959 Ga0268265_101739593 409
116 3300039438 Ga0436360_0472871 Ga0436360_0472871_6625_7932 409
117 3300039447 Ga0436361_0142586 Ga0436361_0142586_193_1500 409
118 3300047315 Ga0495581_0064765 Ga0495581_0064765_322_1662 409
119 3300048905 Ga0496102_0051093 Ga0496102_0051093_195_1535 409
120 3300048909 Ga0496106_0070421 Ga0496106_0070421_204_1544 409
121 3300048914 Ga0496111_0072913 Ga0496111_0072913_307_1647 409
122 3300050512 nmdc:mga0n895_184131_c1 nmdc:mga0n895_184131_c1_297_1637 409
123 3300003215 JGI25153J46596_10005350 JGI25153J46596_100053507 410
124 3300005331 Ga0070670_100272234 Ga0070670_1002722341 410
125 3300005344 Ga0070661_100028972 Ga0070661_1000289723 410
126 3300005564 Ga0070664_100026355 Ga0070664_1000263553 410
127 3300005614 Ga0068856_100017821 Ga0068856_1000178218 410
128 3300005937 Ga0081455_10009563 Ga0081455_100095631 410
129 3300005981 Ga0081538_10047966 Ga0081538_100479662 410
130 3300005983 Ga0081540_1001428 Ga0081540_10014282 410
131 3300006871 Ga0075434_100059695 Ga0075434_1000596954 410
132 3300009093 Ga0105240_10368367 Ga0105240_103683672 410
133 3300009551 Ga0105238_10026564 Ga0105238_100265643 410
134 3300013105 Ga0157369_10076551 Ga0157369_100765514 410
135 3300020078 Ga0206352_10222114 Ga0206352_102221141 410
136 3300021441 Ga0213871_10000047 Ga0213871_100000473 410
137 3300025297 Ga0209758_1002140 Ga0209758_10021406 410
138 3300025901 Ga0207688_10071261 Ga0207688_100712612 410
139 3300025904 Ga0207647_10082441 Ga0207647_100824412 410
140 3300025914 Ga0207671_10061734 Ga0207671_100617342 410
141 3300025919 Ga0207657_10130219 Ga0207657_101302192 410
142 3300025924 Ga0207694_10059445 Ga0207694_100594452 410
143 3300025949 Ga0207667_10047739 Ga0207667_100477395 410
144 3300026041 Ga0207639_10076440 Ga0207639_100764402 410
145 3300026067 Ga0207678_10088731 Ga0207678_100887312 410
146 3300026067 Ga0207678_10190721 Ga0207678_101907212 410
147 3300031238 Ga0265332_10004308 Ga0265332_100043082 410
148 3300046452 Ga0495617_003205 Ga0495617_003205_4848_6188 410
149 3300046471 Ga0495650_0051151 Ga0495650_0051151_232_1638 410
150 3300046518 Ga0495631_0012833 Ga0495631_0012833_128_1468 410
151 3300046519 Ga0495632_0035619 Ga0495632_0035619_288_1694 410
152 3300046528 Ga0495642_0056860 Ga0495642_0056860_235_1575 410
153 3300046558 Ga0495633_0029447 Ga0495633_0029447_403_1743 410
154 3300046616 Ga0495668_0092581 Ga0495668_0092581_154_1494 410
155 3300046648 Ga0495611_0048713 Ga0495611_0048713_294_1700 410
156 3300046660 Ga0495625_0118548 Ga0495625_0118548_224_1564 410
157 3300046665 Ga0495661_0117935 Ga0495661_0117935_48_1454 410
158 3300048914 Ga0496111_0078870 Ga0496111_0078870_75_1307 410
159 3300048924 Ga0496121_0093115 Ga0496121_0093115_429_1769 410
160 3300003215 JGI25153J46596_10000238 JGI25153J46596_1000023820 411
161 3300003771 Ga0055526_1020720 Ga0055526_10207201 411
162 3300003794 Ga0055531_10009794 Ga0055531_100097943 411
163 3300003794 Ga0055531_10012037 Ga0055531_100120372 411
164 3300005536 Ga0070697_100121297 Ga0070697_1001212971 411
165 3300005985 Ga0081539_10003922 Ga0081539_1000392215 411
166 3300006943 Ga0099822_1026245 Ga0099822_10262451 411
167 3300021361 Ga0213872_10037781 Ga0213872_100377812 411
168 3300025253 Ga0209677_104333 Ga0209677_1043332 411
169 3300025261 Ga0209233_1005978 Ga0209233_10059784 411
170 3300025272 Ga0209455_1007058 Ga0209455_10070582 411
171 3300025297 Ga0209758_1000021 Ga0209758_1000021313 411
172 3300025299 Ga0209256_1015513 Ga0209256_10155131 411
173 3300025303 Ga0209051_1037270 Ga0209051_10372701 411
174 3300025304 Ga0209257_1000838 Ga0209257_100083817 411
175 3300025915 Ga0207693_10160282 Ga0207693_101602821 411
176 3300026078 Ga0207702_10167631 Ga0207702_101676311 411
177 3300027357 Ga0209589_1000003 Ga0209589_1000003282 411
178 3300027361 Ga0209489_100003 Ga0209489_100003333 411
179 3300027363 Ga0209700_100003 Ga0209700_100003333 411
180 3300031247 Ga0265340_10015157 Ga0265340_100151572 411
181 3300031712 Ga0265342_10027525 Ga0265342_100275254 411
182 3300037466 Ga0395898_0002979 Ga0395898_0002979_11939_13279 411
183 3300037471 Ga0395905_0093671 Ga0395905_0093671_925_2409 411
184 3300038443 Ga0395901_0040271 Ga0395901_0040271_1756_3096 411
185 3300039437 Ga0436365_0156834 Ga0436365_0156834_389_1729 411
186 3300044901 Ga0466960_0020241 Ga0466960_0020241_1502_2842 411
187 3300047317 Ga0495604_0137177 Ga0495604_0137177_233_1636 411
188 3300048903 Ga0496100_0184850 Ga0496100_0184850_138_1472 411
189 3300048925 Ga0496122_0016224 Ga0496122_0016224_1261_2601 411
190 3300049742 Ga0501080_0287126 Ga0501080_0287126_51_1385 411
191 3300003763 Ga0055529_1006123 Ga0055529_10061232 412
192 3300005262 Ga0065165_1000394 Ga0065165_100039449 412
193 3300005548 Ga0070665_100049324 Ga0070665_1000493245 412
194 3300006042 Ga0075368_10008917 Ga0075368_100089172 412
195 3300006051 Ga0075364_10004859 Ga0075364_100048593 412
196 3300006178 Ga0075367_10018821 Ga0075367_100188212 412
197 3300025253 Ga0209677_102475 Ga0209677_1024754 412
198 3300025254 Ga0209148_1000616 Ga0209148_100061623 412
199 3300025272 Ga0209455_1000716 Ga0209455_10007164 412
200 3300025915 Ga0207693_10000612 Ga0207693_100006122 412
201 3300028379 Ga0268266_10020753 Ga0268266_100207531 412
202 3300033180 Ga0307510_10011576 Ga0307510_100115769 412
203 3300035090 Ga0373949_0017409 Ga0373949_0017409_208_1548 412
204 3300037466 Ga0395898_0228178 Ga0395898_0228178_195_1535 412
205 3300050491 nmdc:mga00v17_38636_c1 nmdc:mga00v17_38636_c1_793_2130 412
206 3300050494 nmdc:mga06z11_20021_c1 nmdc:mga06z11_20021_c1_726_2063 412
207 3300050494 nmdc:mga06z11_28038_c1 nmdc:mga06z11_28038_c1_820_2157 412
208 3300003354 JGI25160J50197_1001951 JGI25160J50197_10019515 413
209 3300005539 Ga0068853_100136854 Ga0068853_1001368542 413
210 3300005577 Ga0068857_100198595 Ga0068857_1001985952 413
211 3300005983 Ga0081540_1020770 Ga0081540_10207704 413
212 3300006042 Ga0075368_10001349 Ga0075368_100013497 413
213 3300006178 Ga0075367_10015063 Ga0075367_100150635 413
214 3300006844 Ga0075428_100001428 Ga0075428_1000014287 413
215 3300006914 Ga0075436_100022672 Ga0075436_1000226724 413
216 3300006942 Ga0099824_1013197 Ga0099824_10131976 413
217 3300006943 Ga0099822_1001406 Ga0099822_100140612 413
218 3300007076 Ga0075435_100064096 Ga0075435_1000640965 413
219 3300009147 Ga0114129_10048840 Ga0114129_100488403 413
220 3300025302 Ga0207426_1014733 Ga0207426_10147332 413
221 3300025904 Ga0207647_10035021 Ga0207647_100350213 413
222 3300025912 Ga0207707_10259397 Ga0207707_102593971 413
223 3300026118 Ga0207675_100040631 Ga0207675_1000406315 413
224 3300027357 Ga0209589_1000007 Ga0209589_1000007254 413
225 3300027361 Ga0209489_100008 Ga0209489_100008254 413
226 3300027363 Ga0209700_100009 Ga0209700_100009254 413
227 3300027866 Ga0209813_10000619 Ga0209813_100006197 413
228 3300050490 nmdc:mga03n38_695_c1 nmdc:mga03n38_695_c1_3373_4680 413
229 3300050494 nmdc:mga06z11_4599_c1 nmdc:mga06z11_4599_c1_3646_4953 413
230 3300050495 nmdc:mga04h51_470_c1 nmdc:mga04h51_470_c1_6846_8153 413
231 3300050507 nmdc:mga05p37_124276_c1 nmdc:mga05p37_124276_c1_774_2114 413
232 3300050507 nmdc:mga05p37_23412_c1 nmdc:mga05p37_23412_c1_1432_2772 413
233 3300050509 nmdc:mga0qj67_92773_c1 nmdc:mga0qj67_92773_c1_477_1817 413
234 3300050510 nmdc:mga06r32_13798_c1 nmdc:mga06r32_13798_c1_4656_5996 413
235 3300053134 Ga0500658_0024432 Ga0500658_0024432_58_1398 413
236 3300003203 JGI25406J46586_10018043 JGI25406J46586_100180432 414
237 3300005843 Ga0068860_100022514 Ga0068860_1000225143 414
238 3300005985 Ga0081539_10003922 Ga0081539_1000392214 414
239 3300006847 Ga0075431_100000132 Ga0075431_10000013216 414
240 3300006847 Ga0075431_100148314 Ga0075431_1001483141 414
241 3300006880 Ga0075429_100005605 Ga0075429_1000056058 414
242 3300009094 Ga0111539_10000933 Ga0111539_100009339 414
243 3300009147 Ga0114129_10000280 Ga0114129_1000028016 414
244 3300025939 Ga0207665_10139787 Ga0207665_101397871 414
245 3300027671 Ga0209588_1010758 Ga0209588_10107582 414
246 3300027907 Ga0207428_10003035 Ga0207428_100030357 414
247 3300028381 Ga0268264_10021446 Ga0268264_100214464 414
248 3300039447 Ga0436361_0488607 Ga0436361_0488607_460_1800 414
249 3300046615 Ga0495656_0056488 Ga0495656_0056488_81_1421 414
250 3300048905 Ga0496102_0157699 Ga0496102_0157699_36_1376 414
251 3300048907 Ga0496104_0005489 Ga0496104_0005489_3502_4842 414
252 3300048907 Ga0496104_0102705 Ga0496104_0102705_1272_2579 414
253 3300048908 Ga0496105_0017241 Ga0496105_0017241_1447_2787 414
254 3300048911 Ga0496108_0055852 Ga0496108_0055852_1900_3240 414
255 3300048912 Ga0496109_0001562 Ga0496109_0001562_12496_13836 414
256 3300048913 Ga0496110_0064167 Ga0496110_0064167_1837_3177 414
257 3300048914 Ga0496111_0002538 Ga0496111_0002538_1673_3013 414
258 3300048915 Ga0496112_0048864 Ga0496112_0048864_2445_3785 414
259 3300048916 Ga0496113_0000917 Ga0496113_0000917_9545_10885 414
260 3300048918 Ga0496115_0009889 Ga0496115_0009889_1451_2791 414
261 3300049580 Ga0501046_0133634 Ga0501046_0133634_229_1629 414
262 3300049741 Ga0501079_0114875 Ga0501079_0114875_23_1423 414
263 3300049743 Ga0501081_0024624 Ga0501081_0024624_2331_3731 414
264 3300049824 Ga0501045_0032880 Ga0501045_0032880_2322_3722 414
265 3300050507 nmdc:mga05p37_223_c1 nmdc:mga05p37_223_c1_13828_15165 414
266 3300050508 nmdc:mga09592_9689_c1 nmdc:mga09592_9689_c1_5425_6762 414
267 3300050509 nmdc:mga0qj67_170788_c1 nmdc:mga0qj67_170788_c1_362_1693 414
268 3300050510 nmdc:mga06r32_186_c1 nmdc:mga06r32_186_c1_19280_20617 414
269 3300050511 nmdc:mga08y16_3000_c1 nmdc:mga08y16_3000_c1_8545_9882 414
270 3300053733 Ga0500552_000522 Ga0500552_000522_1470_2810 414
271 3300054114 Ga0501084_0045573 Ga0501084_0045573_1844_3244 414
272 3300060353 Ga0501082_0073213 Ga0501082_0073213_947_2347 414
273 iso_pu_bacteria 2524023210 2524470039 414
274 3300005354 Ga0070675_100045128 Ga0070675_1000451283 415
275 3300005364 Ga0070673_100095817 Ga0070673_1000958173 415
276 3300005535 Ga0070684_100037495 Ga0070684_1000374952 415
277 3300005548 Ga0070665_100190207 Ga0070665_1001902072 415
278 3300005549 Ga0070704_100092017 Ga0070704_1000920171 415
279 3300005617 Ga0068859_100097252 Ga0068859_1000972523 415
280 3300005841 Ga0068863_100017655 Ga0068863_1000176552 415
281 3300005842 Ga0068858_100031077 Ga0068858_1000310772 415
282 3300005844 Ga0068862_100031277 Ga0068862_1000312772 415
283 3300006237 Ga0097621_100027617 Ga0097621_1000276174 415
284 3300006358 Ga0068871_100014804 Ga0068871_1000148044 415
285 3300006847 Ga0075431_100033979 Ga0075431_1000339794 415
286 3300006931 Ga0097620_100097255 Ga0097620_1000972552 415
287 3300007265 Ga0099794_10009900 Ga0099794_100099004 415
288 3300009147 Ga0114129_10040832 Ga0114129_100408322 415
289 3300009177 Ga0105248_10047411 Ga0105248_100474114 415
290 3300013296 Ga0157374_10351483 Ga0157374_103514831 415
291 3300013307 Ga0157372_10232848 Ga0157372_102328482 415
292 3300014968 Ga0157379_10081215 Ga0157379_100812152 415
293 3300014969 Ga0157376_10075006 Ga0157376_100750061 415
294 3300025924 Ga0207694_10069929 Ga0207694_100699292 415
295 3300025942 Ga0207689_10008628 Ga0207689_100086285 415
296 3300025944 Ga0207661_10010366 Ga0207661_100103664 415
297 3300025945 Ga0207679_10247033 Ga0207679_102470331 415
298 3300048905 Ga0496102_0185476 Ga0496102_0185476_375_1724 415
299 3300050507 nmdc:mga05p37_138839_c1 nmdc:mga05p37_138839_c1_1476_2816 415
300 3300053096 Ga0500641_0011622 Ga0500641_0011622_994_2331 415
301 3300006852 Ga0075433_10226729 Ga0075433_102267291 416
302 3300006871 Ga0075434_100015598 Ga0075434_1000155988 416
303 3300028573 Ga0265334_10023379 Ga0265334_100233792 416
304 3300048914 Ga0496111_0042527 Ga0496111_0042527_153_1403 416
305 3300050512 nmdc:mga0n895_90453_c1 nmdc:mga0n895_90453_c1_408_1745 416
306 3300050512 nmdc:mga0n895_9754_c1 nmdc:mga0n895_9754_c1_2845_4185 416
307 3300050515 nmdc:mga0a205_123281_c1 nmdc:mga0a205_123281_c1_696_2033 416
308 iso_pu_bacteria 8019638758 8019644813 416
309 3300006871 Ga0075434_100043871 Ga0075434_1000438712 417
310 3300014325 Ga0163163_10030770 Ga0163163_100307704 417
311 3300025900 Ga0207710_10023410 Ga0207710_100234103 417
312 3300046648 Ga0495611_0030727 Ga0495611_0030727_1055_2347 417
313 3300046692 Ga0495671_0041331 Ga0495671_0041331_865_2157 417
314 3300047469 Ga0495673_0038332 Ga0495673_0038332_418_1710 417
315 3300048903 Ga0496100_0019519 Ga0496100_0019519_2692_3984 417
316 3300048904 Ga0496101_0022549 Ga0496101_0022549_2237_3529 417
317 3300048907 Ga0496104_0028169 Ga0496104_0028169_2658_3950 417
318 3300048908 Ga0496105_0071136 Ga0496105_0071136_1226_2518 417
319 3300048909 Ga0496106_0021998 Ga0496106_0021998_1885_3177 417
320 3300048910 Ga0496107_0018264 Ga0496107_0018264_918_2210 417
321 3300048916 Ga0496113_0035751 Ga0496113_0035751_1621_2913 417
322 3300048918 Ga0496115_0018758 Ga0496115_0018758_2915_4207 417
323 3300048919 Ga0496116_0026312 Ga0496116_0026312_949_2241 417
324 3300048921 Ga0496118_0067476 Ga0496118_0067476_1078_2370 417
325 3300048929 Ga0496126_0010793 Ga0496126_0010793_715_2055 417
326 3300048929 Ga0496126_0065227 Ga0496126_0065227_1370_2662 417
327 3300049590 Ga0501074_0056491 Ga0501074_0056491_503_1840 417
328 3300049741 Ga0501079_0070716 Ga0501079_0070716_399_1736 417
329 3300003575 Ga0007409J51694_1040095 Ga0007409J51694_10400951 418
330 3300005327 Ga0070658_10006286 Ga0070658_100062867 418
331 3300005339 Ga0070660_100018526 Ga0070660_1000185263 418
332 3300005341 Ga0070691_10010001 Ga0070691_100100012 418
333 3300005441 Ga0070700_100041117 Ga0070700_1000411171 418
334 3300005444 Ga0070694_100025149 Ga0070694_1000251493 418
335 3300005457 Ga0070662_100067254 Ga0070662_1000672542 418
336 3300005545 Ga0070695_100004173 Ga0070695_1000041735 418
337 3300005616 Ga0068852_100268648 Ga0068852_1002686481 418
338 3300005719 Ga0068861_100183114 Ga0068861_1001831142 418
339 3300005843 Ga0068860_100022514 Ga0068860_1000225144 418
340 3300006038 Ga0075365_10052954 Ga0075365_100529542 418
341 3300006942 Ga0099824_1010056 Ga0099824_10100569 418
342 3300017792 Ga0163161_10045064 Ga0163161_100450642 418
343 3300025909 Ga0207705_10049293 Ga0207705_100492932 418
344 3300025919 Ga0207657_10019857 Ga0207657_100198574 418
345 3300025920 Ga0207649_10044917 Ga0207649_100449172 418
346 3300025933 Ga0207706_10092525 Ga0207706_100925252 418
347 3300026041 Ga0207639_10182460 Ga0207639_101824601 418
348 3300026075 Ga0207708_10013604 Ga0207708_100136043 418
349 3300026118 Ga0207675_100235736 Ga0207675_1002357361 418
350 3300027296 Ga0209389_1000281 Ga0209389_100028116 418
351 3300027296 Ga0209389_1000287 Ga0209389_100028715 418
352 3300027357 Ga0209589_1000072 Ga0209589_100007245 418
353 3300027361 Ga0209489_100031 Ga0209489_10003167 418
354 3300027361 Ga0209489_108310 Ga0209489_10831015 418
355 3300027363 Ga0209700_100010 Ga0209700_100010268 418
356 3300028794 Ga0307515_10003270 Ga0307515_1000327028 418
357 3300031241 Ga0265325_10023987 Ga0265325_100239873 418
358 3300031247 Ga0265340_10015157 Ga0265340_100151573 418
359 3300031712 Ga0265342_10053678 Ga0265342_100536782 418
360 3300039447 Ga0436361_0005645 Ga0436361_0005645_659_2062 418
361 3300046616 Ga0495668_0126719 Ga0495668_0126719_44_1384 418
362 3300053139 Ga0500568_0005900 Ga0500568_0005900_2793_4130 418
363 iso_pu_bacteria 8019597564 8019601519 418
364 3300005535 Ga0070684_100001889 Ga0070684_10000188910 419
365 3300005937 Ga0081455_10000338 Ga0081455_1000033828 419
366 3300009101 Ga0105247_10066644 Ga0105247_100666442 419
367 3300013308 Ga0157375_10335825 Ga0157375_103358252 419
368 3300025944 Ga0207661_10000309 Ga0207661_100003095 419
369 3300031344 Ga0265316_10030447 Ga0265316_100304471 419
370 3300031595 Ga0265313_10009133 Ga0265313_100091333 419
371 3300035170 Ga0373943_0049705 Ga0373943_0049705_493_1830 419
372 3300037068 Ga0373925_0114015 Ga0373925_0114015_442_1779 419
373 3300046455 Ga0495603_0073286 Ga0495603_0073286_587_1924 419
374 3300046474 Ga0495605_0046305 Ga0495605_0046305_81_1541 419
375 3300046539 Ga0495621_0018107 Ga0495621_0018107_174_1595 419
376 3300046674 Ga0495588_0080933 Ga0495588_0080933_242_1579 419
377 3300047469 Ga0495673_0064470 Ga0495673_0064470_286_1545 419
378 3300048929 Ga0496126_0153909 Ga0496126_0153909_639_1898 419
379 3300049572 Ga0501036_0264380 Ga0501036_0264380_149_1408 419
380 3300050493 nmdc:mga0k408_114707_c1 nmdc:mga0k408_114707_c1_76_1416 419
381 3300005937 Ga0081455_10001113 Ga0081455_100011138 420
382 3300009147 Ga0114129_10179324 Ga0114129_101793243 420
383 3300028577 Ga0265318_10017367 Ga0265318_100173672 420
384 3300035691 Ga0373931_0003521 Ga0373931_0003521_2440_3747 420
385 3300005329 Ga0070683_100033523 Ga0070683_1000335235 421
386 3300005333 Ga0070677_10016646 Ga0070677_100166462 421
387 3300005335 Ga0070666_10086431 Ga0070666_100864311 421
388 3300005353 Ga0070669_100058601 Ga0070669_1000586012 421
389 3300005355 Ga0070671_100158558 Ga0070671_1001585581 421
390 3300005356 Ga0070674_100005092 Ga0070674_1000050924 421
391 3300005456 Ga0070678_100015679 Ga0070678_1000156792 421
392 3300005466 Ga0070685_10062932 Ga0070685_100629321 421
393 3300009093 Ga0105240_10122827 Ga0105240_101228272 421
394 3300009551 Ga0105238_10074883 Ga0105238_100748832 421
395 3300013297 Ga0157378_10001711 Ga0157378_100017116 421
396 3300021384 Ga0213876_10040021 Ga0213876_100400211 421
397 3300025893 Ga0207682_10004100 Ga0207682_100041006 421
398 3300025900 Ga0207710_10028649 Ga0207710_100286491 421
399 3300025901 Ga0207688_10080221 Ga0207688_100802212 421
400 3300025903 Ga0207680_10091032 Ga0207680_100910322 421
401 3300025907 Ga0207645_10034206 Ga0207645_100342062 421
402 3300025924 Ga0207694_10065100 Ga0207694_100651003 421
403 3300025925 Ga0207650_10049079 Ga0207650_100490794 421
404 3300025937 Ga0207669_10001519 Ga0207669_100015196 421
405 3300025940 Ga0207691_10008519 Ga0207691_100085197 421
406 3300025944 Ga0207661_10010366 Ga0207661_100103665 421
407 3300026089 Ga0207648_10026064 Ga0207648_100260642 421
408 3300026121 Ga0207683_10001401 Ga0207683_1000140116 421
409 3300037466 Ga0395898_0082027 Ga0395898_0082027_274_1641 421
410 3300039437 Ga0436365_0206643 Ga0436365_0206643_2319_3626 421
411 3300048920 Ga0496117_0076731 Ga0496117_0076731_612_1952 421
412 3300048921 Ga0496118_0021212 Ga0496118_0021212_1893_3233 421
413 3300048924 Ga0496121_0044704 Ga0496121_0044704_2034_3374 421
414 3300005615 Ga0070702_100104368 Ga0070702_1001043681 422
415 3300005718 Ga0068866_10011643 Ga0068866_100116434 422
416 3300005983 Ga0081540_1003431 Ga0081540_10034319 422
417 3300006038 Ga0075365_10057357 Ga0075365_100573572 422
418 3300006847 Ga0075431_100000132 Ga0075431_10000013215 422
419 3300006880 Ga0075429_100005605 Ga0075429_1000056057 422
420 3300009094 Ga0111539_10000933 Ga0111539_1000093310 422
421 3300009147 Ga0114129_10000280 Ga0114129_1000028015 422
422 3300026075 Ga0207708_10019614 Ga0207708_100196145 422
423 3300027907 Ga0207428_10003035 Ga0207428_100030356 422
424 3300031730 Ga0307516_10005336 Ga0307516_1000533616 422
425 3300035085 Ga0373929_0009323 Ga0373929_0009323_65_1333 422
426 3300045051 Ga0451576_0261718 Ga0451576_0261718_15_1364 422
427 3300046648 Ga0495611_0077511 Ga0495611_0077511_57_1466 422
428 3300047319 Ga0495674_0168013 Ga0495674_0168013_22_1290 422
429 3300049579 Ga0501043_0217472 Ga0501043_0217472_164_1432 422
430 3300050507 nmdc:mga05p37_223_c1 nmdc:mga05p37_223_c1_12229_13566 422
431 3300050508 nmdc:mga09592_9689_c1 nmdc:mga09592_9689_c1_3826_5163 422
432 3300050510 nmdc:mga06r32_186_c1 nmdc:mga06r32_186_c1_20879_22216 422
433 3300050511 nmdc:mga08y16_3000_c1 nmdc:mga08y16_3000_c1_10144_11481 422
434 3300053077 Ga0495601_0181048 Ga0495601_0181048_62_1330 422
435 3300009094 Ga0111539_10006076 Ga0111539_100060766 423
436 3300009147 Ga0114129_10041435 Ga0114129_100414355 423
437 3300009147 Ga0114129_10068788 Ga0114129_100687883 423
438 3300009147 Ga0114129_10391600 Ga0114129_103916001 423
439 3300013306 Ga0163162_10072199 Ga0163162_100721993 423
440 3300035088 Ga0373940_0005502 Ga0373940_0005502_805_2145 423
441 3300035242 Ga0373962_0024449 Ga0373962_0024449_247_1587 423
442 3300035691 Ga0373931_0003293 Ga0373931_0003293_2506_3846 423
443 3300046455 Ga0495603_0019236 Ga0495603_0019236_2651_4111 423
444 3300046475 Ga0495639_0039535 Ga0495639_0039535_540_2000 423
445 3300046499 Ga0495594_0038830 Ga0495594_0038830_38_1498 423
446 3300046518 Ga0495631_0027377 Ga0495631_0027377_300_1760 423
447 3300046684 Ga0495669_0012768 Ga0495669_0012768_2041_3501 423
448 3300050507 nmdc:mga05p37_144619_c1 nmdc:mga05p37_144619_c1_574_1914 423
449 3300050507 nmdc:mga05p37_98984_c1 nmdc:mga05p37_98984_c1_188_1459 423
450 3300050511 nmdc:mga08y16_96821_c1 nmdc:mga08y16_96821_c1_991_2331 423
451 3300005983 Ga0081540_1000287 Ga0081540_10002873 424
452 3300006852 Ga0075433_10009387 Ga0075433_100093872 424
453 3300007076 Ga0075435_100009425 Ga0075435_1000094255 424
454 3300009094 Ga0111539_10010044 Ga0111539_1001004411 424
455 3300013308 Ga0157375_10320821 Ga0157375_103208211 424
456 3300026118 Ga0207675_100196896 Ga0207675_1001968962 424
457 3300027907 Ga0207428_10075145 Ga0207428_100751453 424
458 3300035242 Ga0373962_0012004 Ga0373962_0012004_226_1581 424
459 3300037466 Ga0395898_0060531 Ga0395898_0060531_1300_2574 424
460 3300047469 Ga0495673_0008685 Ga0495673_0008685_4319_5593 424
461 3300048090 Ga0495615_0022019 Ga0495615_0022019_25_1434 424
462 3300048912 Ga0496109_0107846 Ga0496109_0107846_339_1619 424
463 3300048914 Ga0496111_0036571 Ga0496111_0036571_799_2079 424
464 3300048916 Ga0496113_0057975 Ga0496113_0057975_1513_2793 424
465 3300049823 Ga0501044_0108614 Ga0501044_0108614_20_1294 424
466 3300050511 nmdc:mga08y16_287968_c1 nmdc:mga08y16_287968_c1_45_1385 424
467 3300050512 nmdc:mga0n895_26095_c1 nmdc:mga0n895_26095_c1_2768_4108 424
468 3300050513 nmdc:mga0rr50_37091_c1 nmdc:mga0rr50_37091_c1_1313_2653 424
469 3300050515 nmdc:mga0a205_141_c1 nmdc:mga0a205_141_c1_34303_35643 424
470 3300005355 Ga0070671_100048650 Ga0070671_1000486502 425
471 3300005458 Ga0070681_10026875 Ga0070681_100268754 425
472 3300005616 Ga0068852_100118205 Ga0068852_1001182052 425
473 3300005937 Ga0081455_10087480 Ga0081455_100874802 425
474 3300006852 Ga0075433_10007507 Ga0075433_100075075 425
475 3300006871 Ga0075434_100010545 Ga0075434_1000105453 425
476 3300009093 Ga0105240_10018472 Ga0105240_100184723 425
477 3300009094 Ga0111539_10010044 Ga0111539_1001004412 425
478 3300009094 Ga0111539_10131104 Ga0111539_101311041 425
479 3300009545 Ga0105237_10059746 Ga0105237_100597462 425
480 3300009545 Ga0105237_10143730 Ga0105237_101437301 425
481 3300009551 Ga0105238_10046421 Ga0105238_100464212 425
482 3300009551 Ga0105238_10049694 Ga0105238_100496944 425
483 3300013104 Ga0157370_10009437 Ga0157370_100094379 425
484 3300013105 Ga0157369_10013868 Ga0157369_100138688 425
485 3300013105 Ga0157369_10087438 Ga0157369_100874383 425
486 3300013296 Ga0157374_10056599 Ga0157374_100565992 425
487 3300013308 Ga0157375_10002389 Ga0157375_100023892 425
488 3300014969 Ga0157376_10120431 Ga0157376_101204311 425
489 3300025912 Ga0207707_10039194 Ga0207707_100391941 425
490 3300025913 Ga0207695_10044455 Ga0207695_100444554 425
491 3300025914 Ga0207671_10144097 Ga0207671_101440971 425
492 3300025931 Ga0207644_10057893 Ga0207644_100578932 425
493 3300025949 Ga0207667_10037832 Ga0207667_100378323 425
494 3300026041 Ga0207639_10124819 Ga0207639_101248192 425
495 3300035086 Ga0373934_0008480 Ga0373934_0008480_55_1332 425
496 3300035111 Ga0373923_0001387 Ga0373923_0001387_2370_3647 425
497 3300035112 Ga0373932_0026524 Ga0373932_0026524_234_1511 425
498 3300035114 Ga0373939_0040342 Ga0373939_0040342_47_1324 425
499 3300035117 Ga0373953_0002318 Ga0373953_0002318_1193_2470 425
500 3300035118 Ga0373954_0000575 Ga0373954_0000575_4475_5752 425
501 3300035120 Ga0373957_0000310 Ga0373957_0000310_371_1648 425
502 3300035170 Ga0373943_0003092 Ga0373943_0003092_4517_5794 425
503 3300035172 Ga0373955_0004813 Ga0373955_0004813_1481_2758 425
504 3300035207 Ga0373942_0016516 Ga0373942_0016516_36_1313 425
505 3300035241 Ga0373961_0024902 Ga0373961_0024902_237_1577 425
506 3300035242 Ga0373962_0003154 Ga0373962_0003154_1929_3206 425
507 3300035410 Ga0373924_0028362 Ga0373924_0028362_803_2080 425
508 3300035691 Ga0373931_0013106 Ga0373931_0013106_2314_3654 425
509 3300035724 Ga0373933_0009634 Ga0373933_0009634_746_2023 425
510 3300035725 Ga0373947_0010715 Ga0373947_0010715_2269_3546 425
511 3300036401 Ga0373937_0017298 Ga0373937_0017298_178_1455 425
512 3300037068 Ga0373925_0012194 Ga0373925_0012194_4340_5617 425
513 3300044694 Ga0466963_0053828 Ga0466963_0053828_128_1405 425
514 3300045976 Ga0466967_0039701 Ga0466967_0039701_1218_2495 425
515 3300046454 Ga0495592_0004934 Ga0495592_0004934_5289_6566 425
516 3300046459 Ga0495629_0000274 Ga0495629_0000274_5832_7109 425
517 3300046459 Ga0495629_0083933 Ga0495629_0083933_665_1942 425
518 3300046462 Ga0495651_0021993 Ga0495651_0021993_1310_2587 425
519 3300046463 Ga0495653_0011688 Ga0495653_0011688_4450_5727 425
520 3300046472 Ga0495580_0043997 Ga0495580_0043997_286_1563 425
521 3300046473 Ga0495582_0031888 Ga0495582_0031888_1428_2705 425
522 3300046475 Ga0495639_0024238 Ga0495639_0024238_497_1774 425
523 3300046477 Ga0495664_0007291 Ga0495664_0007291_334_1611 425
524 3300046511 Ga0495608_0003122 Ga0495608_0003122_6851_8128 425
525 3300046511 Ga0495608_0104948 Ga0495608_0104948_228_1505 425
526 3300046516 Ga0495628_0037986 Ga0495628_0037986_662_1939 425
527 3300046529 Ga0495652_0069724 Ga0495652_0069724_1558_2835 425
528 3300046536 Ga0495587_0003309 Ga0495587_0003309_3732_5009 425
529 3300046543 Ga0495645_0004289 Ga0495645_0004289_2166_3443 425
530 3300046559 Ga0495667_0003046 Ga0495667_0003046_111_1388 425
531 3300046642 Ga0495634_0003296 Ga0495634_0003296_9335_10612 425
532 3300046663 Ga0495635_0005568 Ga0495635_0005568_3331_4608 425
533 3300046678 Ga0495599_0013813 Ga0495599_0013813_1017_2294 425
534 3300046679 Ga0495623_0017851 Ga0495623_0017851_178_1455 425
535 3300046680 Ga0495646_0003838 Ga0495646_0003838_7290_8567 425
536 3300046689 Ga0495613_0083699 Ga0495613_0083699_675_1952 425
537 3300046809 Ga0495600_0009105 Ga0495600_0009105_1846_3123 425
538 3300047315 Ga0495581_0010811 Ga0495581_0010811_160_1437 425
539 3300047322 Ga0495680_0013969 Ga0495680_0013969_5593_6870 425
540 3300047471 Ga0495684_0000202 Ga0495684_0000202_41624_42901 425
541 3300047673 Ga0495593_0012536 Ga0495593_0012536_3516_4793 425
542 3300048088 Ga0495602_0091777 Ga0495602_0091777_419_1696 425
543 3300048903 Ga0496100_0029167 Ga0496100_0029167_1398_2798 425
544 3300048905 Ga0496102_0006629 Ga0496102_0006629_917_2317 425
545 3300048905 Ga0496102_0039989 Ga0496102_0039989_1863_3140 425
546 3300048906 Ga0496103_0021662 Ga0496103_0021662_1580_2980 425
547 3300048909 Ga0496106_0000132 Ga0496106_0000132_44112_45389 425
548 3300048909 Ga0496106_0033130 Ga0496106_0033130_1211_2611 425
549 3300048910 Ga0496107_0002892 Ga0496107_0002892_6853_8130 425
550 3300048911 Ga0496108_0006355 Ga0496108_0006355_7827_9227 425
551 3300048915 Ga0496112_0056266 Ga0496112_0056266_1841_3241 425
552 3300048915 Ga0496112_0191752 Ga0496112_0191752_601_1878 425
553 3300048918 Ga0496115_0010748 Ga0496115_0010748_1533_2933 425
554 3300050511 nmdc:mga08y16_157443_c1 nmdc:mga08y16_157443_c1_155_1432 425
555 3300050512 nmdc:mga0n895_26095_c1 nmdc:mga0n895_26095_c1_1317_2594 425
556 3300050515 nmdc:mga0a205_141_c1 nmdc:mga0a205_141_c1_32852_34129 425
557 3300053077 Ga0495601_0007293 Ga0495601_0007293_1962_3239 425
558 3300053078 Ga0495612_0005916 Ga0495612_0005916_3648_4925 425
559 3300053084 Ga0495595_0006827 Ga0495595_0006827_1854_3131 425
560 3300005467 Ga0070706_100018218 Ga0070706_1000182182 426
561 3300005468 Ga0070707_100039960 Ga0070707_1000399604 426
562 3300009094 Ga0111539_10261304 Ga0111539_102613041 426
563 3300009553 Ga0105249_10194742 Ga0105249_101947422 426
564 3300026116 Ga0207674_10157891 Ga0207674_101578912 426
565 3300028800 Ga0265338_10031136 Ga0265338_100311362 426
566 3300035725 Ga0373947_0054510 Ga0373947_0054510_831_2165 426
567 iso_pu_bacteria 2885383462 2885386343 426
568 iso_pu_bacteria 2903768456 2903771419 426
569 3300005331 Ga0070670_100046283 Ga0070670_1000462832 427
570 3300005355 Ga0070671_100014313 Ga0070671_1000143134 427
571 3300005367 Ga0070667_100029473 Ga0070667_1000294735 427
572 3300005539 Ga0068853_100106779 Ga0068853_1001067792 427
573 3300005563 Ga0068855_100081702 Ga0068855_1000817022 427
574 3300005618 Ga0068864_100225765 Ga0068864_1002257652 427
575 3300006042 Ga0075368_10002574 Ga0075368_100025745 427
576 3300006048 Ga0075363_100010469 Ga0075363_1000104695 427
577 3300006178 Ga0075367_10007196 Ga0075367_100071964 427
578 3300006195 Ga0075366_10027505 Ga0075366_100275053 427
579 3300006353 Ga0075370_10011339 Ga0075370_100113393 427
580 3300006871 Ga0075434_100018868 Ga0075434_1000188682 427
581 3300006871 Ga0075434_100056584 Ga0075434_1000565843 427
582 3300009093 Ga0105240_10104887 Ga0105240_101048872 427
583 3300009147 Ga0114129_10063111 Ga0114129_100631114 427
584 3300009174 Ga0105241_10016039 Ga0105241_100160392 427
585 3300009545 Ga0105237_10018618 Ga0105237_100186186 427
586 3300009551 Ga0105238_10045925 Ga0105238_100459255 427
587 3300010375 Ga0105239_10215545 Ga0105239_102155452 427
588 3300011119 Ga0105246_10010229 Ga0105246_100102294 427
589 3300013296 Ga0157374_10010088 Ga0157374_100100886 427
590 3300013308 Ga0157375_10279638 Ga0157375_102796381 427
591 3300025304 Ga0209257_1008496 Ga0209257_10084962 427
592 3300025315 Ga0207697_10012707 Ga0207697_100127072 427
593 3300025904 Ga0207647_10001953 Ga0207647_100019535 427
594 3300025914 Ga0207671_10008638 Ga0207671_100086384 427
595 3300025925 Ga0207650_10009631 Ga0207650_100096313 427
596 3300025941 Ga0207711_10115273 Ga0207711_101152732 427
597 3300025945 Ga0207679_10170203 Ga0207679_101702031 427
598 3300025949 Ga0207667_10297985 Ga0207667_102979851 427
599 3300025972 Ga0207668_10075063 Ga0207668_100750631 427
600 3300035691 Ga0373931_0103293 Ga0373931_0103293_188_1573 427
601 3300035725 Ga0373947_0054014 Ga0373947_0054014_85_1470 427
602 3300039437 Ga0436365_0071656 Ga0436365_0071656_842_2221 427
603 3300046457 Ga0495590_0023720 Ga0495590_0023720_541_1824 427
604 3300046459 Ga0495629_0026723 Ga0495629_0026723_1471_2802 427
605 3300046460 Ga0495638_0039519 Ga0495638_0039519_1235_2518 427
606 3300046476 Ga0495662_0051973 Ga0495662_0051973_192_1577 427
607 3300046519 Ga0495632_0087382 Ga0495632_0087382_80_1420 427
608 3300046522 Ga0495643_0010781 Ga0495643_0010781_968_2308 427
609 3300046616 Ga0495668_0009325 Ga0495668_0009325_1358_2698 427
610 3300046660 Ga0495625_0174850 Ga0495625_0174850_118_1401 427
611 3300046794 Ga0495589_0071687 Ga0495589_0071687_158_1441 427
612 3300048905 Ga0496102_0007550 Ga0496102_0007550_3029_4369 427
613 3300048905 Ga0496102_0029492 Ga0496102_0029492_1272_2657 427
614 3300048906 Ga0496103_0002556 Ga0496103_0002556_6471_7811 427
615 3300048906 Ga0496103_0010340 Ga0496103_0010340_4012_5397 427
616 3300048907 Ga0496104_0001610 Ga0496104_0001610_15745_17130 427
617 3300048908 Ga0496105_0001092 Ga0496105_0001092_11455_12840 427
618 3300048911 Ga0496108_0004593 Ga0496108_0004593_5207_6592 427
619 3300048911 Ga0496108_0045130 Ga0496108_0045130_32_1372 427
620 3300048912 Ga0496109_0000673 Ga0496109_0000673_6326_7711 427
621 3300048913 Ga0496110_0005312 Ga0496110_0005312_8208_9593 427
622 3300048914 Ga0496111_0000369 Ga0496111_0000369_397_1782 427
623 3300048915 Ga0496112_0005651 Ga0496112_0005651_3768_5153 427
624 3300048915 Ga0496112_0021205 Ga0496112_0021205_1518_2858 427
625 3300048916 Ga0496113_0003021 Ga0496113_0003021_4479_5864 427
626 3300048919 Ga0496116_0054972 Ga0496116_0054972_1077_2417 427
627 3300048922 Ga0496119_0038742 Ga0496119_0038742_203_1543 427
628 3300050490 nmdc:mga03n38_11146_c1 nmdc:mga03n38_11146_c1_40_1380 427
629 3300050491 nmdc:mga00v17_16623_c1 nmdc:mga00v17_16623_c1_229_1569 427
630 3300050494 nmdc:mga06z11_2007_c1 nmdc:mga06z11_2007_c1_3333_4673 427
631 3300050495 nmdc:mga04h51_9004_c1 nmdc:mga04h51_9004_c1_953_2293 427
632 3300050496 nmdc:mga07m45_78580_c1 nmdc:mga07m45_78580_c1_335_1675 427
633 3300050507 nmdc:mga05p37_166167_c1 nmdc:mga05p37_166167_c1_494_1879 427
634 3300050512 nmdc:mga0n895_127675_c1 nmdc:mga0n895_127675_c1_834_2219 427
635 3300050512 nmdc:mga0n895_49140_c1 nmdc:mga0n895_49140_c1_1519_2850 427
636 3300050513 nmdc:mga0rr50_3143_c1 nmdc:mga0rr50_3143_c1_2792_4123 427
637 3300053085 Ga0495619_0035265 Ga0495619_0035265_1835_3166 427
638 3300003911 JGI25405J52794_10015703 JGI25405J52794_100157031 428
639 3300005331 Ga0070670_100099224 Ga0070670_1000992241 428
640 3300005338 Ga0068868_100097141 Ga0068868_1000971412 428
641 3300005341 Ga0070691_10028244 Ga0070691_100282444 428
642 3300005341 Ga0070691_10068140 Ga0070691_100681401 428
643 3300005354 Ga0070675_100136493 Ga0070675_1001364932 428
644 3300005355 Ga0070671_100035594 Ga0070671_1000355943 428
645 3300005355 Ga0070671_100059844 Ga0070671_1000598443 428
646 3300005364 Ga0070673_100099578 Ga0070673_1000995782 428
647 3300005366 Ga0070659_100211410 Ga0070659_1002114101 428
648 3300005434 Ga0070709_10018900 Ga0070709_100189002 428
649 3300005435 Ga0070714_100057926 Ga0070714_1000579263 428
650 3300005435 Ga0070714_100118276 Ga0070714_1001182763 428
651 3300005436 Ga0070713_100019235 Ga0070713_1000192353 428
652 3300005436 Ga0070713_100122414 Ga0070713_1001224142 428
653 3300005437 Ga0070710_10002845 Ga0070710_100028459 428
654 3300005437 Ga0070710_10005520 Ga0070710_100055205 428
655 3300005439 Ga0070711_100008227 Ga0070711_1000082272 428
656 3300005439 Ga0070711_100252171 Ga0070711_1002521711 428
657 3300005456 Ga0070678_100025653 Ga0070678_1000256531 428
658 3300005458 Ga0070681_10034038 Ga0070681_100340382 428
659 3300005468 Ga0070707_100351765 Ga0070707_1003517651 428
660 3300005518 Ga0070699_100007741 Ga0070699_1000077417 428
661 3300005535 Ga0070684_100061460 Ga0070684_1000614601 428
662 3300005536 Ga0070697_100056813 Ga0070697_1000568134 428
663 3300005539 Ga0068853_100048509 Ga0068853_1000485091 428
664 3300005545 Ga0070695_100005577 Ga0070695_1000055774 428
665 3300005548 Ga0070665_100030822 Ga0070665_1000308222 428
666 3300005548 Ga0070665_100140512 Ga0070665_1001405122 428
667 3300005563 Ga0068855_100060250 Ga0068855_1000602503 428
668 3300005563 Ga0068855_100221306 Ga0068855_1002213062 428
669 3300005563 Ga0068855_100232942 Ga0068855_1002329423 428
670 3300005564 Ga0070664_100100905 Ga0070664_1001009052 428
671 3300005577 Ga0068857_100038200 Ga0068857_1000382005 428
672 3300005577 Ga0068857_100063354 Ga0068857_1000633541 428
673 3300005614 Ga0068856_100088218 Ga0068856_1000882182 428
674 3300005614 Ga0068856_100158056 Ga0068856_1001580562 428
675 3300005616 Ga0068852_100011636 Ga0068852_1000116367 428
676 3300005617 Ga0068859_100230741 Ga0068859_1002307411 428
677 3300005617 Ga0068859_100402698 Ga0068859_1004026981 428
678 3300005718 Ga0068866_10038826 Ga0068866_100388262 428
679 3300005842 Ga0068858_100016019 Ga0068858_1000160193 428
680 3300005844 Ga0068862_100068284 Ga0068862_1000682842 428
681 3300005937 Ga0081455_10000062 Ga0081455_1000006211 428
682 3300005937 Ga0081455_10020033 Ga0081455_100200333 428
683 3300005937 Ga0081455_10037459 Ga0081455_100374592 428
684 3300006028 Ga0070717_10002845 Ga0070717_100028459 428
685 3300006028 Ga0070717_10051833 Ga0070717_100518333 428
686 3300006028 Ga0070717_10071679 Ga0070717_100716792 428
687 3300006028 Ga0070717_10076155 Ga0070717_100761552 428
688 3300006175 Ga0070712_100012738 Ga0070712_1000127383 428
689 3300006175 Ga0070712_100016856 Ga0070712_1000168565 428
690 3300006237 Ga0097621_100063586 Ga0097621_1000635862 428
691 3300006844 Ga0075428_100074030 Ga0075428_1000740301 428
692 3300006931 Ga0097620_100230741 Ga0097620_1002307412 428
693 3300006931 Ga0097620_100402694 Ga0097620_1004026941 428
694 3300007265 Ga0099794_10003585 Ga0099794_100035855 428
695 3300009092 Ga0105250_10049173 Ga0105250_100491731 428
696 3300009148 Ga0105243_10139959 Ga0105243_101399592 428
697 3300009174 Ga0105241_10050230 Ga0105241_100502302 428
698 3300009545 Ga0105237_10028013 Ga0105237_100280132 428
699 3300010375 Ga0105239_10080412 Ga0105239_100804124 428
700 3300010375 Ga0105239_10193665 Ga0105239_101936652 428
701 3300011119 Ga0105246_10101022 Ga0105246_101010222 428
702 3300013105 Ga0157369_10132704 Ga0157369_101327042 428
703 3300013296 Ga0157374_10158323 Ga0157374_101583232 428
704 3300013297 Ga0157378_10185226 Ga0157378_101852262 428
705 3300013306 Ga0163162_10173284 Ga0163162_101732842 428
706 3300013308 Ga0157375_10216330 Ga0157375_102163302 428
707 3300014497 Ga0182008_10028985 Ga0182008_100289852 428
708 3300014968 Ga0157379_10199759 Ga0157379_101997592 428
709 3300021377 Ga0213874_10027698 Ga0213874_100276982 428
710 3300021388 Ga0213875_10000748 Ga0213875_1000074813 428
711 3300021388 Ga0213875_10003454 Ga0213875_1000345411 428
712 3300021388 Ga0213875_10046568 Ga0213875_100465682 428
713 3300025261 Ga0209233_1009969 Ga0209233_10099692 428
714 3300025297 Ga0209758_1002422 Ga0209758_100242215 428
715 3300025898 Ga0207692_10001849 Ga0207692_100018498 428
716 3300025901 Ga0207688_10001429 Ga0207688_100014298 428
717 3300025910 Ga0207684_10029075 Ga0207684_100290753 428
718 3300025913 Ga0207695_10000015 Ga0207695_10000015485 428
719 3300025914 Ga0207671_10008452 Ga0207671_100084528 428
720 3300025914 Ga0207671_10110809 Ga0207671_101108092 428
721 3300025915 Ga0207693_10001157 Ga0207693_100011579 428
722 3300025916 Ga0207663_10006014 Ga0207663_100060146 428
723 3300025917 Ga0207660_10075782 Ga0207660_100757822 428
724 3300025919 Ga0207657_10146997 Ga0207657_101469971 428
725 3300025922 Ga0207646_10283399 Ga0207646_102833991 428
726 3300025923 Ga0207681_10142125 Ga0207681_101421251 428
727 3300025924 Ga0207694_10173654 Ga0207694_101736541 428
728 3300025926 Ga0207659_10143956 Ga0207659_101439562 428
729 3300025926 Ga0207659_10169132 Ga0207659_101691322 428
730 3300025928 Ga0207700_10062855 Ga0207700_100628553 428
731 3300025928 Ga0207700_10084261 Ga0207700_100842613 428
732 3300025928 Ga0207700_10198572 Ga0207700_101985722 428
733 3300025929 Ga0207664_10121243 Ga0207664_101212431 428
734 3300025939 Ga0207665_10044028 Ga0207665_100440282 428
735 3300025940 Ga0207691_10000910 Ga0207691_1000091023 428
736 3300025942 Ga0207689_10112421 Ga0207689_101124212 428
737 3300025944 Ga0207661_10131875 Ga0207661_101318752 428
738 3300025949 Ga0207667_10225141 Ga0207667_102251412 428
739 3300026023 Ga0207677_10058702 Ga0207677_100587022 428
740 3300026023 Ga0207677_10061807 Ga0207677_100618072 428
741 3300026035 Ga0207703_10039853 Ga0207703_100398532 428
742 3300026041 Ga0207639_10138822 Ga0207639_101388222 428
743 3300026067 Ga0207678_10055570 Ga0207678_100555702 428
744 3300026078 Ga0207702_10009625 Ga0207702_100096252 428
745 3300026116 Ga0207674_10078492 Ga0207674_100784923 428
746 3300026116 Ga0207674_10098061 Ga0207674_100980612 428
747 3300026118 Ga0207675_100043587 Ga0207675_1000435873 428
748 3300026121 Ga0207683_10065696 Ga0207683_100656962 428
749 3300028380 Ga0268265_10156865 Ga0268265_101568652 428
750 3300035089 Ga0373944_0012984 Ga0373944_0012984_533_1882 428
751 3300035116 Ga0373945_0019537 Ga0373945_0019537_463_1812 428
752 3300035170 Ga0373943_0050899 Ga0373943_0050899_429_1778 428
753 3300035171 Ga0373946_0041444 Ga0373946_0041444_283_1632 428
754 3300035692 Ga0373935_0023585 Ga0373935_0023585_2417_3766 428
755 3300035692 Ga0373935_0024652 Ga0373935_0024652_207_1553 428
756 3300035695 Ga0373927_0023630 Ga0373927_0023630_1137_2486 428
757 3300035695 Ga0373927_0026896 Ga0373927_0026896_872_2218 428
758 3300037418 Ga0395900_0009959 Ga0395900_0009959_2227_3561 428
759 3300037471 Ga0395905_0214454 Ga0395905_0214454_52_1401 428
760 3300037853 Ga0436364_0063853 Ga0436364_0063853_11091_12443 428
761 3300037853 Ga0436364_0425406 Ga0436364_0425406_174_1520 428
762 3300037853 Ga0436364_1037748 Ga0436364_1037748_17659_19008 428
763 3300038443 Ga0395901_0002729 Ga0395901_0002729_2706_4040 428
764 3300039447 Ga0436361_0303930 Ga0436361_0303930_3054_4385 428
765 3300039450 Ga0436363_1256145 Ga0436363_1256145_515_1861 428
766 3300044694 Ga0466963_0053755 Ga0466963_0053755_544_1878 428
767 3300044842 Ga0466957_0031508 Ga0466957_0031508_1381_2715 428
768 3300045976 Ga0466967_0275862 Ga0466967_0275862_15_1346 428
769 3300046452 Ga0495617_041209 Ga0495617_041209_153_1487 428
770 3300046455 Ga0495603_0074272 Ga0495603_0074272_444_1793 428
771 3300046461 Ga0495641_0049337 Ga0495641_0049337_191_1540 428
772 3300046473 Ga0495582_0063318 Ga0495582_0063318_282_1631 428
773 3300046476 Ga0495662_0017387 Ga0495662_0017387_597_1946 428
774 3300046491 Ga0495584_0067052 Ga0495584_0067052_351_1700 428
775 3300046492 Ga0495585_0031744 Ga0495585_0031744_776_2125 428
776 3300046501 Ga0495607_0101529 Ga0495607_0101529_60_1409 428
777 3300046513 Ga0495616_0022143 Ga0495616_0022143_820_2169 428
778 3300046517 Ga0495630_0039291 Ga0495630_0039291_2035_3384 428
779 3300046537 Ga0495598_0001513 Ga0495598_0001513_2525_3874 428
780 3300046558 Ga0495633_0039800 Ga0495633_0039800_617_1966 428
781 3300046615 Ga0495656_0001407 Ga0495656_0001407_4615_5964 428
782 3300046664 Ga0495659_0037345 Ga0495659_0037345_227_1576 428
783 3300046665 Ga0495661_0046229 Ga0495661_0046229_1152_2501 428
784 3300046674 Ga0495588_0005658 Ga0495588_0005658_229_1578 428
785 3300046683 Ga0495658_0028915 Ga0495658_0028915_650_1999 428
786 3300046689 Ga0495613_0085961 Ga0495613_0085961_339_1688 428
787 3300046690 Ga0495624_0012108 Ga0495624_0012108_2075_3424 428
788 3300047315 Ga0495581_0042718 Ga0495581_0042718_740_2089 428
789 3300047321 Ga0495676_0040171 Ga0495676_0040171_300_1649 428
790 3300047445 Ga0495677_0032176 Ga0495677_0032176_43_1392 428
791 3300048906 Ga0496103_0043433 Ga0496103_0043433_371_1705 428
792 3300048907 Ga0496104_0072608 Ga0496104_0072608_12_1361 428
793 3300048908 Ga0496105_0040423 Ga0496105_0040423_1627_2961 428
794 3300048909 Ga0496106_0045531 Ga0496106_0045531_1812_3146 428
795 3300048911 Ga0496108_0022585 Ga0496108_0022585_1574_2908 428
796 3300048912 Ga0496109_0041345 Ga0496109_0041345_930_2264 428
797 3300048912 Ga0496109_0067710 Ga0496109_0067710_1541_2878 428
798 3300048914 Ga0496111_0171805 Ga0496111_0171805_32_1444 428
799 3300048915 Ga0496112_0024768 Ga0496112_0024768_929_2263 428
800 3300048916 Ga0496113_0009451 Ga0496113_0009451_3599_4957 428
801 3300048916 Ga0496113_0045124 Ga0496113_0045124_22_1356 428
802 3300048917 Ga0496114_0078870 Ga0496114_0078870_1431_2765 428
803 3300048918 Ga0496115_0017648 Ga0496115_0017648_2450_3784 428
804 3300049571 Ga0501034_0052306 Ga0501034_0052306_1354_2688 428
805 3300049586 Ga0501070_0216517 Ga0501070_0216517_73_1419 428
806 3300049742 Ga0501080_0109118 Ga0501080_0109118_84_1430 428
807 3300049744 Ga0501083_0007657 Ga0501083_0007657_1073_2419 428
808 3300060353 Ga0501082_0013208 Ga0501082_0013208_977_2323 428
809 3300005441 Ga0070700_100077236 Ga0070700_1000772362 429
810 3300005456 Ga0070678_100125581 Ga0070678_1001255811 429
811 3300005539 Ga0068853_100214198 Ga0068853_1002141982 429
812 3300005545 Ga0070695_100002243 Ga0070695_1000022435 429
813 3300005563 Ga0068855_100196308 Ga0068855_1001963081 429
814 3300005937 Ga0081455_10129657 Ga0081455_101296572 429
815 3300005981 Ga0081538_10004691 Ga0081538_100046912 429
816 3300005983 Ga0081540_1001096 Ga0081540_10010968 429
817 3300006175 Ga0070712_100224482 Ga0070712_1002244821 429
818 3300006178 Ga0075367_10139849 Ga0075367_101398491 429
819 3300006844 Ga0075428_100025075 Ga0075428_1000250754 429
820 3300006844 Ga0075428_100233246 Ga0075428_1002332463 429
821 3300006847 Ga0075431_100144185 Ga0075431_1001441852 429
822 3300006871 Ga0075434_100003469 Ga0075434_1000034694 429
823 3300006871 Ga0075434_100010716 Ga0075434_1000107163 429
824 3300007076 Ga0075435_100029324 Ga0075435_1000293244 429
825 3300009094 Ga0111539_10019554 Ga0111539_100195543 429
826 3300009147 Ga0114129_10081706 Ga0114129_100817065 429
827 3300009147 Ga0114129_10233909 Ga0114129_102339091 429
828 3300021388 Ga0213875_10011211 Ga0213875_100112113 429
829 3300026121 Ga0207683_10116996 Ga0207683_101169962 429
830 3300031728 Ga0316578_10036599 Ga0316578_100365991 429
831 3300035691 Ga0373931_0001359 Ga0373931_0001359_8337_9677 429
832 3300037418 Ga0395900_0005908 Ga0395900_0005908_9568_10905 429
833 3300037853 Ga0436364_0875825 Ga0436364_0875825_5004_6353 429
834 3300037853 Ga0436364_1117332 Ga0436364_1117332_490_1854 429
835 3300038443 Ga0395901_0002583 Ga0395901_0002583_9636_10973 429
836 3300038443 Ga0395901_0179180 Ga0395901_0179180_299_1636 429
837 3300039438 Ga0436360_0857979 Ga0436360_0857979_727_2076 429
838 3300044694 Ga0466963_0027947 Ga0466963_0027947_1212_2549 429
839 3300045976 Ga0466967_0120775 Ga0466967_0120775_995_2332 429
840 3300046454 Ga0495592_0026990 Ga0495592_0026990_2738_4087 429
841 3300046535 Ga0495586_0020121 Ga0495586_0020121_1164_2513 429
842 3300046559 Ga0495667_0023182 Ga0495667_0023182_1336_2685 429
843 3300046559 Ga0495667_0074446 Ga0495667_0074446_596_1927 429
844 3300046615 Ga0495656_0078571 Ga0495656_0078571_68_1405 429
845 3300046663 Ga0495635_0069381 Ga0495635_0069381_967_2316 429
846 3300047321 Ga0495676_0027504 Ga0495676_0027504_1742_3202 429
847 3300047322 Ga0495680_0048590 Ga0495680_0048590_1008_2357 429
848 3300048904 Ga0496101_0002175 Ga0496101_0002175_5196_6530 429
849 3300048904 Ga0496101_0230843 Ga0496101_0230843_60_1400 429
850 3300048905 Ga0496102_0008862 Ga0496102_0008862_4319_5653 429
851 3300048907 Ga0496104_0000253 Ga0496104_0000253_23472_24809 429
852 3300048907 Ga0496104_0003222 Ga0496104_0003222_5161_6498 429
853 3300048907 Ga0496104_0027004 Ga0496104_0027004_217_1551 429
854 3300048907 Ga0496104_0106906 Ga0496104_0106906_679_2019 429
855 3300048908 Ga0496105_0070980 Ga0496105_0070980_336_1673 429
856 3300048909 Ga0496106_0019127 Ga0496106_0019127_1612_2946 429
857 3300048909 Ga0496106_0119957 Ga0496106_0119957_237_1574 429
858 3300048910 Ga0496107_0122515 Ga0496107_0122515_471_1811 429
859 3300048911 Ga0496108_0022087 Ga0496108_0022087_1538_2872 429
860 3300048911 Ga0496108_0132783 Ga0496108_0132783_654_2108 429
861 3300048912 Ga0496109_0026829 Ga0496109_0026829_1323_2657 429
862 3300048912 Ga0496109_0040874 Ga0496109_0040874_911_2251 429
863 3300048913 Ga0496110_0003034 Ga0496110_0003034_9140_10474 429
864 3300048913 Ga0496110_0088340 Ga0496110_0088340_1161_2501 429
865 3300048913 Ga0496110_0108320 Ga0496110_0108320_160_1494 429
866 3300048914 Ga0496111_0004419 Ga0496111_0004419_6080_7414 429
867 3300048915 Ga0496112_0037584 Ga0496112_0037584_2635_3969 429
868 3300048915 Ga0496112_0156945 Ga0496112_0156945_238_1578 429
869 3300048916 Ga0496113_0015707 Ga0496113_0015707_143_1477 429
870 3300048917 Ga0496114_0282317 Ga0496114_0282317_111_1445 429
871 3300048918 Ga0496115_0046941 Ga0496115_0046941_1610_2950 429
872 3300049568 Ga0501031_0004827 Ga0501031_0004827_4296_5633 429
873 3300049569 Ga0501032_0000054 Ga0501032_0000054_26268_27605 429
874 3300049570 Ga0501033_0000025 Ga0501033_0000025_130782_132119 429
875 3300049571 Ga0501034_0000177 Ga0501034_0000177_40445_41782 429
876 3300049571 Ga0501034_0004577 Ga0501034_0004577_9662_10999 429
877 3300049571 Ga0501034_0034959 Ga0501034_0034959_2484_3821 429
878 3300049572 Ga0501036_0000025 Ga0501036_0000025_73241_74578 429
879 3300049573 Ga0501037_0000169 Ga0501037_0000169_36282_37619 429
880 3300049574 Ga0501038_0000029 Ga0501038_0000029_57321_58658 429
881 3300049575 Ga0501039_0000441 Ga0501039_0000441_14655_15992 429
882 3300049575 Ga0501039_0243457 Ga0501039_0243457_50_1387 429
883 3300049579 Ga0501043_0000067 Ga0501043_0000067_18576_19913 429
884 3300049580 Ga0501046_0000556 Ga0501046_0000556_26687_28024 429
885 3300049581 Ga0501047_0000061 Ga0501047_0000061_105017_106354 429
886 3300049582 Ga0501048_0000081 Ga0501048_0000081_19250_20587 429
887 3300049583 Ga0501067_0000337 Ga0501067_0000337_12581_13918 429
888 3300049584 Ga0501068_0001209 Ga0501068_0001209_4694_6031 429
889 3300049586 Ga0501070_0004162 Ga0501070_0004162_140_1477 429
890 3300049588 Ga0501072_0024951 Ga0501072_0024951_3254_4591 429
891 3300049590 Ga0501074_0001483 Ga0501074_0001483_3496_4833 429
892 3300049592 Ga0501076_0073707 Ga0501076_0073707_908_2416 429
893 3300049593 Ga0501077_0048866 Ga0501077_0048866_590_1942 429
894 3300049741 Ga0501079_0023853 Ga0501079_0023853_2029_3366 429
895 3300049741 Ga0501079_0080081 Ga0501079_0080081_579_1916 429
896 3300049742 Ga0501080_0000786 Ga0501080_0000786_6881_8218 429
897 3300049744 Ga0501083_0013787 Ga0501083_0013787_675_2012 429
898 3300049822 Ga0501035_0002419 Ga0501035_0002419_53_1390 429
899 3300049823 Ga0501044_0000028 Ga0501044_0000028_133258_134595 429
900 3300049823 Ga0501044_0007082 Ga0501044_0007082_3628_4965 429
901 3300049824 Ga0501045_0019197 Ga0501045_0019197_1103_2440 429
902 3300049824 Ga0501045_0064794 Ga0501045_0064794_287_1639 429
903 3300050494 nmdc:mga06z11_1539_c1 nmdc:mga06z11_1539_c1_2916_4253 429
904 3300050507 nmdc:mga05p37_30636_c1 nmdc:mga05p37_30636_c1_78_1436 429
905 3300050510 nmdc:mga06r32_75770_c1 nmdc:mga06r32_75770_c1_1126_2463 429
906 3300050511 nmdc:mga08y16_322689_c1 nmdc:mga08y16_322689_c1_207_1511 429
907 3300050512 nmdc:mga0n895_317314_c1 nmdc:mga0n895_317314_c1_45_1379 429
908 3300050512 nmdc:mga0n895_4630_c1 nmdc:mga0n895_4630_c1_3138_4475 429
909 3300050513 nmdc:mga0rr50_76664_c1 nmdc:mga0rr50_76664_c1_321_1661 429
910 3300053077 Ga0495601_0018011 Ga0495601_0018011_1540_2889 429
911 3300053084 Ga0495595_0006424 Ga0495595_0006424_1414_2763 429
912 3300054114 Ga0501084_0014366 Ga0501084_0014366_610_1947 429
913 3300060353 Ga0501082_0003510 Ga0501082_0003510_9137_10474 429
914 3300060353 Ga0501082_0063979 Ga0501082_0063979_1723_3060 429
915 iso_pu_bacteria 2524023205 2524443658 429
916 iso_pu_bacteria 2935975950 2935981829 429
917 iso_pu_bacteria 8019629233 8019629586 429
918 3300002070 JGI24750J21931_1004125 JGI24750J21931_10041251 430
919 3300003215 JGI25153J46596_10000235 JGI25153J46596_1000023530 430
920 3300003911 JGI25405J52794_10007662 JGI25405J52794_100076621 430
921 3300004800 Ga0058861_12054439 Ga0058861_120544392 430
922 3300004803 Ga0058862_12877440 Ga0058862_128774402 430
923 3300005329 Ga0070683_100021672 Ga0070683_1000216724 430
924 3300005330 Ga0070690_100088389 Ga0070690_1000883892 430
925 3300005334 Ga0068869_100023870 Ga0068869_1000238704 430
926 3300005336 Ga0070680_100005272 Ga0070680_1000052728 430
927 3300005341 Ga0070691_10010001 Ga0070691_100100013 430
928 3300005347 Ga0070668_100090201 Ga0070668_1000902011 430
929 3300005353 Ga0070669_100025193 Ga0070669_1000251933 430
930 3300005367 Ga0070667_100093206 Ga0070667_1000932062 430
931 3300005406 Ga0070703_10004788 Ga0070703_100047884 430
932 3300005434 Ga0070709_10001133 Ga0070709_1000113311 430
933 3300005434 Ga0070709_10004033 Ga0070709_100040337 430
934 3300005434 Ga0070709_10004449 Ga0070709_100044495 430
935 3300005434 Ga0070709_10021517 Ga0070709_100215171 430
936 3300005435 Ga0070714_100016189 Ga0070714_1000161894 430
937 3300005435 Ga0070714_100018552 Ga0070714_1000185521 430
938 3300005435 Ga0070714_100022544 Ga0070714_1000225443 430
939 3300005436 Ga0070713_100009541 Ga0070713_1000095417 430
940 3300005436 Ga0070713_100031677 Ga0070713_1000316773 430
941 3300005436 Ga0070713_100035565 Ga0070713_1000355652 430
942 3300005436 Ga0070713_100066685 Ga0070713_1000666852 430
943 3300005436 Ga0070713_100068483 Ga0070713_1000684832 430
944 3300005437 Ga0070710_10000179 Ga0070710_1000017928 430
945 3300005437 Ga0070710_10004558 Ga0070710_100045582 430
946 3300005437 Ga0070710_10005105 Ga0070710_100051053 430
947 3300005439 Ga0070711_100001224 Ga0070711_10000122413 430
948 3300005439 Ga0070711_100004199 Ga0070711_1000041992 430
949 3300005439 Ga0070711_100020059 Ga0070711_1000200593 430
950 3300005439 Ga0070711_100038988 Ga0070711_1000389884 430
951 3300005440 Ga0070705_100000027 Ga0070705_10000002730 430
952 3300005441 Ga0070700_100047463 Ga0070700_1000474633 430
953 3300005441 Ga0070700_100075207 Ga0070700_1000752071 430
954 3300005444 Ga0070694_100001546 Ga0070694_1000015462 430
955 3300005444 Ga0070694_100078086 Ga0070694_1000780862 430
956 3300005457 Ga0070662_100064764 Ga0070662_1000647642 430
957 3300005457 Ga0070662_100071696 Ga0070662_1000716961 430
958 3300005458 Ga0070681_10006430 Ga0070681_100064306 430
959 3300005458 Ga0070681_10026034 Ga0070681_100260344 430
960 3300005458 Ga0070681_10302006 Ga0070681_103020061 430
961 3300005471 Ga0070698_100054114 Ga0070698_1000541142 430
962 3300005471 Ga0070698_100131370 Ga0070698_1001313702 430
963 3300005518 Ga0070699_100003991 Ga0070699_1000039916 430
964 3300005530 Ga0070679_100027477 Ga0070679_1000274774 430
965 3300005530 Ga0070679_100111127 Ga0070679_1001111271 430
966 3300005530 Ga0070679_100129485 Ga0070679_1001294852 430
967 3300005535 Ga0070684_100030989 Ga0070684_1000309893 430
968 3300005536 Ga0070697_100025958 Ga0070697_1000259583 430
969 3300005536 Ga0070697_100121048 Ga0070697_1001210482 430
970 3300005536 Ga0070697_100164971 Ga0070697_1001649712 430
971 3300005539 Ga0068853_100031548 Ga0068853_1000315484 430
972 3300005539 Ga0068853_100160130 Ga0068853_1001601301 430
973 3300005545 Ga0070695_100001000 Ga0070695_1000010004 430
974 3300005545 Ga0070695_100004173 Ga0070695_1000041734 430
975 3300005545 Ga0070695_100021613 Ga0070695_1000216132 430
976 3300005546 Ga0070696_100000051 Ga0070696_10000005151 430
977 3300005547 Ga0070693_100004723 Ga0070693_1000047236 430
978 3300005548 Ga0070665_100141978 Ga0070665_1001419782 430
979 3300005548 Ga0070665_100220563 Ga0070665_1002205632 430
980 3300005549 Ga0070704_100005564 Ga0070704_1000055642 430
981 3300005563 Ga0068855_100096599 Ga0068855_1000965994 430
982 3300005563 Ga0068855_100238516 Ga0068855_1002385161 430
983 3300005577 Ga0068857_100009387 Ga0068857_1000093877 430
984 3300005577 Ga0068857_100014381 Ga0068857_1000143813 430
985 3300005577 Ga0068857_100063272 Ga0068857_1000632722 430
986 3300005578 Ga0068854_100100188 Ga0068854_1001001882 430
987 3300005615 Ga0070702_100051167 Ga0070702_1000511672 430
988 3300005616 Ga0068852_100314108 Ga0068852_1003141081 430
989 3300005617 Ga0068859_100017457 Ga0068859_1000174575 430
990 3300005618 Ga0068864_100040051 Ga0068864_1000400511 430
991 3300005618 Ga0068864_100074697 Ga0068864_1000746972 430
992 3300005618 Ga0068864_100149492 Ga0068864_1001494922 430
993 3300005719 Ga0068861_100050681 Ga0068861_1000506812 430
994 3300005719 Ga0068861_100060475 Ga0068861_1000604752 430
995 3300005719 Ga0068861_100151861 Ga0068861_1001518612 430
996 3300005841 Ga0068863_100093227 Ga0068863_1000932271 430
997 3300005843 Ga0068860_100000375 Ga0068860_1000003754 430
998 3300005843 Ga0068860_100001599 Ga0068860_10000159916 430
999 3300005843 Ga0068860_100013303 Ga0068860_1000133034 430
1000 3300005843 Ga0068860_100155199 Ga0068860_1001551991 430
1001 3300005844 Ga0068862_100001717 Ga0068862_1000017174 430
1002 3300005844 Ga0068862_100162667 Ga0068862_1001626672 430
1003 3300005937 Ga0081455_10000087 Ga0081455_1000008710 430
1004 3300005937 Ga0081455_10001255 Ga0081455_1000125525 430
1005 3300005937 Ga0081455_10003384 Ga0081455_1000338419 430
1006 3300005983 Ga0081540_1000413 Ga0081540_100041341 430
1007 3300005983 Ga0081540_1000629 Ga0081540_10006299 430
1008 3300005983 Ga0081540_1000794 Ga0081540_100079419 430
1009 3300005983 Ga0081540_1001058 Ga0081540_100105823 430
1010 3300005983 Ga0081540_1002242 Ga0081540_10022423 430
1011 3300005983 Ga0081540_1036043 Ga0081540_10360432 430
1012 3300005983 Ga0081540_1053418 Ga0081540_10534181 430
1013 3300005985 Ga0081539_10000080 Ga0081539_1000008043 430
1014 3300005985 Ga0081539_10003020 Ga0081539_1000302023 430
1015 3300005985 Ga0081539_10007934 Ga0081539_100079346 430
1016 3300005985 Ga0081539_10007934 Ga0081539_100079347 430
1017 3300006028 Ga0070717_10000770 Ga0070717_1000077025 430
1018 3300006028 Ga0070717_10006584 Ga0070717_100065844 430
1019 3300006028 Ga0070717_10018908 Ga0070717_100189085 430
1020 3300006028 Ga0070717_10040171 Ga0070717_100401713 430
1021 3300006028 Ga0070717_10051665 Ga0070717_100516652 430
1022 3300006163 Ga0070715_10000402 Ga0070715_100004028 430
1023 3300006173 Ga0070716_100012546 Ga0070716_1000125461 430
1024 3300006173 Ga0070716_100014813 Ga0070716_1000148131 430
1025 3300006175 Ga0070712_100022570 Ga0070712_1000225704 430
1026 3300006175 Ga0070712_100033570 Ga0070712_1000335703 430
1027 3300006175 Ga0070712_100076998 Ga0070712_1000769981 430
1028 3300006175 Ga0070712_100204214 Ga0070712_1002042141 430
1029 3300006178 Ga0075367_10015925 Ga0075367_100159255 430
1030 3300006186 Ga0075369_10006148 Ga0075369_100061483 430
1031 3300006186 Ga0075369_10021878 Ga0075369_100218782 430
1032 3300006237 Ga0097621_100122434 Ga0097621_1001224342 430
1033 3300006358 Ga0068871_100226887 Ga0068871_1002268871 430
1034 3300006847 Ga0075431_100141290 Ga0075431_1001412902 430
1035 3300006852 Ga0075433_10009387 Ga0075433_100093873 430
1036 3300006852 Ga0075433_10063791 Ga0075433_100637912 430
1037 3300006871 Ga0075434_100002046 Ga0075434_1000020462 430
1038 3300006880 Ga0075429_100125906 Ga0075429_1001259062 430
1039 3300006914 Ga0075436_100078249 Ga0075436_1000782491 430
1040 3300006931 Ga0097620_100017457 Ga0097620_1000174575 430
1041 3300006931 Ga0097620_100117315 Ga0097620_1001173152 430
1042 3300007076 Ga0075435_100009425 Ga0075435_1000094254 430
1043 3300007265 Ga0099794_10015670 Ga0099794_100156703 430
1044 3300007788 Ga0099795_10003491 Ga0099795_100034912 430
1045 3300007788 Ga0099795_10005064 Ga0099795_100050641 430
1046 3300009092 Ga0105250_10030645 Ga0105250_100306451 430
1047 3300009093 Ga0105240_10016315 Ga0105240_100163154 430
1048 3300009094 Ga0111539_10006076 Ga0111539_100060767 430
1049 3300009094 Ga0111539_10103652 Ga0111539_101036521 430
1050 3300009094 Ga0111539_10216054 Ga0111539_102160542 430
1051 3300009098 Ga0105245_10178531 Ga0105245_101785311 430
1052 3300009101 Ga0105247_10103880 Ga0105247_101038801 430
1053 3300009147 Ga0114129_10041435 Ga0114129_100414354 430
1054 3300009148 Ga0105243_10088118 Ga0105243_100881181 430
1055 3300009174 Ga0105241_10031659 Ga0105241_100316592 430
1056 3300009174 Ga0105241_10051550 Ga0105241_100515501 430
1057 3300009545 Ga0105237_10010000 Ga0105237_100100009 430
1058 3300009545 Ga0105237_10036555 Ga0105237_100365552 430
1059 3300009545 Ga0105237_10054113 Ga0105237_100541132 430
1060 3300009545 Ga0105237_10057725 Ga0105237_100577252 430
1061 3300009545 Ga0105237_10129278 Ga0105237_101292781 430
1062 3300009545 Ga0105237_10170473 Ga0105237_101704731 430
1063 3300009545 Ga0105237_10200818 Ga0105237_102008182 430
1064 3300009553 Ga0105249_10021936 Ga0105249_100219365 430
1065 3300009553 Ga0105249_10119031 Ga0105249_101190312 430
1066 3300010159 Ga0099796_10007346 Ga0099796_100073463 430
1067 3300010159 Ga0099796_10022593 Ga0099796_100225931 430
1068 3300010375 Ga0105239_10059751 Ga0105239_100597516 430
1069 3300010375 Ga0105239_10148787 Ga0105239_101487872 430
1070 3300013105 Ga0157369_10009982 Ga0157369_100099823 430
1071 3300013297 Ga0157378_10085252 Ga0157378_100852522 430
1072 3300013306 Ga0163162_10036057 Ga0163162_100360572 430
1073 3300013306 Ga0163162_10072199 Ga0163162_100721992 430
1074 3300013306 Ga0163162_10235260 Ga0163162_102352602 430
1075 3300013308 Ga0157375_10028331 Ga0157375_100283312 430
1076 3300013308 Ga0157375_10335939 Ga0157375_103359391 430
1077 3300014325 Ga0163163_10005199 Ga0163163_100051997 430
1078 3300014325 Ga0163163_10012257 Ga0163163_100122575 430
1079 3300014325 Ga0163163_10034855 Ga0163163_100348553 430
1080 3300014325 Ga0163163_10223241 Ga0163163_102232412 430
1081 3300014326 Ga0157380_10053360 Ga0157380_100533601 430
1082 3300014968 Ga0157379_10143626 Ga0157379_101436261 430
1083 3300014969 Ga0157376_10092413 Ga0157376_100924132 430
1084 3300017792 Ga0163161_10042735 Ga0163161_100427352 430
1085 3300020069 Ga0197907_10619077 Ga0197907_106190772 430
1086 3300020070 Ga0206356_11161776 Ga0206356_111617762 430
1087 3300020076 Ga0206355_1316074 Ga0206355_13160742 430
1088 3300020076 Ga0206355_1578423 Ga0206355_15784231 430
1089 3300020077 Ga0206351_10575076 Ga0206351_105750761 430
1090 3300020078 Ga0206352_10061378 Ga0206352_100613782 430
1091 3300020081 Ga0206354_10280028 Ga0206354_102800281 430
1092 3300020081 Ga0206354_10650967 Ga0206354_106509672 430
1093 3300020082 Ga0206353_10469523 Ga0206353_104695231 430
1094 3300020082 Ga0206353_10483150 Ga0206353_104831501 430
1095 3300022467 Ga0224712_10022783 Ga0224712_100227832 430
1096 3300022467 Ga0224712_10023166 Ga0224712_100231662 430
1097 3300025297 Ga0209758_1000211 Ga0209758_100021118 430
1098 3300025711 Ga0207696_1022896 Ga0207696_10228961 430
1099 3300025898 Ga0207692_10000069 Ga0207692_1000006912 430
1100 3300025898 Ga0207692_10047515 Ga0207692_100475151 430
1101 3300025898 Ga0207692_10122593 Ga0207692_101225931 430
1102 3300025899 Ga0207642_10033258 Ga0207642_100332581 430
1103 3300025901 Ga0207688_10078787 Ga0207688_100787871 430
1104 3300025901 Ga0207688_10097358 Ga0207688_100973581 430
1105 3300025905 Ga0207685_10009496 Ga0207685_100094962 430
1106 3300025906 Ga0207699_10000289 Ga0207699_1000028924 430
1107 3300025906 Ga0207699_10008164 Ga0207699_100081641 430
1108 3300025906 Ga0207699_10013807 Ga0207699_100138072 430
1109 3300025910 Ga0207684_10208540 Ga0207684_102085402 430
1110 3300025911 Ga0207654_10019277 Ga0207654_100192772 430
1111 3300025912 Ga0207707_10001525 Ga0207707_100015255 430
1112 3300025912 Ga0207707_10010954 Ga0207707_100109544 430
1113 3300025912 Ga0207707_10013724 Ga0207707_100137243 430
1114 3300025913 Ga0207695_10058307 Ga0207695_100583074 430
1115 3300025914 Ga0207671_10037819 Ga0207671_100378192 430
1116 3300025914 Ga0207671_10054490 Ga0207671_100544902 430
1117 3300025914 Ga0207671_10147168 Ga0207671_101471681 430
1118 3300025915 Ga0207693_10002947 Ga0207693_100029479 430
1119 3300025915 Ga0207693_10008488 Ga0207693_100084884 430
1120 3300025915 Ga0207693_10016489 Ga0207693_100164896 430
1121 3300025915 Ga0207693_10032710 Ga0207693_100327101 430
1122 3300025915 Ga0207693_10164763 Ga0207693_101647631 430
1123 3300025916 Ga0207663_10001917 Ga0207663_1000191712 430
1124 3300025916 Ga0207663_10002533 Ga0207663_100025336 430
1125 3300025916 Ga0207663_10018130 Ga0207663_100181304 430
1126 3300025916 Ga0207663_10035940 Ga0207663_100359402 430
1127 3300025916 Ga0207663_10103332 Ga0207663_101033322 430
1128 3300025917 Ga0207660_10001543 Ga0207660_100015438 430
1129 3300025917 Ga0207660_10057636 Ga0207660_100576362 430
1130 3300025917 Ga0207660_10090179 Ga0207660_100901792 430
1131 3300025921 Ga0207652_10006206 Ga0207652_100062063 430
1132 3300025921 Ga0207652_10067123 Ga0207652_100671233 430
1133 3300025921 Ga0207652_10071777 Ga0207652_100717773 430
1134 3300025921 Ga0207652_10075046 Ga0207652_100750463 430
1135 3300025924 Ga0207694_10025225 Ga0207694_100252252 430
1136 3300025927 Ga0207687_10033081 Ga0207687_100330813 430
1137 3300025928 Ga0207700_10003623 Ga0207700_100036235 430
1138 3300025928 Ga0207700_10013365 Ga0207700_100133655 430
1139 3300025928 Ga0207700_10015503 Ga0207700_100155036 430
1140 3300025928 Ga0207700_10025830 Ga0207700_100258302 430
1141 3300025928 Ga0207700_10114873 Ga0207700_101148731 430
1142 3300025929 Ga0207664_10005442 Ga0207664_100054427 430
1143 3300025929 Ga0207664_10005962 Ga0207664_100059627 430
1144 3300025929 Ga0207664_10006018 Ga0207664_100060183 430
1145 3300025929 Ga0207664_10023512 Ga0207664_100235121 430
1146 3300025929 Ga0207664_10068321 Ga0207664_100683211 430
1147 3300025933 Ga0207706_10017340 Ga0207706_100173401 430
1148 3300025933 Ga0207706_10073694 Ga0207706_100736942 430
1149 3300025935 Ga0207709_10076358 Ga0207709_100763581 430
1150 3300025935 Ga0207709_10080306 Ga0207709_100803061 430
1151 3300025936 Ga0207670_10054619 Ga0207670_100546194 430
1152 3300025937 Ga0207669_10001922 Ga0207669_100019224 430
1153 3300025938 Ga0207704_10172861 Ga0207704_101728611 430
1154 3300025939 Ga0207665_10005674 Ga0207665_100056744 430
1155 3300025939 Ga0207665_10016250 Ga0207665_100162503 430
1156 3300025942 Ga0207689_10124466 Ga0207689_101244661 430
1157 3300025944 Ga0207661_10038523 Ga0207661_100385231 430
1158 3300025949 Ga0207667_10134908 Ga0207667_101349082 430
1159 3300025961 Ga0207712_10006806 Ga0207712_100068062 430
1160 3300025961 Ga0207712_10036612 Ga0207712_100366122 430
1161 3300025961 Ga0207712_10105979 Ga0207712_101059792 430
1162 3300025972 Ga0207668_10006532 Ga0207668_100065321 430
1163 3300025972 Ga0207668_10066311 Ga0207668_100663111 430
1164 3300025986 Ga0207658_10142335 Ga0207658_101423351 430
1165 3300026041 Ga0207639_10044210 Ga0207639_100442102 430
1166 3300026041 Ga0207639_10143422 Ga0207639_101434221 430
1167 3300026067 Ga0207678_10023262 Ga0207678_100232622 430
1168 3300026067 Ga0207678_10118834 Ga0207678_101188342 430
1169 3300026075 Ga0207708_10013604 Ga0207708_100136044 430
1170 3300026075 Ga0207708_10100894 Ga0207708_101008942 430
1171 3300026075 Ga0207708_10133803 Ga0207708_101338031 430
1172 3300026075 Ga0207708_10161225 Ga0207708_101612252 430
1173 3300026095 Ga0207676_10041124 Ga0207676_100411243 430
1174 3300026095 Ga0207676_10051483 Ga0207676_100514832 430
1175 3300026116 Ga0207674_10003474 Ga0207674_100034743 430
1176 3300026116 Ga0207674_10119674 Ga0207674_101196742 430
1177 3300026116 Ga0207674_10138856 Ga0207674_101388561 430
1178 3300026118 Ga0207675_100022031 Ga0207675_1000220312 430
1179 3300026118 Ga0207675_100047496 Ga0207675_1000474962 430
1180 3300026118 Ga0207675_100077104 Ga0207675_1000771042 430
1181 3300026118 Ga0207675_100376634 Ga0207675_1003766341 430
1182 3300026121 Ga0207683_10043864 Ga0207683_100438643 430
1183 3300027512 Ga0209179_1004665 Ga0209179_10046651 430
1184 3300027671 Ga0209588_1004526 Ga0209588_10045264 430
1185 3300028379 Ga0268266_10058109 Ga0268266_100581092 430
1186 3300028380 Ga0268265_10008419 Ga0268265_100084191 430
1187 3300028380 Ga0268265_10027002 Ga0268265_100270022 430
1188 3300028381 Ga0268264_10000162 Ga0268264_1000016287 430
1189 3300028381 Ga0268264_10003345 Ga0268264_1000334513 430
1190 3300028381 Ga0268264_10023769 Ga0268264_100237693 430
1191 3300028381 Ga0268264_10039768 Ga0268264_100397682 430
1192 3300028381 Ga0268264_10108822 Ga0268264_101088222 430
1193 3300028381 Ga0268264_10117309 Ga0268264_101173092 430
1194 3300028653 Ga0265323_10002402 Ga0265323_100024029 430
1195 3300028666 Ga0265336_10000443 Ga0265336_1000044311 430
1196 3300028800 Ga0265338_10001194 Ga0265338_1000119427 430
1197 3300031249 Ga0265339_10003343 Ga0265339_1000334311 430
1198 3300031344 Ga0265316_10131217 Ga0265316_101312172 430
1199 3300031456 Ga0307513_10084490 Ga0307513_100844902 430
1200 3300031507 Ga0307509_10033205 Ga0307509_100332054 430
1201 3300031507 Ga0307509_10232821 Ga0307509_102328211 430
1202 3300035111 Ga0373923_0041798 Ga0373923_0041798_301_1641 430
1203 3300035113 Ga0373936_0039797 Ga0373936_0039797_458_1798 430
1204 3300035116 Ga0373945_0007800 Ga0373945_0007800_1631_2923 430
1205 3300035116 Ga0373945_0053648 Ga0373945_0053648_137_1474 430
1206 3300035117 Ga0373953_0009137 Ga0373953_0009137_456_1796 430
1207 3300035118 Ga0373954_0003873 Ga0373954_0003873_4955_6295 430
1208 3300035119 Ga0373956_0007433 Ga0373956_0007433_2031_3371 430
1209 3300035120 Ga0373957_0003550 Ga0373957_0003550_555_1895 430
1210 3300035170 Ga0373943_0003064 Ga0373943_0003064_6207_7547 430
1211 3300035170 Ga0373943_0012722 Ga0373943_0012722_2293_3585 430
1212 3300035171 Ga0373946_0001574 Ga0373946_0001574_5852_7192 430
1213 3300035172 Ga0373955_0006580 Ga0373955_0006580_925_2265 430
1214 3300035172 Ga0373955_0018941 Ga0373955_0018941_1016_2308 430
1215 3300035410 Ga0373924_0040288 Ga0373924_0040288_407_1747 430
1216 3300035692 Ga0373935_0000468 Ga0373935_0000468_9632_10972 430
1217 3300035692 Ga0373935_0017306 Ga0373935_0017306_1755_3047 430
1218 3300035692 Ga0373935_0057971 Ga0373935_0057971_731_2071 430
1219 3300035692 Ga0373935_0111111 Ga0373935_0111111_366_1706 430
1220 3300035695 Ga0373927_0000801 Ga0373927_0000801_5269_6609 430
1221 3300035695 Ga0373927_0029396 Ga0373927_0029396_1602_2894 430
1222 3300035724 Ga0373933_0006978 Ga0373933_0006978_4135_5475 430
1223 3300035724 Ga0373933_0067689 Ga0373933_0067689_104_1444 430
1224 3300035725 Ga0373947_0004970 Ga0373947_0004970_6279_7619 430
1225 3300035725 Ga0373947_0008677 Ga0373947_0008677_410_1702 430
1226 3300036401 Ga0373937_0013442 Ga0373937_0013442_1704_3044 430
1227 3300037068 Ga0373925_0005078 Ga0373925_0005078_5314_6606 430
1228 3300037068 Ga0373925_0066373 Ga0373925_0066373_622_1965 430
1229 3300037312 Ga0395899_0035966 Ga0395899_0035966_2073_3413 430
1230 3300037418 Ga0395900_0010114 Ga0395900_0010114_585_1925 430
1231 3300037466 Ga0395898_0120358 Ga0395898_0120358_702_2045 430
1232 3300037466 Ga0395898_0177688 Ga0395898_0177688_635_1975 430
1233 3300037471 Ga0395905_0002573 Ga0395905_0002573_8393_9685 430
1234 3300037471 Ga0395905_0209939 Ga0395905_0209939_359_1651 430
1235 3300038443 Ga0395901_0002009 Ga0395901_0002009_16199_17539 430
1236 3300039450 Ga0436363_1263636 Ga0436363_1263636_2727_4064 430
1237 3300039453 Ga0436362_0446479 Ga0436362_0446479_3332_4624 430
1238 3300041452 Ga0451793_0230553 Ga0451793_0230553_378_1670 430
1239 3300042436 Ga0439435_0026053 Ga0439435_0026053_168_1508 430
1240 3300044656 Ga0466969_0026253 Ga0466969_0026253_1030_2322 430
1241 3300044658 Ga0466972_0000238 Ga0466972_0000238_10900_12192 430
1242 3300044658 Ga0466972_0000728 Ga0466972_0000728_7415_8707 430
1243 3300044683 Ga0466965_0011418 Ga0466965_0011418_488_1795 430
1244 3300044684 Ga0466966_0009776 Ga0466966_0009776_2654_3946 430
1245 3300044693 Ga0466961_0000007 Ga0466961_0000007_107439_108731 430
1246 3300044693 Ga0466961_0114167 Ga0466961_0114167_110_1651 430
1247 3300044735 Ga0466968_0000531 Ga0466968_0000531_6074_7366 430
1248 3300045049 Ga0466959_0006767 Ga0466959_0006767_904_2196 430
1249 3300045049 Ga0466959_0022085 Ga0466959_0022085_558_2099 430
1250 3300045049 Ga0466959_0164384 Ga0466959_0164384_49_1392 430
1251 3300045976 Ga0466967_0100148 Ga0466967_0100148_558_1850 430
1252 3300046454 Ga0495592_0009635 Ga0495592_0009635_5382_6722 430
1253 3300046454 Ga0495592_0135214 Ga0495592_0135214_204_1544 430
1254 3300046455 Ga0495603_0000076 Ga0495603_0000076_23799_25139 430
1255 3300046455 Ga0495603_0000298 Ga0495603_0000298_3988_5280 430
1256 3300046455 Ga0495603_0001807 Ga0495603_0001807_6283_7623 430
1257 3300046457 Ga0495590_0023171 Ga0495590_0023171_669_1961 430
1258 3300046459 Ga0495629_0000087 Ga0495629_0000087_63661_65001 430
1259 3300046459 Ga0495629_0000336 Ga0495629_0000336_34716_36008 430
1260 3300046459 Ga0495629_0031544 Ga0495629_0031544_1869_3209 430
1261 3300046460 Ga0495638_0004997 Ga0495638_0004997_6120_7412 430
1262 3300046461 Ga0495641_0005191 Ga0495641_0005191_2458_3750 430
1263 3300046462 Ga0495651_0016316 Ga0495651_0016316_2836_4176 430
1264 3300046462 Ga0495651_0032043 Ga0495651_0032043_2283_3575 430
1265 3300046463 Ga0495653_0013726 Ga0495653_0013726_1494_2834 430
1266 3300046472 Ga0495580_0000735 Ga0495580_0000735_8389_9729 430
1267 3300046472 Ga0495580_0003367 Ga0495580_0003367_4136_5428 430
1268 3300046473 Ga0495582_0000101 Ga0495582_0000101_17366_18706 430
1269 3300046473 Ga0495582_0000134 Ga0495582_0000134_34383_35675 430
1270 3300046475 Ga0495639_0000022 Ga0495639_0000022_1674_3014 430
1271 3300046475 Ga0495639_0001106 Ga0495639_0001106_4392_5684 430
1272 3300046476 Ga0495662_0000460 Ga0495662_0000460_9269_10609 430
1273 3300046476 Ga0495662_0001392 Ga0495662_0001392_3940_5232 430
1274 3300046477 Ga0495664_0010312 Ga0495664_0010312_1530_2870 430
1275 3300046477 Ga0495664_0017317 Ga0495664_0017317_295_1635 430
1276 3300046477 Ga0495664_0024065 Ga0495664_0024065_1851_3143 430
1277 3300046477 Ga0495664_0080243 Ga0495664_0080243_595_1935 430
1278 3300046491 Ga0495584_0061733 Ga0495584_0061733_106_1398 430
1279 3300046499 Ga0495594_0000176 Ga0495594_0000176_25303_26643 430
1280 3300046499 Ga0495594_0001316 Ga0495594_0001316_4164_5456 430
1281 3300046511 Ga0495608_0009651 Ga0495608_0009651_1980_3320 430
1282 3300046516 Ga0495628_0023257 Ga0495628_0023257_1899_3239 430
1283 3300046516 Ga0495628_0036847 Ga0495628_0036847_2599_3891 430
1284 3300046516 Ga0495628_0067721 Ga0495628_0067721_300_1592 430
1285 3300046516 Ga0495628_0153080 Ga0495628_0153080_386_1678 430
1286 3300046517 Ga0495630_0010164 Ga0495630_0010164_867_2159 430
1287 3300046522 Ga0495643_0092925 Ga0495643_0092925_144_1436 430
1288 3300046529 Ga0495652_0009267 Ga0495652_0009267_1299_2639 430
1289 3300046531 Ga0495665_0000064 Ga0495665_0000064_12778_14118 430
1290 3300046531 Ga0495665_0005050 Ga0495665_0005050_3349_4641 430
1291 3300046533 Ga0495640_0016218 Ga0495640_0016218_2702_4042 430
1292 3300046533 Ga0495640_0074143 Ga0495640_0074143_881_2173 430
1293 3300046536 Ga0495587_0012587 Ga0495587_0012587_2300_3640 430
1294 3300046543 Ga0495645_0004431 Ga0495645_0004431_7826_9166 430
1295 3300046543 Ga0495645_0030408 Ga0495645_0030408_1207_2547 430
1296 3300046557 Ga0495622_0005549 Ga0495622_0005549_3381_4673 430
1297 3300046559 Ga0495667_0010132 Ga0495667_0010132_4775_6115 430
1298 3300046559 Ga0495667_0060668 Ga0495667_0060668_19_1311 430
1299 3300046616 Ga0495668_0049236 Ga0495668_0049236_704_2044 430
1300 3300046642 Ga0495634_0007620 Ga0495634_0007620_4000_5292 430
1301 3300046642 Ga0495634_0012312 Ga0495634_0012312_2294_3634 430
1302 3300046642 Ga0495634_0024752 Ga0495634_0024752_2523_3863 430
1303 3300046660 Ga0495625_0114002 Ga0495625_0114002_467_1759 430
1304 3300046663 Ga0495635_0001496 Ga0495635_0001496_11165_12505 430
1305 3300046663 Ga0495635_0010556 Ga0495635_0010556_4461_5801 430
1306 3300046663 Ga0495635_0030771 Ga0495635_0030771_996_2288 430
1307 3300046665 Ga0495661_0113893 Ga0495661_0113893_56_1393 430
1308 3300046674 Ga0495588_0013711 Ga0495588_0013711_440_1732 430
1309 3300046675 Ga0495657_0031437 Ga0495657_0031437_1861_3153 430
1310 3300046675 Ga0495657_0037019 Ga0495657_0037019_914_2254 430
1311 3300046678 Ga0495599_0003798 Ga0495599_0003798_154_1494 430
1312 3300046678 Ga0495599_0045639 Ga0495599_0045639_1181_2473 430
1313 3300046679 Ga0495623_0005956 Ga0495623_0005956_1689_3029 430
1314 3300046679 Ga0495623_0085831 Ga0495623_0085831_224_1567 430
1315 3300046680 Ga0495646_0008942 Ga0495646_0008942_4196_5536 430
1316 3300046681 Ga0495647_0015228 Ga0495647_0015228_878_2170 430
1317 3300046683 Ga0495658_0000683 Ga0495658_0000683_5684_7024 430
1318 3300046683 Ga0495658_0025843 Ga0495658_0025843_1367_2659 430
1319 3300046689 Ga0495613_0037705 Ga0495613_0037705_28_1320 430
1320 3300046689 Ga0495613_0039134 Ga0495613_0039134_2095_3435 430
1321 3300046690 Ga0495624_0006443 Ga0495624_0006443_2733_4025 430
1322 3300046690 Ga0495624_0007443 Ga0495624_0007443_36_1376 430
1323 3300046809 Ga0495600_0020623 Ga0495600_0020623_1576_2916 430
1324 3300046809 Ga0495600_0035649 Ga0495600_0035649_1494_2786 430
1325 3300047315 Ga0495581_0000072 Ga0495581_0000072_34392_35684 430
1326 3300047315 Ga0495581_0000139 Ga0495581_0000139_3423_4763 430
1327 3300047317 Ga0495604_0009620 Ga0495604_0009620_1845_3185 430
1328 3300047317 Ga0495604_0039436 Ga0495604_0039436_2186_3478 430
1329 3300047319 Ga0495674_0000523 Ga0495674_0000523_18044_19384 430
1330 3300047319 Ga0495674_0005593 Ga0495674_0005593_5550_6890 430
1331 3300047319 Ga0495674_0008405 Ga0495674_0008405_6206_7498 430
1332 3300047320 Ga0495672_0016998 Ga0495672_0016998_689_2029 430
1333 3300047321 Ga0495676_0045413 Ga0495676_0045413_204_1499 430
1334 3300047322 Ga0495680_0013168 Ga0495680_0013168_2852_4192 430
1335 3300047322 Ga0495680_0031385 Ga0495680_0031385_1667_2959 430
1336 3300047322 Ga0495680_0109442 Ga0495680_0109442_747_2039 430
1337 3300047444 Ga0495675_0004139 Ga0495675_0004139_4703_6043 430
1338 3300047471 Ga0495684_0028162 Ga0495684_0028162_807_2099 430
1339 3300047673 Ga0495593_0000042 Ga0495593_0000042_8262_9602 430
1340 3300047673 Ga0495593_0000094 Ga0495593_0000094_34380_35672 430
1341 3300048088 Ga0495602_0007342 Ga0495602_0007342_5310_6650 430
1342 3300048089 Ga0495614_0021380 Ga0495614_0021380_981_2321 430
1343 3300048903 Ga0496100_0111092 Ga0496100_0111092_470_1807 430
1344 3300048904 Ga0496101_0019246 Ga0496101_0019246_34_1374 430
1345 3300048904 Ga0496101_0077398 Ga0496101_0077398_427_1767 430
1346 3300048904 Ga0496101_0094017 Ga0496101_0094017_41_1378 430
1347 3300048905 Ga0496102_0031856 Ga0496102_0031856_681_2018 430
1348 3300048905 Ga0496102_0089138 Ga0496102_0089138_192_1529 430
1349 3300048905 Ga0496102_0175760 Ga0496102_0175760_329_1621 430
1350 3300048905 Ga0496102_0213020 Ga0496102_0213020_204_1544 430
1351 3300048906 Ga0496103_0044178 Ga0496103_0044178_598_1905 430
1352 3300048906 Ga0496103_0116851 Ga0496103_0116851_122_1414 430
1353 3300048907 Ga0496104_0003135 Ga0496104_0003135_1136_2476 430
1354 3300048907 Ga0496104_0037046 Ga0496104_0037046_1636_2928 430
1355 3300048907 Ga0496104_0097007 Ga0496104_0097007_1022_2365 430
1356 3300048907 Ga0496104_0157241 Ga0496104_0157241_763_2103 430
1357 3300048908 Ga0496105_0168430 Ga0496105_0168430_53_1396 430
1358 3300048909 Ga0496106_0037139 Ga0496106_0037139_323_1663 430
1359 3300048909 Ga0496106_0079272 Ga0496106_0079272_452_1795 430
1360 3300048910 Ga0496107_0064733 Ga0496107_0064733_14_1354 430
1361 3300048911 Ga0496108_0023873 Ga0496108_0023873_1379_2719 430
1362 3300048911 Ga0496108_0192153 Ga0496108_0192153_194_1486 430
1363 3300048912 Ga0496109_0014967 Ga0496109_0014967_5031_6371 430
1364 3300048912 Ga0496109_0054017 Ga0496109_0054017_62_1402 430
1365 3300048912 Ga0496109_0113482 Ga0496109_0113482_955_2247 430
1366 3300048912 Ga0496109_0131890 Ga0496109_0131890_406_1749 430
1367 3300048912 Ga0496109_0132733 Ga0496109_0132733_530_1867 430
1368 3300048913 Ga0496110_0007058 Ga0496110_0007058_3581_4921 430
1369 3300048913 Ga0496110_0045039 Ga0496110_0045039_2114_3406 430
1370 3300048913 Ga0496110_0053222 Ga0496110_0053222_1337_2629 430
1371 3300048914 Ga0496111_0051182 Ga0496111_0051182_631_1971 430
1372 3300048914 Ga0496111_0225133 Ga0496111_0225133_91_1383 430
1373 3300048915 Ga0496112_0005306 Ga0496112_0005306_620_1963 430
1374 3300048915 Ga0496112_0013677 Ga0496112_0013677_4535_5875 430
1375 3300048915 Ga0496112_0056255 Ga0496112_0056255_1999_3339 430
1376 3300048915 Ga0496112_0199172 Ga0496112_0199172_595_1932 430
1377 3300048916 Ga0496113_0000751 Ga0496113_0000751_37_1377 430
1378 3300048916 Ga0496113_0051573 Ga0496113_0051573_468_1811 430
1379 3300048917 Ga0496114_0205568 Ga0496114_0205568_341_1681 430
1380 3300048918 Ga0496115_0017758 Ga0496115_0017758_3562_4902 430
1381 3300048918 Ga0496115_0196223 Ga0496115_0196223_163_1500 430
1382 3300048920 Ga0496117_0115943 Ga0496117_0115943_84_1376 430
1383 3300048923 Ga0496120_0054003 Ga0496120_0054003_860_2152 430
1384 3300048924 Ga0496121_0026727 Ga0496121_0026727_3857_5263 430
1385 3300048924 Ga0496121_0059454 Ga0496121_0059454_905_2254 430
1386 3300048927 Ga0496124_0017261 Ga0496124_0017261_261_1601 430
1387 3300048927 Ga0496124_0089563 Ga0496124_0089563_842_2182 430
1388 3300048928 Ga0496125_0007099 Ga0496125_0007099_28_1320 430
1389 3300048929 Ga0496126_0016460 Ga0496126_0016460_2035_3327 430
1390 3300048929 Ga0496126_0046793 Ga0496126_0046793_2443_3945 430
1391 3300048929 Ga0496126_0059880 Ga0496126_0059880_436_1776 430
1392 3300048929 Ga0496126_0094303 Ga0496126_0094303_677_2014 430
1393 3300048929 Ga0496126_0129303 Ga0496126_0129303_611_1951 430
1394 3300049571 Ga0501034_0042095 Ga0501034_0042095_850_2190 430
1395 3300049575 Ga0501039_0050696 Ga0501039_0050696_1173_2513 430
1396 3300049585 Ga0501069_0054953 Ga0501069_0054953_184_1524 430
1397 3300049742 Ga0501080_0323418 Ga0501080_0323418_34_1359 430
1398 3300049744 Ga0501083_0082828 Ga0501083_0082828_615_1940 430
1399 3300050489 nmdc:mga03683_9878_c1 nmdc:mga03683_9878_c1_466_1803 430
1400 3300050492 nmdc:mga0yw44_44903_c1 nmdc:mga0yw44_44903_c1_522_1814 430
1401 3300050493 nmdc:mga0k408_86760_c1 nmdc:mga0k408_86760_c1_226_1518 430
1402 3300050494 nmdc:mga06z11_53640_c1 nmdc:mga06z11_53640_c1_180_1523 430
1403 3300050508 nmdc:mga09592_227968_c1 nmdc:mga09592_227968_c1_215_1555 430
1404 3300050511 nmdc:mga08y16_27939_c1 nmdc:mga08y16_27939_c1_395_1702 430
1405 3300050514 nmdc:mga08x19_10352_c1 nmdc:mga08x19_10352_c1_3427_4770 430
1406 3300050516 nmdc:mga0sz30_54497_c1 nmdc:mga0sz30_54497_c1_189_1481 430
1407 3300053077 Ga0495601_0007154 Ga0495601_0007154_4238_5578 430
1408 3300053077 Ga0495601_0065471 Ga0495601_0065471_709_2046 430
1409 3300053078 Ga0495612_0001490 Ga0495612_0001490_3317_4657 430
1410 3300053078 Ga0495612_0008254 Ga0495612_0008254_1697_3037 430
1411 3300053085 Ga0495619_0047977 Ga0495619_0047977_1243_2583 430
1412 3300053086 Ga0500578_0064433 Ga0500578_0064433_891_2183 430
1413 3300053086 Ga0500578_0067858 Ga0500578_0067858_337_1629 430
1414 3300053087 Ga0500643_000056 Ga0500643_000056_101719_103011 430
1415 3300053093 Ga0500651_0037501 Ga0500651_0037501_600_1892 430
1416 3300053094 Ga0500566_0000031 Ga0500566_0000031_49914_51254 430
1417 3300053094 Ga0500566_0000189 Ga0500566_0000189_15592_16884 430
1418 3300053095 Ga0500640_008340 Ga0500640_008340_614_1954 430
1419 3300053098 Ga0500650_0089459 Ga0500650_0089459_80_1372 430
1420 3300053103 Ga0500555_000978 Ga0500555_000978_7821_9113 430
1421 3300053104 Ga0500556_0006746 Ga0500556_0006746_810_2102 430
1422 3300053105 Ga0500557_000002 Ga0500557_000002_72_1364 430
1423 3300053108 Ga0500562_004486 Ga0500562_004486_1788_3080 430
1424 3300053111 Ga0500572_000108 Ga0500572_000108_17746_19086 430
1425 3300053119 Ga0500595_000131 Ga0500595_000131_1710_3050 430
1426 3300053119 Ga0500595_007986 Ga0500595_007986_2225_3784 430
1427 3300053123 Ga0500614_004573 Ga0500614_004573_1516_2856 430
1428 3300053130 Ga0500642_0000266 Ga0500642_0000266_1634_2926 430
1429 3300053136 Ga0500559_0006373 Ga0500559_0006373_1459_2799 430
1430 3300053136 Ga0500559_0038432 Ga0500559_0038432_529_1821 430
1431 3300053148 Ga0500590_080985 Ga0500590_080985_221_1513 430
1432 3300053150 Ga0500603_000160 Ga0500603_000160_11186_12526 430
1433 3300053150 Ga0500603_002161 Ga0500603_002161_1756_3093 430
1434 3300053153 Ga0500616_0006319 Ga0500616_0006319_5046_6386 430
1435 3300053154 Ga0500619_028103 Ga0500619_028103_95_1387 430
1436 3300053156 Ga0500622_0009192 Ga0500622_0009192_2977_4269 430
1437 3300053159 Ga0500630_000427 Ga0500630_000427_1937_3277 430
1438 3300053163 Ga0500639_000008 Ga0500639_000008_133580_134920 430
1439 3300053177 Ga0500636_0000836 Ga0500636_0000836_5319_6611 430
1440 3300053178 Ga0500637_0000086 Ga0500637_0000086_30525_31865 430
1441 3300053178 Ga0500637_0000260 Ga0500637_0000260_1756_3093 430
1442 3300053178 Ga0500637_0039628 Ga0500637_0039628_802_2142 430
1443 3300053729 Ga0500625_018517 Ga0500625_018517_42_1334 430
1444 3300053731 Ga0500609_000673 Ga0500609_000673_2996_4288 430
1445 3300053735 Ga0500596_008474 Ga0500596_008474_31_1371 430
1446 3300053736 Ga0500599_000229 Ga0500599_000229_3901_5193 430
1447 3300053737 Ga0500601_000566 Ga0500601_000566_1894_3186 430
1448 3300054114 Ga0501084_0203440 Ga0501084_0203440_232_1572 430
1449 3300055283 Ga0500661_000107 Ga0500661_000107_2162_3502 430
1450 iso_pu_bacteria 2507262055 2507509037 430
1451 iso_pu_bacteria 2508501009 2508543121 430
1452 iso_pu_bacteria 2508501042 2508691127 430
1453 iso_pu_bacteria 2508501128 2509146663 430
1454 iso_pu_bacteria 2508501128 2509151760 430
1455 iso_pu_bacteria 2511231028 2511393368 430
1456 iso_pu_bacteria 2513237092 2513624402 430
1457 iso_pu_bacteria 2513237095 2513650153 430
1458 iso_pu_bacteria 2513237096 2513654409 430
1459 iso_pu_bacteria 2513237098 2513673969 430
1460 iso_pu_bacteria 2513237098 2513676547 430
1461 iso_pu_bacteria 2513237101 2513692139 430
1462 iso_pu_bacteria 2513237102 2513703125 430
1463 iso_pu_bacteria 2513237104 2513718066 430
1464 iso_pu_bacteria 2513237137 2513859205 430
1465 iso_pu_bacteria 2513237139 2513872389 430
1466 iso_pu_bacteria 2513237141 2513887490 430
1467 iso_pu_bacteria 2513237141 2513893513 430
1468 iso_pu_bacteria 2513237145 2513915412 430
1469 iso_pu_bacteria 2513237161 2514014116 430
1470 iso_pu_bacteria 2515154112 2515626468 430
1471 iso_pu_bacteria 2517093001 2517101659 430
1472 iso_pu_bacteria 2517572143 2517892726 430
1473 iso_pu_bacteria 2524023205 2524436895 430
1474 iso_pu_bacteria 2524023210 2524464581 430
1475 iso_pu_bacteria 2524023228 2524538114 430
1476 iso_pu_bacteria 2528768022 2528850093 430
1477 iso_pu_bacteria 2617270735 2617351446 430
1478 iso_pu_bacteria 2617270741 2617376164 430
1479 iso_pu_bacteria 2667528175 2671117436 430
1480 iso_pu_bacteria 2721755755 2723845489 430
1481 iso_pu_bacteria 2728368998 2728748598 430
1482 iso_pu_bacteria 2744054633 2745080164 430
1483 iso_pu_bacteria 2791355196 2793063751 430
1484 iso_pu_bacteria 2791355197 2793068269 430
1485 iso_pu_bacteria 2791355199 2793083324 430
1486 iso_pu_bacteria 2802429603 2805918007 430
1487 iso_pu_bacteria 2816332527 2818243105 430
1488 iso_pu_bacteria 2824600985 2824608339 430
1489 iso_pu_bacteria 2824609381 2824616268 430
1490 iso_pu_bacteria 2824617872 2824625680 430
1491 iso_pu_bacteria 2824626560 2824631339 430
1492 iso_pu_bacteria 2824635225 2824641810 430
1493 iso_pu_bacteria 2824644064 2824649088 430
1494 iso_pu_bacteria 2824653114 2824660025 430
1495 iso_pu_bacteria 2824671348 2824677453 430
1496 iso_pu_bacteria 2824687955 2824693940 430
1497 iso_pu_bacteria 2824696289 2824702142 430
1498 iso_pu_bacteria 2824704595 2824710608 430
1499 iso_pu_bacteria 2824714736 2824720691 430
1500 iso_pu_bacteria 2824723954 2824729355 430
1501 iso_pu_bacteria 2824732956 2824738016 430
1502 iso_pu_bacteria 2824746037 2824752946 430
1503 iso_pu_bacteria 2824753945 2824757273 430
1504 iso_pu_bacteria 2824763712 2824766871 430
1505 iso_pu_bacteria 2824773399 2824776403 430
1506 iso_pu_bacteria 2838122688 2838126193 430
1507 iso_pu_bacteria 2841941048 2841943718 430
1508 iso_pu_bacteria 2841949485 2841950268 430
1509 iso_pu_bacteria 2841957949 2841958298 430
1510 iso_pu_bacteria 2841966195 2841966647 430
1511 iso_pu_bacteria 2841974524 2841975406 430
1512 iso_pu_bacteria 2841983080 2841988455 430
1513 iso_pu_bacteria 2842038055 2842039461 430
1514 iso_pu_bacteria 2842045827 2842047593 430
1515 iso_pu_bacteria 2844315083 2844318676 430
1516 iso_pu_bacteria 2847930680 2847935784 430
1517 iso_pu_bacteria 2847939898 2847946173 430
1518 iso_pu_bacteria 2849076700 2849079684 430
1519 iso_pu_bacteria 2857509624 2857513891 430
1520 iso_pu_bacteria 2874590934 2874597173 430
1521 iso_pu_bacteria 2874604998 2874607619 430
1522 iso_pu_bacteria 2874612657 2874616186 430
1523 iso_pu_bacteria 2874620515 2874627493 430
1524 iso_pu_bacteria 2874628541 2874629734 430
1525 iso_pu_bacteria 2874645413 2874645540 430
1526 iso_pu_bacteria 2876761206 2876764714 430
1527 iso_pu_bacteria 2876761206 2876767373 430
1528 iso_pu_bacteria 2876771140 2876771355 430
1529 iso_pu_bacteria 2876808645 2876813002 430
1530 iso_pu_bacteria 2876818435 2876818662 430
1531 iso_pu_bacteria 2879074833 2879075126 430
1532 iso_pu_bacteria 2879083081 2879085172 430
1533 iso_pu_bacteria 2879099564 2879100932 430
1534 iso_pu_bacteria 2879110137 2879115357 430
1535 iso_pu_bacteria 2879127579 2879127683 430
1536 iso_pu_bacteria 2879142872 2879143195 430
1537 iso_pu_bacteria 2881364244 2881366981 430
1538 iso_pu_bacteria 2881665667 2881666384 430
1539 iso_pu_bacteria 2885366525 2885372124 430
1540 iso_pu_bacteria 2885374607 2885377001 430
1541 iso_pu_bacteria 2885383462 2885385262 430
1542 iso_pu_bacteria 2885409591 2885417675 430
1543 iso_pu_bacteria 2888378607 2888383659 430
1544 iso_pu_bacteria 2888419890 2888424075 430
1545 iso_pu_bacteria 2889033259 2889040262 430
1546 iso_pu_bacteria 2903727486 2903728785 430
1547 iso_pu_bacteria 2903748898 2903756251 430
1548 iso_pu_bacteria 2903768456 2903773406 430
1549 iso_pu_bacteria 2904666416 2904670989 430
1550 iso_pu_bacteria 2904699407 2904702856 430
1551 iso_pu_bacteria 2904711408 2904717489 430
1552 iso_pu_bacteria 2906602504 2906604495 430
1553 iso_pu_bacteria 2906610324 2906618270 430
1554 iso_pu_bacteria 2906626472 2906629161 430
1555 iso_pu_bacteria 2906635258 2906643270 430
1556 iso_pu_bacteria 2906643746 2906650923 430
1557 iso_pu_bacteria 2906660503 2906664348 430
1558 iso_pu_bacteria 2908739725 2908743084 430
1559 iso_pu_bacteria 2908775508 2908779713 430
1560 iso_pu_bacteria 2922361189 2922368163 430
1561 iso_pu_bacteria 2922368715 2922373878 430
1562 iso_pu_bacteria 2922386360 2922388365 430
1563 iso_pu_bacteria 2922393267 2922399604 430
1564 iso_pu_bacteria 2922425934 2922429820 430
1565 iso_pu_bacteria 2929615660 2929617585 430
1566 iso_pu_bacteria 2929624759 2929627290 430
1567 iso_pu_bacteria 2932784394 2932787369 430
1568 iso_pu_bacteria 2932794094 2932798512 430
1569 iso_pu_bacteria 2932801729 2932803190 430
1570 iso_pu_bacteria 2932809354 2932815177 430
1571 iso_pu_bacteria 2932818245 2932820625 430
1572 iso_pu_bacteria 2932828146 2932831676 430
1573 iso_pu_bacteria 2933577622 2933579541 430
1574 iso_pu_bacteria 2935608549 2935612088 430
1575 iso_pu_bacteria 2935616580 2935622272 430
1576 iso_pu_bacteria 2935630451 2935633452 430
1577 iso_pu_bacteria 2935638405 2935642911 430
1578 iso_pu_bacteria 2935648319 2935649682 430
1579 iso_pu_bacteria 2935656913 2935658803 430
1580 iso_pu_bacteria 2935665750 2935668012 430
1581 iso_pu_bacteria 2935675223 2935678916 430
1582 iso_pu_bacteria 2935684952 2935688760 430
1583 iso_pu_bacteria 2935694250 2935696114 430
1584 iso_pu_bacteria 2935703347 2935706881 430
1585 iso_pu_bacteria 2935713505 2935715779 430
1586 iso_pu_bacteria 2935722832 2935725657 430
1587 iso_pu_bacteria 2935732158 2935738064 430
1588 iso_pu_bacteria 2935741537 2935747439 430
1589 iso_pu_bacteria 2935750917 2935753986 430
1590 iso_pu_bacteria 2935760218 2935762990 430
1591 iso_pu_bacteria 2935769743 2935772474 430
1592 iso_pu_bacteria 2935769743 2935777192 430
1593 iso_pu_bacteria 2935777560 2935782603 430
1594 iso_pu_bacteria 2935785616 2935791807 430
1595 iso_pu_bacteria 2935793552 2935799533 430
1596 iso_pu_bacteria 2935801545 2935808531 430
1597 iso_pu_bacteria 2935810662 2935812773 430
1598 iso_pu_bacteria 2935819856 2935821561 430
1599 iso_pu_bacteria 2935827899 2935830424 430
1600 iso_pu_bacteria 2935837841 2935840455 430
1601 iso_pu_bacteria 2935847175 2935850170 430
1602 iso_pu_bacteria 2935855204 2935860660 430
1603 iso_pu_bacteria 2935864058 2935865306 430
1604 iso_pu_bacteria 2935873716 2935877903 430
1605 iso_pu_bacteria 2935883170 2935887965 430
1606 iso_pu_bacteria 2935908558 2935914241 430
1607 iso_pu_bacteria 2935916978 2935924593 430
1608 iso_pu_bacteria 2935926038 2935931897 430
1609 iso_pu_bacteria 2935926038 2935932851 430
1610 iso_pu_bacteria 2935934488 2935940495 430
1611 iso_pu_bacteria 2935934488 2935941537 430
1612 iso_pu_bacteria 2935942939 2935948437 430
1613 iso_pu_bacteria 2935942939 2935949626 430
1614 iso_pu_bacteria 2935951376 2935957092 430
1615 iso_pu_bacteria 2935951376 2935958321 430
1616 iso_pu_bacteria 2935959822 2935960119 430
1617 iso_pu_bacteria 2935967501 2935973690 430
1618 iso_pu_bacteria 2935967501 2935974509 430
1619 iso_pu_bacteria 2935975950 2935977367 430
1620 iso_pu_bacteria 2935984226 2935988564 430
1621 iso_pu_bacteria 2935992306 2935996145 430
1622 iso_pu_bacteria 2936002035 2936006279 430
1623 iso_pu_bacteria 2936011229 2936012836 430
1624 iso_pu_bacteria 2936019824 2936021400 430
1625 iso_pu_bacteria 2936028420 2936030129 430
1626 iso_pu_bacteria 2936037263 2936041361 430
1627 iso_pu_bacteria 2936046547 2936047594 430
1628 iso_pu_bacteria 2936055302 2936057248 430
1629 iso_pu_bacteria 2940556831 2940560638 430
1630 iso_pu_bacteria 2941507105 2941510343 430
1631 iso_pu_bacteria 2941515067 2941517920 430
1632 iso_pu_bacteria 2941523033 2941525936 430
1633 iso_pu_bacteria 2941531003 2941534429 430
1634 iso_pu_bacteria 2941538514 2941541414 430
1635 iso_pu_bacteria 3005474847 3005479836 430
1636 iso_pu_bacteria 3005483717 3005486892 430
1637 iso_pu_bacteria 3005506211 3005509964 430
1638 iso_pu_bacteria 3005587118 3005593285 430
1639 iso_pu_bacteria 3005594810 3005598834 430
1640 iso_pu_bacteria 3005710791 3005714462 430
1641 iso_pu_bacteria 3005718088 3005721976 430
1642 iso_pu_bacteria 8006926726 8006933235 430
1643 iso_pu_bacteria 8006933436 8006940989 430
1644 iso_pu_bacteria 8006964411 8006970756 430
1645 iso_pu_bacteria 8006973647 8006980810 430
1646 iso_pu_bacteria 8006984368 8006985604 430
1647 iso_pu_bacteria 8006994254 8007000157 430
1648 iso_pu_bacteria 8006994254 8007000724 430
1649 iso_pu_bacteria 8006994254 8007000991 430
1650 iso_pu_bacteria 8016511872 8016513805 430
1651 iso_pu_bacteria 8016522445 8016530066 430
1652 iso_pu_bacteria 8016539877 8016548514 430
1653 iso_pu_bacteria 8016548790 8016553616 430
1654 iso_pu_bacteria 8016557553 8016561997 430
1655 iso_pu_bacteria 8016566248 8016573642 430
1656 iso_pu_bacteria 8016583857 8016592370 430
1657 iso_pu_bacteria 8016595262 8016599822 430
1658 iso_pu_bacteria 8016603502 8016611348 430
1659 iso_pu_bacteria 8016613128 8016613976 430
1660 iso_pu_bacteria 8016622563 8016627426 430
1661 iso_pu_bacteria 8016630954 8016631445 430
1662 iso_pu_bacteria 8017057580 8017062667 430
1663 iso_pu_bacteria 8019530166 8019535053 430
1664 iso_pu_bacteria 8019547302 8019554223 430
1665 iso_pu_bacteria 8019547302 8019554526 430
1666 iso_pu_bacteria 8019555841 8019557149 430
1667 iso_pu_bacteria 8019586578 8019589756 430
1668 iso_pu_bacteria 8019608314 8019617039 430
1669 iso_pu_bacteria 8019619141 8019627659 430
1670 iso_pu_bacteria 8019648815 8019657893 430
1671 iso_pu_bacteria 8019659431 8019662747 430
1672 iso_pu_bacteria 8019668869 8019672357 430
1673 iso_pu_bacteria 8019678201 8019683848 430
1674 iso_pu_bacteria 8019687851 8019689099 430
1675 iso_pu_bacteria 8019687851 8019689564 430
1676 iso_pu_bacteria 8055742211 8055746800 430
1677 iso_pu_bacteria 8056673599 8056674221 430
1678 iso_pu_bacteria 8056681323 8056685451 430
1679 iso_pu_bacteria 8056967851 8056973043 430

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

120

423

0.76

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

128

450

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
6dtr-assembly1.cif.gz_A apo t. maritima male3 0.8347 20 430
6dtr-assembly1.cif.gz_A apo t. maritima male3 0.8289 20 430
6wpn-assembly2.cif.gz_B crystal structure of a putative oligosaccharide periplasmic-binding protein from synechococcus sp. mits9220 0.8076 20 429
7nbz-assembly1.cif.gz_A crystal structure of ligand free open conformation of sulfoquinovosyl binding protein (sqbp) from agrobacterium tumefaciens 0.8071 20 429
7v09-assembly2.cif.gz_B crystal structure of ecl_rs08780, putative sugar transport system periplasmic sugar-binding protein 0.8028 20 430
ID Description Score Start End Superfamily
4rk9B01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8046 20 130 3.40.190.10
2gh9A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8045 23 352 3.40.190.10
af_P76042_18_428_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7895 4 428 3.40.190.10
af_P76042_18_428_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.786 4 428 3.40.190.10
1eu8A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7844 19 130 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A537J5U0-F1-model_v4 Extracellular solute-binding protein 0.9878 37 427
AF-M4ZU59-F1-model_v4 ABC transporter substrate-binding protein, periplasmic component 0.9832 6 430 GO:0042597
AF-A0A537WVK1-F1-model_v4 ABC transporter substrate-binding protein 0.9821 228 370 GO:0042597
AF-A0A537U2M9-F1-model_v4 Extracellular solute-binding protein 0.9809 89 430 GO:0042597
AF-M4ZU59-F1-model_v4 ABC transporter substrate-binding protein, periplasmic component 0.9809 6 430 GO:0042597

Feature Viewer

pLDDT pTM Quality
94.66 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map