F495288

General Info

Members Datasets Scaffolds Average Seq Length
1674 696 1487 210

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_0602091|Ga0436361_0602091_290_1003
Length 237
Sequence MKRRLEADMEPELNLPAPYTPHVGFVAAFGACRMIAIVRGIKPAEAVAHGRALYEAGFRIIEVPLNSPQPLDSIAALREALPEDAMIGAGTVLTTARVRDVREAGGEVIVMPHADIDVILAAKLQGLACVPGVATPTEAFAALGHGADALKMFPAEQLGPAVTKAWRAVIPPVVPLLPVGGVKPDNMGPQLAAGASGFGLGSALYKPGQDAAATRANALAFIEGWRVTQLGMHGAQK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
3 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
4 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
5 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
6 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
7 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
8 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
9 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
10 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
11 2511231004 Pseudomonas sp. GM102 Isolate Nodule
12 2511231010 Pseudomonas sp. GM25 Isolate Nodule
13 2511231011 Pseudomonas sp. GM30 Isolate Nodule
14 2511231012 Pseudomonas sp. GM33 Isolate Nodule
15 2511231015 Pseudomonas sp. GM49 Isolate Nodule
16 2511231016 Pseudomonas sp. GM50 Isolate Nodule
17 2511231017 Pseudomonas sp. GM55 Isolate Nodule
18 2511231018 Pseudomonas sp. GM60 Isolate Nodule
19 2511231019 Pseudomonas sp. GM67 Isolate Nodule
20 2511231020 Pseudomonas sp. GM74 Isolate Nodule
21 2511231022 Pseudomonas sp. GM79 Isolate Nodule
22 2511231023 Pseudomonas sp. GM80 Isolate Nodule
23 2511231031 Pseudomonas sp. GM16 Isolate Nodule
24 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
25 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
26 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
27 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
28 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
29 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
30 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
31 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
32 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
33 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
34 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
35 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
36 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
37 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
38 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
39 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
40 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
41 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
42 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
43 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
44 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
45 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
46 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
47 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
48 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
49 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
50 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
51 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
52 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
53 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
54 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
55 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
56 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
57 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
58 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
59 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
60 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
61 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
62 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
63 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
64 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
65 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
66 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
67 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
68 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
69 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
70 2643221570 Acidovorax sp. Root568 Isolate Unclassified
71 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
72 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
73 2643221596 Acidovorax sp. Root70 Isolate Unclassified
74 2643221609 Acidovorax sp. Root217 Isolate Unclassified
75 2643221611 Acidovorax sp. Root219 Isolate Unclassified
76 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
77 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
78 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
79 2643221717 Acidovorax sp. Root267 Isolate Unclassified
80 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
81 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
82 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
83 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
84 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
85 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
86 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
87 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
88 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
89 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
90 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
91 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
92 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
93 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
94 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
95 2739367700 Dyella sp. YR388 Isolate Unclassified
96 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
97 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
98 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
99 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
100 2773857673 Pseudomonas sp. 443 Isolate Unclassified
101 2784132063 Pseudomonas sp. 424 Isolate Unclassified
102 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
103 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
104 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
105 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
106 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
107 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
108 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
109 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
110 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
111 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
112 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
113 2818991436 Collimonas arenae 515 Isolate Unclassified
114 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
115 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
116 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
117 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
118 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
119 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
120 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
121 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
122 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
123 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
124 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
125 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
126 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
127 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
128 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
129 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
130 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
131 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
132 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
133 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
134 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
135 2884411467 Dyella sp. AD56 Isolate Rhizosphere
136 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
137 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
138 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
139 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
140 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
141 2904456579 Variovorax sp. 2002 Isolate Unclassified
142 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
143 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
144 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
145 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
146 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
147 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
148 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
149 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
150 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
151 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
152 2928963466 Dyella japonica 1073 Isolate Unclassified
153 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
154 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
155 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
156 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
157 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
158 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
159 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
160 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
161 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
162 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
163 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
164 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
165 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
166 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
167 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
168 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
169 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
170 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
171 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
172 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
173 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
174 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
175 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
176 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
177 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
178 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
179 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
180 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
181 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
182 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
183 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
184 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
185 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
186 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
187 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
188 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
189 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
190 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
191 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
192 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
193 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
194 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
195 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
196 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
197 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
198 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
199 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
200 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
201 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
202 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
203 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
204 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
205 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
206 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
207 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
208 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
209 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
210 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
211 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
212 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
213 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
214 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
215 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
216 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
217 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
218 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
219 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
220 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
221 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
222 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
223 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
224 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
225 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
226 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
227 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
228 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
229 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
230 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
231 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
232 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
233 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
234 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
235 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
236 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
237 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
238 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
239 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
240 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
241 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
242 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
243 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
244 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
245 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
246 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
247 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
248 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
249 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
250 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
251 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
252 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
253 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
254 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
255 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
256 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
257 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
258 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
259 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
260 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
261 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
262 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
263 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
264 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
265 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
266 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
267 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
268 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
269 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
270 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
271 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
272 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
273 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
274 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
275 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
276 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
277 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
278 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
279 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
280 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
281 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
282 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
283 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
284 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
285 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
286 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
287 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
288 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
289 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
290 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
291 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
292 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
293 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
294 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
295 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
296 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
297 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
298 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
299 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
300 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
301 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
302 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
303 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
304 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
305 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
306 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
307 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
308 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
309 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
310 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
311 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
312 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
313 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
314 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
315 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
316 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
317 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
318 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
319 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
320 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
321 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
322 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
323 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
324 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
325 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
326 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
327 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
328 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
329 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
330 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
331 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
332 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
333 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
334 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
335 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
336 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
337 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
338 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
339 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
340 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
341 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
342 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
343 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
344 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
345 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
346 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
347 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
348 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
349 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
350 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
351 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
352 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
353 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
354 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
355 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
356 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
357 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
358 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
359 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
360 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
361 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
362 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
363 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
364 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
365 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
366 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
400 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
402 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
403 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
404 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
405 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
406 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
407 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
408 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
409 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
410 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
411 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
412 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
413 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
414 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
415 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
416 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
417 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
418 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
419 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
420 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
421 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
422 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
423 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
424 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
425 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
426 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
427 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
428 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
429 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
430 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
431 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
432 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
433 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
434 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
435 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
436 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
437 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
438 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
439 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
440 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
441 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
442 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
443 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
444 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
445 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
446 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
447 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
448 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
449 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
450 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
451 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
452 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
453 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
454 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
455 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
456 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
457 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
458 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
459 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
460 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
461 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
462 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
463 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
464 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
465 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
466 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
467 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
468 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
469 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
470 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
471 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
472 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
473 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
474 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
475 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
476 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
477 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
478 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
479 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
480 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
481 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
482 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
483 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
484 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
485 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
486 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
487 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
488 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
489 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
490 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
491 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
492 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
493 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
494 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
495 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
496 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
497 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
498 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
499 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
500 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
501 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
502 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
503 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
504 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
505 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
506 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
507 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
508 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
509 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
510 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
511 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
512 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
513 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
514 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
515 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
516 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
517 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
518 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
519 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
520 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
521 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
522 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
523 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
524 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
525 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
526 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
527 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
528 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
529 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
530 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
531 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
532 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
533 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
534 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
535 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
536 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
537 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
538 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
539 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
540 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
541 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
542 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
543 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
544 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
545 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
546 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
547 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
548 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
549 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
550 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
551 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
552 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
553 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
554 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
555 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
556 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
557 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
558 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
559 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
560 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
561 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
562 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
563 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
564 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
565 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
566 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
567 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
568 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
569 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
570 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
571 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
572 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
573 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
574 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
575 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
576 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
577 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
578 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
579 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
580 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
581 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
582 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
583 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
584 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
585 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
586 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
587 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
588 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
589 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
590 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
591 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
592 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
593 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
594 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
595 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
596 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
597 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
598 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
599 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
600 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
601 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
602 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
603 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
604 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
605 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
606 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
607 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
608 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
609 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
610 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
611 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
612 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
613 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
614 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
615 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
616 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
617 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
618 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
619 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
620 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
621 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
622 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
623 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
624 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
625 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
626 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
627 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
628 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
629 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
630 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
631 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
632 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
633 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
634 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
635 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
636 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
637 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
638 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
639 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
640 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
641 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
642 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
643 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
644 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
645 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
646 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
647 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
648 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
649 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
650 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
651 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
652 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
653 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
654 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
655 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
656 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
657 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
658 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
659 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
660 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
661 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
662 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
663 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
664 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
665 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
666 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
667 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
668 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
669 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
670 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
671 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
672 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
673 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
674 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
675 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
676 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
677 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
678 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
679 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
680 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
681 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
682 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
683 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
684 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
685 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
686 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
687 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
688 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
689 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
690 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
691 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
692 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
693 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
694 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
695 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
696 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.65
Metatranscriptomes 0.18
Isolates 11.17

Biome Distribution

Category Percentage (%)
Aerial Root 0.12
Bulb 0
Endosphere 10.39
Nodule 1.14
Rhizoplane 3.58
Rhizosphere 72.7
Stem 0
Stem Tuber 0
Unclassified 12.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_656453 2162886007 Bacteria 2013
2 JGI24739J22299_10001818 3300001989 Bacteria 8134
3 JGI24737J22298_10091662 3300001990 Bacteria 901
4 JGI24735J21928_10000175 3300002067 Bacteria 22763
5 JGI24735J21928_10001426 3300002067 Bacteria 8447
6 JGI25162J39368_1000063 3300002737 Bacteria 134747
7 JGI25162J39368_1000287 3300002737 Bacteria 47192
8 JGI25158J39367_1004817 3300002739 Bacteria 2010
9 JGI25157J39369_1000217 3300002741 Bacteria 47210
10 JGI25157J39369_1008628 3300002741 Bacteria 1409
11 JGI25163J39215_1000677 3300002771 Bacteria 9056
12 JGI25163J39215_1002287 3300002771 Bacteria 2080
13 JGI25164J39214_1000672 3300002772 Bacteria 13810
14 JGI25164J39214_1004989 3300002772 Bacteria 1473
15 JGI25159J45721_1004581 3300002987 Bacteria 4548
16 JGI25151J46595_10000338 3300003187 Bacteria 50270
17 JGI25165J46597_1000069 3300003214 Bacteria 195460
18 JGI25165J46597_1000388 3300003214 Bacteria 47192
19 rootH1_10093753 3300003316 Bacteria 2008
20 rootH2_10007026 3300003320 Bacteria 3234
21 rootH2_10077057 3300003320 Bacteria 1527
22 rootL2_10039617 3300003322 Bacteria 3957
23 rootH1_10009337 3300003323 Bacteria 14683
24 rootH1_10071821 3300003323 Bacteria 3001
25 rootH1_10074923 3300003323 Bacteria 2899
26 rootH1_10105829 3300003323 Bacteria 2883
27 rootH1_10249875 3300003323 Bacteria 1124
28 JGI25161J50226_1000201 3300003374 Bacteria 39071
29 Ga0055538_1000034 3300003751 Bacteria 195460
30 Ga0055538_1004584 3300003751 Bacteria 1544
31 Ga0055539_1000044 3300003752 Bacteria 195460
32 Ga0055533_1000055 3300003756 Bacteria 195460
33 Ga0055525_1000066 3300003759 Bacteria 195460
34 Ga0055535_1000335 3300003761 Bacteria 47184
35 Ga0055535_1000978 3300003761 Bacteria 18662
36 Ga0055535_1019184 3300003761 Bacteria 873
37 Ga0055542_1000363 3300003762 Bacteria 47192
38 Ga0055542_1001209 3300003762 Bacteria 14546
39 Ga0055529_1000391 3300003763 Bacteria 47192
40 Ga0055529_1000610 3300003763 Bacteria 27246
41 Ga0055529_1000975 3300003763 Bacteria 14385
42 Ga0055529_1005226 3300003763 Bacteria 1897
43 Ga0055529_1015679 3300003763 Bacteria 955
44 Ga0055526_1000116 3300003771 Bacteria 70518
45 Ga0055526_1000487 3300003771 Bacteria 31529
46 Ga0055526_1006469 3300003771 Bacteria 6351
47 Ga0055537_1000035 3300003773 Bacteria 96274
48 Ga0055524_1021726 3300003775 Bacteria 2117
49 Ga0055524_1025753 3300003775 Bacteria 1834
50 Ga0055524_1053959 3300003775 Bacteria 885
51 Ga0055536_1000103 3300003781 Bacteria 73706
52 Ga0055536_1002169 3300003781 Bacteria 11186
53 Ga0055536_1041914 3300003781 Bacteria 1075
54 Ga0055534_1000104 3300003784 Bacteria 64767
55 Ga0055534_1000158 3300003784 Bacteria 50846
56 Ga0055534_1000325 3300003784 Bacteria 31562
57 Ga0055528_1000058 3300003790 Bacteria 88086
58 Ga0055530_10001374 3300003791 Bacteria 18030
59 Ga0055530_10007126 3300003791 Bacteria 4791
60 Ga0055540_1010062 3300003792 Bacteria 3184
61 Ga0055531_10006687 3300003794 Bacteria 6463
62 Ga0055531_10014117 3300003794 Bacteria 3623
63 Ga0055531_10023407 3300003794 Bacteria 2318
64 Ga0055531_10067287 3300003794 Bacteria 842
65 Ga0055541_1000032 3300003841 Bacteria 195460
66 Ga0058692_1000009 3300003856 Bacteria 349545
67 Ga0055543_1000103 3300004625 Bacteria 73828
68 Ga0065165_1000224 3300005262 Bacteria 99359
69 Ga0065165_1000854 3300005262 Bacteria 39869
70 Ga0065714_10007829 3300005288 Bacteria 3380
71 Ga0065714_10012581 3300005288 Bacteria 2772
72 Ga0065714_10069716 3300005288 Bacteria 4094
73 Ga0065704_10009257 3300005289 Bacteria 4670
74 Ga0065704_10118926 3300005289 Bacteria 1808
75 Ga0065704_10264331 3300005289 Bacteria 956
76 Ga0065712_10000132 3300005290 Bacteria 73390
77 Ga0065712_10090203 3300005290 Bacteria 2403
78 Ga0065707_10082092 3300005295 Bacteria 22240
79 Ga0070658_10014131 3300005327 Bacteria 6410
80 Ga0070658_10123076 3300005327 Bacteria 2156
81 Ga0070658_10173891 3300005327 Bacteria 1810
82 Ga0070676_10000184 3300005328 Bacteria 25832
83 Ga0070676_10016033 3300005328 Bacteria 4138
84 Ga0070676_10086903 3300005328 Bacteria 1908
85 Ga0070676_10155529 3300005328 Bacteria 1467
86 Ga0070683_100002328 3300005329 Bacteria 15073
87 Ga0070683_100031670 3300005329 Bacteria 4812
88 Ga0070683_100115303 3300005329 Bacteria 2536
89 Ga0070683_100140189 3300005329 Bacteria 2291
90 Ga0070683_100510519 3300005329 Bacteria 1149
91 Ga0070690_100096094 3300005330 Bacteria 1958
92 Ga0070670_100005054 3300005331 Bacteria 11101
93 Ga0070670_100026223 3300005331 Bacteria 5017
94 Ga0070670_100128471 3300005331 Bacteria 2187
95 Ga0070670_100265249 3300005331 Bacteria 1498
96 Ga0070677_10000379 3300005333 Bacteria 15666
97 Ga0070677_10022599 3300005333 Bacteria 2318
98 Ga0070677_10070743 3300005333 Bacteria 1467
99 Ga0068869_100028286 3300005334 Bacteria 3917
100 Ga0068869_100225786 3300005334 Bacteria 1486
101 Ga0070666_10012374 3300005335 Bacteria 5379
102 Ga0070680_100003334 3300005336 Bacteria 11980
103 Ga0070680_100124199 3300005336 Bacteria 2156
104 Ga0070680_100269382 3300005336 Bacteria 1442
105 Ga0070682_100003944 3300005337 Bacteria 8239
106 Ga0070682_100014112 3300005337 Bacteria 4613
107 Ga0068868_100002077 3300005338 Bacteria 13773
108 Ga0068868_100023967 3300005338 Bacteria 4625
109 Ga0068868_100026781 3300005338 Bacteria 4396
110 Ga0068868_100418855 3300005338 Bacteria 1159
111 Ga0068868_100647819 3300005338 Bacteria 940
112 Ga0070660_100001110 3300005339 Bacteria 18135
113 Ga0070660_100078997 3300005339 Bacteria 2581
114 Ga0070660_100114547 3300005339 Bacteria 2148
115 Ga0070661_100085612 3300005344 Bacteria 2329
116 Ga0070661_100120919 3300005344 Bacteria 1961
117 Ga0070668_100004033 3300005347 Bacteria 10859
118 Ga0070668_100060509 3300005347 Bacteria 2933
119 Ga0070668_100067315 3300005347 Bacteria 2782
120 Ga0070668_100094228 3300005347 Bacteria 2363
121 Ga0070668_100167475 3300005347 Bacteria 1787
122 Ga0070668_100275083 3300005347 Bacteria 1405
123 Ga0070668_100336190 3300005347 Bacteria 1275
124 Ga0070668_100410165 3300005347 Bacteria 1158
125 Ga0070669_100020760 3300005353 Bacteria 4692
126 Ga0070669_100136133 3300005353 Bacteria 1889
127 Ga0070669_100764828 3300005353 Bacteria 819
128 Ga0070675_100004329 3300005354 Bacteria 10827
129 Ga0070675_100010835 3300005354 Bacteria 7127
130 Ga0070675_100075645 3300005354 Bacteria 2799
131 Ga0070675_100251931 3300005354 Bacteria 1546
132 Ga0070675_100918528 3300005354 Bacteria 802
133 Ga0070671_100043865 3300005355 Bacteria 3716
134 Ga0070671_100049086 3300005355 Bacteria 3511
135 Ga0070671_100074400 3300005355 Bacteria 2838
136 Ga0070674_100006415 3300005356 Bacteria 6860
137 Ga0070674_100185045 3300005356 Bacteria 1598
138 Ga0070674_100228228 3300005356 Bacteria 1452
139 Ga0070673_100019406 3300005364 Bacteria 4879
140 Ga0070673_100021478 3300005364 Bacteria 4681
141 Ga0070673_100073974 3300005364 Bacteria 2744
142 Ga0070673_100087809 3300005364 Bacteria 2535
143 Ga0070688_100382213 3300005365 Bacteria 1038
144 Ga0070688_100832145 3300005365 Bacteria 724
145 Ga0070688_100844682 3300005365 Bacteria 719
146 Ga0070659_100062514 3300005366 Bacteria 2944
147 Ga0070659_100318943 3300005366 Bacteria 1299
148 Ga0070659_100548394 3300005366 Bacteria 989
149 Ga0070659_100770255 3300005366 Bacteria 836
150 Ga0070667_100018980 3300005367 Bacteria 5701
151 Ga0070667_100101645 3300005367 Bacteria 2484
152 Ga0070667_100153202 3300005367 Bacteria 2026
153 Ga0070667_100260558 3300005367 Bacteria 1552
154 Ga0070714_100601099 3300005435 Bacteria 1056
155 Ga0070713_100111919 3300005436 Bacteria 2381
156 Ga0070710_10021874 3300005437 Bacteria 3338
157 Ga0070711_100438177 3300005439 Bacteria 1068
158 Ga0070700_100798855 3300005441 Bacteria 760
159 Ga0070663_100013698 3300005455 Bacteria 5182
160 Ga0070663_100248073 3300005455 Bacteria 1408
161 Ga0070663_100403662 3300005455 Bacteria 1118
162 Ga0070663_100464896 3300005455 Bacteria 1045
163 Ga0070678_100342825 3300005456 Bacteria 1282
164 Ga0070678_100927899 3300005456 Bacteria 797
165 Ga0070662_100009714 3300005457 Bacteria 6296
166 Ga0070662_100029289 3300005457 Bacteria 3842
167 Ga0070662_100074443 3300005457 Bacteria 2512
168 Ga0070662_100264729 3300005457 Bacteria 1386
169 Ga0070662_100274238 3300005457 Bacteria 1363
170 Ga0070681_10211816 3300005458 Bacteria 1854
171 Ga0070681_10238260 3300005458 Bacteria 1733
172 Ga0070681_10308196 3300005458 Bacteria 1493
173 Ga0068867_100021598 3300005459 Bacteria 4595
174 Ga0070685_10031687 3300005466 Bacteria 2956
175 Ga0070685_10345998 3300005466 Bacteria 1015
176 Ga0070699_100470317 3300005518 Bacteria 1140
177 Ga0070679_100119972 3300005530 Bacteria 2615
178 Ga0070679_100153527 3300005530 Bacteria 2278
179 Ga0070679_100156262 3300005530 Bacteria 2255
180 Ga0070679_100225783 3300005530 Bacteria 1833
181 Ga0070679_100466101 3300005530 Bacteria 1208
182 Ga0070684_100001235 3300005535 Bacteria 18342
183 Ga0070684_100027746 3300005535 Bacteria 4782
184 Ga0070684_100057175 3300005535 Bacteria 3405
185 Ga0070684_100147827 3300005535 Bacteria 2128
186 Ga0070684_100218756 3300005535 Bacteria 1738
187 Ga0068853_100035810 3300005539 Bacteria 4218
188 Ga0070672_100024644 3300005543 Bacteria 4450
189 Ga0070672_100039537 3300005543 Bacteria 3614
190 Ga0070672_100083942 3300005543 Bacteria 2557
191 Ga0070672_100107480 3300005543 Bacteria 2270
192 Ga0070672_100113189 3300005543 Bacteria 2214
193 Ga0070672_100201041 3300005543 Bacteria 1666
194 Ga0070672_100318529 3300005543 Bacteria 1322
195 Ga0070672_100372234 3300005543 Bacteria 1221
196 Ga0070696_100186255 3300005546 Bacteria 1542
197 Ga0070693_100172707 3300005547 Bacteria 1386
198 Ga0070665_100012164 3300005548 Bacteria 8676
199 Ga0070665_100024403 3300005548 Bacteria 6089
200 Ga0070665_100459856 3300005548 Bacteria 1283
201 Ga0070665_100534549 3300005548 Bacteria 1184
202 Ga0070665_100560054 3300005548 Bacteria 1155
203 Ga0070665_100575002 3300005548 Bacteria 1139
204 Ga0068855_100003248 3300005563 Bacteria 19878
205 Ga0068855_100012376 3300005563 Bacteria 10305
206 Ga0068855_100051713 3300005563 Bacteria 4839
207 Ga0068855_100132342 3300005563 Bacteria 2847
208 Ga0068855_100183432 3300005563 Bacteria 2365
209 Ga0068855_100602645 3300005563 Bacteria 1184
210 Ga0070664_100055289 3300005564 Bacteria 3369
211 Ga0070664_100169074 3300005564 Bacteria 1939
212 Ga0070664_100178464 3300005564 Bacteria 1887
213 Ga0070664_100190283 3300005564 Bacteria 1828
214 Ga0070664_100418747 3300005564 Bacteria 1227
215 Ga0070664_100486035 3300005564 Bacteria 1137
216 Ga0068857_100008513 3300005577 Bacteria 8870
217 Ga0068857_100051007 3300005577 Bacteria 3670
218 Ga0068857_100063861 3300005577 Bacteria 3273
219 Ga0068857_100182706 3300005577 Bacteria 1909
220 Ga0068857_100365287 3300005577 Bacteria 1338
221 Ga0068854_100000699 3300005578 Bacteria 19878
222 Ga0068854_100001438 3300005578 Bacteria 14407
223 Ga0068854_100006866 3300005578 Bacteria 7259
224 Ga0068854_100162955 3300005578 Bacteria 1729
225 Ga0068854_100437129 3300005578 Bacteria 1090
226 Ga0068854_100523259 3300005578 Bacteria 1002
227 Ga0068854_100779783 3300005578 Bacteria 831
228 Ga0068856_100016100 3300005614 Bacteria 7228
229 Ga0068856_100768637 3300005614 Bacteria 983
230 Ga0068852_100045673 3300005616 Bacteria 3727
231 Ga0068852_100049791 3300005616 Bacteria 3586
232 Ga0068852_100113902 3300005616 Bacteria 2463
233 Ga0068852_100286449 3300005616 Bacteria 1590
234 Ga0068852_100704958 3300005616 Bacteria 1020
235 Ga0068859_100011168 3300005617 Bacteria 9029
236 Ga0068859_100014157 3300005617 Bacteria 7998
237 Ga0068859_100071933 3300005617 Bacteria 3494
238 Ga0068859_100233165 3300005617 Bacteria 1929
239 Ga0068864_100006939 3300005618 Bacteria 9292
240 Ga0068864_100014348 3300005618 Bacteria 6581
241 Ga0068864_100020963 3300005618 Bacteria 5473
242 Ga0068864_100035586 3300005618 Bacteria 4240
243 Ga0068866_10176571 3300005718 Unclassified 1258
244 Ga0068861_100001967 3300005719 Bacteria 13242
245 Ga0068861_100098554 3300005719 Bacteria 2320
246 Ga0068861_100099116 3300005719 Bacteria 2314
247 Ga0068861_101011004 3300005719 Bacteria 794
248 Ga0068851_10015815 3300005834 Bacteria 3601
249 Ga0068851_10065197 3300005834 Bacteria 1874
250 Ga0068851_10209105 3300005834 Bacteria 1092
251 Ga0068870_10027147 3300005840 Bacteria 2861
252 Ga0068870_10124361 3300005840 Bacteria 1490
253 Ga0068863_100012433 3300005841 Bacteria 8219
254 Ga0068863_100037327 3300005841 Bacteria 4626
255 Ga0068863_100151663 3300005841 Bacteria 2218
256 Ga0068863_100241408 3300005841 Bacteria 1744
257 Ga0068863_100276828 3300005841 Bacteria 1625
258 Ga0068863_100278780 3300005841 Bacteria 1619
259 Ga0068863_100336788 3300005841 Bacteria 1467
260 Ga0068863_100500118 3300005841 Bacteria 1197
261 Ga0068863_100518383 3300005841 Bacteria 1175
262 Ga0068863_100623364 3300005841 Bacteria 1068
263 Ga0068858_100139654 3300005842 Bacteria 2274
264 Ga0068858_100485410 3300005842 Bacteria 1193
265 Ga0068860_100014126 3300005843 Bacteria 7830
266 Ga0068860_100018457 3300005843 Bacteria 6785
267 Ga0068860_100230298 3300005843 Bacteria 1801
268 Ga0068860_100272470 3300005843 Bacteria 1652
269 Ga0068860_100275885 3300005843 Unclassified 1642
270 Ga0068860_100408596 3300005843 Bacteria 1344
271 Ga0068862_100015603 3300005844 Bacteria 6310
272 Ga0068862_100073069 3300005844 Unclassified 2964
273 Ga0075363_100279879 3300006048 Bacteria 965
274 Ga0075364_10320929 3300006051 Bacteria 1055
275 Ga0075364_10426602 3300006051 Bacteria 905
276 Ga0075364_10570376 3300006051 Bacteria 773
277 Ga0075432_10000316 3300006058 Bacteria 13593
278 Ga0075432_10103215 3300006058 Bacteria 1055
279 Ga0075362_10000923 3300006177 Bacteria 8934
280 Ga0075369_10119616 3300006186 Bacteria 1191
281 Ga0075366_10009494 3300006195 Bacteria 5431
282 Ga0097621_100386334 3300006237 Bacteria 1251
283 Ga0097621_100457433 3300006237 Bacteria 1151
284 Ga0097621_100516321 3300006237 Bacteria 1084
285 Ga0068871_100080037 3300006358 Bacteria 2704
286 Ga0068871_100829103 3300006358 Unclassified 854
287 Ga0075428_100647354 3300006844 Bacteria 1127
288 Ga0075428_101084647 3300006844 Bacteria 846
289 Ga0068865_100047329 3300006881 Bacteria 2955
290 Ga0068865_100227731 3300006881 Bacteria 1461
291 Ga0075436_100119814 3300006914 Bacteria 1840
292 Ga0097620_100011168 3300006931 Bacteria 9029
293 Ga0097620_100014159 3300006931 Bacteria 7998
294 Ga0097620_100071933 3300006931 Bacteria 3494
295 Ga0097620_100233177 3300006931 Bacteria 1929
296 Ga0079104_1021663 3300006946 Bacteria 1746
297 Ga0105251_10002617 3300009011 Bacteria 13912
298 Ga0105251_10004604 3300009011 Bacteria 9313
299 Ga0105251_10032844 3300009011 Bacteria 2582
300 Ga0105251_10056938 3300009011 Bacteria 1849
301 Ga0105244_10002401 3300009036 Bacteria 14159
302 Ga0105244_10120692 3300009036 Bacteria 1269
303 Ga0105244_10148471 3300009036 Bacteria 1124
304 Ga0105250_10000550 3300009092 Bacteria 25618
305 Ga0105250_10002212 3300009092 Bacteria 9912
306 Ga0105250_10026587 3300009092 Bacteria 2332
307 Ga0105250_10287560 3300009092 Bacteria 708
308 Ga0105240_10001607 3300009093 Bacteria 38298
309 Ga0105240_10005342 3300009093 Bacteria 19161
310 Ga0105240_10017316 3300009093 Bacteria 9714
311 Ga0105240_10020280 3300009093 Bacteria 8873
312 Ga0105240_10023104 3300009093 Bacteria 8233
313 Ga0105240_10224191 3300009093 Bacteria 2188
314 Ga0105240_10322835 3300009093 Bacteria 1759
315 Ga0105240_10381595 3300009093 Bacteria 1592
316 Ga0105240_10405876 3300009093 Bacteria 1534
317 Ga0105240_10648266 3300009093 Bacteria 1158
318 Ga0105240_11392873 3300009093 Bacteria 737
319 Ga0111539_10640115 3300009094 Bacteria 1238
320 Ga0105245_10257272 3300009098 Bacteria 1698
321 Ga0105245_10320485 3300009098 Bacteria 1527
322 Ga0105247_10018162 3300009101 Bacteria 4218
323 Ga0105247_10267118 3300009101 Bacteria 1175
324 Ga0105243_10001011 3300009148 Bacteria 25990
325 Ga0105243_10051347 3300009148 Bacteria 3261
326 Ga0105242_10358512 3300009176 Bacteria 1349
327 Ga0105242_10421815 3300009176 Bacteria 1250
328 Ga0105248_10257694 3300009177 Bacteria 1964
329 Ga0105248_10334437 3300009177 Bacteria 1705
330 Ga0105248_11132222 3300009177 Bacteria 885
331 Ga0105237_10000036 3300009545 Bacteria 191142
332 Ga0105237_10000136 3300009545 Bacteria 103269
333 Ga0105237_10058621 3300009545 Bacteria 3853
334 Ga0105237_10188719 3300009545 Bacteria 2061
335 Ga0105238_10036529 3300009551 Bacteria 4995
336 Ga0105238_10261347 3300009551 Bacteria 1710
337 Ga0105238_10777598 3300009551 Bacteria 972
338 Ga0105249_10096119 3300009553 Bacteria 2779
339 Ga0105239_10011357 3300010375 Bacteria 9936
340 Ga0105239_10061307 3300010375 Bacteria 4128
341 Ga0105246_10000322 3300011119 Bacteria 25369
342 Ga0105246_10002126 3300011119 Bacteria 11943
343 Ga0105246_10023561 3300011119 Bacteria 3985
344 Ga0105246_10567655 3300011119 Bacteria 975
345 Ga0157345_1000091 3300012498 Bacteria 19224
346 Ga0157314_1000581 3300012500 Bacteria 3371
347 Ga0157347_1002954 3300012502 Bacteria 1494
348 Ga0157373_10000568 3300013100 Bacteria 28815
349 Ga0157373_10003664 3300013100 Bacteria 11614
350 Ga0157373_10009218 3300013100 Bacteria 7299
351 Ga0157373_10085097 3300013100 Bacteria 2229
352 Ga0157373_10113106 3300013100 Bacteria 1907
353 Ga0157373_10638965 3300013100 Bacteria 777
354 Ga0157371_10016582 3300013102 Bacteria 5494
355 Ga0157371_10216135 3300013102 Bacteria 1376
356 Ga0157371_10377801 3300013102 Bacteria 1034
357 Ga0157370_10077206 3300013104 Bacteria 3138
358 Ga0157370_10281370 3300013104 Bacteria 1537
359 Ga0157370_10322545 3300013104 Bacteria 1425
360 Ga0157369_10001737 3300013105 Bacteria 26487
361 Ga0157369_10001978 3300013105 Bacteria 24687
362 Ga0157369_10025617 3300013105 Bacteria 6545
363 Ga0157369_10047946 3300013105 Bacteria 4637
364 Ga0157369_10147301 3300013105 Bacteria 2489
365 Ga0157369_10170224 3300013105 Bacteria 2295
366 Ga0157369_10255746 3300013105 Bacteria 1827
367 Ga0157369_10604876 3300013105 Bacteria 1131
368 Ga0157369_10646301 3300013105 Bacteria 1091
369 Ga0157369_10833279 3300013105 Bacteria 947
370 Ga0157374_10000055 3300013296 Bacteria 120079
371 Ga0157374_10003393 3300013296 Bacteria 13392
372 Ga0157374_10388709 3300013296 Bacteria 1390
373 Ga0157378_10285618 3300013297 Bacteria 1592
374 Ga0163162_10083329 3300013306 Bacteria 3271
375 Ga0163162_10162708 3300013306 Bacteria 2354
376 Ga0163162_10258243 3300013306 Bacteria 1874
377 Ga0163162_10578767 3300013306 Bacteria 1250
378 Ga0157372_10001079 3300013307 Bacteria 29711
379 Ga0157372_10055049 3300013307 Bacteria 4441
380 Ga0157372_10131453 3300013307 Bacteria 2880
381 Ga0157372_10220879 3300013307 Bacteria 2196
382 Ga0157372_10437604 3300013307 Bacteria 1524
383 Ga0157372_10477804 3300013307 Bacteria 1453
384 Ga0157372_10527871 3300013307 Bacteria 1376
385 Ga0157372_10544429 3300013307 Bacteria 1353
386 Ga0157375_10007393 3300013308 Bacteria 9615
387 Ga0157375_10012489 3300013308 Bacteria 7538
388 Ga0157375_10106507 3300013308 Bacteria 2895
389 Ga0157375_10350854 3300013308 Bacteria 1641
390 Ga0157375_10699769 3300013308 Bacteria 1167
391 Ga0157375_11107539 3300013308 Bacteria 927
392 Ga0163163_10012181 3300014325 Bacteria 7828
393 Ga0157380_10006526 3300014326 Bacteria 8227
394 Ga0157380_10125069 3300014326 Bacteria 2184
395 Ga0182008_10001995 3300014497 Bacteria 13100
396 Ga0182008_10009442 3300014497 Bacteria 5263
397 Ga0182008_10036444 3300014497 Bacteria 2461
398 Ga0182008_10038233 3300014497 Bacteria 2400
399 Ga0182008_10112878 3300014497 Bacteria 1347
400 Ga0157377_10395201 3300014745 Bacteria 940
401 Ga0157379_10007766 3300014968 Bacteria 9290
402 Ga0157379_10126591 3300014968 Bacteria 2298
403 Ga0157376_10069963 3300014969 Bacteria 2977
404 Ga0157376_10111105 3300014969 Bacteria 2413
405 Ga0157376_10159234 3300014969 Bacteria 2045
406 Ga0157376_10918310 3300014969 Bacteria 894
407 Ga0182006_1000967 3300015261 Bacteria 19035
408 Ga0182006_1002514 3300015261 Bacteria 9969
409 Ga0182006_1006793 3300015261 Bacteria 5279
410 Ga0182006_1009331 3300015261 Bacteria 4401
411 Ga0182006_1020584 3300015261 Bacteria 2762
412 Ga0182006_1104194 3300015261 Bacteria 1003
413 Ga0182006_1134970 3300015261 Bacteria 847
414 Ga0182005_1000289 3300015265 Bacteria 31434
415 Ga0182005_1041459 3300015265 Bacteria 1252
416 Ga0182005_1042136 3300015265 Bacteria 1241
417 Ga0183365_10004 3300015684 Bacteria 333304
418 Ga0183368_1007 3300015687 Bacteria 405609
419 Ga0183360_11919 3300015689 Bacteria 757
420 Ga0183363_1007 3300015690 Bacteria 315687
421 Ga0163161_10071262 3300017792 Bacteria 2543
422 Ga0163161_10087295 3300017792 Bacteria 2304
423 Ga0163161_10144012 3300017792 Bacteria 1806
424 Ga0163161_10160712 3300017792 Bacteria 1713
425 Ga0163161_10192938 3300017792 Bacteria 1567
426 Ga0163161_10599252 3300017792 Bacteria 908
427 Ga0163161_10603799 3300017792 Bacteria 905
428 Ga0163161_10784277 3300017792 Bacteria 800
429 Ga0206356_11616746 3300020070 Bacteria 3414
430 Ga0206354_10931273 3300020081 Bacteria 1474
431 Ga0213872_10001316 3300021361 Bacteria 16470
432 Ga0213875_10023663 3300021388 Bacteria 2933
433 Ga0228598_1000332 3300024227 Bacteria 9268
434 Ga0209435_106429 3300025206 Bacteria 1308
435 Ga0209760_100340 3300025207 Bacteria 13643
436 Ga0209760_101173 3300025207 Bacteria 2947
437 Ga0209436_100301 3300025208 Bacteria 22729
438 Ga0209784_100049 3300025224 Bacteria 195512
439 Ga0209784_100164 3300025224 Bacteria 57421
440 Ga0209566_100061 3300025225 Bacteria 195512
441 Ga0209566_102109 3300025225 Bacteria 4082
442 Ga0209674_100069 3300025226 Bacteria 243948
443 Ga0209672_102388 3300025228 Bacteria 4672
444 Ga0209672_102751 3300025228 Bacteria 4055
445 Ga0209672_103395 3300025228 Bacteria 3314
446 Ga0209672_112054 3300025228 Bacteria 1089
447 Ga0209563_100083 3300025230 Bacteria 195512
448 Ga0207427_100084 3300025231 Bacteria 142663
449 Ga0207427_101954 3300025231 Bacteria 6328
450 Ga0207427_103135 3300025231 Bacteria 3710
451 Ga0209437_100037 3300025233 Bacteria 459730
452 Ga0209437_100091 3300025233 Bacteria 243344
453 Ga0209437_100924 3300025233 Bacteria 11174
454 Ga0209258_100034 3300025242 Bacteria 437372
455 Ga0209258_100071 3300025242 Bacteria 278319
456 Ga0209258_100459 3300025242 Bacteria 44386
457 Ga0209258_100792 3300025242 Bacteria 18794
458 Ga0209258_101200 3300025242 Bacteria 10284
459 Ga0209258_103464 3300025242 Bacteria 3390
460 Ga0209646_1000895 3300025246 Bacteria 9727
461 Ga0209646_1001788 3300025246 Bacteria 5375
462 Ga0209026_1000187 3300025250 Bacteria 90872
463 Ga0209026_1000223 3300025250 Bacteria 77328
464 Ga0209677_100039 3300025253 Bacteria 243974
465 Ga0209148_1000001 3300025254 Bacteria 2545271
466 Ga0209148_1000002 3300025254 Bacteria 2399500
467 Ga0209148_1004832 3300025254 Bacteria 3213
468 Ga0209759_1001491 3300025256 Bacteria 12985
469 Ga0209759_1001499 3300025256 Bacteria 12890
470 Ga0209759_1001939 3300025256 Bacteria 10058
471 Ga0209759_1003025 3300025256 Bacteria 6937
472 Ga0209759_1003373 3300025256 Bacteria 6411
473 Ga0209129_1002340 3300025258 Bacteria 9382
474 Ga0209233_1000002 3300025261 Bacteria 2501366
475 Ga0209233_1000115 3300025261 Bacteria 243344
476 Ga0209233_1020535 3300025261 Bacteria 1730
477 Ga0209233_1023887 3300025261 Bacteria 1538
478 Ga0209565_1000009 3300025263 Bacteria 751701
479 Ga0209455_1000030 3300025272 Bacteria 533479
480 Ga0209455_1000054 3300025272 Bacteria 358936
481 Ga0209455_1000427 3300025272 Bacteria 32971
482 Ga0209455_1000628 3300025272 Bacteria 21902
483 Ga0209455_1003037 3300025272 Bacteria 6141
484 Ga0209673_1000036 3300025273 Bacteria 323162
485 Ga0209673_1007680 3300025273 Bacteria 4916
486 Ga0209130_1000044 3300025284 Bacteria 241110
487 Ga0209130_1000188 3300025284 Bacteria 86963
488 Ga0209130_1002498 3300025284 Bacteria 9091
489 Ga0209675_1000013 3300025291 Bacteria 448220
490 Ga0209675_1000078 3300025291 Bacteria 156111
491 Ga0209675_1007119 3300025291 Bacteria 4349
492 Ga0209676_1000121 3300025292 Bacteria 198920
493 Ga0209676_1000345 3300025292 Bacteria 88051
494 Ga0209676_1000440 3300025292 Bacteria 71013
495 Ga0209676_1004038 3300025292 Bacteria 8449
496 Ga0209025_1000051 3300025294 Bacteria 330080
497 Ga0209025_1038002 3300025294 Bacteria 2125
498 Ga0209564_1000122 3300025295 Bacteria 203709
499 Ga0209564_1000133 3300025295 Bacteria 189140
500 Ga0209564_1000202 3300025295 Bacteria 136555
501 Ga0209758_1001007 3300025297 Bacteria 37395
502 Ga0209758_1048733 3300025297 Bacteria 1502
503 Ga0209758_1066634 3300025297 Bacteria 1156
504 Ga0209050_1001731 3300025298 Bacteria 21722
505 Ga0209050_1002704 3300025298 Bacteria 14408
506 Ga0209256_1000106 3300025299 Bacteria 187258
507 Ga0209256_1001832 3300025299 Bacteria 19843
508 Ga0209256_1008649 3300025299 Bacteria 4663
509 Ga0209256_1010324 3300025299 Bacteria 3931
510 Ga0207426_1049454 3300025302 Bacteria 1258
511 Ga0209051_1000979 3300025303 Bacteria 27790
512 Ga0209051_1005522 3300025303 Bacteria 7372
513 Ga0209257_1000065 3300025304 Bacteria 353604
514 Ga0209257_1000121 3300025304 Bacteria 222588
515 Ga0209257_1000356 3300025304 Bacteria 93656
516 Ga0209257_1000452 3300025304 Bacteria 77144
517 Ga0209257_1001064 3300025304 Bacteria 36288
518 Ga0209257_1028082 3300025304 Bacteria 1858
519 Ga0209257_1068871 3300025304 Bacteria 939
520 Ga0207697_10017549 3300025315 Bacteria 2941
521 Ga0207697_10038369 3300025315 Bacteria 1964
522 Ga0207656_10079257 3300025321 Bacteria 1473
523 Ga0207696_1000165 3300025711 Bacteria 104683
524 Ga0207696_1001780 3300025711 Bacteria 11122
525 Ga0207655_1000603 3300025728 Bacteria 43527
526 Ga0207655_1000772 3300025728 Bacteria 35772
527 Ga0207655_1003483 3300025728 Bacteria 11691
528 Ga0207655_1004427 3300025728 Bacteria 9962
529 Ga0207655_1012890 3300025728 Bacteria 4840
530 Ga0207655_1014595 3300025728 Bacteria 4429
531 Ga0207655_1029630 3300025728 Bacteria 2559
532 Ga0207713_1001400 3300025735 Bacteria 19498
533 Ga0207713_1003713 3300025735 Bacteria 10262
534 Ga0207713_1017174 3300025735 Bacteria 3641
535 Ga0207682_10001014 3300025893 Bacteria 13035
536 Ga0207682_10182826 3300025893 Bacteria 958
537 Ga0207710_10017120 3300025900 Bacteria 3072
538 Ga0207680_10033556 3300025903 Bacteria 2929
539 Ga0207680_10036168 3300025903 Bacteria 2842
540 Ga0207680_10438600 3300025903 Bacteria 926
541 Ga0207647_10002310 3300025904 Bacteria 14530
542 Ga0207647_10003842 3300025904 Bacteria 11237
543 Ga0207647_10005179 3300025904 Bacteria 9593
544 Ga0207645_10000428 3300025907 Bacteria 34870
545 Ga0207645_10018585 3300025907 Bacteria 4569
546 Ga0207645_10025328 3300025907 Bacteria 3839
547 Ga0207643_10028023 3300025908 Bacteria 3125
548 Ga0207643_10057340 3300025908 Bacteria 2217
549 Ga0207705_10171889 3300025909 Bacteria 1632
550 Ga0207705_10205601 3300025909 Bacteria 1492
551 Ga0207705_10220760 3300025909 Bacteria 1440
552 Ga0207705_10234864 3300025909 Bacteria 1395
553 Ga0207707_10052033 3300025912 Bacteria 3566
554 Ga0207707_10303155 3300025912 Bacteria 1381
555 Ga0207695_10001702 3300025913 Bacteria 35225
556 Ga0207695_10003515 3300025913 Bacteria 21943
557 Ga0207695_10007231 3300025913 Bacteria 14184
558 Ga0207695_10012415 3300025913 Bacteria 10229
559 Ga0207695_10021072 3300025913 Bacteria 7444
560 Ga0207695_10242701 3300025913 Bacteria 1702
561 Ga0207695_10313859 3300025913 Bacteria 1458
562 Ga0207671_10000059 3300025914 Bacteria 179761
563 Ga0207671_10000135 3300025914 Bacteria 112401
564 Ga0207671_10000713 3300025914 Bacteria 42635
565 Ga0207671_10004409 3300025914 Bacteria 13488
566 Ga0207671_10223289 3300025914 Bacteria 1476
567 Ga0207671_10269649 3300025914 Bacteria 1341
568 Ga0207660_10154998 3300025917 Bacteria 1763
569 Ga0207657_10009078 3300025919 Bacteria 10037
570 Ga0207657_10067795 3300025919 Bacteria 3033
571 Ga0207649_10000007 3300025920 Bacteria 334217
572 Ga0207649_10019952 3300025920 Bacteria 3838
573 Ga0207649_10123389 3300025920 Bacteria 1749
574 Ga0207649_10159895 3300025920 Bacteria 1560
575 Ga0207649_10213836 3300025920 Bacteria 1369
576 Ga0207649_10272468 3300025920 Bacteria 1227
577 Ga0207652_10530962 3300025921 Bacteria 1058
578 Ga0207681_10073391 3300025923 Bacteria 2393
579 Ga0207694_10042761 3300025924 Bacteria 3496
580 Ga0207650_10034174 3300025925 Bacteria 3686
581 Ga0207650_10124175 3300025925 Bacteria 2013
582 Ga0207650_10263864 3300025925 Bacteria 1398
583 Ga0207659_10131071 3300025926 Bacteria 1935
584 Ga0207687_10043694 3300025927 Bacteria 3089
585 Ga0207687_10186128 3300025927 Bacteria 1612
586 Ga0207700_10260945 3300025928 Bacteria 1483
587 Ga0207664_10044849 3300025929 Bacteria 3464
588 Ga0207664_10563071 3300025929 Bacteria 1023
589 Ga0207644_10070897 3300025931 Bacteria 2548
590 Ga0207644_10087503 3300025931 Bacteria 2315
591 Ga0207644_10323607 3300025931 Bacteria 1247
592 Ga0207690_10014282 3300025932 Bacteria 4795
593 Ga0207690_10096449 3300025932 Bacteria 2103
594 Ga0207706_10057627 3300025933 Bacteria 3422
595 Ga0207706_10094002 3300025933 Bacteria 2637
596 Ga0207706_10133108 3300025933 Bacteria 2187
597 Ga0207706_10138154 3300025933 Bacteria 2144
598 Ga0207706_10588517 3300025933 Bacteria 956
599 Ga0207686_10001532 3300025934 Bacteria 13024
600 Ga0207686_10607395 3300025934 Bacteria 861
601 Ga0207709_10065230 3300025935 Bacteria 2289
602 Ga0207670_10565835 3300025936 Bacteria 930
603 Ga0207669_10544061 3300025937 Bacteria 936
604 Ga0207704_10010676 3300025938 Bacteria 4489
605 Ga0207704_10115126 3300025938 Bacteria 1827
606 Ga0207691_10000127 3300025940 Bacteria 69355
607 Ga0207691_10004858 3300025940 Bacteria 12997
608 Ga0207691_10071976 3300025940 Bacteria 3118
609 Ga0207691_10133688 3300025940 Bacteria 2189
610 Ga0207691_10172497 3300025940 Bacteria 1893
611 Ga0207691_10234026 3300025940 Bacteria 1590
612 Ga0207689_10262507 3300025942 Bacteria 1429
613 Ga0207661_10003004 3300025944 Bacteria 11670
614 Ga0207661_10041845 3300025944 Bacteria 3609
615 Ga0207661_10091582 3300025944 Bacteria 2533
616 Ga0207661_10102213 3300025944 Bacteria 2409
617 Ga0207661_10227205 3300025944 Bacteria 1651
618 Ga0207679_10000013 3300025945 Bacteria 334197
619 Ga0207679_10007435 3300025945 Bacteria 6949
620 Ga0207679_10055251 3300025945 Bacteria 2926
621 Ga0207679_10153761 3300025945 Bacteria 1876
622 Ga0207679_10246545 3300025945 Bacteria 1516
623 Ga0207679_11229545 3300025945 Unclassified 687
624 Ga0207667_10000292 3300025949 Bacteria 69279
625 Ga0207667_10000486 3300025949 Bacteria 52631
626 Ga0207667_10009358 3300025949 Bacteria 11553
627 Ga0207667_10055825 3300025949 Bacteria 4150
628 Ga0207667_10121940 3300025949 Bacteria 2686
629 Ga0207667_10471054 3300025949 Bacteria 1275
630 Ga0207651_10341407 3300025960 Bacteria 1258
631 Ga0207651_10452334 3300025960 Bacteria 1102
632 Ga0207668_10021890 3300025972 Bacteria 4082
633 Ga0207668_10122115 3300025972 Bacteria 1974
634 Ga0207668_10124149 3300025972 Bacteria 1960
635 Ga0207668_10223889 3300025972 Bacteria 1512
636 Ga0207668_10356560 3300025972 Bacteria 1224
637 Ga0207668_10469968 3300025972 Bacteria 1077
638 Ga0207668_10620511 3300025972 Bacteria 943
639 Ga0207640_10000471 3300025981 Bacteria 24571
640 Ga0207640_10000670 3300025981 Bacteria 19993
641 Ga0207640_10018115 3300025981 Bacteria 4132
642 Ga0207640_10021026 3300025981 Bacteria 3882
643 Ga0207640_10053029 3300025981 Bacteria 2645
644 Ga0207640_10182581 3300025981 Bacteria 1574
645 Ga0207658_10044979 3300025986 Bacteria 3216
646 Ga0207658_10059775 3300025986 Bacteria 2841
647 Ga0207658_10065595 3300025986 Bacteria 2727
648 Ga0207658_10117646 3300025986 Bacteria 2113
649 Ga0207677_10026161 3300026023 Bacteria 3654
650 Ga0207677_10088036 3300026023 Bacteria 2250
651 Ga0207677_10892240 3300026023 Bacteria 801
652 Ga0207703_10132703 3300026035 Bacteria 2153
653 Ga0207703_10536907 3300026035 Bacteria 1102
654 Ga0207703_10553092 3300026035 Bacteria 1085
655 Ga0207703_10931067 3300026035 Bacteria 832
656 Ga0207639_10193654 3300026041 Bacteria 1738
657 Ga0207678_10000969 3300026067 Bacteria 26231
658 Ga0207678_10032281 3300026067 Bacteria 4563
659 Ga0207678_10143379 3300026067 Bacteria 2039
660 Ga0207678_10145112 3300026067 Bacteria 2026
661 Ga0207678_10724564 3300026067 Bacteria 876
662 Ga0207708_10235273 3300026075 Bacteria 1472
663 Ga0207702_11166583 3300026078 Bacteria 764
664 Ga0207641_10049260 3300026088 Bacteria 3559
665 Ga0207641_10173981 3300026088 Bacteria 1967
666 Ga0207641_10265698 3300026088 Bacteria 1608
667 Ga0207641_10323837 3300026088 Bacteria 1462
668 Ga0207641_10331629 3300026088 Bacteria 1445
669 Ga0207641_10346093 3300026088 Bacteria 1416
670 Ga0207641_10365360 3300026088 Bacteria 1379
671 Ga0207641_10877082 3300026088 Unclassified 890
672 Ga0207641_11113180 3300026088 Bacteria 788
673 Ga0207648_10004283 3300026089 Bacteria 14715
674 Ga0207648_10011720 3300026089 Bacteria 8244
675 Ga0207648_10023017 3300026089 Bacteria 5587
676 Ga0207648_10265180 3300026089 Bacteria 1533
677 Ga0207676_10032072 3300026095 Bacteria 3956
678 Ga0207676_10048307 3300026095 Bacteria 3303
679 Ga0207676_10170681 3300026095 Bacteria 1895
680 Ga0207674_10000298 3300026116 Bacteria 62902
681 Ga0207674_10010196 3300026116 Bacteria 10673
682 Ga0207674_10011014 3300026116 Bacteria 10169
683 Ga0207674_10155541 3300026116 Bacteria 2242
684 Ga0207675_100012815 3300026118 Bacteria 7834
685 Ga0207675_100029062 3300026118 Bacteria 5151
686 Ga0207675_100075242 3300026118 Bacteria 3161
687 Ga0207675_100162337 3300026118 Bacteria 2132
688 Ga0207675_100862005 3300026118 Bacteria 921
689 Ga0207683_10000009 3300026121 Bacteria 150281
690 Ga0207698_10008277 3300026142 Bacteria 6567
691 Ga0207698_10019529 3300026142 Bacteria 4642
692 Ga0207698_10046054 3300026142 Bacteria 3290
693 Ga0207698_10140636 3300026142 Bacteria 2079
694 Ga0207698_10215874 3300026142 Bacteria 1730
695 Ga0207698_10388092 3300026142 Bacteria 1331
696 Ga0207698_10711551 3300026142 Bacteria 1000
697 Ga0209281_1013031 3300027111 Bacteria 1806
698 Ga0209371_1000023 3300027312 Bacteria 519553
699 Ga0207428_10015977 3300027907 Bacteria 6471
700 Ga0207428_10203634 3300027907 Bacteria 1489
701 Ga0268266_10005005 3300028379 Bacteria 12518
702 Ga0268266_10060827 3300028379 Bacteria 3256
703 Ga0268266_10172820 3300028379 Bacteria 1962
704 Ga0268266_10297171 3300028379 Bacteria 1505
705 Ga0268266_10922761 3300028379 Bacteria 845
706 Ga0268266_11010465 3300028379 Bacteria 805
707 Ga0268265_10289752 3300028380 Bacteria 1469
708 Ga0268264_10058224 3300028381 Bacteria 3235
709 Ga0268264_10070210 3300028381 Bacteria 2965
710 Ga0268264_10081212 3300028381 Bacteria 2770
711 Ga0268264_10643278 3300028381 Bacteria 1049
712 Ga0268264_10678496 3300028381 Bacteria 1022
713 Ga0307517_10005849 3300028786 Bacteria 18395
714 Ga0307517_10010226 3300028786 Bacteria 13164
715 Ga0307517_10104066 3300028786 Bacteria 2213
716 Ga0307517_10217316 3300028786 Bacteria 1167
717 Ga0307515_10013824 3300028794 Bacteria 15040
718 Ga0307515_10133079 3300028794 Bacteria 2723
719 Ga0265338_10000118 3300028800 Bacteria 146710
720 Ga0268256_1000023 3300030500 Bacteria 519631
721 Ga0268256_1000050 3300030500 Bacteria 300675
722 Ga0316177_1104169 3300030731 Bacteria 1494
723 Ga0316181_1003769 3300030744 Bacteria 2103
724 Ga0265332_10020812 3300031238 Bacteria 2897
725 Ga0265340_10063801 3300031247 Bacteria 1757
726 Ga0265316_10205203 3300031344 Bacteria 1460
727 Ga0307513_10020408 3300031456 Bacteria 7861
728 Ga0307513_10052805 3300031456 Bacteria 4374
729 Ga0307513_10086379 3300031456 Bacteria 3216
730 Ga0307513_10117764 3300031456 Bacteria 2633
731 Ga0307513_10138965 3300031456 Bacteria 2359
732 Ga0307513_10350485 3300031456 Unclassified 1224
733 Ga0307509_10000052 3300031507 Bacteria 164947
734 Ga0307509_10003622 3300031507 Bacteria 23190
735 Ga0307509_10023567 3300031507 Bacteria 6906
736 Ga0307509_10034645 3300031507 Bacteria 5545
737 Ga0307509_10067060 3300031507 Bacteria 3761
738 Ga0307509_10147362 3300031507 Bacteria 2276
739 Ga0307408_100000194 3300031548 Bacteria 65753
740 Ga0307408_100020906 3300031548 Bacteria 4423
741 Ga0307408_100100941 3300031548 Bacteria 2198
742 Ga0307408_100190230 3300031548 Bacteria 1653
743 Ga0307508_10002365 3300031616 Bacteria 19947
744 Ga0307508_10442277 3300031616 Bacteria 892
745 Ga0307508_10481723 3300031616 Bacteria 834
746 Ga0307514_10012360 3300031649 Bacteria 7101
747 Ga0307516_10007666 3300031730 Bacteria 12353
748 Ga0307516_10063274 3300031730 Bacteria 3582
749 Ga0307516_10134536 3300031730 Bacteria 2248
750 Ga0307516_10167955 3300031730 Bacteria 1937
751 Ga0307516_10251391 3300031730 Bacteria 1462
752 Ga0307516_10653191 3300031730 Bacteria 707
753 Ga0307405_10164241 3300031731 Bacteria 1576
754 Ga0307405_10301078 3300031731 Bacteria 1216
755 Ga0307413_10025015 3300031824 Bacteria 3265
756 Ga0307413_10226532 3300031824 Bacteria 1369
757 Ga0307410_10080021 3300031852 Bacteria 2291
758 Ga0307410_10306209 3300031852 Bacteria 1255
759 Ga0307406_10130772 3300031901 Bacteria 1762
760 Ga0307406_10539633 3300031901 Bacteria 952
761 Ga0307407_10005761 3300031903 Bacteria 5417
762 Ga0307407_10133122 3300031903 Bacteria 1594
763 Ga0307412_10047860 3300031911 Bacteria 2809
764 Ga0307409_100037068 3300031995 Bacteria 3591
765 Ga0307409_100075501 3300031995 Bacteria 2699
766 Ga0307409_100207555 3300031995 Bacteria 1758
767 Ga0307409_100536681 3300031995 Bacteria 1146
768 Ga0307416_100019933 3300032002 Bacteria 4769
769 Ga0307416_100068548 3300032002 Bacteria 2932
770 Ga0307416_100307980 3300032002 Bacteria 1578
771 Ga0307414_10112044 3300032004 Bacteria 2079
772 Ga0307414_10236516 3300032004 Bacteria 1509
773 Ga0307414_10510780 3300032004 Bacteria 1065
774 Ga0307507_10092396 3300033179 Bacteria 2583
775 Ga0307507_10117726 3300033179 Bacteria 2140
776 Ga0307510_10000118 3300033180 Bacteria 63011
777 Ga0307510_10014576 3300033180 Bacteria 9303
778 Ga0307510_10088730 3300033180 Bacteria 2950
779 Ga0307510_10120543 3300033180 Bacteria 2329
780 Ga0307510_10145502 3300033180 Bacteria 2003
781 Ga0307510_10184103 3300033180 Bacteria 1646
782 Ga0373940_0087971 3300035088 Bacteria 927
783 Ga0373951_0081722 3300035091 Bacteria 837
784 Ga0373932_0054478 3300035112 Bacteria 1197
785 Ga0373931_0072019 3300035691 Bacteria 1889
786 Ga0373931_0239671 3300035691 Bacteria 1099
787 Ga0373947_0163753 3300035725 Bacteria 1439
788 Ga0373947_0420280 3300035725 Bacteria 903
789 Ga0373947_0721919 3300035725 Bacteria 680
790 Ga0373937_0025086 3300036401 Bacteria 5382
791 Ga0373937_0341074 3300036401 Bacteria 1419
792 Ga0373925_0212396 3300037068 Bacteria 1542
793 Ga0373925_0254489 3300037068 Bacteria 1409
794 Ga0395899_0000012 3300037312 Bacteria 517561
795 Ga0395899_0005005 3300037312 Bacteria 10313
796 Ga0395899_0010317 3300037312 Bacteria 7162
797 Ga0395899_0012450 3300037312 Bacteria 6517
798 Ga0395899_0195356 3300037312 Bacteria 1414
799 Ga0395900_0002549 3300037418 Bacteria 19963
800 Ga0395900_0006267 3300037418 Bacteria 12412
801 Ga0395900_0092457 3300037418 Bacteria 3108
802 Ga0395900_0124178 3300037418 Bacteria 2647
803 Ga0395898_0005884 3300037466 Bacteria 13184
804 Ga0395898_0110701 3300037466 Bacteria 2632
805 Ga0395898_0508189 3300037466 Bacteria 1146
806 Ga0395898_0626058 3300037466 Bacteria 1018
807 Ga0395905_0000136 3300037471 Bacteria 121009
808 Ga0395905_0001886 3300037471 Bacteria 24164
809 Ga0395905_0055632 3300037471 Bacteria 3703
810 Ga0395905_0147935 3300037471 Bacteria 2210
811 Ga0436364_0034966 3300037853 Bacteria 762
812 Ga0436364_0389486 3300037853 Bacteria 795
813 Ga0436364_0471363 3300037853 Bacteria 869
814 Ga0436364_1529296 3300037853 Bacteria 12470
815 Ga0395901_0001400 3300038443 Bacteria 25196
816 Ga0395901_0003633 3300038443 Bacteria 15561
817 Ga0395901_0003670 3300038443 Bacteria 15482
818 Ga0395901_0630531 3300038443 Bacteria 1078
819 Ga0237819_00624 3300038705 Bacteria 11567
820 Ga0237819_07641 3300038705 Bacteria 1540
821 Ga0400483_000346 3300039062 Bacteria 4820
822 Ga0400483_020937 3300039062 Bacteria 11125
823 Ga0400483_095196 3300039062 Bacteria 15889
824 Ga0400483_163079 3300039062 Bacteria 1305
825 Ga0400483_171786 3300039062 Bacteria 5041
826 Ga0400483_248084 3300039062 Bacteria 9234
827 Ga0400483_248289 3300039062 Bacteria 9961
828 Ga0436361_0602091 3300039447 Bacteria 1223
829 Ga0436361_0821396 3300039447 Bacteria 16496
830 Ga0436362_0202120 3300039453 Bacteria 1813
831 Ga0439438_004655 3300041405 Bacteria 5215
832 Ga0439447_002799 3300041407 Bacteria 6291
833 Ga0439466_0004451 3300041411 Bacteria 5392
834 Ga0439431_0010973 3300041997 Bacteria 2064
835 Ga0439448_0023985 3300042005 Bacteria 1906
836 Ga0439432_016961 3300042006 Bacteria 2447
837 Ga0439449_0065883 3300042007 Bacteria 1336
838 Ga0439451_000445 3300042009 Bacteria 8055
839 Ga0439451_004420 3300042009 Bacteria 2855
840 Ga0439452_000485 3300042010 Bacteria 22057
841 Ga0439452_019785 3300042010 Bacteria 1774
842 Ga0439462_0032484 3300042015 Bacteria 1383
843 Ga0439463_002054 3300042016 Bacteria 5222
844 Ga0439463_025189 3300042016 Bacteria 1492
845 Ga0439463_057533 3300042016 Bacteria 993
846 Ga0450911_001553 3300042115 Bacteria 5205
847 Ga0450911_003577 3300042115 Bacteria 2707
848 Ga0450913_008653 3300042117 Bacteria 787
849 Ga0450890_000729 3300042127 Bacteria 4769
850 Ga0450891_003745 3300042129 Bacteria 1451
851 Ga0450903_014414 3300042138 Bacteria 1250
852 Ga0450907_009459 3300042146 Bacteria 1616
853 Ga0439446_0087263 3300042156 Bacteria 973
854 Ga0439446_0169028 3300042156 Bacteria 726
855 Ga0439435_0112338 3300042436 Unclassified 847
856 Ga0439464_0004285 3300042439 Bacteria 3644
857 Ga0439460_0004154 3300042461 Bacteria 3524
858 Ga0451577_0000561 3300042876 Bacteria 60402
859 Ga0466969_0002544 3300044656 Bacteria 9741
860 Ga0466969_0017277 3300044656 Bacteria 3770
861 Ga0466969_0034736 3300044656 Bacteria 2553
862 Ga0466972_0062241 3300044658 Bacteria 1788
863 Ga0466972_0137285 3300044658 Bacteria 1151
864 Ga0466982_0000044 3300044672 Bacteria 38923
865 Ga0466965_0016690 3300044683 Bacteria 3498
866 Ga0466966_0000701 3300044684 Bacteria 21320
867 Ga0466966_0002676 3300044684 Bacteria 11672
868 Ga0466961_0002712 3300044693 Bacteria 11005
869 Ga0466961_0003965 3300044693 Bacteria 9260
870 Ga0466961_0070693 3300044693 Bacteria 2215
871 Ga0466963_0240141 3300044694 Bacteria 1270
872 Ga0466964_0022707 3300044706 Bacteria 2436
873 Ga0466964_0052165 3300044706 Bacteria 1681
874 Ga0453684_0532631 3300044712 Bacteria 1296
875 Ga0466971_0004296 3300044719 Bacteria 6142
876 Ga0466971_0090701 3300044719 Bacteria 1399
877 Ga0466971_0210867 3300044719 Bacteria 919
878 Ga0466968_0008215 3300044735 Bacteria 3992
879 Ga0466968_0068779 3300044735 Bacteria 1538
880 Ga0466970_0003084 3300044765 Bacteria 8089
881 Ga0466970_0013349 3300044765 Bacteria 4211
882 Ga0466970_0179059 3300044765 Bacteria 1176
883 Ga0466970_0381209 3300044765 Unclassified 803
884 Ga0466957_0004013 3300044842 Bacteria 8140
885 Ga0466960_0030336 3300044901 Bacteria 2487
886 Ga0466959_0000100 3300045049 Bacteria 54979
887 Ga0466959_0020575 3300045049 Bacteria 4862
888 Ga0466959_0139992 3300045049 Bacteria 1711
889 Ga0466959_0167906 3300045049 Bacteria 1540
890 Ga0466959_0288700 3300045049 Bacteria 1125
891 Ga0466959_0436775 3300045049 Bacteria 888
892 Ga0451576_0097798 3300045051 Bacteria 3052
893 Ga0451576_0132455 3300045051 Bacteria 2599
894 Ga0451576_0220133 3300045051 Bacteria 1982
895 Ga0466958_0006453 3300045836 Bacteria 6384
896 Ga0466958_0287134 3300045836 Bacteria 1055
897 Ga0466967_0111240 3300045976 Bacteria 2517
898 Ga0466967_0205699 3300045976 Bacteria 1866
899 Ga0466967_0356071 3300045976 Bacteria 1417
900 Ga0495617_086552 3300046452 Bacteria 1024
901 Ga0495617_093614 3300046452 Bacteria 979
902 Ga0495627_002371 3300046453 Bacteria 9195
903 Ga0495627_003650 3300046453 Bacteria 6678
904 Ga0495627_004572 3300046453 Bacteria 5752
905 Ga0495592_0000142 3300046454 Bacteria 63571
906 Ga0495592_0140582 3300046454 Bacteria 1680
907 Ga0495592_0435252 3300046454 Bacteria 824
908 Ga0495603_0090152 3300046455 Bacteria 1793
909 Ga0495590_0053594 3300046457 Bacteria 1408
910 Ga0495590_0075190 3300046457 Bacteria 1188
911 Ga0495591_000037 3300046458 Bacteria 158323
912 Ga0495591_000960 3300046458 Bacteria 19699
913 Ga0495591_001346 3300046458 Bacteria 15427
914 Ga0495591_001506 3300046458 Bacteria 14373
915 Ga0495591_001756 3300046458 Bacteria 12889
916 Ga0495591_002170 3300046458 Bacteria 11235
917 Ga0495591_002395 3300046458 Bacteria 10486
918 Ga0495591_007687 3300046458 Bacteria 4537
919 Ga0495591_047522 3300046458 Bacteria 1187
920 Ga0495629_0309896 3300046459 Bacteria 1080
921 Ga0495638_0000048 3300046460 Bacteria 209787
922 Ga0495638_0000116 3300046460 Bacteria 128087
923 Ga0495638_0000609 3300046460 Bacteria 40051
924 Ga0495638_0004826 3300046460 Bacteria 10156
925 Ga0495638_0005132 3300046460 Bacteria 9801
926 Ga0495638_0005434 3300046460 Bacteria 9478
927 Ga0495638_0006182 3300046460 Bacteria 8746
928 Ga0495638_0006896 3300046460 Bacteria 8198
929 Ga0495638_0009403 3300046460 Bacteria 6867
930 Ga0495638_0014627 3300046460 Bacteria 5295
931 Ga0495638_0051434 3300046460 Bacteria 2569
932 Ga0495638_0065460 3300046460 Bacteria 2237
933 Ga0495638_0089304 3300046460 Bacteria 1859
934 Ga0495638_0175133 3300046460 Bacteria 1228
935 Ga0495651_0001526 3300046462 Bacteria 17899
936 Ga0495651_0017466 3300046462 Bacteria 5556
937 Ga0495653_0010928 3300046463 Bacteria 7434
938 Ga0495653_0046847 3300046463 Bacteria 3346
939 Ga0495653_0207640 3300046463 Bacteria 1325
940 Ga0495650_0000064 3300046471 Bacteria 275412
941 Ga0495650_0000174 3300046471 Bacteria 142519
942 Ga0495650_0001163 3300046471 Bacteria 28128
943 Ga0495650_0005976 3300046471 Bacteria 7710
944 Ga0495650_0011700 3300046471 Bacteria 4778
945 Ga0495582_0028785 3300046473 Bacteria 3049
946 Ga0495605_0000036 3300046474 Bacteria 203902
947 Ga0495605_0000849 3300046474 Bacteria 21311
948 Ga0495605_0002810 3300046474 Bacteria 10584
949 Ga0495605_0013595 3300046474 Bacteria 4479
950 Ga0495605_0019669 3300046474 Bacteria 3603
951 Ga0495605_0033210 3300046474 Bacteria 2622
952 Ga0495605_0069943 3300046474 Bacteria 1660
953 Ga0495639_0037023 3300046475 Unclassified 2187
954 Ga0495639_0063650 3300046475 Bacteria 1694
955 Ga0495664_0355824 3300046477 Bacteria 881
956 Ga0495584_0002037 3300046491 Bacteria 11614
957 Ga0495584_0003914 3300046491 Bacteria 8049
958 Ga0495584_0019260 3300046491 Bacteria 3466
959 Ga0495584_0048988 3300046491 Bacteria 2129
960 Ga0495584_0095941 3300046491 Bacteria 1497
961 Ga0495584_0212467 3300046491 Bacteria 983
962 Ga0495585_0002685 3300046492 Bacteria 12473
963 Ga0495585_0013417 3300046492 Bacteria 4795
964 Ga0495585_0192600 3300046492 Bacteria 1042
965 Ga0495594_0001898 3300046499 Bacteria 10887
966 Ga0495594_0067344 3300046499 Bacteria 1987
967 Ga0495596_0003157 3300046500 Bacteria 8489
968 Ga0495607_0000149 3300046501 Bacteria 73673
969 Ga0495607_0001076 3300046501 Bacteria 24950
970 Ga0495607_0001283 3300046501 Bacteria 22484
971 Ga0495607_0001388 3300046501 Bacteria 21548
972 Ga0495607_0009553 3300046501 Bacteria 6554
973 Ga0495607_0018552 3300046501 Bacteria 4434
974 Ga0495607_0021322 3300046501 Bacteria 4078
975 Ga0495607_0040702 3300046501 Bacteria 2764
976 Ga0495607_0060814 3300046501 Bacteria 2148
977 Ga0495607_0061381 3300046501 Bacteria 2136
978 Ga0495607_0061828 3300046501 Bacteria 2126
979 Ga0495607_0112849 3300046501 Bacteria 1438
980 Ga0495607_0189239 3300046501 Bacteria 1026
981 Ga0495607_0190950 3300046501 Bacteria 1020
982 Ga0495583_0000028 3300046506 Bacteria 255787
983 Ga0495583_0000271 3300046506 Bacteria 85085
984 Ga0495583_0003346 3300046506 Bacteria 12366
985 Ga0495583_0003399 3300046506 Bacteria 12174
986 Ga0495583_0004619 3300046506 Bacteria 9731
987 Ga0495583_0005967 3300046506 Bacteria 8081
988 Ga0495583_0007992 3300046506 Bacteria 6542
989 Ga0495583_0017345 3300046506 Bacteria 3825
990 Ga0495583_0091190 3300046506 Bacteria 1311
991 Ga0495606_0000042 3300046507 Bacteria 215099
992 Ga0495606_0000094 3300046507 Bacteria 151840
993 Ga0495606_0000415 3300046507 Bacteria 71371
994 Ga0495606_0004342 3300046507 Bacteria 14233
995 Ga0495606_0006710 3300046507 Bacteria 10546
996 Ga0495606_0010458 3300046507 Bacteria 7697
997 Ga0495606_0014490 3300046507 Bacteria 6147
998 Ga0495606_0024275 3300046507 Bacteria 4373
999 Ga0495606_0036664 3300046507 Bacteria 3337
1000 Ga0495606_0039111 3300046507 Bacteria 3202
1001 Ga0495606_0052325 3300046507 Bacteria 2656
1002 Ga0495606_0088236 3300046507 Bacteria 1912
1003 Ga0495606_0169291 3300046507 Bacteria 1269
1004 Ga0495608_0014841 3300046511 Bacteria 5405
1005 Ga0495608_0214098 3300046511 Bacteria 1210
1006 Ga0495610_0002926 3300046512 Bacteria 13804
1007 Ga0495610_0011761 3300046512 Bacteria 5316
1008 Ga0495610_0019341 3300046512 Bacteria 3815
1009 Ga0495610_0021121 3300046512 Bacteria 3587
1010 Ga0495610_0026266 3300046512 Bacteria 3111
1011 Ga0495610_0034583 3300046512 Bacteria 2602
1012 Ga0495610_0053459 3300046512 Bacteria 1956
1013 Ga0495610_0083878 3300046512 Bacteria 1457
1014 Ga0495610_0132491 3300046512 Bacteria 1081
1015 Ga0495616_0006962 3300046513 Bacteria 6809
1016 Ga0495616_0013952 3300046513 Bacteria 4514
1017 Ga0495616_0049861 3300046513 Bacteria 2096
1018 Ga0495616_0257611 3300046513 Bacteria 747
1019 Ga0495618_0117375 3300046514 Bacteria 1704
1020 Ga0495618_0489653 3300046514 Bacteria 742
1021 Ga0495620_0000322 3300046515 Bacteria 33867
1022 Ga0495620_0000370 3300046515 Bacteria 30870
1023 Ga0495620_0000712 3300046515 Bacteria 20529
1024 Ga0495620_0004434 3300046515 Bacteria 7912
1025 Ga0495620_0015211 3300046515 Bacteria 3889
1026 Ga0495620_0029580 3300046515 Bacteria 2532
1027 Ga0495620_0041274 3300046515 Bacteria 2025
1028 Ga0495620_0073965 3300046515 Bacteria 1389
1029 Ga0495620_0120267 3300046515 Bacteria 1035
1030 Ga0495628_0019455 3300046516 Bacteria 5612
1031 Ga0495628_0023111 3300046516 Bacteria 5105
1032 Ga0495628_0043863 3300046516 Bacteria 3560
1033 Ga0495630_0302918 3300046517 Bacteria 1221
1034 Ga0495630_0343695 3300046517 Bacteria 1142
1035 Ga0495631_0009296 3300046518 Bacteria 4915
1036 Ga0495631_0013326 3300046518 Bacteria 3992
1037 Ga0495631_0058600 3300046518 Bacteria 1674
1038 Ga0495631_0077096 3300046518 Bacteria 1438
1039 Ga0495632_0000839 3300046519 Bacteria 27070
1040 Ga0495632_0002490 3300046519 Bacteria 13979
1041 Ga0495632_0003654 3300046519 Bacteria 10796
1042 Ga0495632_0007029 3300046519 Bacteria 7136
1043 Ga0495632_0017521 3300046519 Bacteria 3950
1044 Ga0495632_0068575 3300046519 Bacteria 1709
1045 Ga0495632_0076860 3300046519 Bacteria 1596
1046 Ga0495632_0112566 3300046519 Bacteria 1277
1047 Ga0495632_0244946 3300046519 Bacteria 805
1048 Ga0495637_0000518 3300046520 Bacteria 27995
1049 Ga0495637_0002120 3300046520 Bacteria 11144
1050 Ga0495637_0002498 3300046520 Bacteria 10150
1051 Ga0495637_0006632 3300046520 Bacteria 5795
1052 Ga0495637_0011157 3300046520 Bacteria 4322
1053 Ga0495637_0013035 3300046520 Bacteria 3958
1054 Ga0495637_0054447 3300046520 Bacteria 1662
1055 Ga0495637_0090531 3300046520 Bacteria 1207
1056 Ga0495637_0098999 3300046520 Bacteria 1141
1057 Ga0495643_0001985 3300046522 Bacteria 17133
1058 Ga0495643_0027906 3300046522 Bacteria 3168
1059 Ga0495643_0072791 3300046522 Bacteria 1801
1060 Ga0495643_0228252 3300046522 Bacteria 879
1061 Ga0495643_0273125 3300046522 Bacteria 780
1062 Ga0495644_0003319 3300046523 Bacteria 6361
1063 Ga0495644_0022555 3300046523 Bacteria 2399
1064 Ga0495648_0003291 3300046524 Bacteria 14274
1065 Ga0495648_0009523 3300046524 Bacteria 7506
1066 Ga0495648_0012087 3300046524 Bacteria 6462
1067 Ga0495648_0015690 3300046524 Bacteria 5487
1068 Ga0495648_0021890 3300046524 Bacteria 4415
1069 Ga0495648_0021980 3300046524 Bacteria 4404
1070 Ga0495648_0034583 3300046524 Bacteria 3286
1071 Ga0495648_0085577 3300046524 Bacteria 1780
1072 Ga0495648_0328987 3300046524 Bacteria 705
1073 Ga0495663_0037378 3300046525 Unclassified 1464
1074 Ga0495666_0002123 3300046526 Bacteria 9831
1075 Ga0495666_0015904 3300046526 Bacteria 3747
1076 Ga0495642_0001683 3300046528 Bacteria 9580
1077 Ga0495652_0003383 3300046529 Bacteria 15774
1078 Ga0495652_0014655 3300046529 Bacteria 7030
1079 Ga0495652_0018360 3300046529 Bacteria 6237
1080 Ga0495652_0062372 3300046529 Bacteria 3143
1081 Ga0495654_0009795 3300046530 Bacteria 5236
1082 Ga0495654_0010614 3300046530 Bacteria 5005
1083 Ga0495654_0010779 3300046530 Bacteria 4965
1084 Ga0495654_0018508 3300046530 Bacteria 3649
1085 Ga0495654_0027630 3300046530 Bacteria 2907
1086 Ga0495654_0045750 3300046530 Bacteria 2158
1087 Ga0495654_0054388 3300046530 Bacteria 1942
1088 Ga0495654_0138228 3300046530 Bacteria 1088
1089 Ga0495586_0090429 3300046535 Bacteria 1690
1090 Ga0495587_0096907 3300046536 Bacteria 1701
1091 Ga0495609_0000115 3300046538 Bacteria 93419
1092 Ga0495609_0000395 3300046538 Bacteria 36677
1093 Ga0495609_0001220 3300046538 Bacteria 17715
1094 Ga0495609_0027036 3300046538 Bacteria 2623
1095 Ga0495609_0089017 3300046538 Bacteria 1343
1096 Ga0495609_0104390 3300046538 Bacteria 1226
1097 Ga0495597_0001034 3300046542 Bacteria 21263
1098 Ga0495597_0003290 3300046542 Bacteria 9561
1099 Ga0495597_0009290 3300046542 Bacteria 4866
1100 Ga0495597_0038735 3300046542 Bacteria 2136
1101 Ga0495645_0041759 3300046543 Bacteria 3344
1102 Ga0495645_0146948 3300046543 Bacteria 1641
1103 Ga0495645_0234638 3300046543 Bacteria 1227
1104 Ga0495622_0001521 3300046557 Bacteria 11587
1105 Ga0495622_0010711 3300046557 Bacteria 4231
1106 Ga0495622_0015667 3300046557 Bacteria 3524
1107 Ga0495633_0001693 3300046558 Bacteria 16578
1108 Ga0495633_0003880 3300046558 Bacteria 9752
1109 Ga0495633_0018744 3300046558 Bacteria 3510
1110 Ga0495633_0104180 3300046558 Bacteria 1316
1111 Ga0495668_0000025 3300046616 Bacteria 304546
1112 Ga0495668_0000034 3300046616 Bacteria 254171
1113 Ga0495668_0003196 3300046616 Bacteria 12548
1114 Ga0495668_0018558 3300046616 Bacteria 4019
1115 Ga0495668_0045515 3300046616 Bacteria 2440
1116 Ga0495611_0000736 3300046648 Bacteria 18466
1117 Ga0495611_0000932 3300046648 Bacteria 15712
1118 Ga0495611_0004344 3300046648 Bacteria 6144
1119 Ga0495611_0011566 3300046648 Bacteria 3743
1120 Ga0495611_0118484 3300046648 Bacteria 1234
1121 Ga0495625_0000672 3300046660 Bacteria 48741
1122 Ga0495625_0001328 3300046660 Bacteria 30717
1123 Ga0495625_0002338 3300046660 Bacteria 20719
1124 Ga0495625_0003330 3300046660 Bacteria 16184
1125 Ga0495625_0007862 3300046660 Bacteria 9187
1126 Ga0495625_0013918 3300046660 Bacteria 6441
1127 Ga0495625_0015980 3300046660 Bacteria 5920
1128 Ga0495625_0029666 3300046660 Bacteria 4087
1129 Ga0495625_0034457 3300046660 Bacteria 3737
1130 Ga0495625_0058185 3300046660 Bacteria 2747
1131 Ga0495625_0125368 3300046660 Bacteria 1744
1132 Ga0495625_0327292 3300046660 Bacteria 974
1133 Ga0495635_0142949 3300046663 Bacteria 1629
1134 Ga0495659_0003001 3300046664 Bacteria 5412
1135 Ga0495661_0000205 3300046665 Bacteria 68743
1136 Ga0495661_0000437 3300046665 Bacteria 44095
1137 Ga0495661_0000685 3300046665 Bacteria 33805
1138 Ga0495661_0001817 3300046665 Bacteria 17115
1139 Ga0495661_0015865 3300046665 Bacteria 5014
1140 Ga0495661_0021833 3300046665 Bacteria 4167
1141 Ga0495661_0030083 3300046665 Bacteria 3460
1142 Ga0495661_0050094 3300046665 Bacteria 2530
1143 Ga0495661_0117772 3300046665 Bacteria 1471
1144 Ga0495661_0170983 3300046665 Bacteria 1159
1145 Ga0495588_0386856 3300046674 Bacteria 734
1146 Ga0495657_0078730 3300046675 Bacteria 2136
1147 Ga0495657_0169271 3300046675 Bacteria 1346
1148 Ga0495599_0065919 3300046678 Bacteria 2262
1149 Ga0495599_0092568 3300046678 Bacteria 1886
1150 Ga0495623_0006272 3300046679 Bacteria 7731
1151 Ga0495623_0011011 3300046679 Bacteria 5853
1152 Ga0495623_0117161 3300046679 Bacteria 1608
1153 Ga0495646_0031113 3300046680 Bacteria 3329
1154 Ga0495646_0167151 3300046680 Bacteria 1214
1155 Ga0495669_0005645 3300046684 Bacteria 5222
1156 Ga0495624_0008471 3300046690 Bacteria 7167
1157 Ga0495624_0008919 3300046690 Bacteria 6971
1158 Ga0495624_0090273 3300046690 Bacteria 1890
1159 Ga0495624_0205268 3300046690 Bacteria 1196
1160 Ga0495670_0007244 3300046691 Bacteria 5455
1161 Ga0495670_0037571 3300046691 Bacteria 2413
1162 Ga0495670_0149284 3300046691 Bacteria 1225
1163 Ga0495671_0003674 3300046692 Bacteria 9339
1164 Ga0495671_0004465 3300046692 Bacteria 8360
1165 Ga0495671_0004983 3300046692 Bacteria 7824
1166 Ga0495671_0007822 3300046692 Bacteria 6049
1167 Ga0495671_0015205 3300046692 Bacteria 4130
1168 Ga0495671_0015406 3300046692 Bacteria 4095
1169 Ga0495671_0034356 3300046692 Bacteria 2578
1170 Ga0495671_0104254 3300046692 Bacteria 1385
1171 Ga0495671_0115800 3300046692 Bacteria 1308
1172 Ga0495671_0121301 3300046692 Bacteria 1275
1173 Ga0495649_0000813 3300046694 Bacteria 25176
1174 Ga0495649_0001962 3300046694 Bacteria 14916
1175 Ga0495649_0011895 3300046694 Bacteria 5085
1176 Ga0495649_0023047 3300046694 Bacteria 3478
1177 Ga0495649_0047497 3300046694 Bacteria 2334
1178 Ga0495649_0055434 3300046694 Bacteria 2141
1179 Ga0495649_0070460 3300046694 Bacteria 1874
1180 Ga0495649_0084108 3300046694 Bacteria 1699
1181 Ga0495649_0098503 3300046694 Bacteria 1555
1182 Ga0495649_0211595 3300046694 Bacteria 1004
1183 Ga0495649_0358682 3300046694 Bacteria 736
1184 Ga0495589_0003822 3300046794 Bacteria 8093
1185 Ga0495589_0006874 3300046794 Bacteria 5981
1186 Ga0495589_0009064 3300046794 Bacteria 5173
1187 Ga0495600_0005056 3300046809 Bacteria 7922
1188 Ga0495600_0022072 3300046809 Bacteria 4084
1189 Ga0495600_0115827 3300046809 Bacteria 1744
1190 Ga0495600_0447738 3300046809 Bacteria 799
1191 Ga0495660_0001767 3300046810 Bacteria 14330
1192 Ga0495660_0002709 3300046810 Bacteria 11186
1193 Ga0495660_0003160 3300046810 Bacteria 10257
1194 Ga0495660_0006768 3300046810 Bacteria 6759
1195 Ga0495660_0011688 3300046810 Bacteria 5092
1196 Ga0495660_0028243 3300046810 Bacteria 3171
1197 Ga0495660_0043308 3300046810 Bacteria 2483
1198 Ga0495660_0079486 3300046810 Bacteria 1722
1199 Ga0495660_0093520 3300046810 Bacteria 1558
1200 Ga0495660_0093707 3300046810 Bacteria 1556
1201 Ga0495660_0187273 3300046810 Bacteria 997
1202 Ga0495660_0251164 3300046810 Bacteria 820
1203 Ga0495604_0015148 3300047317 Bacteria 6153
1204 Ga0495636_0002862 3300047318 Bacteria 6662
1205 Ga0495674_0371631 3300047319 Bacteria 1158
1206 Ga0495674_0752674 3300047319 Bacteria 761
1207 Ga0495672_0003648 3300047320 Bacteria 13034
1208 Ga0495672_0008206 3300047320 Bacteria 7744
1209 Ga0495672_0008237 3300047320 Bacteria 7727
1210 Ga0495672_0012356 3300047320 Bacteria 5962
1211 Ga0495672_0029446 3300047320 Bacteria 3458
1212 Ga0495672_0029976 3300047320 Bacteria 3419
1213 Ga0495672_0035502 3300047320 Bacteria 3070
1214 Ga0495672_0044459 3300047320 Bacteria 2664
1215 Ga0495672_0085170 3300047320 Bacteria 1752
1216 Ga0495676_0000171 3300047321 Bacteria 50588
1217 Ga0495676_0005618 3300047321 Bacteria 11494
1218 Ga0495676_0019092 3300047321 Bacteria 6035
1219 Ga0495676_0287743 3300047321 Bacteria 1111
1220 Ga0495680_0013577 3300047322 Bacteria 7098
1221 Ga0495680_0195899 3300047322 Bacteria 1451
1222 Ga0495680_0245429 3300047322 Bacteria 1270
1223 Ga0495680_0590021 3300047322 Bacteria 744
1224 Ga0495683_0000507 3300047323 Bacteria 30072
1225 Ga0495683_0002187 3300047323 Bacteria 11984
1226 Ga0495683_0004452 3300047323 Bacteria 7955
1227 Ga0495683_0060803 3300047323 Bacteria 1871
1228 Ga0495683_0112566 3300047323 Bacteria 1298
1229 Ga0495687_014652 3300047443 Bacteria 4022
1230 Ga0495675_0160520 3300047444 Bacteria 1384
1231 Ga0495679_000119 3300047446 Bacteria 69255
1232 Ga0495679_000616 3300047446 Bacteria 24020
1233 Ga0495679_005316 3300047446 Bacteria 5728
1234 Ga0495679_005487 3300047446 Bacteria 5616
1235 Ga0495679_011231 3300047446 Bacteria 3470
1236 Ga0495673_0002146 3300047469 Bacteria 14327
1237 Ga0495673_0003396 3300047469 Bacteria 10517
1238 Ga0495673_0004684 3300047469 Bacteria 8491
1239 Ga0495673_0006738 3300047469 Bacteria 6713
1240 Ga0495673_0014086 3300047469 Bacteria 4169
1241 Ga0495673_0015086 3300047469 Bacteria 3993
1242 Ga0495673_0016949 3300047469 Bacteria 3712
1243 Ga0495673_0021460 3300047469 Bacteria 3187
1244 Ga0495673_0032777 3300047469 Bacteria 2417
1245 Ga0495673_0071120 3300047469 Bacteria 1463
1246 Ga0495673_0087608 3300047469 Bacteria 1277
1247 Ga0495673_0092902 3300047469 Bacteria 1230
1248 Ga0495673_0106155 3300047469 Bacteria 1128
1249 Ga0495681_0006275 3300047470 Bacteria 7830
1250 Ga0495681_0007039 3300047470 Bacteria 7263
1251 Ga0495681_0011334 3300047470 Bacteria 5316
1252 Ga0495681_0016651 3300047470 Bacteria 4110
1253 Ga0495681_0018332 3300047470 Bacteria 3859
1254 Ga0495681_0021522 3300047470 Bacteria 3472
1255 Ga0495681_0022687 3300047470 Bacteria 3352
1256 Ga0495681_0028069 3300047470 Bacteria 2901
1257 Ga0495681_0106035 3300047470 Bacteria 1222
1258 Ga0495684_0239586 3300047471 Bacteria 1324
1259 Ga0495686_0004625 3300047472 Bacteria 11194
1260 Ga0495686_0013186 3300047472 Bacteria 5748
1261 Ga0495686_0049354 3300047472 Bacteria 2648
1262 Ga0495686_0145655 3300047472 Bacteria 1394
1263 Ga0495686_0150339 3300047472 Bacteria 1367
1264 Ga0495686_0350079 3300047472 Bacteria 803
1265 Ga0495593_0005528 3300047673 Bacteria 7462
1266 Ga0495593_0036138 3300047673 Bacteria 2680
1267 Ga0495602_0035542 3300048088 Bacteria 4646
1268 Ga0495602_0052798 3300048088 Bacteria 3606
1269 Ga0495602_0189543 3300048088 Bacteria 1578
1270 Ga0495602_0339293 3300048088 Bacteria 1087
1271 Ga0495602_0502137 3300048088 Bacteria 848
1272 Ga0495626_0000123 3300048091 Bacteria 100704
1273 Ga0495626_0003485 3300048091 Bacteria 10079
1274 Ga0495626_0009762 3300048091 Bacteria 5168
1275 Ga0495626_0040937 3300048091 Bacteria 2185
1276 Ga0495626_0052685 3300048091 Bacteria 1875
1277 Ga0495626_0055747 3300048091 Bacteria 1810
1278 Ga0496100_0481852 3300048903 Bacteria 954
1279 Ga0496101_0540725 3300048904 Bacteria 921
1280 Ga0496102_0062552 3300048905 Bacteria 3408
1281 Ga0496102_0296561 3300048905 Bacteria 1524
1282 Ga0496103_0077612 3300048906 Bacteria 2085
1283 Ga0496106_0265042 3300048909 Bacteria 1375
1284 Ga0496108_0358924 3300048911 Bacteria 1272
1285 Ga0496108_0382610 3300048911 Bacteria 1229
1286 Ga0496110_0229455 3300048913 Bacteria 1688
1287 Ga0496110_0270918 3300048913 Bacteria 1546
1288 Ga0496112_0001839 3300048915 Bacteria 16699
1289 Ga0496112_0043323 3300048915 Bacteria 4406
1290 Ga0496112_0526048 3300048915 Bacteria 1117
1291 Ga0496113_0021787 3300048916 Bacteria 4525
1292 Ga0496113_0031793 3300048916 Bacteria 3833
1293 Ga0496113_0156192 3300048916 Bacteria 1802
1294 Ga0496114_0205139 3300048917 Bacteria 1728
1295 Ga0496115_0000272 3300048918 Bacteria 45410
1296 Ga0496115_0000603 3300048918 Bacteria 27521
1297 Ga0496115_0060115 3300048918 Bacteria 3061
1298 Ga0496115_0077865 3300048918 Bacteria 2697
1299 Ga0496115_0148277 3300048918 Bacteria 1936
1300 Ga0496115_0494381 3300048918 Bacteria 984
1301 Ga0496116_0001261 3300048919 Bacteria 29306
1302 Ga0496116_0009203 3300048919 Bacteria 8455
1303 Ga0496116_0065947 3300048919 Bacteria 2319
1304 Ga0496117_0007562 3300048920 Bacteria 10581
1305 Ga0496117_0013964 3300048920 Bacteria 6959
1306 Ga0496117_0043017 3300048920 Bacteria 3290
1307 Ga0496117_0275142 3300048920 Bacteria 904
1308 Ga0496118_0000110 3300048921 Bacteria 152891
1309 Ga0496118_0106046 3300048921 Bacteria 1881
1310 Ga0496118_0202860 3300048921 Bacteria 1172
1311 Ga0496118_0212095 3300048921 Bacteria 1135
1312 Ga0496119_0018322 3300048922 Bacteria 5222
1313 Ga0496121_0003265 3300048924 Bacteria 23309
1314 Ga0496121_0007177 3300048924 Bacteria 13499
1315 Ga0496121_0022646 3300048924 Bacteria 6083
1316 Ga0496121_0023406 3300048924 Bacteria 5950
1317 Ga0496121_0027767 3300048924 Bacteria 5287
1318 Ga0496121_0049083 3300048924 Bacteria 3583
1319 Ga0496121_0073761 3300048924 Bacteria 2733
1320 Ga0496121_0157459 3300048924 Bacteria 1665
1321 Ga0496121_0298633 3300048924 Bacteria 1094
1322 Ga0496121_0495183 3300048924 Bacteria 777
1323 Ga0496122_0000156 3300048925 Bacteria 160178
1324 Ga0496122_0000203 3300048925 Bacteria 132679
1325 Ga0496122_0001639 3300048925 Bacteria 34793
1326 Ga0496122_0001861 3300048925 Bacteria 32176
1327 Ga0496122_0005055 3300048925 Bacteria 15939
1328 Ga0496122_0031343 3300048925 Bacteria 4427
1329 Ga0496122_0039759 3300048925 Bacteria 3746
1330 Ga0496122_0040203 3300048925 Bacteria 3721
1331 Ga0496122_0080009 3300048925 Bacteria 2281
1332 Ga0496122_0125128 3300048925 Bacteria 1647
1333 Ga0496123_0000087 3300048926 Bacteria 182994
1334 Ga0496123_0000164 3300048926 Bacteria 132565
1335 Ga0496123_0001205 3300048926 Bacteria 37836
1336 Ga0496123_0001590 3300048926 Bacteria 30876
1337 Ga0496123_0007317 3300048926 Bacteria 10466
1338 Ga0496123_0008731 3300048926 Bacteria 9251
1339 Ga0496123_0035809 3300048926 Bacteria 3530
1340 Ga0496123_0080573 3300048926 Bacteria 1983
1341 Ga0496123_0112383 3300048926 Bacteria 1553
1342 Ga0496123_0155192 3300048926 Bacteria 1228
1343 Ga0496123_0316871 3300048926 Bacteria 738
1344 Ga0496124_0000006 3300048927 Bacteria 904259
1345 Ga0496124_0000625 3300048927 Bacteria 58974
1346 Ga0496124_0004834 3300048927 Bacteria 15491
1347 Ga0496124_0014633 3300048927 Bacteria 7575
1348 Ga0496124_0034319 3300048927 Bacteria 4454
1349 Ga0496124_0038440 3300048927 Bacteria 4156
1350 Ga0496124_0204851 3300048927 Bacteria 1497
1351 Ga0496124_0231951 3300048927 Bacteria 1379
1352 Ga0496124_0381799 3300048927 Bacteria 985
1353 Ga0496124_0430146 3300048927 Bacteria 906
1354 Ga0496125_0000144 3300048928 Bacteria 156270
1355 Ga0496125_0000453 3300048928 Bacteria 74032
1356 Ga0496125_0003794 3300048928 Bacteria 17970
1357 Ga0496125_0028662 3300048928 Bacteria 5022
1358 Ga0496126_0012736 3300048929 Bacteria 8596
1359 Ga0496126_0033969 3300048929 Bacteria 4796
1360 Ga0496126_0097693 3300048929 Bacteria 2573
1361 Ga0496126_0169439 3300048929 Bacteria 1861
1362 Ga0496126_0423695 3300048929 Bacteria 1075
1363 Ga0495678_000020 3300049459 Bacteria 253654
1364 Ga0495678_003152 3300049459 Bacteria 10408
1365 Ga0495678_003293 3300049459 Bacteria 10086
1366 Ga0495678_003507 3300049459 Bacteria 9650
1367 Ga0495678_013660 3300049459 Bacteria 3801
1368 Ga0495678_014347 3300049459 Bacteria 3686
1369 Ga0495678_014358 3300049459 Bacteria 3684
1370 Ga0495678_018085 3300049459 Bacteria 3177
1371 Ga0495678_032830 3300049459 Bacteria 2147
1372 Ga0495678_035839 3300049459 Bacteria 2030
1373 Ga0495678_105558 3300049459 Bacteria 969
1374 Ga0495682_0000586 3300049460 Bacteria 24744
1375 Ga0495682_0002009 3300049460 Bacteria 10039
1376 Ga0495682_0005889 3300049460 Bacteria 5031
1377 Ga0501032_0497113 3300049569 Bacteria 780
1378 Ga0501033_0005599 3300049570 Bacteria 9920
1379 Ga0501033_0219951 3300049570 Bacteria 1352
1380 Ga0501034_0001143 3300049571 Bacteria 36925
1381 Ga0501034_0007022 3300049571 Bacteria 12011
1382 Ga0501034_0013846 3300049571 Bacteria 8302
1383 Ga0501034_0022920 3300049571 Bacteria 6362
1384 Ga0501034_0144429 3300049571 Bacteria 2357
1385 Ga0501034_0153669 3300049571 Bacteria 2276
1386 Ga0501034_0579291 3300049571 Bacteria 1029
1387 Ga0501036_0015983 3300049572 Bacteria 6269
1388 Ga0501038_0044736 3300049574 Bacteria 3845
1389 Ga0501039_0002412 3300049575 Bacteria 13907
1390 Ga0501039_0305875 3300049575 Bacteria 1250
1391 Ga0501040_0034026 3300049576 Bacteria 3453
1392 Ga0501041_0029168 3300049577 Bacteria 3328
1393 Ga0501042_0005080 3300049578 Bacteria 8442
1394 Ga0501042_0133279 3300049578 Bacteria 1791
1395 Ga0501043_0003327 3300049579 Bacteria 13249
1396 Ga0501043_0075596 3300049579 Bacteria 2646
1397 Ga0501043_0486007 3300049579 Bacteria 924
1398 Ga0501046_0012903 3300049580 Bacteria 7105
1399 Ga0501047_0039535 3300049581 Bacteria 4562
1400 Ga0501047_0053424 3300049581 Bacteria 3907
1401 Ga0501047_0080968 3300049581 Bacteria 3122
1402 Ga0501068_0000930 3300049584 Bacteria 15380
1403 Ga0501070_0079142 3300049586 Bacteria 2720
1404 Ga0501070_0264244 3300049586 Bacteria 1406
1405 Ga0501071_0467023 3300049587 Bacteria 966
1406 Ga0501072_0010165 3300049588 Bacteria 7167
1407 Ga0501072_0381629 3300049588 Bacteria 1118
1408 Ga0501073_0044984 3300049589 Bacteria 3111
1409 Ga0501073_0064473 3300049589 Bacteria 2555
1410 Ga0501074_0058162 3300049590 Bacteria 2785
1411 Ga0501076_0008593 3300049592 Bacteria 7491
1412 Ga0501076_0377147 3300049592 Bacteria 1166
1413 Ga0501077_0007696 3300049593 Bacteria 6648
1414 Ga0501077_0489887 3300049593 Bacteria 788
1415 Ga0501257_050780 3300049686 Bacteria 1034
1416 Ga0501079_0188946 3300049741 Bacteria 1607
1417 Ga0501080_0020448 3300049742 Bacteria 6128
1418 Ga0501080_0136946 3300049742 Unclassified 2265
1419 Ga0501080_0494998 3300049742 Bacteria 1093
1420 Ga0501081_0020291 3300049743 Bacteria 4429
1421 Ga0501083_0238302 3300049744 Bacteria 1184
1422 Ga0501241_004812 3300049758 Bacteria 2521
1423 Ga0501035_0004258 3300049822 Bacteria 13582
1424 Ga0501035_0024656 3300049822 Bacteria 5515
1425 Ga0501035_0155649 3300049822 Bacteria 1981
1426 Ga0501035_0416739 3300049822 Bacteria 1115
1427 Ga0501044_0002363 3300049823 Bacteria 21502
1428 Ga0501044_0069914 3300049823 Bacteria 3573
1429 Ga0501044_0072183 3300049823 Bacteria 3510
1430 Ga0501044_0278560 3300049823 Bacteria 1607
1431 Ga0501044_0331238 3300049823 Bacteria 1445
1432 Ga0501045_0012036 3300049824 Bacteria 6083
1433 Ga0501045_0224852 3300049824 Bacteria 1397
1434 nmdc:mga03683_3195_c1 3300050489 Bacteria 5235
1435 nmdc:mga0k408_19404_c1 3300050493 Bacteria 3800
1436 nmdc:mga07m45_13908_c2 3300050496 Bacteria 1571
1437 nmdc:mga0qj67_116626_c1 3300050509 Bacteria 2158
1438 nmdc:mga0sz30_118006_c1 3300050516 Bacteria 1165
1439 Ga0495601_0053137 3300053077 Bacteria 2560
1440 Ga0495601_0090848 3300053077 Bacteria 1965
1441 Ga0495601_0090990 3300053077 Bacteria 1964
1442 Ga0495601_0666155 3300053077 Bacteria 665
1443 Ga0500635_0004850 3300053080 Bacteria 3489
1444 Ga0495595_0073684 3300053084 Bacteria 1617
1445 Ga0495619_0395030 3300053085 Bacteria 955
1446 Ga0500643_000498 3300053087 Bacteria 28188
1447 Ga0500644_0001114 3300053088 Bacteria 7914
1448 Ga0500644_0064461 3300053088 Bacteria 1302
1449 Ga0500646_0105160 3300053090 Bacteria 891
1450 Ga0500583_0043969 3300053092 Bacteria 2043
1451 Ga0500583_0142876 3300053092 Bacteria 1190
1452 Ga0500555_028482 3300053103 Unclassified 1591
1453 Ga0500594_0019363 3300053118 Bacteria 1686
1454 Ga0500595_001126 3300053119 Bacteria 14807
1455 Ga0500607_049700 3300053121 Bacteria 2238
1456 Ga0500608_001477 3300053122 Bacteria 8402
1457 Ga0500617_060103 3300053124 Bacteria 1684
1458 Ga0500618_019033 3300053125 Bacteria 1693
1459 Ga0500642_0293386 3300053130 Bacteria 736
1460 Ga0500658_0012753 3300053134 Bacteria 3103
1461 Ga0500559_0001341 3300053136 Bacteria 14123
1462 Ga0500559_0010104 3300053136 Bacteria 4062
1463 Ga0500559_0143991 3300053136 Bacteria 1117
1464 Ga0500564_114763 3300053138 Bacteria 1179
1465 Ga0500568_0058092 3300053139 Bacteria 1504
1466 Ga0500573_0000071 3300053140 Bacteria 59706
1467 Ga0500573_0094310 3300053140 Bacteria 1688
1468 Ga0500574_005083 3300053141 Bacteria 2527
1469 Ga0500577_0298617 3300053142 Bacteria 703
1470 Ga0500588_0110221 3300053146 Bacteria 959
1471 Ga0500600_0005717 3300053149 Bacteria 7357
1472 Ga0500616_0024107 3300053153 Bacteria 3386
1473 Ga0500622_0001100 3300053156 Bacteria 22485
1474 Ga0500622_0173085 3300053156 Bacteria 1003
1475 Ga0500627_0346951 3300053158 Bacteria 641
1476 Ga0500636_0035697 3300053177 Bacteria 2941
1477 Ga0500611_089672 3300053727 Bacteria 781
1478 Ga0500645_007540 3300053730 Bacteria 3778
1479 Ga0500552_000300 3300053733 Bacteria 4486
1480 Ga0501084_0008983 3300054114 Bacteria 8264
1481 Ga0587111_0004128 3300060346 Bacteria 2134
1482 Ga0501082_0315950 3300060353 Bacteria 1361
1483 Ga0501082_0464469 3300060353 Bacteria 1106
1484 Ga0466962_0002025 3300061719 Bacteria 9565
1485 Ga0466962_0043341 3300061719 Bacteria 2153
1486 Ga0530510_0019831 3300061734 Bacteria 4778
1487 Ga0530510_0333456 3300061734 Bacteria 1138

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_0000561 Ga0451577_0000561_54430_55092 174
2 3300044712 Ga0453684_0532631 Ga0453684_0532631_252_914 174
3 3300042156 Ga0439446_0087263 Ga0439446_0087263_277_936 175
4 3300045051 Ga0451576_0132455 Ga0451576_0132455_850_1521 175
5 3300053136 Ga0500559_0143991 Ga0500559_0143991_374_1015 176
6 3300031548 Ga0307408_100100941 Ga0307408_1001009412 178
7 3300041997 Ga0439431_0010973 Ga0439431_0010973_913_1572 181
8 3300046660 Ga0495625_0003330 Ga0495625_0003330_9380_10033 182
9 3300050509 nmdc:mga0qj67_116626_c1 nmdc:mga0qj67_116626_c1_1480_2121 182
10 3300037312 Ga0395899_0000012 Ga0395899_0000012_8275_8919 184
11 3300046514 Ga0495618_0489653 Ga0495618_0489653_138_719 184
12 3300005328 Ga0070676_10016033 Ga0070676_100160332 185
13 3300005331 Ga0070670_100128471 Ga0070670_1001284713 185
14 3300005334 Ga0068869_100028286 Ga0068869_1000282863 185
15 3300005338 Ga0068868_100026781 Ga0068868_1000267814 185
16 3300005354 Ga0070675_100010835 Ga0070675_1000108359 185
17 3300005543 Ga0070672_100039537 Ga0070672_1000395373 185
18 3300005577 Ga0068857_100051007 Ga0068857_1000510073 185
19 3300025907 Ga0207645_10018585 Ga0207645_100185853 185
20 3300025940 Ga0207691_10133688 Ga0207691_101336883 185
21 3300026023 Ga0207677_10088036 Ga0207677_100880362 185
22 3300026116 Ga0207674_10011014 Ga0207674_1001101412 185
23 3300002739 JGI25158J39367_1004817 JGI25158J39367_10048172 186
24 3300002987 JGI25159J45721_1004581 JGI25159J45721_10045817 186
25 3300003374 JGI25161J50226_1000201 JGI25161J50226_100020126 186
26 3300004625 Ga0055543_1000103 Ga0055543_100010342 186
27 3300005262 Ga0065165_1000854 Ga0065165_100085427 186
28 3300025208 Ga0209436_100301 Ga0209436_10030110 186
29 3300025284 Ga0209130_1000188 Ga0209130_100018844 186
30 3300025302 Ga0207426_1049454 Ga0207426_10494542 186
31 3300028379 Ga0268266_11010465 Ga0268266_110104651 186
32 3300049581 Ga0501047_0080968 Ga0501047_0080968_897_1547 187
33 3300049822 Ga0501035_0416739 Ga0501035_0416739_300_950 187
34 3300025903 Ga0207680_10438600 Ga0207680_104386002 188
35 3300025909 Ga0207705_10234864 Ga0207705_102348642 188
36 3300025981 Ga0207640_10182581 Ga0207640_101825812 188
37 3300031456 Ga0307513_10350485 Ga0307513_103504852 188
38 3300037853 Ga0436364_0389486 Ga0436364_0389486_219_785 188
39 3300053080 Ga0500635_0004850 Ga0500635_0004850_2594_3235 188
40 3300053122 Ga0500608_001477 Ga0500608_001477_7248_7880 188
41 3300005336 Ga0070680_100124199 Ga0070680_1001241992 190
42 3300005530 Ga0070679_100156262 Ga0070679_1001562622 190
43 3300005548 Ga0070665_100534549 Ga0070665_1005345492 190
44 3300025917 Ga0207660_10154998 Ga0207660_101549982 190
45 3300025921 Ga0207652_10530962 Ga0207652_105309622 190
46 3300025986 Ga0207658_10117646 Ga0207658_101176462 190
47 3300038443 Ga0395901_0630531 Ga0395901_0630531_233_865 190
48 3300053087 Ga0500643_000498 Ga0500643_000498_26286_26912 190
49 3300033180 Ga0307510_10000118 Ga0307510_1000011812 191
50 3300035725 Ga0373947_0420280 Ga0373947_0420280_148_807 191
51 3300037312 Ga0395899_0010317 Ga0395899_0010317_1537_2160 191
52 3300037418 Ga0395900_0124178 Ga0395900_0124178_287_934 191
53 3300037466 Ga0395898_0110701 Ga0395898_0110701_820_1443 191
54 3300037466 Ga0395898_0626058 Ga0395898_0626058_85_732 191
55 3300037471 Ga0395905_0001886 Ga0395905_0001886_17412_18035 191
56 3300038443 Ga0395901_0003633 Ga0395901_0003633_8054_8677 191
57 3300046522 Ga0495643_0228252 Ga0495643_0228252_22_648 191
58 3300047319 Ga0495674_0371631 Ga0495674_0371631_397_1056 191
59 3300048088 Ga0495602_0502137 Ga0495602_0502137_123_782 191
60 3300013307 Ga0157372_10131453 Ga0157372_101314533 192
61 3300039062 Ga0400483_163079 Ga0400483_163079_666_1247 192
62 3300046506 Ga0495583_0004619 Ga0495583_0004619_8440_9066 192
63 3300046660 Ga0495625_0002338 Ga0495625_0002338_7915_8541 192
64 3300009545 Ga0105237_10058621 Ga0105237_100586213 193
65 3300014969 Ga0157376_10918310 Ga0157376_109183102 193
66 3300025914 Ga0207671_10004409 Ga0207671_100044097 193
67 3300035091 Ga0373951_0081722 Ga0373951_0081722_198_779 193
68 3300035691 Ga0373931_0072019 Ga0373931_0072019_42_623 193
69 3300037068 Ga0373925_0254489 Ga0373925_0254489_21_602 193
70 3300048927 Ga0496124_0231951 Ga0496124_0231951_736_1359 193
71 3300049569 Ga0501032_0497113 Ga0501032_0497113_180_770 193
72 3300053077 Ga0495601_0666155 Ga0495601_0666155_52_633 193
73 3300003322 rootL2_10039617 rootL2_100396172 194
74 3300005354 Ga0070675_100251931 Ga0070675_1002519312 194
75 iso_pu_bacteria 2904449895 2904455291 194
76 iso_pu_bacteria 2904456579 2904461324 194
77 iso_pu_bacteria 2919462493 2919466868 194
78 3300003323 rootH1_10249875 rootH1_102498751 195
79 3300005336 Ga0070680_100269382 Ga0070680_1002693822 195
80 3300005436 Ga0070713_100111919 Ga0070713_1001119192 195
81 3300005437 Ga0070710_10021874 Ga0070710_100218742 195
82 3300005439 Ga0070711_100438177 Ga0070711_1004381772 195
83 3300005458 Ga0070681_10308196 Ga0070681_103081962 195
84 3300005518 Ga0070699_100470317 Ga0070699_1004703172 195
85 3300005530 Ga0070679_100466101 Ga0070679_1004661012 195
86 3300005546 Ga0070696_100186255 Ga0070696_1001862552 195
87 3300025928 Ga0207700_10260945 Ga0207700_102609452 195
88 3300025929 Ga0207664_10044849 Ga0207664_100448495 195
89 3300032002 Ga0307416_100068548 Ga0307416_1000685483 195
90 3300037471 Ga0395905_0000136 Ga0395905_0000136_70981_71619 195
91 3300044658 Ga0466972_0137285 Ga0466972_0137285_464_1102 195
92 3300005353 Ga0070669_100764828 Ga0070669_1007648281 196
93 3300009177 Ga0105248_11132222 Ga0105248_111322222 196
94 3300044719 Ga0466971_0210867 Ga0466971_0210867_169_807 196
95 3300048925 Ga0496122_0080009 Ga0496122_0080009_94_717 196
96 3300048926 Ga0496123_0035809 Ga0496123_0035809_503_1126 196
97 3300048927 Ga0496124_0038440 Ga0496124_0038440_2388_3011 196
98 iso_pu_bacteria 2899275550 2899275640 196
99 iso_pu_bacteria 2643221609 2644063252 197
100 3300003792 Ga0055540_1010062 Ga0055540_10100624 198
101 3300005289 Ga0065704_10118926 Ga0065704_101189262 198
102 3300005842 Ga0068858_100139654 Ga0068858_1001396542 198
103 3300006177 Ga0075362_10000923 Ga0075362_100009232 198
104 3300009093 Ga0105240_10224191 Ga0105240_102241913 198
105 3300009101 Ga0105247_10018162 Ga0105247_100181623 198
106 3300013100 Ga0157373_10009218 Ga0157373_100092187 198
107 3300014325 Ga0163163_10012181 Ga0163163_100121813 198
108 3300014969 Ga0157376_10111105 Ga0157376_101111053 198
109 3300015261 Ga0182006_1104194 Ga0182006_11041942 198
110 3300025303 Ga0209051_1000979 Ga0209051_100097921 198
111 3300031731 Ga0307405_10301078 Ga0307405_103010782 198
112 3300031901 Ga0307406_10130772 Ga0307406_101307722 198
113 3300045051 Ga0451576_0097798 Ga0451576_0097798_1198_1800 198
114 3300045051 Ga0451576_0220133 Ga0451576_0220133_995_1618 198
115 3300048918 Ga0496115_0494381 Ga0496115_0494381_21_623 198
116 3300050489 nmdc:mga03683_3195_c1 nmdc:mga03683_3195_c1_2582_3178 198
117 3300053156 Ga0500622_0001100 Ga0500622_0001100_20753_21382 199
118 iso_pu_bacteria 2643221654 2644301090 199
119 iso_pu_bacteria 8016728285 8016731742 199
120 iso_pu_bacteria 2739367700 2739733513 200
121 iso_pu_bacteria 2842775625 2842776991 200
122 iso_pu_bacteria 2884411467 2884412791 200
123 iso_pu_bacteria 2894772417 2894775022 200
124 iso_pu_bacteria 2928963466 2928966808 200
125 3300003316 rootH1_10093753 rootH1_100937532 201
126 3300014497 Ga0182008_10038233 Ga0182008_100382332 201
127 3300015261 Ga0182006_1009331 Ga0182006_10093312 201
128 3300015265 Ga0182005_1000289 Ga0182005_10002891 201
129 3300037853 Ga0436364_0034966 Ga0436364_0034966_10_621 201
130 3300038705 Ga0237819_07641 Ga0237819_07641_832_1452 201
131 3300039453 Ga0436362_0202120 Ga0436362_0202120_336_947 201
132 3300048916 Ga0496113_0156192 Ga0496113_0156192_236_856 201
133 3300048924 Ga0496121_0023406 Ga0496121_0023406_4093_4719 201
134 3300049459 Ga0495678_105558 Ga0495678_105558_10_615 201
135 3300050516 nmdc:mga0sz30_118006_c1 nmdc:mga0sz30_118006_c1_295_906 201
136 3300053142 Ga0500577_0298617 Ga0500577_0298617_65_676 201
137 3300053153 Ga0500616_0024107 Ga0500616_0024107_2281_2892 201
138 3300053158 Ga0500627_0346951 Ga0500627_0346951_14_625 201
139 3300053177 Ga0500636_0035697 Ga0500636_0035697_139_750 201
140 iso_pu_bacteria 2599185359 2600227499 201
141 iso_pu_bacteria 2818991466 2819716083 201
142 iso_pu_bacteria 2879163058 2879163333 201
143 iso_pu_bacteria 2928526807 2928528143 201
144 iso_pu_bacteria 643348564 643602444 201
145 3300003761 Ga0055535_1000978 Ga0055535_10009785 202
146 3300003763 Ga0055529_1000610 Ga0055529_10006105 202
147 3300003771 Ga0055526_1000487 Ga0055526_100048718 202
148 3300003773 Ga0055537_1000035 Ga0055537_100003547 202
149 3300003775 Ga0055524_1021726 Ga0055524_10217262 202
150 3300003784 Ga0055534_1000325 Ga0055534_10003259 202
151 3300003790 Ga0055528_1000058 Ga0055528_100005838 202
152 3300021388 Ga0213875_10023663 Ga0213875_100236633 202
153 3300025228 Ga0209672_103395 Ga0209672_1033953 202
154 3300025242 Ga0209258_100071 Ga0209258_100071205 202
155 3300025254 Ga0209148_1004832 Ga0209148_10048322 202
156 3300025256 Ga0209759_1003025 Ga0209759_10030254 202
157 3300025263 Ga0209565_1000009 Ga0209565_1000009635 202
158 3300025272 Ga0209455_1000030 Ga0209455_100003066 202
159 3300025273 Ga0209673_1000036 Ga0209673_100003648 202
160 3300025291 Ga0209675_1000013 Ga0209675_100001348 202
161 3300025295 Ga0209564_1000122 Ga0209564_100012248 202
162 3300025299 Ga0209256_1000106 Ga0209256_1000106128 202
163 3300037853 Ga0436364_1529296 Ga0436364_1529296_5194_5808 202
164 3300039062 Ga0400483_000346 Ga0400483_000346_3587_4201 202
165 3300039062 Ga0400483_095196 Ga0400483_095196_3124_3738 202
166 3300039062 Ga0400483_171786 Ga0400483_171786_91_705 202
167 3300045976 Ga0466967_0356071 Ga0466967_0356071_217_831 202
168 3300048903 Ga0496100_0481852 Ga0496100_0481852_55_687 202
169 iso_pu_bacteria 2510065053 2510282948 202
170 iso_pu_bacteria 2510065055 2510293622 202
171 iso_pu_bacteria 2510065058 2510310772 202
172 iso_pu_bacteria 2511231004 2511256746 202
173 iso_pu_bacteria 2511231010 2511287653 202
174 iso_pu_bacteria 2511231011 2511294081 202
175 iso_pu_bacteria 2511231012 2511303121 202
176 iso_pu_bacteria 2511231015 2511319887 202
177 iso_pu_bacteria 2511231016 2511327730 202
178 iso_pu_bacteria 2511231017 2511331593 202
179 iso_pu_bacteria 2511231018 2511340314 202
180 iso_pu_bacteria 2511231019 2511344956 202
181 iso_pu_bacteria 2511231020 2511348646 202
182 iso_pu_bacteria 2511231022 2511360794 202
183 iso_pu_bacteria 2511231023 2511371090 202
184 iso_pu_bacteria 2511231031 2511410727 202
185 iso_pu_bacteria 2511231156 2511826113 202
186 iso_pu_bacteria 2597489889 2597866972 202
187 iso_pu_bacteria 2599185155 2599326628 202
188 iso_pu_bacteria 2599185188 2599504338 202
189 iso_pu_bacteria 2599185212 2599613628 202
190 iso_pu_bacteria 2599185248 2599773002 202
191 iso_pu_bacteria 2599185288 2599879345 202
192 iso_pu_bacteria 2599185289 2599889369 202
193 iso_pu_bacteria 2599185291 2599900767 202
194 iso_pu_bacteria 2599185300 2599933401 202
195 iso_pu_bacteria 2599185302 2599944146 202
196 iso_pu_bacteria 2599185303 2599948709 202
197 iso_pu_bacteria 2599185304 2599956364 202
198 iso_pu_bacteria 2599185305 2599963412 202
199 iso_pu_bacteria 2599185306 2599966542 202
200 iso_pu_bacteria 2599185307 2599970517 202
201 iso_pu_bacteria 2599185308 2599977679 202
202 iso_pu_bacteria 2599185309 2599985058 202
203 iso_pu_bacteria 2599185310 2599989316 202
204 iso_pu_bacteria 2599185311 2599994229 202
205 iso_pu_bacteria 2599185312 2600000288 202
206 iso_pu_bacteria 2599185314 2600011848 202
207 iso_pu_bacteria 2599185315 2600019337 202
208 iso_pu_bacteria 2599185316 2600023524 202
209 iso_pu_bacteria 2599185317 2600030674 202
210 iso_pu_bacteria 2599185318 2600037031 202
211 iso_pu_bacteria 2599185319 2600042454 202
212 iso_pu_bacteria 2599185320 2600049550 202
213 iso_pu_bacteria 2599185321 2600053847 202
214 iso_pu_bacteria 2599185322 2600060517 202
215 iso_pu_bacteria 2599185323 2600065616 202
216 iso_pu_bacteria 2599185324 2600070775 202
217 iso_pu_bacteria 2599185325 2600078301 202
218 iso_pu_bacteria 2600254930 2600360481 202
219 iso_pu_bacteria 2600255283 2601624908 202
220 iso_pu_bacteria 2600255296 2601693299 202
221 iso_pu_bacteria 2619619299 2621296521 202
222 iso_pu_bacteria 2623620443 2624482029 202
223 iso_pu_bacteria 2643221565 2643845072 202
224 iso_pu_bacteria 2643221571 2643873515 202
225 iso_pu_bacteria 2643221577 2643895807 202
226 iso_pu_bacteria 2643221650 2644286253 202
227 iso_pu_bacteria 2643221685 2644477999 202
228 iso_pu_bacteria 2667528170 2671093677 202
229 iso_pu_bacteria 2667528176 2671129093 202
230 iso_pu_bacteria 2675903515 2678264449 202
231 iso_pu_bacteria 2718217725 2718635272 202
232 iso_pu_bacteria 2738541265 2738673467 202
233 iso_pu_bacteria 2738541271 2738688496 202
234 iso_pu_bacteria 2738541282 2738751860 202
235 iso_pu_bacteria 2738541294 2738807569 202
236 iso_pu_bacteria 2738541303 2738860901 202
237 iso_pu_bacteria 2738541309 2738894929 202
238 iso_pu_bacteria 2738543016 2739264228 202
239 iso_pu_bacteria 2738543020 2739284892 202
240 iso_pu_bacteria 2738543021 2739290206 202
241 iso_pu_bacteria 2738543025 2739315061 202
242 iso_pu_bacteria 2744054620 2745004903 202
243 iso_pu_bacteria 2765235840 2765578237 202
244 iso_pu_bacteria 2773857672 2774129007 202
245 iso_pu_bacteria 2773857673 2774132930 202
246 iso_pu_bacteria 2784132063 2784263206 202
247 iso_pu_bacteria 2791355520 2794595962 202
248 iso_pu_bacteria 2808606361 2808856905 202
249 iso_pu_bacteria 2808606376 2808924261 202
250 iso_pu_bacteria 2808606378 2808936976 202
251 iso_pu_bacteria 2808606380 2808946354 202
252 iso_pu_bacteria 2808606383 2808965328 202
253 iso_pu_bacteria 2808606385 2808980119 202
254 iso_pu_bacteria 2808606388 2808995839 202
255 iso_pu_bacteria 2808606389 2809000184 202
256 iso_pu_bacteria 2808606445 2809218873 202
257 iso_pu_bacteria 2816332298 2817488000 202
258 iso_pu_bacteria 2818991436 2819543539 202
259 iso_pu_bacteria 2818991456 2819655767 202
260 iso_pu_bacteria 2825651385 2825656609 202
261 iso_pu_bacteria 2826581358 2826583068 202
262 iso_pu_bacteria 2842780639 2842782426 202
263 iso_pu_bacteria 2842815866 2842817526 202
264 iso_pu_bacteria 2842849001 2842850677 202
265 iso_pu_bacteria 2842854478 2842859300 202
266 iso_pu_bacteria 2852612431 2852616657 202
267 iso_pu_bacteria 2852657418 2852663017 202
268 iso_pu_bacteria 2852667396 2852671625 202
269 iso_pu_bacteria 2857442823 2857443924 202
270 iso_pu_bacteria 2860867994 2860868025 202
271 iso_pu_bacteria 2880230671 2880234631 202
272 iso_pu_bacteria 2904518522 2904521230 202
273 iso_pu_bacteria 2904550169 2904555284 202
274 iso_pu_bacteria 2913036834 2913040926 202
275 iso_pu_bacteria 2917832318 2917836877 202
276 iso_pu_bacteria 2919125081 2919125914 202
277 iso_pu_bacteria 2919456309 2919460967 202
278 iso_pu_bacteria 2919481497 2919487275 202
279 iso_pu_bacteria 2923586266 2923589963 202
280 iso_pu_bacteria 2928968154 2928971350 202
281 iso_pu_bacteria 2929144301 2929148425 202
282 iso_pu_bacteria 2929189879 2929189908 202
283 iso_pu_bacteria 2929199973 2929204315 202
284 iso_pu_bacteria 2931369376 2931374159 202
285 iso_pu_bacteria 2939622612 2939623926 202
286 iso_pu_bacteria 2939636861 2939637519 202
287 iso_pu_bacteria 2946006987 2946012923 202
288 iso_pu_bacteria 2946027586 2946028213 202
289 iso_pu_bacteria 2947233263 2947234734 202
290 iso_pu_bacteria 2969304461 2969308785 202
291 iso_pu_bacteria 2974298342 2974302578 202
292 iso_pu_bacteria 2984286254 2984290602 202
293 iso_pu_bacteria 2984499530 2984499836 202
294 iso_pu_bacteria 2984504281 2984506267 202
295 iso_pu_bacteria 2988728565 2988730026 202
296 iso_pu_bacteria 3007315729 3007315895 202
297 iso_pu_bacteria 3007395558 3007400967 202
298 iso_pu_bacteria 3007511990 3007515729 202
299 iso_pu_bacteria 3007614139 3007617863 202
300 iso_pu_bacteria 3007619802 3007619929 202
301 iso_pu_bacteria 3007855910 3007858925 202
302 iso_pu_bacteria 3007861166 3007865519 202
303 iso_pu_bacteria 8003014200 8003015638 202
304 iso_pu_bacteria 8034962539 8034965120 202
305 iso_pu_bacteria 8054503363 8054503576 202
306 iso_pu_bacteria 8056125926 8056127469 202
307 iso_pu_bacteria 8056143049 8056144946 202
308 iso_pu_bacteria 8056177738 8056180094 202
309 3300005262 Ga0065165_1000224 Ga0065165_100022449 203
310 3300005333 Ga0070677_10070743 Ga0070677_100707432 203
311 3300005347 Ga0070668_100336190 Ga0070668_1003361902 203
312 3300005364 Ga0070673_100019406 Ga0070673_1000194064 203
313 3300005457 Ga0070662_100074443 Ga0070662_1000744434 203
314 3300005564 Ga0070664_100190283 Ga0070664_1001902832 203
315 3300005841 Ga0068863_100336788 Ga0068863_1003367882 203
316 3300006237 Ga0097621_100516321 Ga0097621_1005163212 203
317 3300009098 Ga0105245_10257272 Ga0105245_102572722 203
318 3300009545 Ga0105237_10188719 Ga0105237_101887192 203
319 3300011119 Ga0105246_10023561 Ga0105246_100235612 203
320 3300013297 Ga0157378_10285618 Ga0157378_102856181 203
321 3300025242 Ga0209258_100459 Ga0209258_1004594 203
322 3300025284 Ga0209130_1000044 Ga0209130_1000044113 203
323 3300025914 Ga0207671_10223289 Ga0207671_102232892 203
324 3300025927 Ga0207687_10186128 Ga0207687_101861282 203
325 3300025933 Ga0207706_10094002 Ga0207706_100940024 203
326 3300025972 Ga0207668_10469968 Ga0207668_104699682 203
327 3300025981 Ga0207640_10021026 Ga0207640_100210265 203
328 3300026035 Ga0207703_10536907 Ga0207703_105369072 203
329 3300026089 Ga0207648_10004283 Ga0207648_1000428314 203
330 3300028786 Ga0307517_10005849 Ga0307517_1000584913 203
331 3300028794 Ga0307515_10013824 Ga0307515_1001382413 203
332 3300028794 Ga0307515_10133079 Ga0307515_101330792 203
333 3300031456 Ga0307513_10138965 Ga0307513_101389654 203
334 3300031507 Ga0307509_10003622 Ga0307509_1000362213 203
335 3300031507 Ga0307509_10023567 Ga0307509_100235678 203
336 3300031507 Ga0307509_10034645 Ga0307509_100346453 203
337 3300031507 Ga0307509_10067060 Ga0307509_100670604 203
338 3300031507 Ga0307509_10147362 Ga0307509_101473623 203
339 3300031616 Ga0307508_10002365 Ga0307508_100023657 203
340 3300031616 Ga0307508_10442277 Ga0307508_104422772 203
341 3300031616 Ga0307508_10481723 Ga0307508_104817232 203
342 3300031649 Ga0307514_10012360 Ga0307514_100123605 203
343 3300031730 Ga0307516_10063274 Ga0307516_100632744 203
344 3300031730 Ga0307516_10167955 Ga0307516_101679552 203
345 3300033179 Ga0307507_10092396 Ga0307507_100923962 203
346 3300033179 Ga0307507_10117726 Ga0307507_101177264 203
347 3300033180 Ga0307510_10014576 Ga0307510_100145762 203
348 3300033180 Ga0307510_10120543 Ga0307510_101205432 203
349 3300033180 Ga0307510_10145502 Ga0307510_101455022 203
350 3300033180 Ga0307510_10184103 Ga0307510_101841032 203
351 3300046454 Ga0495592_0000142 Ga0495592_0000142_11649_12275 203
352 3300046459 Ga0495629_0309896 Ga0495629_0309896_391_1017 203
353 3300046460 Ga0495638_0051434 Ga0495638_0051434_764_1399 203
354 3300046460 Ga0495638_0065460 Ga0495638_0065460_1197_1823 203
355 3300046460 Ga0495638_0175133 Ga0495638_0175133_430_1056 203
356 3300046491 Ga0495584_0002037 Ga0495584_0002037_9527_10162 203
357 3300046501 Ga0495607_0009553 Ga0495607_0009553_3179_3814 203
358 3300046506 Ga0495583_0091190 Ga0495583_0091190_199_834 203
359 3300046513 Ga0495616_0006962 Ga0495616_0006962_4156_4791 203
360 3300046514 Ga0495618_0117375 Ga0495618_0117375_258_884 203
361 3300046515 Ga0495620_0041274 Ga0495620_0041274_171_797 203
362 3300046517 Ga0495630_0302918 Ga0495630_0302918_186_812 203
363 3300046519 Ga0495632_0068575 Ga0495632_0068575_500_1126 203
364 3300046519 Ga0495632_0112566 Ga0495632_0112566_196_822 203
365 3300046524 Ga0495648_0328987 Ga0495648_0328987_49_684 203
366 3300046538 Ga0495609_0001220 Ga0495609_0001220_9181_9816 203
367 3300046616 Ga0495668_0000025 Ga0495668_0000025_148737_149372 203
368 3300046616 Ga0495668_0018558 Ga0495668_0018558_284_919 203
369 3300046660 Ga0495625_0029666 Ga0495625_0029666_1854_2489 203
370 3300046664 Ga0495659_0003001 Ga0495659_0003001_3155_3790 203
371 3300046665 Ga0495661_0015865 Ga0495661_0015865_2864_3499 203
372 3300046680 Ga0495646_0167151 Ga0495646_0167151_498_1124 203
373 3300046684 Ga0495669_0005645 Ga0495669_0005645_1829_2464 203
374 3300046690 Ga0495624_0008919 Ga0495624_0008919_4787_5413 203
375 3300046691 Ga0495670_0149284 Ga0495670_0149284_235_861 203
376 3300046692 Ga0495671_0104254 Ga0495671_0104254_35_670 203
377 3300046694 Ga0495649_0098503 Ga0495649_0098503_881_1525 203
378 3300047318 Ga0495636_0002862 Ga0495636_0002862_5729_6364 203
379 3300047321 Ga0495676_0019092 Ga0495676_0019092_3525_4151 203
380 3300047446 Ga0495679_005316 Ga0495679_005316_2356_2991 203
381 3300047470 Ga0495681_0006275 Ga0495681_0006275_437_1072 203
382 3300047673 Ga0495593_0036138 Ga0495593_0036138_1749_2375 203
383 3300048091 Ga0495626_0052685 Ga0495626_0052685_427_1053 203
384 3300049459 Ga0495678_014347 Ga0495678_014347_2987_3622 203
385 3300050496 nmdc:mga07m45_13908_c2 nmdc:mga07m45_13908_c2_327_992 203
386 3300053088 Ga0500644_0001114 Ga0500644_0001114_6387_7004 203
387 3300053092 Ga0500583_0043969 Ga0500583_0043969_573_1199 203
388 3300053118 Ga0500594_0019363 Ga0500594_0019363_624_1250 203
389 3300053121 Ga0500607_049700 Ga0500607_049700_326_952 203
390 3300053136 Ga0500559_0001341 Ga0500559_0001341_1214_1840 203
391 3300053138 Ga0500564_114763 Ga0500564_114763_106_732 203
392 3300053139 Ga0500568_0058092 Ga0500568_0058092_564_1190 203
393 3300053156 Ga0500622_0173085 Ga0500622_0173085_360_986 203
394 3300053733 Ga0500552_000300 Ga0500552_000300_1897_2523 203
395 iso_pu_bacteria 2501025501 2501070871 203
396 iso_pu_bacteria 2501025502 2501078568 203
397 iso_pu_bacteria 2501025504 2501413700 203
398 iso_pu_bacteria 2510917013 2511089625 203
399 iso_pu_bacteria 2510917014 2511095029 203
400 iso_pu_bacteria 2510917015 2511104685 203
401 iso_pu_bacteria 2515154189 2516016857 203
402 iso_pu_bacteria 2852653556 2852657290 203
403 iso_pu_bacteria 2879163058 2879164124 203
404 iso_pu_bacteria 2883087390 2883094613 203
405 iso_pu_bacteria 2884960567 2884963330 203
406 iso_pu_bacteria 2928972540 2928973921 203
407 iso_pu_bacteria 2977240413 2977241119 203
408 3300002067 JGI24735J21928_10000175 JGI24735J21928_100001757 204
409 3300002067 JGI24735J21928_10001426 JGI24735J21928_100014264 204
410 3300002737 JGI25162J39368_1000287 JGI25162J39368_10002876 204
411 3300002741 JGI25157J39369_1000217 JGI25157J39369_100021731 204
412 3300002771 JGI25163J39215_1000677 JGI25163J39215_10006772 204
413 3300002772 JGI25164J39214_1000672 JGI25164J39214_10006726 204
414 3300003214 JGI25165J46597_1000388 JGI25165J46597_100038831 204
415 3300003751 Ga0055538_1004584 Ga0055538_10045842 204
416 3300003761 Ga0055535_1000335 Ga0055535_10003356 204
417 3300003761 Ga0055535_1019184 Ga0055535_10191842 204
418 3300003762 Ga0055542_1000363 Ga0055542_100036331 204
419 3300003762 Ga0055542_1001209 Ga0055542_100120913 204
420 3300003763 Ga0055529_1000391 Ga0055529_100039131 204
421 3300003763 Ga0055529_1015679 Ga0055529_10156792 204
422 3300005327 Ga0070658_10173891 Ga0070658_101738912 204
423 3300005329 Ga0070683_100031670 Ga0070683_1000316702 204
424 3300005329 Ga0070683_100115303 Ga0070683_1001153032 204
425 3300005331 Ga0070670_100005054 Ga0070670_1000050541 204
426 3300005338 Ga0068868_100002077 Ga0068868_1000020773 204
427 3300005339 Ga0070660_100001110 Ga0070660_10000111015 204
428 3300005344 Ga0070661_100085612 Ga0070661_1000856123 204
429 3300005364 Ga0070673_100087809 Ga0070673_1000878091 204
430 3300005365 Ga0070688_100832145 Ga0070688_1008321451 204
431 3300005366 Ga0070659_100062514 Ga0070659_1000625142 204
432 3300005366 Ga0070659_100318943 Ga0070659_1003189432 204
433 3300005367 Ga0070667_100153202 Ga0070667_1001532023 204
434 3300005455 Ga0070663_100248073 Ga0070663_1002480732 204
435 3300005455 Ga0070663_100403662 Ga0070663_1004036622 204
436 3300005458 Ga0070681_10238260 Ga0070681_102382601 204
437 3300005466 Ga0070685_10031687 Ga0070685_100316872 204
438 3300005530 Ga0070679_100225783 Ga0070679_1002257831 204
439 3300005535 Ga0070684_100027746 Ga0070684_1000277462 204
440 3300005535 Ga0070684_100057175 Ga0070684_1000571752 204
441 3300005548 Ga0070665_100459856 Ga0070665_1004598562 204
442 3300005563 Ga0068855_100012376 Ga0068855_1000123765 204
443 3300005563 Ga0068855_100602645 Ga0068855_1006026452 204
444 3300005577 Ga0068857_100182706 Ga0068857_1001827062 204
445 3300005578 Ga0068854_100779783 Ga0068854_1007797831 204
446 3300005614 Ga0068856_100016100 Ga0068856_1000161005 204
447 3300005616 Ga0068852_100045673 Ga0068852_1000456733 204
448 3300005617 Ga0068859_100014157 Ga0068859_1000141573 204
449 3300005618 Ga0068864_100014348 Ga0068864_1000143482 204
450 3300005841 Ga0068863_100037327 Ga0068863_1000373272 204
451 3300005841 Ga0068863_100518383 Ga0068863_1005183832 204
452 3300005843 Ga0068860_100018457 Ga0068860_1000184575 204
453 3300005843 Ga0068860_100272470 Ga0068860_1002724701 204
454 3300005844 Ga0068862_100073069 Ga0068862_1000730693 204
455 3300006931 Ga0097620_100014159 Ga0097620_1000141596 204
456 3300009093 Ga0105240_10001607 Ga0105240_1000160728 204
457 3300009093 Ga0105240_10322835 Ga0105240_103228352 204
458 3300009093 Ga0105240_10381595 Ga0105240_103815952 204
459 3300009093 Ga0105240_11392873 Ga0105240_113928731 204
460 3300009551 Ga0105238_10036529 Ga0105238_100365292 204
461 3300009551 Ga0105238_10261347 Ga0105238_102613472 204
462 3300009551 Ga0105238_10777598 Ga0105238_107775982 204
463 3300010375 Ga0105239_10011357 Ga0105239_100113576 204
464 3300013100 Ga0157373_10003664 Ga0157373_100036648 204
465 3300013105 Ga0157369_10025617 Ga0157369_100256176 204
466 3300013105 Ga0157369_10147301 Ga0157369_101473012 204
467 3300013105 Ga0157369_10255746 Ga0157369_102557462 204
468 3300013296 Ga0157374_10000055 Ga0157374_1000005569 204
469 3300013296 Ga0157374_10003393 Ga0157374_100033937 204
470 3300013307 Ga0157372_10001079 Ga0157372_1000107923 204
471 3300013307 Ga0157372_10220879 Ga0157372_102208792 204
472 3300013307 Ga0157372_10544429 Ga0157372_105444291 204
473 3300013308 Ga0157375_10012489 Ga0157375_100124897 204
474 3300014497 Ga0182008_10112878 Ga0182008_101128782 204
475 3300014968 Ga0157379_10007766 Ga0157379_100077663 204
476 3300014969 Ga0157376_10159234 Ga0157376_101592342 204
477 3300015687 Ga0183368_1007 Ga0183368_1007260 204
478 3300025206 Ga0209435_106429 Ga0209435_1064292 204
479 3300025207 Ga0209760_100340 Ga0209760_1003406 204
480 3300025224 Ga0209784_100164 Ga0209784_10016430 204
481 3300025225 Ga0209566_102109 Ga0209566_1021093 204
482 3300025228 Ga0209672_102751 Ga0209672_1027514 204
483 3300025231 Ga0207427_100084 Ga0207427_10008454 204
484 3300025231 Ga0207427_101954 Ga0207427_1019542 204
485 3300025233 Ga0209437_100037 Ga0209437_10003769 204
486 3300025233 Ga0209437_100924 Ga0209437_1009249 204
487 3300025242 Ga0209258_100034 Ga0209258_100034263 204
488 3300025242 Ga0209258_100792 Ga0209258_10079211 204
489 3300025242 Ga0209258_101200 Ga0209258_1012006 204
490 3300025246 Ga0209646_1000895 Ga0209646_10008956 204
491 3300025250 Ga0209026_1000187 Ga0209026_100018740 204
492 3300025254 Ga0209148_1000001 Ga0209148_1000001441 204
493 3300025254 Ga0209148_1000002 Ga0209148_1000002395 204
494 3300025256 Ga0209759_1001499 Ga0209759_10014996 204
495 3300025256 Ga0209759_1001939 Ga0209759_10019396 204
496 3300025256 Ga0209759_1003373 Ga0209759_10033736 204
497 3300025261 Ga0209233_1000002 Ga0209233_10000021790 204
498 3300025261 Ga0209233_1020535 Ga0209233_10205352 204
499 3300025261 Ga0209233_1023887 Ga0209233_10238872 204
500 3300025272 Ga0209455_1000054 Ga0209455_1000054232 204
501 3300025272 Ga0209455_1003037 Ga0209455_10030376 204
502 3300025900 Ga0207710_10017120 Ga0207710_100171203 204
503 3300025903 Ga0207680_10036168 Ga0207680_100361682 204
504 3300025904 Ga0207647_10002310 Ga0207647_1000231012 204
505 3300025904 Ga0207647_10005179 Ga0207647_100051796 204
506 3300025909 Ga0207705_10171889 Ga0207705_101718892 204
507 3300025913 Ga0207695_10007231 Ga0207695_100072317 204
508 3300025913 Ga0207695_10242701 Ga0207695_102427012 204
509 3300025914 Ga0207671_10269649 Ga0207671_102696492 204
510 3300025919 Ga0207657_10009078 Ga0207657_100090782 204
511 3300025920 Ga0207649_10019952 Ga0207649_100199525 204
512 3300025920 Ga0207649_10123389 Ga0207649_101233892 204
513 3300025924 Ga0207694_10042761 Ga0207694_100427613 204
514 3300025932 Ga0207690_10096449 Ga0207690_100964493 204
515 3300025944 Ga0207661_10003004 Ga0207661_100030042 204
516 3300025944 Ga0207661_10091582 Ga0207661_100915823 204
517 3300025945 Ga0207679_10246545 Ga0207679_102465452 204
518 3300025949 Ga0207667_10009358 Ga0207667_100093587 204
519 3300025949 Ga0207667_10471054 Ga0207667_104710542 204
520 3300025960 Ga0207651_10341407 Ga0207651_103414072 204
521 3300025986 Ga0207658_10044979 Ga0207658_100449792 204
522 3300026035 Ga0207703_10553092 Ga0207703_105530922 204
523 3300026035 Ga0207703_10931067 Ga0207703_109310672 204
524 3300026041 Ga0207639_10193654 Ga0207639_101936542 204
525 3300026067 Ga0207678_10145112 Ga0207678_101451122 204
526 3300026088 Ga0207641_10365360 Ga0207641_103653602 204
527 3300026116 Ga0207674_10155541 Ga0207674_101555412 204
528 3300026142 Ga0207698_10008277 Ga0207698_100082772 204
529 3300028379 Ga0268266_10172820 Ga0268266_101728202 204
530 3300028380 Ga0268265_10289752 Ga0268265_102897522 204
531 3300028381 Ga0268264_10058224 Ga0268264_100582242 204
532 3300028381 Ga0268264_10643278 Ga0268264_106432781 204
533 3300031456 Ga0307513_10052805 Ga0307513_100528052 204
534 3300031456 Ga0307513_10117764 Ga0307513_101177642 204
535 3300031730 Ga0307516_10007666 Ga0307516_100076668 204
536 3300031995 Ga0307409_100207555 Ga0307409_1002075552 204
537 3300032004 Ga0307414_10112044 Ga0307414_101120443 204
538 3300035088 Ga0373940_0087971 Ga0373940_0087971_134_763 204
539 3300035112 Ga0373932_0054478 Ga0373932_0054478_102_731 204
540 3300035691 Ga0373931_0239671 Ga0373931_0239671_357_1007 204
541 3300037312 Ga0395899_0005005 Ga0395899_0005005_5248_5889 204
542 3300037312 Ga0395899_0012450 Ga0395899_0012450_1144_1785 204
543 3300037418 Ga0395900_0002549 Ga0395900_0002549_11475_12116 204
544 3300037418 Ga0395900_0006267 Ga0395900_0006267_7347_7988 204
545 3300037418 Ga0395900_0092457 Ga0395900_0092457_996_1694 204
546 3300037466 Ga0395898_0005884 Ga0395898_0005884_8922_9563 204
547 3300037466 Ga0395898_0508189 Ga0395898_0508189_14_661 204
548 3300037471 Ga0395905_0147935 Ga0395905_0147935_692_1333 204
549 3300038443 Ga0395901_0001400 Ga0395901_0001400_11065_11706 204
550 3300038443 Ga0395901_0003670 Ga0395901_0003670_9763_10404 204
551 3300042005 Ga0439448_0023985 Ga0439448_0023985_52_693 204
552 3300044656 Ga0466969_0034736 Ga0466969_0034736_1849_2541 204
553 3300044693 Ga0466961_0070693 Ga0466961_0070693_1448_2155 204
554 3300044765 Ga0466970_0179059 Ga0466970_0179059_422_1114 204
555 3300044765 Ga0466970_0381209 Ga0466970_0381209_45_734 204
556 3300045049 Ga0466959_0020575 Ga0466959_0020575_1384_2091 204
557 3300045049 Ga0466959_0139992 Ga0466959_0139992_869_1525 204
558 3300045049 Ga0466959_0288700 Ga0466959_0288700_97_786 204
559 3300046460 Ga0495638_0000048 Ga0495638_0000048_29938_30567 204
560 3300046460 Ga0495638_0000116 Ga0495638_0000116_97543_98181 204
561 3300046460 Ga0495638_0000609 Ga0495638_0000609_29875_30513 204
562 3300046471 Ga0495650_0000064 Ga0495650_0000064_33860_34498 204
563 3300046507 Ga0495606_0000415 Ga0495606_0000415_7895_8533 204
564 3300046507 Ga0495606_0014490 Ga0495606_0014490_923_1576 204
565 3300046530 Ga0495654_0138228 Ga0495654_0138228_295_924 204
566 3300046557 Ga0495622_0015667 Ga0495622_0015667_1160_1798 204
567 3300046660 Ga0495625_0007862 Ga0495625_0007862_4974_5612 204
568 3300046660 Ga0495625_0034457 Ga0495625_0034457_61_699 204
569 3300046660 Ga0495625_0125368 Ga0495625_0125368_310_939 204
570 3300046694 Ga0495649_0001962 Ga0495649_0001962_11200_11838 204
571 3300048915 Ga0496112_0526048 Ga0496112_0526048_63_701 204
572 3300048916 Ga0496113_0021787 Ga0496113_0021787_1532_2170 204
573 3300048918 Ga0496115_0000272 Ga0496115_0000272_5915_6553 204
574 3300048918 Ga0496115_0000603 Ga0496115_0000603_7007_7645 204
575 3300048918 Ga0496115_0060115 Ga0496115_0060115_1085_1723 204
576 3300048918 Ga0496115_0148277 Ga0496115_0148277_659_1297 204
577 3300048924 Ga0496121_0157459 Ga0496121_0157459_159_797 204
578 3300048925 Ga0496122_0001639 Ga0496122_0001639_32820_33449 204
579 3300048925 Ga0496122_0001861 Ga0496122_0001861_14341_14967 204
580 3300048926 Ga0496123_0001205 Ga0496123_0001205_32810_33439 204
581 3300048926 Ga0496123_0001590 Ga0496123_0001590_26558_27184 204
582 3300048927 Ga0496124_0204851 Ga0496124_0204851_753_1382 204
583 3300048929 Ga0496126_0097693 Ga0496126_0097693_192_830 204
584 3300048929 Ga0496126_0423695 Ga0496126_0423695_396_1034 204
585 3300049459 Ga0495678_035839 Ga0495678_035839_1187_1825 204
586 3300049460 Ga0495682_0005889 Ga0495682_0005889_3348_3986 204
587 3300049571 Ga0501034_0001143 Ga0501034_0001143_1336_1977 204
588 3300049571 Ga0501034_0007022 Ga0501034_0007022_9605_10246 204
589 3300049571 Ga0501034_0022920 Ga0501034_0022920_5368_6009 204
590 3300049571 Ga0501034_0144429 Ga0501034_0144429_657_1298 204
591 3300049581 Ga0501047_0039535 Ga0501047_0039535_2110_2736 204
592 3300049584 Ga0501068_0000930 Ga0501068_0000930_8424_9065 204
593 3300049586 Ga0501070_0079142 Ga0501070_0079142_166_792 204
594 3300049586 Ga0501070_0264244 Ga0501070_0264244_705_1346 204
595 3300049589 Ga0501073_0064473 Ga0501073_0064473_250_876 204
596 3300049590 Ga0501074_0058162 Ga0501074_0058162_1063_1689 204
597 3300049742 Ga0501080_0136946 Ga0501080_0136946_213_839 204
598 3300049823 Ga0501044_0069914 Ga0501044_0069914_1140_1781 204
599 3300049823 Ga0501044_0072183 Ga0501044_0072183_1095_1721 204
600 3300053088 Ga0500644_0064461 Ga0500644_0064461_642_1274 204
601 3300060346 Ga0587111_0004128 Ga0587111_0004128_1084_1713 204
602 iso_pu_bacteria 2511231221 2512035163 204
603 iso_pu_bacteria 2522572158 2523107000 204
604 iso_pu_bacteria 2643221554 2643789496 204
605 iso_pu_bacteria 3000865235 3000865581 204
606 3300001989 JGI24739J22299_10001818 JGI24739J22299_100018185 205
607 3300002741 JGI25157J39369_1008628 JGI25157J39369_10086282 205
608 3300003763 Ga0055529_1005226 Ga0055529_10052262 205
609 3300003775 Ga0055524_1053959 Ga0055524_10539592 205
610 3300005295 Ga0065707_10082092 Ga0065707_100820927 205
611 3300005327 Ga0070658_10014131 Ga0070658_100141313 205
612 3300005336 Ga0070680_100003334 Ga0070680_1000033343 205
613 3300005337 Ga0070682_100014112 Ga0070682_1000141122 205
614 3300005339 Ga0070660_100078997 Ga0070660_1000789972 205
615 3300005347 Ga0070668_100275083 Ga0070668_1002750832 205
616 3300005355 Ga0070671_100049086 Ga0070671_1000490862 205
617 3300005365 Ga0070688_100844682 Ga0070688_1008446821 205
618 3300005366 Ga0070659_100770255 Ga0070659_1007702551 205
619 3300005435 Ga0070714_100601099 Ga0070714_1006010992 205
620 3300005455 Ga0070663_100013698 Ga0070663_1000136985 205
621 3300005457 Ga0070662_100264729 Ga0070662_1002647292 205
622 3300005547 Ga0070693_100172707 Ga0070693_1001727072 205
623 3300005548 Ga0070665_100024403 Ga0070665_1000244033 205
624 3300005563 Ga0068855_100003248 Ga0068855_1000032485 205
625 3300005563 Ga0068855_100051713 Ga0068855_1000517136 205
626 3300005563 Ga0068855_100132342 Ga0068855_1001323424 205
627 3300005563 Ga0068855_100183432 Ga0068855_1001834323 205
628 3300005577 Ga0068857_100008513 Ga0068857_1000085133 205
629 3300005578 Ga0068854_100000699 Ga0068854_1000006995 205
630 3300005578 Ga0068854_100006866 Ga0068854_1000068667 205
631 3300005578 Ga0068854_100162955 Ga0068854_1001629551 205
632 3300005616 Ga0068852_100286449 Ga0068852_1002864492 205
633 3300005616 Ga0068852_100704958 Ga0068852_1007049582 205
634 3300005617 Ga0068859_100233165 Ga0068859_1002331651 205
635 3300005618 Ga0068864_100020963 Ga0068864_1000209637 205
636 3300005719 Ga0068861_100001967 Ga0068861_1000019674 205
637 3300005719 Ga0068861_100099116 Ga0068861_1000991162 205
638 3300005834 Ga0068851_10015815 Ga0068851_100158152 205
639 3300005841 Ga0068863_100012433 Ga0068863_1000124338 205
640 3300005843 Ga0068860_100408596 Ga0068860_1004085962 205
641 3300006048 Ga0075363_100279879 Ga0075363_1002798792 205
642 3300006195 Ga0075366_10009494 Ga0075366_100094944 205
643 3300006844 Ga0075428_101084647 Ga0075428_1010846472 205
644 3300006931 Ga0097620_100233177 Ga0097620_1002331773 205
645 3300009011 Ga0105251_10056938 Ga0105251_100569382 205
646 3300009093 Ga0105240_10005342 Ga0105240_1000534211 205
647 3300009093 Ga0105240_10017316 Ga0105240_100173166 205
648 3300009093 Ga0105240_10020280 Ga0105240_100202806 205
649 3300009093 Ga0105240_10023104 Ga0105240_100231042 205
650 3300009093 Ga0105240_10405876 Ga0105240_104058762 205
651 3300009098 Ga0105245_10320485 Ga0105245_103204852 205
652 3300009101 Ga0105247_10267118 Ga0105247_102671182 205
653 3300009545 Ga0105237_10000036 Ga0105237_1000003658 205
654 3300009545 Ga0105237_10000136 Ga0105237_100001366 205
655 3300010375 Ga0105239_10061307 Ga0105239_100613072 205
656 3300012500 Ga0157314_1000581 Ga0157314_10005812 205
657 3300013102 Ga0157371_10016582 Ga0157371_100165822 205
658 3300013104 Ga0157370_10077206 Ga0157370_100772062 205
659 3300013105 Ga0157369_10047946 Ga0157369_100479464 205
660 3300013105 Ga0157369_10170224 Ga0157369_101702243 205
661 3300013306 Ga0163162_10083329 Ga0163162_100833295 205
662 3300014326 Ga0157380_10006526 Ga0157380_100065263 205
663 3300014968 Ga0157379_10126591 Ga0157379_101265913 205
664 3300020070 Ga0206356_11616746 Ga0206356_116167464 205
665 3300020081 Ga0206354_10931273 Ga0206354_109312732 205
666 3300021361 Ga0213872_10001316 Ga0213872_1000131611 205
667 3300024227 Ga0228598_1000332 Ga0228598_100033210 205
668 3300025246 Ga0209646_1001788 Ga0209646_10017884 205
669 3300025250 Ga0209026_1000223 Ga0209026_100022312 205
670 3300025256 Ga0209759_1001491 Ga0209759_10014918 205
671 3300025258 Ga0209129_1002340 Ga0209129_10023402 205
672 3300025272 Ga0209455_1000628 Ga0209455_100062819 205
673 3300025297 Ga0209758_1001007 Ga0209758_100100715 205
674 3300025297 Ga0209758_1066634 Ga0209758_10666342 205
675 3300025299 Ga0209256_1001832 Ga0209256_10018322 205
676 3300025321 Ga0207656_10079257 Ga0207656_100792572 205
677 3300025904 Ga0207647_10003842 Ga0207647_100038429 205
678 3300025912 Ga0207707_10303155 Ga0207707_103031552 205
679 3300025913 Ga0207695_10001702 Ga0207695_1000170232 205
680 3300025913 Ga0207695_10003515 Ga0207695_1000351517 205
681 3300025913 Ga0207695_10012415 Ga0207695_100124154 205
682 3300025913 Ga0207695_10021072 Ga0207695_100210726 205
683 3300025913 Ga0207695_10313859 Ga0207695_103138592 205
684 3300025914 Ga0207671_10000059 Ga0207671_100000596 205
685 3300025914 Ga0207671_10000135 Ga0207671_1000013548 205
686 3300025925 Ga0207650_10263864 Ga0207650_102638642 205
687 3300025927 Ga0207687_10043694 Ga0207687_100436944 205
688 3300025929 Ga0207664_10563071 Ga0207664_105630711 205
689 3300025931 Ga0207644_10070897 Ga0207644_100708972 205
690 3300025933 Ga0207706_10138154 Ga0207706_101381542 205
691 3300025945 Ga0207679_11229545 Ga0207679_112295451 205
692 3300025949 Ga0207667_10000292 Ga0207667_1000029236 205
693 3300025949 Ga0207667_10000486 Ga0207667_1000048613 205
694 3300025949 Ga0207667_10055825 Ga0207667_100558254 205
695 3300025949 Ga0207667_10121940 Ga0207667_101219402 205
696 3300025981 Ga0207640_10000471 Ga0207640_100004713 205
697 3300025981 Ga0207640_10000670 Ga0207640_1000067012 205
698 3300025981 Ga0207640_10053029 Ga0207640_100530293 205
699 3300026067 Ga0207678_10000969 Ga0207678_1000096913 205
700 3300026067 Ga0207678_10143379 Ga0207678_101433792 205
701 3300026078 Ga0207702_11166583 Ga0207702_111665831 205
702 3300026088 Ga0207641_10049260 Ga0207641_100492603 205
703 3300026095 Ga0207676_10032072 Ga0207676_100320722 205
704 3300026116 Ga0207674_10000298 Ga0207674_100002986 205
705 3300026118 Ga0207675_100029062 Ga0207675_1000290623 205
706 3300026118 Ga0207675_100075242 Ga0207675_1000752425 205
707 3300026142 Ga0207698_10019529 Ga0207698_100195294 205
708 3300026142 Ga0207698_10140636 Ga0207698_101406363 205
709 3300028379 Ga0268266_10297171 Ga0268266_102971712 205
710 3300028379 Ga0268266_10922761 Ga0268266_109227612 205
711 3300028381 Ga0268264_10678496 Ga0268264_106784962 205
712 3300028786 Ga0307517_10010226 Ga0307517_100102268 205
713 3300028786 Ga0307517_10217316 Ga0307517_102173162 205
714 3300031456 Ga0307513_10020408 Ga0307513_100204083 205
715 3300031456 Ga0307513_10086379 Ga0307513_100863793 205
716 3300033180 Ga0307510_10088730 Ga0307510_100887302 205
717 3300035725 Ga0373947_0163753 Ga0373947_0163753_333_965 205
718 3300035725 Ga0373947_0721919 Ga0373947_0721919_10_642 205
719 3300036401 Ga0373937_0341074 Ga0373937_0341074_694_1326 205
720 3300037068 Ga0373925_0212396 Ga0373925_0212396_575_1207 205
721 3300037853 Ga0436364_0471363 Ga0436364_0471363_162_797 205
722 3300039447 Ga0436361_0821396 Ga0436361_0821396_13459_14088 205
723 3300041407 Ga0439447_002799 Ga0439447_002799_2728_3372 205
724 3300042436 Ga0439435_0112338 Ga0439435_0112338_15_647 205
725 3300044656 Ga0466969_0017277 Ga0466969_0017277_786_1427 205
726 3300044658 Ga0466972_0062241 Ga0466972_0062241_749_1390 205
727 3300044672 Ga0466982_0000044 Ga0466982_0000044_4420_5061 205
728 3300044683 Ga0466965_0016690 Ga0466965_0016690_95_736 205
729 3300044684 Ga0466966_0002676 Ga0466966_0002676_5507_6148 205
730 3300044706 Ga0466964_0022707 Ga0466964_0022707_526_1167 205
731 3300044719 Ga0466971_0090701 Ga0466971_0090701_361_1002 205
732 3300044735 Ga0466968_0008215 Ga0466968_0008215_2938_3579 205
733 3300044901 Ga0466960_0030336 Ga0466960_0030336_899_1540 205
734 3300045049 Ga0466959_0436775 Ga0466959_0436775_229_870 205
735 3300046453 Ga0495627_003650 Ga0495627_003650_2802_3419 205
736 3300046454 Ga0495592_0435252 Ga0495592_0435252_115_747 205
737 3300046460 Ga0495638_0006896 Ga0495638_0006896_3100_3726 205
738 3300046462 Ga0495651_0017466 Ga0495651_0017466_563_1195 205
739 3300046463 Ga0495653_0207640 Ga0495653_0207640_460_1092 205
740 3300046471 Ga0495650_0000174 Ga0495650_0000174_135659_136291 205
741 3300046471 Ga0495650_0011700 Ga0495650_0011700_3663_4280 205
742 3300046474 Ga0495605_0000036 Ga0495605_0000036_8179_8796 205
743 3300046477 Ga0495664_0355824 Ga0495664_0355824_126_758 205
744 3300046499 Ga0495594_0001898 Ga0495594_0001898_2092_2709 205
745 3300046506 Ga0495583_0000028 Ga0495583_0000028_21427_22044 205
746 3300046506 Ga0495583_0000271 Ga0495583_0000271_39042_39674 205
747 3300046512 Ga0495610_0026266 Ga0495610_0026266_1390_2007 205
748 3300046515 Ga0495620_0000322 Ga0495620_0000322_8567_9184 205
749 3300046516 Ga0495628_0043863 Ga0495628_0043863_288_920 205
750 3300046517 Ga0495630_0343695 Ga0495630_0343695_244_876 205
751 3300046518 Ga0495631_0009296 Ga0495631_0009296_452_1069 205
752 3300046524 Ga0495648_0015690 Ga0495648_0015690_1375_1992 205
753 3300046524 Ga0495648_0021980 Ga0495648_0021980_262_894 205
754 3300046529 Ga0495652_0018360 Ga0495652_0018360_597_1229 205
755 3300046529 Ga0495652_0062372 Ga0495652_0062372_1926_2558 205
756 3300046530 Ga0495654_0010779 Ga0495654_0010779_3656_4273 205
757 3300046538 Ga0495609_0000115 Ga0495609_0000115_8179_8796 205
758 3300046542 Ga0495597_0009290 Ga0495597_0009290_3701_4318 205
759 3300046558 Ga0495633_0001693 Ga0495633_0001693_8744_9361 205
760 3300046616 Ga0495668_0000034 Ga0495668_0000034_186150_186776 205
761 3300046648 Ga0495611_0000736 Ga0495611_0000736_15728_16345 205
762 3300046660 Ga0495625_0001328 Ga0495625_0001328_14441_15067 205
763 3300046665 Ga0495661_0000685 Ga0495661_0000685_8544_9161 205
764 3300046665 Ga0495661_0170983 Ga0495661_0170983_332_964 205
765 3300046678 Ga0495599_0092568 Ga0495599_0092568_560_1192 205
766 3300046691 Ga0495670_0007244 Ga0495670_0007244_1399_2016 205
767 3300046692 Ga0495671_0034356 Ga0495671_0034356_1031_1648 205
768 3300046694 Ga0495649_0358682 Ga0495649_0358682_14_670 205
769 3300046794 Ga0495589_0009064 Ga0495589_0009064_3708_4325 205
770 3300046809 Ga0495600_0022072 Ga0495600_0022072_1984_2616 205
771 3300046810 Ga0495660_0002709 Ga0495660_0002709_2391_3008 205
772 3300047319 Ga0495674_0752674 Ga0495674_0752674_17_649 205
773 3300047323 Ga0495683_0000507 Ga0495683_0000507_8180_8797 205
774 3300047446 Ga0495679_000616 Ga0495679_000616_763_1380 205
775 3300047469 Ga0495673_0021460 Ga0495673_0021460_2429_3046 205
776 3300047470 Ga0495681_0016651 Ga0495681_0016651_2812_3429 205
777 3300047471 Ga0495684_0239586 Ga0495684_0239586_516_1148 205
778 3300047472 Ga0495686_0150339 Ga0495686_0150339_588_1220 205
779 3300048904 Ga0496101_0540725 Ga0496101_0540725_22_663 205
780 3300048909 Ga0496106_0265042 Ga0496106_0265042_668_1294 205
781 3300048922 Ga0496119_0018322 Ga0496119_0018322_538_1164 205
782 3300048924 Ga0496121_0022646 Ga0496121_0022646_4064_4690 205
783 3300048924 Ga0496121_0073761 Ga0496121_0073761_1737_2378 205
784 3300048925 Ga0496122_0031343 Ga0496122_0031343_2830_3447 205
785 3300048926 Ga0496123_0008731 Ga0496123_0008731_2035_2652 205
786 3300048928 Ga0496125_0000453 Ga0496125_0000453_21067_21708 205
787 3300049459 Ga0495678_000020 Ga0495678_000020_8503_9120 205
788 3300049570 Ga0501033_0005599 Ga0501033_0005599_3604_4239 205
789 3300049579 Ga0501043_0486007 Ga0501043_0486007_227_871 205
790 3300049581 Ga0501047_0053424 Ga0501047_0053424_2478_3110 205
791 3300049822 Ga0501035_0155649 Ga0501035_0155649_1061_1705 205
792 3300049823 Ga0501044_0331238 Ga0501044_0331238_335_979 205
793 3300050493 nmdc:mga0k408_19404_c1 nmdc:mga0k408_19404_c1_870_1514 205
794 3300053077 Ga0495601_0090848 Ga0495601_0090848_756_1388 205
795 3300053084 Ga0495595_0073684 Ga0495595_0073684_501_1133 205
796 3300053090 Ga0500646_0105160 Ga0500646_0105160_164_796 205
797 3300053092 Ga0500583_0142876 Ga0500583_0142876_24_686 205
798 3300053125 Ga0500618_019033 Ga0500618_019033_101_718 205
799 3300053130 Ga0500642_0293386 Ga0500642_0293386_24_686 205
800 3300053136 Ga0500559_0010104 Ga0500559_0010104_1275_1904 205
801 3300053146 Ga0500588_0110221 Ga0500588_0110221_74_706 205
802 3300053727 Ga0500611_089672 Ga0500611_089672_33_674 205
803 3300053730 Ga0500645_007540 Ga0500645_007540_918_1550 205
804 3300061719 Ga0466962_0043341 Ga0466962_0043341_1014_1655 205
805 iso_pu_bacteria 2671180139 2671695356 205
806 iso_pu_bacteria 2739367756 2739792210 205
807 iso_pu_bacteria 2848297114 2848298180 205
808 2162886007 SwRhRL2b_contig_656453 SwRhRL2b_0247.00007820 206
809 3300001990 JGI24737J22298_10091662 JGI24737J22298_100916621 206
810 3300002737 JGI25162J39368_1000063 JGI25162J39368_100006315 206
811 3300002771 JGI25163J39215_1002287 JGI25163J39215_10022872 206
812 3300002772 JGI25164J39214_1004989 JGI25164J39214_10049892 206
813 3300003187 JGI25151J46595_10000338 JGI25151J46595_1000033833 206
814 3300003214 JGI25165J46597_1000069 JGI25165J46597_100006915 206
815 3300003320 rootH2_10007026 rootH2_100070262 206
816 3300003320 rootH2_10077057 rootH2_100770572 206
817 3300003323 rootH1_10009337 rootH1_100093378 206
818 3300003323 rootH1_10071821 rootH1_100718214 206
819 3300003323 rootH1_10074923 rootH1_100749233 206
820 3300003323 rootH1_10105829 rootH1_101058292 206
821 3300003751 Ga0055538_1000034 Ga0055538_100003414 206
822 3300003752 Ga0055539_1000044 Ga0055539_100004414 206
823 3300003756 Ga0055533_1000055 Ga0055533_100005514 206
824 3300003759 Ga0055525_1000066 Ga0055525_1000066168 206
825 3300003763 Ga0055529_1000975 Ga0055529_10009758 206
826 3300003771 Ga0055526_1000116 Ga0055526_10001164 206
827 3300003771 Ga0055526_1006469 Ga0055526_10064695 206
828 3300003775 Ga0055524_1025753 Ga0055524_10257532 206
829 3300003781 Ga0055536_1000103 Ga0055536_10001036 206
830 3300003781 Ga0055536_1002169 Ga0055536_10021693 206
831 3300003781 Ga0055536_1041914 Ga0055536_10419142 206
832 3300003784 Ga0055534_1000104 Ga0055534_100010446 206
833 3300003784 Ga0055534_1000158 Ga0055534_100015844 206
834 3300003791 Ga0055530_10001374 Ga0055530_100013746 206
835 3300003791 Ga0055530_10007126 Ga0055530_100071265 206
836 3300003794 Ga0055531_10006687 Ga0055531_100066874 206
837 3300003794 Ga0055531_10014117 Ga0055531_100141173 206
838 3300003794 Ga0055531_10023407 Ga0055531_100234073 206
839 3300003794 Ga0055531_10067287 Ga0055531_100672871 206
840 3300003841 Ga0055541_1000032 Ga0055541_1000032169 206
841 3300003856 Ga0058692_1000009 Ga0058692_1000009261 206
842 3300005288 Ga0065714_10007829 Ga0065714_100078293 206
843 3300005288 Ga0065714_10012581 Ga0065714_100125813 206
844 3300005288 Ga0065714_10069716 Ga0065714_100697162 206
845 3300005289 Ga0065704_10009257 Ga0065704_100092574 206
846 3300005289 Ga0065704_10264331 Ga0065704_102643311 206
847 3300005290 Ga0065712_10000132 Ga0065712_100001325 206
848 3300005290 Ga0065712_10090203 Ga0065712_100902032 206
849 3300005327 Ga0070658_10123076 Ga0070658_101230762 206
850 3300005328 Ga0070676_10000184 Ga0070676_100001844 206
851 3300005328 Ga0070676_10086903 Ga0070676_100869032 206
852 3300005328 Ga0070676_10155529 Ga0070676_101555292 206
853 3300005329 Ga0070683_100002328 Ga0070683_10000232811 206
854 3300005329 Ga0070683_100140189 Ga0070683_1001401892 206
855 3300005329 Ga0070683_100510519 Ga0070683_1005105192 206
856 3300005330 Ga0070690_100096094 Ga0070690_1000960942 206
857 3300005331 Ga0070670_100026223 Ga0070670_1000262238 206
858 3300005331 Ga0070670_100265249 Ga0070670_1002652492 206
859 3300005333 Ga0070677_10000379 Ga0070677_100003798 206
860 3300005333 Ga0070677_10022599 Ga0070677_100225992 206
861 3300005334 Ga0068869_100225786 Ga0068869_1002257862 206
862 3300005335 Ga0070666_10012374 Ga0070666_100123747 206
863 3300005337 Ga0070682_100003944 Ga0070682_1000039444 206
864 3300005338 Ga0068868_100023967 Ga0068868_1000239672 206
865 3300005338 Ga0068868_100418855 Ga0068868_1004188551 206
866 3300005338 Ga0068868_100647819 Ga0068868_1006478191 206
867 3300005339 Ga0070660_100114547 Ga0070660_1001145471 206
868 3300005344 Ga0070661_100120919 Ga0070661_1001209192 206
869 3300005347 Ga0070668_100004033 Ga0070668_1000040334 206
870 3300005347 Ga0070668_100060509 Ga0070668_1000605092 206
871 3300005347 Ga0070668_100067315 Ga0070668_1000673153 206
872 3300005347 Ga0070668_100094228 Ga0070668_1000942284 206
873 3300005347 Ga0070668_100167475 Ga0070668_1001674752 206
874 3300005347 Ga0070668_100410165 Ga0070668_1004101652 206
875 3300005353 Ga0070669_100020760 Ga0070669_1000207602 206
876 3300005353 Ga0070669_100136133 Ga0070669_1001361332 206
877 3300005354 Ga0070675_100004329 Ga0070675_10000432911 206
878 3300005354 Ga0070675_100075645 Ga0070675_1000756452 206
879 3300005354 Ga0070675_100918528 Ga0070675_1009185281 206
880 3300005355 Ga0070671_100043865 Ga0070671_1000438652 206
881 3300005355 Ga0070671_100074400 Ga0070671_1000744002 206
882 3300005356 Ga0070674_100006415 Ga0070674_1000064157 206
883 3300005356 Ga0070674_100185045 Ga0070674_1001850452 206
884 3300005356 Ga0070674_100228228 Ga0070674_1002282282 206
885 3300005364 Ga0070673_100021478 Ga0070673_1000214781 206
886 3300005364 Ga0070673_100073974 Ga0070673_1000739743 206
887 3300005365 Ga0070688_100382213 Ga0070688_1003822131 206
888 3300005366 Ga0070659_100548394 Ga0070659_1005483942 206
889 3300005367 Ga0070667_100018980 Ga0070667_1000189808 206
890 3300005367 Ga0070667_100101645 Ga0070667_1001016453 206
891 3300005367 Ga0070667_100260558 Ga0070667_1002605582 206
892 3300005441 Ga0070700_100798855 Ga0070700_1007988551 206
893 3300005455 Ga0070663_100464896 Ga0070663_1004648962 206
894 3300005456 Ga0070678_100342825 Ga0070678_1003428252 206
895 3300005456 Ga0070678_100927899 Ga0070678_1009278991 206
896 3300005457 Ga0070662_100009714 Ga0070662_1000097142 206
897 3300005457 Ga0070662_100029289 Ga0070662_1000292892 206
898 3300005457 Ga0070662_100274238 Ga0070662_1002742382 206
899 3300005458 Ga0070681_10211816 Ga0070681_102118162 206
900 3300005459 Ga0068867_100021598 Ga0068867_1000215982 206
901 3300005466 Ga0070685_10345998 Ga0070685_103459982 206
902 3300005530 Ga0070679_100119972 Ga0070679_1001199722 206
903 3300005530 Ga0070679_100153527 Ga0070679_1001535272 206
904 3300005535 Ga0070684_100001235 Ga0070684_1000012354 206
905 3300005535 Ga0070684_100147827 Ga0070684_1001478272 206
906 3300005535 Ga0070684_100218756 Ga0070684_1002187562 206
907 3300005539 Ga0068853_100035810 Ga0068853_1000358107 206
908 3300005543 Ga0070672_100024644 Ga0070672_1000246444 206
909 3300005543 Ga0070672_100083942 Ga0070672_1000839422 206
910 3300005543 Ga0070672_100107480 Ga0070672_1001074803 206
911 3300005543 Ga0070672_100113189 Ga0070672_1001131892 206
912 3300005543 Ga0070672_100201041 Ga0070672_1002010412 206
913 3300005543 Ga0070672_100318529 Ga0070672_1003185292 206
914 3300005543 Ga0070672_100372234 Ga0070672_1003722341 206
915 3300005548 Ga0070665_100012164 Ga0070665_1000121647 206
916 3300005548 Ga0070665_100560054 Ga0070665_1005600542 206
917 3300005548 Ga0070665_100575002 Ga0070665_1005750021 206
918 3300005564 Ga0070664_100055289 Ga0070664_1000552892 206
919 3300005564 Ga0070664_100169074 Ga0070664_1001690742 206
920 3300005564 Ga0070664_100178464 Ga0070664_1001784642 206
921 3300005564 Ga0070664_100418747 Ga0070664_1004187472 206
922 3300005564 Ga0070664_100486035 Ga0070664_1004860352 206
923 3300005577 Ga0068857_100063861 Ga0068857_1000638612 206
924 3300005577 Ga0068857_100365287 Ga0068857_1003652872 206
925 3300005578 Ga0068854_100001438 Ga0068854_1000014387 206
926 3300005578 Ga0068854_100437129 Ga0068854_1004371292 206
927 3300005578 Ga0068854_100523259 Ga0068854_1005232592 206
928 3300005614 Ga0068856_100768637 Ga0068856_1007686372 206
929 3300005616 Ga0068852_100049791 Ga0068852_1000497913 206
930 3300005616 Ga0068852_100113902 Ga0068852_1001139022 206
931 3300005617 Ga0068859_100011168 Ga0068859_1000111682 206
932 3300005617 Ga0068859_100071933 Ga0068859_1000719333 206
933 3300005618 Ga0068864_100006939 Ga0068864_1000069392 206
934 3300005618 Ga0068864_100035586 Ga0068864_1000355861 206
935 3300005718 Ga0068866_10176571 Ga0068866_101765712 206
936 3300005719 Ga0068861_100098554 Ga0068861_1000985543 206
937 3300005719 Ga0068861_101011004 Ga0068861_1010110041 206
938 3300005834 Ga0068851_10065197 Ga0068851_100651972 206
939 3300005834 Ga0068851_10209105 Ga0068851_102091052 206
940 3300005840 Ga0068870_10027147 Ga0068870_100271473 206
941 3300005840 Ga0068870_10124361 Ga0068870_101243612 206
942 3300005841 Ga0068863_100151663 Ga0068863_1001516633 206
943 3300005841 Ga0068863_100241408 Ga0068863_1002414082 206
944 3300005841 Ga0068863_100276828 Ga0068863_1002768282 206
945 3300005841 Ga0068863_100278780 Ga0068863_1002787802 206
946 3300005841 Ga0068863_100500118 Ga0068863_1005001182 206
947 3300005841 Ga0068863_100623364 Ga0068863_1006233642 206
948 3300005842 Ga0068858_100485410 Ga0068858_1004854102 206
949 3300005843 Ga0068860_100014126 Ga0068860_1000141265 206
950 3300005843 Ga0068860_100230298 Ga0068860_1002302982 206
951 3300005843 Ga0068860_100275885 Ga0068860_1002758852 206
952 3300005844 Ga0068862_100015603 Ga0068862_1000156035 206
953 3300006051 Ga0075364_10320929 Ga0075364_103209292 206
954 3300006051 Ga0075364_10426602 Ga0075364_104266022 206
955 3300006051 Ga0075364_10570376 Ga0075364_105703762 206
956 3300006058 Ga0075432_10000316 Ga0075432_1000031612 206
957 3300006058 Ga0075432_10103215 Ga0075432_101032152 206
958 3300006186 Ga0075369_10119616 Ga0075369_101196162 206
959 3300006237 Ga0097621_100386334 Ga0097621_1003863342 206
960 3300006237 Ga0097621_100457433 Ga0097621_1004574332 206
961 3300006358 Ga0068871_100080037 Ga0068871_1000800372 206
962 3300006358 Ga0068871_100829103 Ga0068871_1008291032 206
963 3300006844 Ga0075428_100647354 Ga0075428_1006473542 206
964 3300006881 Ga0068865_100047329 Ga0068865_1000473292 206
965 3300006881 Ga0068865_100227731 Ga0068865_1002277312 206
966 3300006914 Ga0075436_100119814 Ga0075436_1001198142 206
967 3300006931 Ga0097620_100011168 Ga0097620_1000111687 206
968 3300006931 Ga0097620_100071933 Ga0097620_1000719333 206
969 3300006946 Ga0079104_1021663 Ga0079104_10216632 206
970 3300009011 Ga0105251_10002617 Ga0105251_100026172 206
971 3300009011 Ga0105251_10004604 Ga0105251_100046045 206
972 3300009011 Ga0105251_10032844 Ga0105251_100328444 206
973 3300009036 Ga0105244_10002401 Ga0105244_100024014 206
974 3300009036 Ga0105244_10120692 Ga0105244_101206922 206
975 3300009036 Ga0105244_10148471 Ga0105244_101484711 206
976 3300009092 Ga0105250_10000550 Ga0105250_1000055020 206
977 3300009092 Ga0105250_10002212 Ga0105250_100022129 206
978 3300009092 Ga0105250_10026587 Ga0105250_100265872 206
979 3300009092 Ga0105250_10287560 Ga0105250_102875601 206
980 3300009093 Ga0105240_10648266 Ga0105240_106482662 206
981 3300009094 Ga0111539_10640115 Ga0111539_106401152 206
982 3300009148 Ga0105243_10001011 Ga0105243_1000101123 206
983 3300009148 Ga0105243_10051347 Ga0105243_100513472 206
984 3300009176 Ga0105242_10358512 Ga0105242_103585122 206
985 3300009176 Ga0105242_10421815 Ga0105242_104218152 206
986 3300009177 Ga0105248_10257694 Ga0105248_102576942 206
987 3300009177 Ga0105248_10334437 Ga0105248_103344372 206
988 3300009553 Ga0105249_10096119 Ga0105249_100961193 206
989 3300011119 Ga0105246_10000322 Ga0105246_100003226 206
990 3300011119 Ga0105246_10002126 Ga0105246_100021263 206
991 3300011119 Ga0105246_10567655 Ga0105246_105676551 206
992 3300012498 Ga0157345_1000091 Ga0157345_100009116 206
993 3300012502 Ga0157347_1002954 Ga0157347_10029542 206
994 3300013100 Ga0157373_10000568 Ga0157373_100005687 206
995 3300013100 Ga0157373_10085097 Ga0157373_100850972 206
996 3300013100 Ga0157373_10113106 Ga0157373_101131062 206
997 3300013100 Ga0157373_10638965 Ga0157373_106389651 206
998 3300013102 Ga0157371_10216135 Ga0157371_102161352 206
999 3300013102 Ga0157371_10377801 Ga0157371_103778012 206
1000 3300013104 Ga0157370_10281370 Ga0157370_102813702 206
1001 3300013104 Ga0157370_10322545 Ga0157370_103225452 206
1002 3300013105 Ga0157369_10001737 Ga0157369_100017379 206
1003 3300013105 Ga0157369_10001978 Ga0157369_1000197821 206
1004 3300013105 Ga0157369_10604876 Ga0157369_106048762 206
1005 3300013105 Ga0157369_10646301 Ga0157369_106463011 206
1006 3300013105 Ga0157369_10833279 Ga0157369_108332792 206
1007 3300013296 Ga0157374_10388709 Ga0157374_103887092 206
1008 3300013306 Ga0163162_10162708 Ga0163162_101627082 206
1009 3300013306 Ga0163162_10258243 Ga0163162_102582432 206
1010 3300013306 Ga0163162_10578767 Ga0163162_105787672 206
1011 3300013307 Ga0157372_10055049 Ga0157372_100550491 206
1012 3300013307 Ga0157372_10437604 Ga0157372_104376042 206
1013 3300013307 Ga0157372_10477804 Ga0157372_104778042 206
1014 3300013307 Ga0157372_10527871 Ga0157372_105278712 206
1015 3300013308 Ga0157375_10007393 Ga0157375_1000739312 206
1016 3300013308 Ga0157375_10106507 Ga0157375_101065072 206
1017 3300013308 Ga0157375_10350854 Ga0157375_103508542 206
1018 3300013308 Ga0157375_10699769 Ga0157375_106997692 206
1019 3300013308 Ga0157375_11107539 Ga0157375_111075392 206
1020 3300014326 Ga0157380_10125069 Ga0157380_101250692 206
1021 3300014497 Ga0182008_10001995 Ga0182008_1000199510 206
1022 3300014497 Ga0182008_10009442 Ga0182008_100094422 206
1023 3300014497 Ga0182008_10036444 Ga0182008_100364443 206
1024 3300014745 Ga0157377_10395201 Ga0157377_103952011 206
1025 3300014969 Ga0157376_10069963 Ga0157376_100699636 206
1026 3300015261 Ga0182006_1000967 Ga0182006_10009676 206
1027 3300015261 Ga0182006_1002514 Ga0182006_10025142 206
1028 3300015261 Ga0182006_1006793 Ga0182006_10067935 206
1029 3300015261 Ga0182006_1020584 Ga0182006_10205846 206
1030 3300015261 Ga0182006_1134970 Ga0182006_11349702 206
1031 3300015265 Ga0182005_1041459 Ga0182005_10414592 206
1032 3300015265 Ga0182005_1042136 Ga0182005_10421361 206
1033 3300015684 Ga0183365_10004 Ga0183365_10004149 206
1034 3300015689 Ga0183360_11919 Ga0183360_119191 206
1035 3300015690 Ga0183363_1007 Ga0183363_100795 206
1036 3300017792 Ga0163161_10071262 Ga0163161_100712622 206
1037 3300017792 Ga0163161_10087295 Ga0163161_100872951 206
1038 3300017792 Ga0163161_10144012 Ga0163161_101440122 206
1039 3300017792 Ga0163161_10160712 Ga0163161_101607122 206
1040 3300017792 Ga0163161_10192938 Ga0163161_101929382 206
1041 3300017792 Ga0163161_10599252 Ga0163161_105992522 206
1042 3300017792 Ga0163161_10603799 Ga0163161_106037992 206
1043 3300017792 Ga0163161_10784277 Ga0163161_107842772 206
1044 3300025207 Ga0209760_101173 Ga0209760_1011732 206
1045 3300025224 Ga0209784_100049 Ga0209784_100049168 206
1046 3300025225 Ga0209566_100061 Ga0209566_100061168 206
1047 3300025226 Ga0209674_100069 Ga0209674_100069217 206
1048 3300025228 Ga0209672_102388 Ga0209672_1023884 206
1049 3300025228 Ga0209672_112054 Ga0209672_1120542 206
1050 3300025230 Ga0209563_100083 Ga0209563_100083168 206
1051 3300025231 Ga0207427_103135 Ga0207427_1031352 206
1052 3300025233 Ga0209437_100091 Ga0209437_100091216 206
1053 3300025242 Ga0209258_103464 Ga0209258_1034642 206
1054 3300025253 Ga0209677_100039 Ga0209677_100039217 206
1055 3300025261 Ga0209233_1000115 Ga0209233_1000115216 206
1056 3300025272 Ga0209455_1000427 Ga0209455_100042724 206
1057 3300025273 Ga0209673_1007680 Ga0209673_10076805 206
1058 3300025284 Ga0209130_1002498 Ga0209130_10024984 206
1059 3300025291 Ga0209675_1000078 Ga0209675_100007860 206
1060 3300025291 Ga0209675_1007119 Ga0209675_10071194 206
1061 3300025292 Ga0209676_1000121 Ga0209676_1000121125 206
1062 3300025292 Ga0209676_1000345 Ga0209676_100034528 206
1063 3300025292 Ga0209676_1000440 Ga0209676_10004404 206
1064 3300025292 Ga0209676_1004038 Ga0209676_10040385 206
1065 3300025294 Ga0209025_1000051 Ga0209025_100005163 206
1066 3300025294 Ga0209025_1038002 Ga0209025_10380023 206
1067 3300025295 Ga0209564_1000133 Ga0209564_1000133119 206
1068 3300025295 Ga0209564_1000202 Ga0209564_100020266 206
1069 3300025297 Ga0209758_1048733 Ga0209758_10487331 206
1070 3300025298 Ga0209050_1001731 Ga0209050_10017314 206
1071 3300025298 Ga0209050_1002704 Ga0209050_100270411 206
1072 3300025299 Ga0209256_1008649 Ga0209256_10086492 206
1073 3300025299 Ga0209256_1010324 Ga0209256_10103245 206
1074 3300025303 Ga0209051_1005522 Ga0209051_10055223 206
1075 3300025304 Ga0209257_1000065 Ga0209257_1000065210 206
1076 3300025304 Ga0209257_1000121 Ga0209257_100012128 206
1077 3300025304 Ga0209257_1000356 Ga0209257_1000356100 206
1078 3300025304 Ga0209257_1000452 Ga0209257_10004524 206
1079 3300025304 Ga0209257_1001064 Ga0209257_10010644 206
1080 3300025304 Ga0209257_1028082 Ga0209257_10280822 206
1081 3300025304 Ga0209257_1068871 Ga0209257_10688712 206
1082 3300025315 Ga0207697_10017549 Ga0207697_100175491 206
1083 3300025315 Ga0207697_10038369 Ga0207697_100383692 206
1084 3300025711 Ga0207696_1000165 Ga0207696_100016587 206
1085 3300025711 Ga0207696_1001780 Ga0207696_10017809 206
1086 3300025728 Ga0207655_1000603 Ga0207655_100060340 206
1087 3300025728 Ga0207655_1000772 Ga0207655_10007721 206
1088 3300025728 Ga0207655_1003483 Ga0207655_10034837 206
1089 3300025728 Ga0207655_1004427 Ga0207655_100442710 206
1090 3300025728 Ga0207655_1012890 Ga0207655_10128904 206
1091 3300025728 Ga0207655_1014595 Ga0207655_10145952 206
1092 3300025728 Ga0207655_1029630 Ga0207655_10296302 206
1093 3300025735 Ga0207713_1001400 Ga0207713_100140018 206
1094 3300025735 Ga0207713_1003713 Ga0207713_10037137 206
1095 3300025735 Ga0207713_1017174 Ga0207713_10171743 206
1096 3300025893 Ga0207682_10001014 Ga0207682_1000101414 206
1097 3300025893 Ga0207682_10182826 Ga0207682_101828262 206
1098 3300025903 Ga0207680_10033556 Ga0207680_100335564 206
1099 3300025907 Ga0207645_10000428 Ga0207645_1000042824 206
1100 3300025907 Ga0207645_10025328 Ga0207645_100253283 206
1101 3300025908 Ga0207643_10028023 Ga0207643_100280232 206
1102 3300025908 Ga0207643_10057340 Ga0207643_100573403 206
1103 3300025909 Ga0207705_10205601 Ga0207705_102056012 206
1104 3300025909 Ga0207705_10220760 Ga0207705_102207601 206
1105 3300025912 Ga0207707_10052033 Ga0207707_100520335 206
1106 3300025914 Ga0207671_10000713 Ga0207671_100007135 206
1107 3300025919 Ga0207657_10067795 Ga0207657_100677953 206
1108 3300025920 Ga0207649_10000007 Ga0207649_10000007208 206
1109 3300025920 Ga0207649_10159895 Ga0207649_101598952 206
1110 3300025920 Ga0207649_10213836 Ga0207649_102138362 206
1111 3300025920 Ga0207649_10272468 Ga0207649_102724682 206
1112 3300025923 Ga0207681_10073391 Ga0207681_100733913 206
1113 3300025925 Ga0207650_10034174 Ga0207650_100341742 206
1114 3300025925 Ga0207650_10124175 Ga0207650_101241752 206
1115 3300025926 Ga0207659_10131071 Ga0207659_101310712 206
1116 3300025931 Ga0207644_10087503 Ga0207644_100875032 206
1117 3300025931 Ga0207644_10323607 Ga0207644_103236072 206
1118 3300025932 Ga0207690_10014282 Ga0207690_100142823 206
1119 3300025933 Ga0207706_10057627 Ga0207706_100576272 206
1120 3300025933 Ga0207706_10133108 Ga0207706_101331083 206
1121 3300025933 Ga0207706_10588517 Ga0207706_105885172 206
1122 3300025934 Ga0207686_10001532 Ga0207686_100015326 206
1123 3300025934 Ga0207686_10607395 Ga0207686_106073952 206
1124 3300025935 Ga0207709_10065230 Ga0207709_100652302 206
1125 3300025936 Ga0207670_10565835 Ga0207670_105658352 206
1126 3300025937 Ga0207669_10544061 Ga0207669_105440612 206
1127 3300025938 Ga0207704_10010676 Ga0207704_100106763 206
1128 3300025938 Ga0207704_10115126 Ga0207704_101151262 206
1129 3300025940 Ga0207691_10000127 Ga0207691_1000012752 206
1130 3300025940 Ga0207691_10004858 Ga0207691_100048584 206
1131 3300025940 Ga0207691_10071976 Ga0207691_100719762 206
1132 3300025940 Ga0207691_10172497 Ga0207691_101724973 206
1133 3300025940 Ga0207691_10234026 Ga0207691_102340261 206
1134 3300025942 Ga0207689_10262507 Ga0207689_102625072 206
1135 3300025944 Ga0207661_10041845 Ga0207661_100418453 206
1136 3300025944 Ga0207661_10102213 Ga0207661_101022133 206
1137 3300025944 Ga0207661_10227205 Ga0207661_102272052 206
1138 3300025945 Ga0207679_10000013 Ga0207679_1000001396 206
1139 3300025945 Ga0207679_10007435 Ga0207679_100074352 206
1140 3300025945 Ga0207679_10055251 Ga0207679_100552512 206
1141 3300025945 Ga0207679_10153761 Ga0207679_101537612 206
1142 3300025960 Ga0207651_10452334 Ga0207651_104523342 206
1143 3300025972 Ga0207668_10021890 Ga0207668_100218905 206
1144 3300025972 Ga0207668_10122115 Ga0207668_101221152 206
1145 3300025972 Ga0207668_10124149 Ga0207668_101241492 206
1146 3300025972 Ga0207668_10223889 Ga0207668_102238892 206
1147 3300025972 Ga0207668_10356560 Ga0207668_103565602 206
1148 3300025972 Ga0207668_10620511 Ga0207668_106205112 206
1149 3300025981 Ga0207640_10018115 Ga0207640_100181155 206
1150 3300025986 Ga0207658_10059775 Ga0207658_100597752 206
1151 3300025986 Ga0207658_10065595 Ga0207658_100655954 206
1152 3300026023 Ga0207677_10026161 Ga0207677_100261615 206
1153 3300026023 Ga0207677_10892240 Ga0207677_108922401 206
1154 3300026035 Ga0207703_10132703 Ga0207703_101327032 206
1155 3300026067 Ga0207678_10032281 Ga0207678_100322815 206
1156 3300026067 Ga0207678_10724564 Ga0207678_107245642 206
1157 3300026075 Ga0207708_10235273 Ga0207708_102352732 206
1158 3300026088 Ga0207641_10173981 Ga0207641_101739812 206
1159 3300026088 Ga0207641_10265698 Ga0207641_102656982 206
1160 3300026088 Ga0207641_10323837 Ga0207641_103238372 206
1161 3300026088 Ga0207641_10331629 Ga0207641_103316292 206
1162 3300026088 Ga0207641_10346093 Ga0207641_103460932 206
1163 3300026088 Ga0207641_10877082 Ga0207641_108770822 206
1164 3300026088 Ga0207641_11113180 Ga0207641_111131801 206
1165 3300026089 Ga0207648_10011720 Ga0207648_100117203 206
1166 3300026089 Ga0207648_10023017 Ga0207648_100230172 206
1167 3300026089 Ga0207648_10265180 Ga0207648_102651802 206
1168 3300026095 Ga0207676_10048307 Ga0207676_100483072 206
1169 3300026095 Ga0207676_10170681 Ga0207676_101706811 206
1170 3300026116 Ga0207674_10010196 Ga0207674_100101964 206
1171 3300026118 Ga0207675_100012815 Ga0207675_1000128155 206
1172 3300026118 Ga0207675_100162337 Ga0207675_1001623373 206
1173 3300026118 Ga0207675_100862005 Ga0207675_1008620051 206
1174 3300026121 Ga0207683_10000009 Ga0207683_10000009106 206
1175 3300026142 Ga0207698_10046054 Ga0207698_100460543 206
1176 3300026142 Ga0207698_10215874 Ga0207698_102158742 206
1177 3300026142 Ga0207698_10388092 Ga0207698_103880922 206
1178 3300026142 Ga0207698_10711551 Ga0207698_107115512 206
1179 3300027111 Ga0209281_1013031 Ga0209281_10130312 206
1180 3300027312 Ga0209371_1000023 Ga0209371_1000023183 206
1181 3300027907 Ga0207428_10015977 Ga0207428_100159776 206
1182 3300027907 Ga0207428_10203634 Ga0207428_102036342 206
1183 3300028379 Ga0268266_10005005 Ga0268266_1000500511 206
1184 3300028379 Ga0268266_10060827 Ga0268266_100608274 206
1185 3300028381 Ga0268264_10070210 Ga0268264_100702104 206
1186 3300028381 Ga0268264_10081212 Ga0268264_100812122 206
1187 3300028786 Ga0307517_10104066 Ga0307517_101040661 206
1188 3300028800 Ga0265338_10000118 Ga0265338_10000118106 206
1189 3300030500 Ga0268256_1000023 Ga0268256_1000023257 206
1190 3300030500 Ga0268256_1000050 Ga0268256_100005083 206
1191 3300030731 Ga0316177_1104169 Ga0316177_11041692 206
1192 3300030744 Ga0316181_1003769 Ga0316181_10037693 206
1193 3300031238 Ga0265332_10020812 Ga0265332_100208122 206
1194 3300031247 Ga0265340_10063801 Ga0265340_100638012 206
1195 3300031344 Ga0265316_10205203 Ga0265316_102052032 206
1196 3300031507 Ga0307509_10000052 Ga0307509_10000052119 206
1197 3300031548 Ga0307408_100000194 Ga0307408_10000019446 206
1198 3300031548 Ga0307408_100020906 Ga0307408_1000209065 206
1199 3300031548 Ga0307408_100190230 Ga0307408_1001902302 206
1200 3300031730 Ga0307516_10134536 Ga0307516_101345363 206
1201 3300031730 Ga0307516_10251391 Ga0307516_102513912 206
1202 3300031730 Ga0307516_10653191 Ga0307516_106531911 206
1203 3300031731 Ga0307405_10164241 Ga0307405_101642411 206
1204 3300031824 Ga0307413_10025015 Ga0307413_100250153 206
1205 3300031824 Ga0307413_10226532 Ga0307413_102265322 206
1206 3300031852 Ga0307410_10080021 Ga0307410_100800212 206
1207 3300031852 Ga0307410_10306209 Ga0307410_103062092 206
1208 3300031901 Ga0307406_10539633 Ga0307406_105396331 206
1209 3300031903 Ga0307407_10005761 Ga0307407_100057613 206
1210 3300031903 Ga0307407_10133122 Ga0307407_101331222 206
1211 3300031911 Ga0307412_10047860 Ga0307412_100478602 206
1212 3300031995 Ga0307409_100037068 Ga0307409_1000370683 206
1213 3300031995 Ga0307409_100075501 Ga0307409_1000755012 206
1214 3300031995 Ga0307409_100536681 Ga0307409_1005366812 206
1215 3300032002 Ga0307416_100019933 Ga0307416_1000199334 206
1216 3300032002 Ga0307416_100307980 Ga0307416_1003079802 206
1217 3300032004 Ga0307414_10236516 Ga0307414_102365162 206
1218 3300032004 Ga0307414_10510780 Ga0307414_105107802 206
1219 3300036401 Ga0373937_0025086 Ga0373937_0025086_4448_5080 206
1220 3300037312 Ga0395899_0195356 Ga0395899_0195356_713_1384 206
1221 3300037471 Ga0395905_0055632 Ga0395905_0055632_341_964 206
1222 3300038705 Ga0237819_00624 Ga0237819_00624_6077_6697 206
1223 3300039062 Ga0400483_020937 Ga0400483_020937_4900_5526 206
1224 3300039062 Ga0400483_248084 Ga0400483_248084_3014_3640 206
1225 3300039062 Ga0400483_248289 Ga0400483_248289_2081_2707 206
1226 3300039447 Ga0436361_0602091 Ga0436361_0602091_290_1003 206
1227 3300041405 Ga0439438_004655 Ga0439438_004655_2318_2938 206
1228 3300041411 Ga0439466_0004451 Ga0439466_0004451_394_1014 206
1229 3300042006 Ga0439432_016961 Ga0439432_016961_1459_2079 206
1230 3300042007 Ga0439449_0065883 Ga0439449_0065883_174_797 206
1231 3300042009 Ga0439451_000445 Ga0439451_000445_1059_1679 206
1232 3300042009 Ga0439451_004420 Ga0439451_004420_1699_2319 206
1233 3300042010 Ga0439452_000485 Ga0439452_000485_4159_4779 206
1234 3300042010 Ga0439452_019785 Ga0439452_019785_574_1194 206
1235 3300042015 Ga0439462_0032484 Ga0439462_0032484_404_1057 206
1236 3300042016 Ga0439463_002054 Ga0439463_002054_4315_4947 206
1237 3300042016 Ga0439463_025189 Ga0439463_025189_161_793 206
1238 3300042016 Ga0439463_057533 Ga0439463_057533_47_667 206
1239 3300042115 Ga0450911_001553 Ga0450911_001553_81_701 206
1240 3300042115 Ga0450911_003577 Ga0450911_003577_86_706 206
1241 3300042117 Ga0450913_008653 Ga0450913_008653_28_663 206
1242 3300042127 Ga0450890_000729 Ga0450890_000729_1231_1851 206
1243 3300042129 Ga0450891_003745 Ga0450891_003745_34_654 206
1244 3300042138 Ga0450903_014414 Ga0450903_014414_418_1038 206
1245 3300042146 Ga0450907_009459 Ga0450907_009459_359_979 206
1246 3300042156 Ga0439446_0169028 Ga0439446_0169028_35_670 206
1247 3300042439 Ga0439464_0004285 Ga0439464_0004285_813_1436 206
1248 3300042461 Ga0439460_0004154 Ga0439460_0004154_2328_2948 206
1249 3300044656 Ga0466969_0002544 Ga0466969_0002544_4945_5607 206
1250 3300044684 Ga0466966_0000701 Ga0466966_0000701_13478_14140 206
1251 3300044693 Ga0466961_0002712 Ga0466961_0002712_9352_9987 206
1252 3300044693 Ga0466961_0003965 Ga0466961_0003965_4639_5301 206
1253 3300044694 Ga0466963_0240141 Ga0466963_0240141_229_891 206
1254 3300044706 Ga0466964_0052165 Ga0466964_0052165_457_1092 206
1255 3300044719 Ga0466971_0004296 Ga0466971_0004296_1331_1993 206
1256 3300044735 Ga0466968_0068779 Ga0466968_0068779_664_1299 206
1257 3300044765 Ga0466970_0003084 Ga0466970_0003084_3365_4000 206
1258 3300044765 Ga0466970_0013349 Ga0466970_0013349_262_924 206
1259 3300044842 Ga0466957_0004013 Ga0466957_0004013_3282_3917 206
1260 3300045049 Ga0466959_0000100 Ga0466959_0000100_19070_19732 206
1261 3300045049 Ga0466959_0167906 Ga0466959_0167906_214_846 206
1262 3300045836 Ga0466958_0006453 Ga0466958_0006453_606_1268 206
1263 3300045836 Ga0466958_0287134 Ga0466958_0287134_274_918 206
1264 3300045976 Ga0466967_0111240 Ga0466967_0111240_52_690 206
1265 3300045976 Ga0466967_0205699 Ga0466967_0205699_1055_1717 206
1266 3300046452 Ga0495617_086552 Ga0495617_086552_70_690 206
1267 3300046452 Ga0495617_093614 Ga0495617_093614_280_915 206
1268 3300046453 Ga0495627_002371 Ga0495627_002371_5583_6203 206
1269 3300046453 Ga0495627_004572 Ga0495627_004572_373_993 206
1270 3300046454 Ga0495592_0140582 Ga0495592_0140582_438_1085 206
1271 3300046455 Ga0495603_0090152 Ga0495603_0090152_1065_1685 206
1272 3300046457 Ga0495590_0053594 Ga0495590_0053594_382_1002 206
1273 3300046457 Ga0495590_0075190 Ga0495590_0075190_171_791 206
1274 3300046458 Ga0495591_000037 Ga0495591_000037_27303_27932 206
1275 3300046458 Ga0495591_000960 Ga0495591_000960_14702_15322 206
1276 3300046458 Ga0495591_001346 Ga0495591_001346_2597_3217 206
1277 3300046458 Ga0495591_001506 Ga0495591_001506_8284_8919 206
1278 3300046458 Ga0495591_001756 Ga0495591_001756_2841_3461 206
1279 3300046458 Ga0495591_002170 Ga0495591_002170_6764_7396 206
1280 3300046458 Ga0495591_002395 Ga0495591_002395_9346_9966 206
1281 3300046458 Ga0495591_007687 Ga0495591_007687_517_1152 206
1282 3300046458 Ga0495591_047522 Ga0495591_047522_21_641 206
1283 3300046460 Ga0495638_0004826 Ga0495638_0004826_3262_3882 206
1284 3300046460 Ga0495638_0005132 Ga0495638_0005132_548_1168 206
1285 3300046460 Ga0495638_0005434 Ga0495638_0005434_8210_8830 206
1286 3300046460 Ga0495638_0006182 Ga0495638_0006182_3951_4601 206
1287 3300046460 Ga0495638_0009403 Ga0495638_0009403_3096_3749 206
1288 3300046460 Ga0495638_0014627 Ga0495638_0014627_505_1125 206
1289 3300046460 Ga0495638_0089304 Ga0495638_0089304_1115_1750 206
1290 3300046462 Ga0495651_0001526 Ga0495651_0001526_11228_11875 206
1291 3300046463 Ga0495653_0010928 Ga0495653_0010928_1869_2489 206
1292 3300046463 Ga0495653_0046847 Ga0495653_0046847_2396_3016 206
1293 3300046471 Ga0495650_0001163 Ga0495650_0001163_15768_16403 206
1294 3300046471 Ga0495650_0005976 Ga0495650_0005976_4096_4734 206
1295 3300046473 Ga0495582_0028785 Ga0495582_0028785_1695_2315 206
1296 3300046474 Ga0495605_0000849 Ga0495605_0000849_13624_14256 206
1297 3300046474 Ga0495605_0002810 Ga0495605_0002810_9463_10083 206
1298 3300046474 Ga0495605_0013595 Ga0495605_0013595_1655_2290 206
1299 3300046474 Ga0495605_0019669 Ga0495605_0019669_2817_3452 206
1300 3300046474 Ga0495605_0033210 Ga0495605_0033210_1534_2163 206
1301 3300046474 Ga0495605_0069943 Ga0495605_0069943_287_916 206
1302 3300046475 Ga0495639_0037023 Ga0495639_0037023_17_637 206
1303 3300046475 Ga0495639_0063650 Ga0495639_0063650_424_1044 206
1304 3300046491 Ga0495584_0003914 Ga0495584_0003914_6762_7382 206
1305 3300046491 Ga0495584_0019260 Ga0495584_0019260_39_674 206
1306 3300046491 Ga0495584_0048988 Ga0495584_0048988_79_699 206
1307 3300046491 Ga0495584_0095941 Ga0495584_0095941_451_1071 206
1308 3300046491 Ga0495584_0212467 Ga0495584_0212467_158_790 206
1309 3300046492 Ga0495585_0002685 Ga0495585_0002685_11457_12077 206
1310 3300046492 Ga0495585_0013417 Ga0495585_0013417_2558_3193 206
1311 3300046492 Ga0495585_0192600 Ga0495585_0192600_44_664 206
1312 3300046499 Ga0495594_0067344 Ga0495594_0067344_628_1248 206
1313 3300046500 Ga0495596_0003157 Ga0495596_0003157_6903_7538 206
1314 3300046501 Ga0495607_0000149 Ga0495607_0000149_72620_73252 206
1315 3300046501 Ga0495607_0001076 Ga0495607_0001076_12237_12866 206
1316 3300046501 Ga0495607_0001283 Ga0495607_0001283_13550_14185 206
1317 3300046501 Ga0495607_0001388 Ga0495607_0001388_4319_4948 206
1318 3300046501 Ga0495607_0018552 Ga0495607_0018552_260_880 206
1319 3300046501 Ga0495607_0021322 Ga0495607_0021322_1652_2287 206
1320 3300046501 Ga0495607_0040702 Ga0495607_0040702_721_1341 206
1321 3300046501 Ga0495607_0060814 Ga0495607_0060814_497_1117 206
1322 3300046501 Ga0495607_0061381 Ga0495607_0061381_861_1490 206
1323 3300046501 Ga0495607_0061828 Ga0495607_0061828_514_1134 206
1324 3300046501 Ga0495607_0112849 Ga0495607_0112849_668_1306 206
1325 3300046501 Ga0495607_0189239 Ga0495607_0189239_151_771 206
1326 3300046501 Ga0495607_0190950 Ga0495607_0190950_146_775 206
1327 3300046506 Ga0495583_0003346 Ga0495583_0003346_2189_2824 206
1328 3300046506 Ga0495583_0003399 Ga0495583_0003399_3096_3728 206
1329 3300046506 Ga0495583_0005967 Ga0495583_0005967_4522_5160 206
1330 3300046506 Ga0495583_0007992 Ga0495583_0007992_4966_5607 206
1331 3300046506 Ga0495583_0017345 Ga0495583_0017345_345_983 206
1332 3300046507 Ga0495606_0000042 Ga0495606_0000042_209068_209703 206
1333 3300046507 Ga0495606_0000094 Ga0495606_0000094_122112_122744 206
1334 3300046507 Ga0495606_0004342 Ga0495606_0004342_6612_7247 206
1335 3300046507 Ga0495606_0006710 Ga0495606_0006710_667_1287 206
1336 3300046507 Ga0495606_0010458 Ga0495606_0010458_3035_3655 206
1337 3300046507 Ga0495606_0024275 Ga0495606_0024275_985_1605 206
1338 3300046507 Ga0495606_0036664 Ga0495606_0036664_438_1058 206
1339 3300046507 Ga0495606_0039111 Ga0495606_0039111_216_851 206
1340 3300046507 Ga0495606_0052325 Ga0495606_0052325_1941_2561 206
1341 3300046507 Ga0495606_0088236 Ga0495606_0088236_986_1606 206
1342 3300046507 Ga0495606_0169291 Ga0495606_0169291_267_896 206
1343 3300046511 Ga0495608_0014841 Ga0495608_0014841_116_775 206
1344 3300046511 Ga0495608_0214098 Ga0495608_0214098_176_823 206
1345 3300046512 Ga0495610_0002926 Ga0495610_0002926_11611_12231 206
1346 3300046512 Ga0495610_0011761 Ga0495610_0011761_2018_2653 206
1347 3300046512 Ga0495610_0019341 Ga0495610_0019341_772_1392 206
1348 3300046512 Ga0495610_0021121 Ga0495610_0021121_2718_3338 206
1349 3300046512 Ga0495610_0034583 Ga0495610_0034583_372_992 206
1350 3300046512 Ga0495610_0053459 Ga0495610_0053459_465_1085 206
1351 3300046512 Ga0495610_0083878 Ga0495610_0083878_710_1348 206
1352 3300046512 Ga0495610_0132491 Ga0495610_0132491_131_760 206
1353 3300046513 Ga0495616_0013952 Ga0495616_0013952_318_938 206
1354 3300046513 Ga0495616_0049861 Ga0495616_0049861_829_1464 206
1355 3300046513 Ga0495616_0257611 Ga0495616_0257611_25_645 206
1356 3300046515 Ga0495620_0000370 Ga0495620_0000370_23028_23648 206
1357 3300046515 Ga0495620_0000712 Ga0495620_0000712_16467_17099 206
1358 3300046515 Ga0495620_0004434 Ga0495620_0004434_2945_3580 206
1359 3300046515 Ga0495620_0015211 Ga0495620_0015211_2449_3069 206
1360 3300046515 Ga0495620_0029580 Ga0495620_0029580_889_1509 206
1361 3300046515 Ga0495620_0073965 Ga0495620_0073965_477_1097 206
1362 3300046515 Ga0495620_0120267 Ga0495620_0120267_144_779 206
1363 3300046516 Ga0495628_0019455 Ga0495628_0019455_2801_3460 206
1364 3300046516 Ga0495628_0023111 Ga0495628_0023111_3209_3856 206
1365 3300046518 Ga0495631_0013326 Ga0495631_0013326_2719_3357 206
1366 3300046518 Ga0495631_0058600 Ga0495631_0058600_874_1509 206
1367 3300046518 Ga0495631_0077096 Ga0495631_0077096_713_1333 206
1368 3300046519 Ga0495632_0000839 Ga0495632_0000839_19987_20607 206
1369 3300046519 Ga0495632_0002490 Ga0495632_0002490_697_1317 206
1370 3300046519 Ga0495632_0003654 Ga0495632_0003654_283_921 206
1371 3300046519 Ga0495632_0007029 Ga0495632_0007029_2914_3534 206
1372 3300046519 Ga0495632_0017521 Ga0495632_0017521_3029_3664 206
1373 3300046519 Ga0495632_0076860 Ga0495632_0076860_330_950 206
1374 3300046519 Ga0495632_0244946 Ga0495632_0244946_26_658 206
1375 3300046520 Ga0495637_0000518 Ga0495637_0000518_7723_8358 206
1376 3300046520 Ga0495637_0002120 Ga0495637_0002120_3909_4529 206
1377 3300046520 Ga0495637_0002498 Ga0495637_0002498_3017_3637 206
1378 3300046520 Ga0495637_0006632 Ga0495637_0006632_2340_2969 206
1379 3300046520 Ga0495637_0011157 Ga0495637_0011157_658_1296 206
1380 3300046520 Ga0495637_0013035 Ga0495637_0013035_3028_3666 206
1381 3300046520 Ga0495637_0054447 Ga0495637_0054447_607_1242 206
1382 3300046520 Ga0495637_0090531 Ga0495637_0090531_63_683 206
1383 3300046520 Ga0495637_0098999 Ga0495637_0098999_69_689 206
1384 3300046522 Ga0495643_0001985 Ga0495643_0001985_6647_7267 206
1385 3300046522 Ga0495643_0027906 Ga0495643_0027906_296_931 206
1386 3300046522 Ga0495643_0072791 Ga0495643_0072791_224_862 206
1387 3300046522 Ga0495643_0273125 Ga0495643_0273125_14_634 206
1388 3300046523 Ga0495644_0003319 Ga0495644_0003319_4400_5020 206
1389 3300046523 Ga0495644_0022555 Ga0495644_0022555_405_1040 206
1390 3300046524 Ga0495648_0003291 Ga0495648_0003291_13413_14033 206
1391 3300046524 Ga0495648_0009523 Ga0495648_0009523_6197_6817 206
1392 3300046524 Ga0495648_0012087 Ga0495648_0012087_152_772 206
1393 3300046524 Ga0495648_0021890 Ga0495648_0021890_2899_3537 206
1394 3300046524 Ga0495648_0034583 Ga0495648_0034583_14_649 206
1395 3300046524 Ga0495648_0085577 Ga0495648_0085577_894_1514 206
1396 3300046525 Ga0495663_0037378 Ga0495663_0037378_87_719 206
1397 3300046526 Ga0495666_0002123 Ga0495666_0002123_240_860 206
1398 3300046526 Ga0495666_0015904 Ga0495666_0015904_2736_3356 206
1399 3300046528 Ga0495642_0001683 Ga0495642_0001683_2801_3421 206
1400 3300046529 Ga0495652_0003383 Ga0495652_0003383_9628_10275 206
1401 3300046529 Ga0495652_0014655 Ga0495652_0014655_5922_6569 206
1402 3300046530 Ga0495654_0009795 Ga0495654_0009795_2018_2653 206
1403 3300046530 Ga0495654_0010614 Ga0495654_0010614_3154_3774 206
1404 3300046530 Ga0495654_0018508 Ga0495654_0018508_1768_2388 206
1405 3300046530 Ga0495654_0027630 Ga0495654_0027630_2010_2639 206
1406 3300046530 Ga0495654_0045750 Ga0495654_0045750_1108_1728 206
1407 3300046530 Ga0495654_0054388 Ga0495654_0054388_885_1505 206
1408 3300046535 Ga0495586_0090429 Ga0495586_0090429_462_1082 206
1409 3300046536 Ga0495587_0096907 Ga0495587_0096907_617_1240 206
1410 3300046538 Ga0495609_0000395 Ga0495609_0000395_18909_19544 206
1411 3300046538 Ga0495609_0027036 Ga0495609_0027036_1198_1818 206
1412 3300046538 Ga0495609_0089017 Ga0495609_0089017_350_985 206
1413 3300046538 Ga0495609_0104390 Ga0495609_0104390_37_657 206
1414 3300046542 Ga0495597_0001034 Ga0495597_0001034_17758_18387 206
1415 3300046542 Ga0495597_0003290 Ga0495597_0003290_600_1220 206
1416 3300046542 Ga0495597_0038735 Ga0495597_0038735_46_681 206
1417 3300046543 Ga0495645_0041759 Ga0495645_0041759_924_1571 206
1418 3300046543 Ga0495645_0146948 Ga0495645_0146948_154_813 206
1419 3300046543 Ga0495645_0234638 Ga0495645_0234638_66_686 206
1420 3300046557 Ga0495622_0001521 Ga0495622_0001521_2540_3160 206
1421 3300046557 Ga0495622_0010711 Ga0495622_0010711_3263_3898 206
1422 3300046558 Ga0495633_0003880 Ga0495633_0003880_8407_9027 206
1423 3300046558 Ga0495633_0018744 Ga0495633_0018744_2760_3380 206
1424 3300046558 Ga0495633_0104180 Ga0495633_0104180_543_1163 206
1425 3300046616 Ga0495668_0003196 Ga0495668_0003196_11430_12050 206
1426 3300046616 Ga0495668_0045515 Ga0495668_0045515_461_1090 206
1427 3300046648 Ga0495611_0000932 Ga0495611_0000932_6479_7099 206
1428 3300046648 Ga0495611_0004344 Ga0495611_0004344_38_673 206
1429 3300046648 Ga0495611_0011566 Ga0495611_0011566_319_957 206
1430 3300046648 Ga0495611_0118484 Ga0495611_0118484_506_1126 206
1431 3300046660 Ga0495625_0000672 Ga0495625_0000672_27982_28617 206
1432 3300046660 Ga0495625_0013918 Ga0495625_0013918_2548_3168 206
1433 3300046660 Ga0495625_0015980 Ga0495625_0015980_564_1184 206
1434 3300046660 Ga0495625_0058185 Ga0495625_0058185_383_1003 206
1435 3300046660 Ga0495625_0327292 Ga0495625_0327292_312_941 206
1436 3300046663 Ga0495635_0142949 Ga0495635_0142949_326_985 206
1437 3300046665 Ga0495661_0000205 Ga0495661_0000205_15736_16374 206
1438 3300046665 Ga0495661_0000437 Ga0495661_0000437_19093_19728 206
1439 3300046665 Ga0495661_0001817 Ga0495661_0001817_12201_12821 206
1440 3300046665 Ga0495661_0021833 Ga0495661_0021833_3145_3777 206
1441 3300046665 Ga0495661_0030083 Ga0495661_0030083_2786_3424 206
1442 3300046665 Ga0495661_0050094 Ga0495661_0050094_1392_2012 206
1443 3300046665 Ga0495661_0117772 Ga0495661_0117772_515_1135 206
1444 3300046674 Ga0495588_0386856 Ga0495588_0386856_82_702 206
1445 3300046675 Ga0495657_0078730 Ga0495657_0078730_1257_1916 206
1446 3300046675 Ga0495657_0169271 Ga0495657_0169271_556_1176 206
1447 3300046678 Ga0495599_0065919 Ga0495599_0065919_1396_2055 206
1448 3300046679 Ga0495623_0006272 Ga0495623_0006272_5651_6271 206
1449 3300046679 Ga0495623_0011011 Ga0495623_0011011_2444_3091 206
1450 3300046679 Ga0495623_0117161 Ga0495623_0117161_624_1283 206
1451 3300046680 Ga0495646_0031113 Ga0495646_0031113_1317_1964 206
1452 3300046690 Ga0495624_0008471 Ga0495624_0008471_188_808 206
1453 3300046690 Ga0495624_0090273 Ga0495624_0090273_580_1239 206
1454 3300046690 Ga0495624_0205268 Ga0495624_0205268_270_917 206
1455 3300046691 Ga0495670_0037571 Ga0495670_0037571_1410_2030 206
1456 3300046692 Ga0495671_0003674 Ga0495671_0003674_1690_2310 206
1457 3300046692 Ga0495671_0004465 Ga0495671_0004465_5994_6614 206
1458 3300046692 Ga0495671_0004983 Ga0495671_0004983_1753_2391 206
1459 3300046692 Ga0495671_0007822 Ga0495671_0007822_4416_5036 206
1460 3300046692 Ga0495671_0015205 Ga0495671_0015205_582_1202 206
1461 3300046692 Ga0495671_0015406 Ga0495671_0015406_101_721 206
1462 3300046692 Ga0495671_0115800 Ga0495671_0115800_619_1239 206
1463 3300046692 Ga0495671_0121301 Ga0495671_0121301_158_778 206
1464 3300046694 Ga0495649_0000813 Ga0495649_0000813_19429_20049 206
1465 3300046694 Ga0495649_0011895 Ga0495649_0011895_193_813 206
1466 3300046694 Ga0495649_0023047 Ga0495649_0023047_2279_2899 206
1467 3300046694 Ga0495649_0047497 Ga0495649_0047497_1194_1814 206
1468 3300046694 Ga0495649_0055434 Ga0495649_0055434_514_1134 206
1469 3300046694 Ga0495649_0070460 Ga0495649_0070460_53_688 206
1470 3300046694 Ga0495649_0084108 Ga0495649_0084108_270_905 206
1471 3300046694 Ga0495649_0211595 Ga0495649_0211595_116_736 206
1472 3300046794 Ga0495589_0003822 Ga0495589_0003822_1780_2400 206
1473 3300046794 Ga0495589_0006874 Ga0495589_0006874_3189_3809 206
1474 3300046809 Ga0495600_0005056 Ga0495600_0005056_4306_4965 206
1475 3300046809 Ga0495600_0115827 Ga0495600_0115827_497_1117 206
1476 3300046809 Ga0495600_0447738 Ga0495600_0447738_37_657 206
1477 3300046810 Ga0495660_0001767 Ga0495660_0001767_8186_8815 206
1478 3300046810 Ga0495660_0003160 Ga0495660_0003160_1370_1999 206
1479 3300046810 Ga0495660_0006768 Ga0495660_0006768_5860_6480 206
1480 3300046810 Ga0495660_0011688 Ga0495660_0011688_2524_3144 206
1481 3300046810 Ga0495660_0028243 Ga0495660_0028243_109_747 206
1482 3300046810 Ga0495660_0043308 Ga0495660_0043308_578_1198 206
1483 3300046810 Ga0495660_0079486 Ga0495660_0079486_393_1013 206
1484 3300046810 Ga0495660_0093520 Ga0495660_0093520_765_1385 206
1485 3300046810 Ga0495660_0093707 Ga0495660_0093707_853_1473 206
1486 3300046810 Ga0495660_0187273 Ga0495660_0187273_200_835 206
1487 3300046810 Ga0495660_0251164 Ga0495660_0251164_48_686 206
1488 3300047317 Ga0495604_0015148 Ga0495604_0015148_4204_4863 206
1489 3300047320 Ga0495672_0003648 Ga0495672_0003648_7935_8555 206
1490 3300047320 Ga0495672_0008206 Ga0495672_0008206_6344_6964 206
1491 3300047320 Ga0495672_0008237 Ga0495672_0008237_548_1168 206
1492 3300047320 Ga0495672_0012356 Ga0495672_0012356_2367_2996 206
1493 3300047320 Ga0495672_0029446 Ga0495672_0029446_1751_2371 206
1494 3300047320 Ga0495672_0029976 Ga0495672_0029976_1750_2385 206
1495 3300047320 Ga0495672_0035502 Ga0495672_0035502_1542_2162 206
1496 3300047320 Ga0495672_0044459 Ga0495672_0044459_332_952 206
1497 3300047320 Ga0495672_0085170 Ga0495672_0085170_981_1610 206
1498 3300047321 Ga0495676_0000171 Ga0495676_0000171_21956_22591 206
1499 3300047321 Ga0495676_0005618 Ga0495676_0005618_8762_9382 206
1500 3300047321 Ga0495676_0287743 Ga0495676_0287743_250_909 206
1501 3300047322 Ga0495680_0013577 Ga0495680_0013577_5282_5902 206
1502 3300047322 Ga0495680_0195899 Ga0495680_0195899_374_994 206
1503 3300047322 Ga0495680_0245429 Ga0495680_0245429_202_822 206
1504 3300047322 Ga0495680_0590021 Ga0495680_0590021_66_686 206
1505 3300047323 Ga0495683_0002187 Ga0495683_0002187_5144_5764 206
1506 3300047323 Ga0495683_0004452 Ga0495683_0004452_2854_3474 206
1507 3300047323 Ga0495683_0060803 Ga0495683_0060803_176_811 206
1508 3300047323 Ga0495683_0112566 Ga0495683_0112566_543_1163 206
1509 3300047443 Ga0495687_014652 Ga0495687_014652_1680_2300 206
1510 3300047444 Ga0495675_0160520 Ga0495675_0160520_156_776 206
1511 3300047446 Ga0495679_000119 Ga0495679_000119_50402_51037 206
1512 3300047446 Ga0495679_005487 Ga0495679_005487_305_925 206
1513 3300047446 Ga0495679_011231 Ga0495679_011231_2473_3093 206
1514 3300047469 Ga0495673_0002146 Ga0495673_0002146_9302_9922 206
1515 3300047469 Ga0495673_0003396 Ga0495673_0003396_2955_3578 206
1516 3300047469 Ga0495673_0004684 Ga0495673_0004684_4944_5582 206
1517 3300047469 Ga0495673_0006738 Ga0495673_0006738_889_1509 206
1518 3300047469 Ga0495673_0014086 Ga0495673_0014086_2848_3486 206
1519 3300047469 Ga0495673_0015086 Ga0495673_0015086_2748_3380 206
1520 3300047469 Ga0495673_0016949 Ga0495673_0016949_135_767 206
1521 3300047469 Ga0495673_0032777 Ga0495673_0032777_71_706 206
1522 3300047469 Ga0495673_0071120 Ga0495673_0071120_135_755 206
1523 3300047469 Ga0495673_0087608 Ga0495673_0087608_49_669 206
1524 3300047469 Ga0495673_0092902 Ga0495673_0092902_494_1114 206
1525 3300047469 Ga0495673_0106155 Ga0495673_0106155_228_863 206
1526 3300047470 Ga0495681_0007039 Ga0495681_0007039_5124_5744 206
1527 3300047470 Ga0495681_0011334 Ga0495681_0011334_406_1026 206
1528 3300047470 Ga0495681_0018332 Ga0495681_0018332_660_1295 206
1529 3300047470 Ga0495681_0021522 Ga0495681_0021522_2353_2973 206
1530 3300047470 Ga0495681_0022687 Ga0495681_0022687_204_824 206
1531 3300047470 Ga0495681_0028069 Ga0495681_0028069_1615_2235 206
1532 3300047470 Ga0495681_0106035 Ga0495681_0106035_520_1140 206
1533 3300047472 Ga0495686_0004625 Ga0495686_0004625_9966_10586 206
1534 3300047472 Ga0495686_0013186 Ga0495686_0013186_4105_4740 206
1535 3300047472 Ga0495686_0049354 Ga0495686_0049354_42_662 206
1536 3300047472 Ga0495686_0145655 Ga0495686_0145655_721_1356 206
1537 3300047472 Ga0495686_0350079 Ga0495686_0350079_154_783 206
1538 3300047673 Ga0495593_0005528 Ga0495593_0005528_5196_5816 206
1539 3300048088 Ga0495602_0035542 Ga0495602_0035542_3569_4189 206
1540 3300048088 Ga0495602_0052798 Ga0495602_0052798_401_1060 206
1541 3300048088 Ga0495602_0189543 Ga0495602_0189543_373_1020 206
1542 3300048088 Ga0495602_0339293 Ga0495602_0339293_250_897 206
1543 3300048091 Ga0495626_0000123 Ga0495626_0000123_24367_25002 206
1544 3300048091 Ga0495626_0003485 Ga0495626_0003485_9314_9934 206
1545 3300048091 Ga0495626_0009762 Ga0495626_0009762_2827_3447 206
1546 3300048091 Ga0495626_0040937 Ga0495626_0040937_567_1187 206
1547 3300048091 Ga0495626_0055747 Ga0495626_0055747_635_1255 206
1548 3300048905 Ga0496102_0062552 Ga0496102_0062552_448_1080 206
1549 3300048905 Ga0496102_0296561 Ga0496102_0296561_657_1289 206
1550 3300048906 Ga0496103_0077612 Ga0496103_0077612_228_860 206
1551 3300048911 Ga0496108_0358924 Ga0496108_0358924_284_916 206
1552 3300048911 Ga0496108_0382610 Ga0496108_0382610_102_806 206
1553 3300048913 Ga0496110_0229455 Ga0496110_0229455_700_1332 206
1554 3300048913 Ga0496110_0270918 Ga0496110_0270918_755_1387 206
1555 3300048915 Ga0496112_0001839 Ga0496112_0001839_6990_7646 206
1556 3300048915 Ga0496112_0043323 Ga0496112_0043323_3545_4180 206
1557 3300048916 Ga0496113_0031793 Ga0496113_0031793_983_1618 206
1558 3300048917 Ga0496114_0205139 Ga0496114_0205139_675_1379 206
1559 3300048918 Ga0496115_0077865 Ga0496115_0077865_1017_1637 206
1560 3300048919 Ga0496116_0001261 Ga0496116_0001261_6328_6948 206
1561 3300048919 Ga0496116_0009203 Ga0496116_0009203_931_1551 206
1562 3300048919 Ga0496116_0065947 Ga0496116_0065947_1360_1992 206
1563 3300048920 Ga0496117_0007562 Ga0496117_0007562_513_1148 206
1564 3300048920 Ga0496117_0013964 Ga0496117_0013964_4420_5040 206
1565 3300048920 Ga0496117_0043017 Ga0496117_0043017_40_672 206
1566 3300048920 Ga0496117_0275142 Ga0496117_0275142_158_778 206
1567 3300048921 Ga0496118_0000110 Ga0496118_0000110_75768_76403 206
1568 3300048921 Ga0496118_0106046 Ga0496118_0106046_1065_1685 206
1569 3300048921 Ga0496118_0202860 Ga0496118_0202860_470_1105 206
1570 3300048921 Ga0496118_0212095 Ga0496118_0212095_95_727 206
1571 3300048924 Ga0496121_0003265 Ga0496121_0003265_12488_13123 206
1572 3300048924 Ga0496121_0007177 Ga0496121_0007177_5860_6495 206
1573 3300048924 Ga0496121_0027767 Ga0496121_0027767_1117_1737 206
1574 3300048924 Ga0496121_0049083 Ga0496121_0049083_2664_3296 206
1575 3300048924 Ga0496121_0298633 Ga0496121_0298633_404_1024 206
1576 3300048924 Ga0496121_0495183 Ga0496121_0495183_85_717 206
1577 3300048925 Ga0496122_0000156 Ga0496122_0000156_15995_16630 206
1578 3300048925 Ga0496122_0000203 Ga0496122_0000203_81639_82274 206
1579 3300048925 Ga0496122_0005055 Ga0496122_0005055_8695_9330 206
1580 3300048925 Ga0496122_0039759 Ga0496122_0039759_2407_3027 206
1581 3300048925 Ga0496122_0040203 Ga0496122_0040203_2710_3342 206
1582 3300048925 Ga0496122_0125128 Ga0496122_0125128_250_870 206
1583 3300048926 Ga0496123_0000087 Ga0496123_0000087_166163_166798 206
1584 3300048926 Ga0496123_0000164 Ga0496123_0000164_50275_50910 206
1585 3300048926 Ga0496123_0007317 Ga0496123_0007317_5830_6465 206
1586 3300048926 Ga0496123_0080573 Ga0496123_0080573_1001_1633 206
1587 3300048926 Ga0496123_0112383 Ga0496123_0112383_397_1017 206
1588 3300048926 Ga0496123_0155192 Ga0496123_0155192_553_1173 206
1589 3300048926 Ga0496123_0316871 Ga0496123_0316871_90_713 206
1590 3300048927 Ga0496124_0000006 Ga0496124_0000006_529080_529715 206
1591 3300048927 Ga0496124_0000625 Ga0496124_0000625_12078_12713 206
1592 3300048927 Ga0496124_0004834 Ga0496124_0004834_14233_14865 206
1593 3300048927 Ga0496124_0014633 Ga0496124_0014633_1727_2347 206
1594 3300048927 Ga0496124_0034319 Ga0496124_0034319_3563_4183 206
1595 3300048927 Ga0496124_0381799 Ga0496124_0381799_266_901 206
1596 3300048927 Ga0496124_0430146 Ga0496124_0430146_193_825 206
1597 3300048928 Ga0496125_0000144 Ga0496125_0000144_104699_105334 206
1598 3300048928 Ga0496125_0003794 Ga0496125_0003794_8792_9412 206
1599 3300048928 Ga0496125_0028662 Ga0496125_0028662_1906_2526 206
1600 3300048929 Ga0496126_0012736 Ga0496126_0012736_3860_4480 206
1601 3300048929 Ga0496126_0033969 Ga0496126_0033969_3734_4369 206
1602 3300048929 Ga0496126_0169439 Ga0496126_0169439_394_1014 206
1603 3300049459 Ga0495678_003152 Ga0495678_003152_9622_10257 206
1604 3300049459 Ga0495678_003293 Ga0495678_003293_6318_6938 206
1605 3300049459 Ga0495678_003507 Ga0495678_003507_2321_2941 206
1606 3300049459 Ga0495678_013660 Ga0495678_013660_3027_3665 206
1607 3300049459 Ga0495678_014358 Ga0495678_014358_2909_3547 206
1608 3300049459 Ga0495678_018085 Ga0495678_018085_2426_3046 206
1609 3300049459 Ga0495678_032830 Ga0495678_032830_826_1446 206
1610 3300049460 Ga0495682_0000586 Ga0495682_0000586_455_1087 206
1611 3300049460 Ga0495682_0002009 Ga0495682_0002009_9209_9829 206
1612 3300049570 Ga0501033_0219951 Ga0501033_0219951_196_849 206
1613 3300049571 Ga0501034_0013846 Ga0501034_0013846_2525_3223 206
1614 3300049571 Ga0501034_0153669 Ga0501034_0153669_760_1401 206
1615 3300049571 Ga0501034_0579291 Ga0501034_0579291_116_751 206
1616 3300049572 Ga0501036_0015983 Ga0501036_0015983_5301_5954 206
1617 3300049574 Ga0501038_0044736 Ga0501038_0044736_2355_3008 206
1618 3300049575 Ga0501039_0002412 Ga0501039_0002412_3604_4257 206
1619 3300049575 Ga0501039_0305875 Ga0501039_0305875_447_1097 206
1620 3300049576 Ga0501040_0034026 Ga0501040_0034026_2071_2724 206
1621 3300049577 Ga0501041_0029168 Ga0501041_0029168_2164_2817 206
1622 3300049578 Ga0501042_0005080 Ga0501042_0005080_2646_3299 206
1623 3300049578 Ga0501042_0133279 Ga0501042_0133279_700_1335 206
1624 3300049579 Ga0501043_0003327 Ga0501043_0003327_10818_11441 206
1625 3300049579 Ga0501043_0075596 Ga0501043_0075596_154_807 206
1626 3300049580 Ga0501046_0012903 Ga0501046_0012903_2327_2980 206
1627 3300049587 Ga0501071_0467023 Ga0501071_0467023_246_899 206
1628 3300049588 Ga0501072_0010165 Ga0501072_0010165_2130_2783 206
1629 3300049588 Ga0501072_0381629 Ga0501072_0381629_278_916 206
1630 3300049589 Ga0501073_0044984 Ga0501073_0044984_2313_2966 206
1631 3300049592 Ga0501076_0008593 Ga0501076_0008593_4902_5555 206
1632 3300049592 Ga0501076_0377147 Ga0501076_0377147_176_826 206
1633 3300049593 Ga0501077_0007696 Ga0501077_0007696_1871_2524 206
1634 3300049593 Ga0501077_0489887 Ga0501077_0489887_38_700 206
1635 3300049686 Ga0501257_050780 Ga0501257_050780_40_675 206
1636 3300049741 Ga0501079_0188946 Ga0501079_0188946_827_1480 206
1637 3300049742 Ga0501080_0020448 Ga0501080_0020448_2443_3096 206
1638 3300049742 Ga0501080_0494998 Ga0501080_0494998_279_908 206
1639 3300049743 Ga0501081_0020291 Ga0501081_0020291_1277_1930 206
1640 3300049744 Ga0501083_0238302 Ga0501083_0238302_190_843 206
1641 3300049758 Ga0501241_004812 Ga0501241_004812_1482_2102 206
1642 3300049822 Ga0501035_0004258 Ga0501035_0004258_6112_6810 206
1643 3300049822 Ga0501035_0024656 Ga0501035_0024656_2591_3244 206
1644 3300049823 Ga0501044_0002363 Ga0501044_0002363_1775_2473 206
1645 3300049823 Ga0501044_0278560 Ga0501044_0278560_328_963 206
1646 3300049824 Ga0501045_0012036 Ga0501045_0012036_3380_4033 206
1647 3300049824 Ga0501045_0224852 Ga0501045_0224852_285_935 206
1648 3300053077 Ga0495601_0053137 Ga0495601_0053137_103_762 206
1649 3300053077 Ga0495601_0090990 Ga0495601_0090990_316_963 206
1650 3300053085 Ga0495619_0395030 Ga0495619_0395030_251_937 206
1651 3300053103 Ga0500555_028482 Ga0500555_028482_196_822 206
1652 3300053119 Ga0500595_001126 Ga0500595_001126_7965_8624 206
1653 3300053124 Ga0500617_060103 Ga0500617_060103_599_1237 206
1654 3300053134 Ga0500658_0012753 Ga0500658_0012753_179_829 206
1655 3300053140 Ga0500573_0000071 Ga0500573_0000071_21623_22279 206
1656 3300053140 Ga0500573_0094310 Ga0500573_0094310_633_1262 206
1657 3300053141 Ga0500574_005083 Ga0500574_005083_861_1520 206
1658 3300053149 Ga0500600_0005717 Ga0500600_0005717_1977_2657 206
1659 3300054114 Ga0501084_0008983 Ga0501084_0008983_1741_2394 206
1660 3300060353 Ga0501082_0315950 Ga0501082_0315950_46_684 206
1661 3300060353 Ga0501082_0464469 Ga0501082_0464469_424_1083 206
1662 3300061719 Ga0466962_0002025 Ga0466962_0002025_5072_5734 206
1663 3300061734 Ga0530510_0019831 Ga0530510_0019831_19_672 206
1664 3300061734 Ga0530510_0333456 Ga0530510_0333456_480_1118 206
1665 iso_pu_bacteria 2513237082 2513551450 206
1666 iso_pu_bacteria 2513237083 2513560100 206
1667 iso_pu_bacteria 2643221570 2643865505 206
1668 iso_pu_bacteria 2643221596 2643992044 206
1669 iso_pu_bacteria 2643221611 2644071735 206
1670 iso_pu_bacteria 2643221717 2644649451 206
1671 iso_pu_bacteria 2856287931 2856293324 206
1672 iso_pu_bacteria 2857357740 2857366557 206
1673 iso_pu_bacteria 2904434214 2904434671 206
1674 iso_pu_bacteria 8003955200 8003957365 206

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01081

Aldolase

KDPG and KHG aldolase

27

217

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2v81-assembly1.cif.gz_A native kdpgal structure 0.9831 11 205
4qcc-assembly1.cif.gz_A structure of a cube-shaped, highly porous protein cage designed by fusing symmetric oligomeric domains 0.9809 10 205
6xh5-assembly1.cif.gz_A hierarchical design of multi-scale protein complexes by combinatorial assembly of oligomeric helical bundle and repeat protein building blocks 0.9364 10 203
8szz-assembly1.cif.gz_J cryoem structure of computationally designed nanocage o32-zl4 0.9354 3 204
7b3y-assembly1.cif.gz_B-9 structure of a nanoparticle for a covid-19 vaccine candidate 0.9335 1 204
ID Description Score Start End Superfamily
2v81A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.98 11 205 3.20.20.70
1vlwB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9328 2 206 3.20.20.70
2v81A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9278 11 205 3.20.20.70
1vlwB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9114 2 206 3.20.20.70
af_A0A1D6HW21_144_318_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9109 39 201 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A519F750-F1-model_v4 2-dehydro-3-deoxy-6-phosphogalactonate aldolase 1 20 206 GO:0016829
AF-A0A3M3GZY1-F1-model_v4 deleted 0.9999 1 113
AF-A0A3L8CVF3-F1-model_v4 2-dehydro-3-deoxy-6-phosphogalactonate aldolase 0.9978 65 206 GO:0016829
AF-A0A2N8GTS6-F1-model_v4 deleted 0.9967 54 183
AF-A0A3M3A9Z3-F1-model_v4 2-dehydro-3-deoxy-6-phosphogalactonate aldolase 0.9963 98 206 GO:0016829

Feature Viewer

pLDDT pTM Quality
97.64 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map