F495287

General Info

Members Datasets Scaffolds Average Seq Length
1674 566 1619 251

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10040946|Ga0105239_100409464
Length 285
Sequence VVDPAHGSDLTSGRGGGGRRCAMGHRLAIDEVSMAAQLQFNDVTLGYDRHPAVHHLSGEIAAGALLAVAGPNGAGKSTLFRGIVGILKPLSGTIRTAGLDIRDIAYLPQTADIDRSFPISVFDFVGTGLWRKTGVFGGIGSKARQAIAQALTAVGLNGFENRAIGTLSGGQMQRMLFARLLLQDARLIVLDEPFNAVDAKTSADLLALIKRWYAEGRTVLAALHDLDLVRASFPETLLLARGKVAWGVTADILTADNLLEARRMCEAFDDSAAACAVDDPPSQAA

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
3 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
4 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
5 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
6 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
7 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
8 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
9 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
10 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
11 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
12 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
13 2643221651 Afipia sp. Root123D2 Isolate Unclassified
14 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
15 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
16 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
17 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
18 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
19 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
20 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
21 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
22 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
23 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
24 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
25 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
26 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
27 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
28 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
29 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
30 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
31 2904699407
32 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
33 2906610324
34 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
35 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
36 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
37 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
38 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
39 2922425934
40 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
41 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
42 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
43 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
44 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
45 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
46 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
47 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
48 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
49 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
50 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
51 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
53 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
55 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
56 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
57 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
58 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
59 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
60 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
61 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
62 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
63 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
64 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
65 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
66 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
67 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
68 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
69 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
70 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
71 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
72 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
73 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
74 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
75 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
76 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
77 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
78 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
79 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
80 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
81 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
82 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
83 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
84 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
85 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
86 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
87 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
88 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
89 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
90 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
91 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
92 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
93 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
94 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
95 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
96 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
97 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
98 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
99 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
100 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
101 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
102 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
103 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
104 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
105 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
106 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
107 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
108 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
109 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
110 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
111 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
112 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
113 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
114 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
115 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
116 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
117 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
118 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
119 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
120 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
121 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
122 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
123 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
124 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
125 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
126 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
127 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
128 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
129 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
130 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
131 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
132 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
133 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
134 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
135 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
136 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
137 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
138 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
139 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
140 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
141 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
142 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
143 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
144 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
145 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
146 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
147 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
148 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
149 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
150 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
151 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
152 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
153 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
154 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
155 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
156 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
157 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
158 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
159 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
160 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
161 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
162 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
163 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
164 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
165 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
166 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
167 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
168 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
169 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
170 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
171 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
172 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
173 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
174 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
175 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
176 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
177 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
178 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
179 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
180 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
181 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
182 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
183 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
184 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
187 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
189 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
190 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
255 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
256 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
257 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
262 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
263 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
264 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
265 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
266 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
269 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
270 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
271 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
272 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
273 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
274 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
275 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
276 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
277 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
278 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
279 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
280 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
281 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
282 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
283 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
284 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
285 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
286 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
287 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
288 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
289 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
290 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
291 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
292 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
293 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
294 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
295 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
296 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
297 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
298 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
299 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
300 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
301 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
302 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
303 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
304 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
305 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
306 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
307 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
308 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
309 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
310 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
311 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
312 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
313 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
314 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
315 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
316 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
317 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
318 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
319 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
320 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
321 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
322 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
323 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
324 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
325 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
326 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
327 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
328 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
329 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
330 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
331 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
332 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
333 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
334 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
335 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
336 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
337 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
338 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
339 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
340 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
341 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
342 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
343 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
344 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
345 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
346 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
347 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
348 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
349 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
350 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
351 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
352 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
353 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
354 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
355 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
356 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
357 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
358 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
359 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
360 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
361 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
362 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
363 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
364 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
365 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
366 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
367 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
368 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
369 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
370 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
371 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
372 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
373 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
374 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
375 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
376 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
377 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
378 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
379 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
380 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
381 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
382 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
383 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
384 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
385 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
386 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
387 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
388 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
389 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
390 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
391 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
392 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
393 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
394 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
395 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
396 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
397 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
398 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
399 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
400 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
401 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
402 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
403 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
404 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
405 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
406 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
407 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
408 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
409 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
410 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
411 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
412 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
413 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
414 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
415 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
416 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
417 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
418 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
419 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
420 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
421 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
422 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
423 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
424 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
425 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
426 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
427 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
428 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
429 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
430 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
431 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
432 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
433 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
434 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
435 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
436 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
437 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
438 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
439 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
440 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
441 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
442 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
443 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
444 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
445 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
446 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
447 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
448 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
449 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
450 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
451 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
452 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
453 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
454 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
455 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
456 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
457 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
458 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
459 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
460 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
461 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
462 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
463 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
464 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
465 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
466 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
467 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
468 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
469 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
470 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
471 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
472 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
473 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
474 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
475 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
476 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
477 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
478 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
479 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
480 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
481 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
482 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
483 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
484 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
485 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
486 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
487 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
488 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
489 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
490 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
491 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
492 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
493 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
494 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
495 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
496 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
497 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
498 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
499 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
500 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
501 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
502 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
503 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
504 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
505 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
506 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
507 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
508 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
509 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
510 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
511 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
512 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
513 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
514 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
515 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
516 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
517 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
518 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
519 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
520 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
521 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
522 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
523 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
524 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
525 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
526 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
527 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
528 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
529 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
530 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
531 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
532 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
533 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
534 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
535 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
536 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
537 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
538 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
539 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
540 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
541 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
542 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
543 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
544 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
545 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
546 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
547 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
548 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
549 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
550 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
551 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
552 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
553 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
554 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
555 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
556 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
557 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
558 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
559 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
560 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
561 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
562 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
563 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
564 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
565 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
566 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.65
Metatranscriptomes 0.24
Isolates 3.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8
Nodule 2.09
Rhizoplane 7.59
Rhizosphere 75.21
Stem 0
Stem Tuber 0
Unclassified 7.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10004386 3300001989 Bacteria 5402
2 JGI24737J22298_10036272 3300001990 Bacteria 1523
3 JGI24735J21928_10043583 3300002067 Bacteria 1305
4 JGI24744J21845_10016883 3300002077 Bacteria 1452
5 JGI25406J46586_10000123 3300003203 Bacteria 33753
6 JGI25406J46586_10002008 3300003203 Bacteria 9613
7 JGI25406J46586_10011288 3300003203 Bacteria 3925
8 JGI25153J46596_10013220 3300003215 Bacteria 3505
9 JGI25404J52841_10006783 3300003659 Bacteria 2403
10 JGI25404J52841_10029708 3300003659 Bacteria 1172
11 Ga0065165_1077181 3300005262 Bacteria 872
12 Ga0070676_10160260 3300005328 Bacteria 1447
13 Ga0070676_10469751 3300005328 Bacteria 888
14 Ga0070683_100652076 3300005329 Bacteria 1008
15 Ga0070690_100015033 3300005330 Bacteria 4606
16 Ga0070690_100035314 3300005330 Bacteria 3136
17 Ga0070690_100097902 3300005330 Bacteria 1941
18 Ga0070690_100325104 3300005330 Bacteria 1109
19 Ga0070670_100015459 3300005331 Bacteria 6555
20 Ga0070670_100018725 3300005331 Bacteria 5936
21 Ga0070670_100022211 3300005331 Bacteria 5461
22 Ga0070670_100028912 3300005331 Bacteria 4771
23 Ga0070677_10003744 3300005333 Bacteria 4918
24 Ga0070666_10044995 3300005335 Bacteria 2959
25 Ga0070666_10066295 3300005335 Bacteria 2450
26 Ga0070666_10148576 3300005335 Bacteria 1634
27 Ga0070680_100173606 3300005336 Bacteria 1814
28 Ga0070680_100264188 3300005336 Bacteria 1456
29 Ga0070680_100287855 3300005336 Bacteria 1392
30 Ga0068868_100015983 3300005338 Bacteria 5565
31 Ga0068868_100040355 3300005338 Bacteria 3633
32 Ga0068868_100080496 3300005338 Bacteria 2611
33 Ga0068868_100509881 3300005338 Bacteria 1055
34 Ga0070660_100112612 3300005339 Bacteria 2166
35 Ga0070660_100166316 3300005339 Bacteria 1779
36 Ga0070689_100003230 3300005340 Bacteria 10805
37 Ga0070689_100012114 3300005340 Bacteria 6201
38 Ga0070689_100013407 3300005340 Bacteria 5930
39 Ga0070689_100017936 3300005340 Bacteria 5204
40 Ga0070691_10030581 3300005341 Bacteria 2522
41 Ga0070687_100005935 3300005343 Bacteria 4968
42 Ga0070687_100183708 3300005343 Bacteria 1254
43 Ga0070661_100076325 3300005344 Bacteria 2470
44 Ga0070661_100229369 3300005344 Bacteria 1427
45 Ga0070661_100259604 3300005344 Bacteria 1343
46 Ga0070661_100339875 3300005344 Bacteria 1176
47 Ga0070668_100155491 3300005347 Bacteria 1852
48 Ga0070668_100277548 3300005347 Bacteria 1398
49 Ga0070669_100203534 3300005353 Bacteria 1559
50 Ga0070669_100258011 3300005353 Bacteria 1390
51 Ga0070675_100013324 3300005354 Bacteria 6460
52 Ga0070675_100049538 3300005354 Bacteria 3448
53 Ga0070675_100267317 3300005354 Bacteria 1500
54 Ga0070675_100373682 3300005354 Bacteria 1268
55 Ga0070675_100405536 3300005354 Bacteria 1217
56 Ga0070671_100001610 3300005355 Bacteria 17014
57 Ga0070671_100007034 3300005355 Bacteria 9013
58 Ga0070671_100457826 3300005355 Bacteria 1095
59 Ga0070674_100002026 3300005356 Bacteria 11109
60 Ga0070674_100053105 3300005356 Bacteria 2796
61 Ga0070674_100056484 3300005356 Bacteria 2722
62 Ga0070674_100212106 3300005356 Bacteria 1501
63 Ga0070673_100037233 3300005364 Bacteria 3705
64 Ga0070673_100046009 3300005364 Bacteria 3387
65 Ga0070673_100184639 3300005364 Bacteria 1787
66 Ga0070673_100386636 3300005364 Bacteria 1248
67 Ga0070688_100005393 3300005365 Bacteria 6730
68 Ga0070688_100018452 3300005365 Bacteria 4025
69 Ga0070688_100079337 3300005365 Bacteria 2120
70 Ga0070688_100120457 3300005365 Bacteria 1757
71 Ga0070659_100256257 3300005366 Bacteria 1451
72 Ga0070659_100269598 3300005366 Bacteria 1414
73 Ga0070667_100130204 3300005367 Bacteria 2195
74 Ga0070667_100222310 3300005367 Bacteria 1681
75 Ga0070667_100318711 3300005367 Bacteria 1403
76 Ga0070709_10003714 3300005434 Bacteria 8201
77 Ga0070709_10010860 3300005434 Bacteria 5056
78 Ga0070709_10016287 3300005434 Bacteria 4242
79 Ga0070709_10035409 3300005434 Bacteria 3033
80 Ga0070709_10365416 3300005434 Bacteria 1069
81 Ga0070709_10385356 3300005434 Bacteria 1043
82 Ga0070709_10446297 3300005434 Bacteria 974
83 Ga0070714_100004426 3300005435 Bacteria 10573
84 Ga0070714_100019687 3300005435 Bacteria 5502
85 Ga0070714_100110011 3300005435 Bacteria 2439
86 Ga0070714_100134438 3300005435 Bacteria 2213
87 Ga0070714_100192220 3300005435 Bacteria 1863
88 Ga0070714_100361523 3300005435 Bacteria 1365
89 Ga0070714_100431304 3300005435 Bacteria 1250
90 Ga0070714_100486162 3300005435 Bacteria 1176
91 Ga0070713_100004454 3300005436 Bacteria 9411
92 Ga0070713_100037805 3300005436 Bacteria 3905
93 Ga0070713_100069892 3300005436 Bacteria 2962
94 Ga0070713_100090424 3300005436 Bacteria 2631
95 Ga0070713_100421166 3300005436 Bacteria 1250
96 Ga0070713_100541114 3300005436 Bacteria 1102
97 Ga0070713_100681252 3300005436 Bacteria 981
98 Ga0070710_10004296 3300005437 Bacteria 6755
99 Ga0070710_10007859 3300005437 Bacteria 5178
100 Ga0070710_10101370 3300005437 Bacteria 1715
101 Ga0070701_10009849 3300005438 Bacteria 4202
102 Ga0070711_100013653 3300005439 Bacteria 5104
103 Ga0070711_100079146 3300005439 Bacteria 2337
104 Ga0070711_100081895 3300005439 Bacteria 2302
105 Ga0070711_100209201 3300005439 Bacteria 1510
106 Ga0070711_100623380 3300005439 Bacteria 902
107 Ga0070711_100648559 3300005439 Bacteria 885
108 Ga0070700_100008437 3300005441 Bacteria 5609
109 Ga0070700_100065836 3300005441 Bacteria 2299
110 Ga0070700_100368336 3300005441 Bacteria 1071
111 Ga0070663_100050622 3300005455 Bacteria 2955
112 Ga0070663_100078596 3300005455 Bacteria 2419
113 Ga0070663_100084289 3300005455 Bacteria 2342
114 Ga0070663_100124267 3300005455 Bacteria 1953
115 Ga0070678_100043308 3300005456 Bacteria 3205
116 Ga0070678_100172924 3300005456 Bacteria 1761
117 Ga0070678_100196307 3300005456 Bacteria 1663
118 Ga0070678_100816699 3300005456 Bacteria 847
119 Ga0070662_100161339 3300005457 Bacteria 1754
120 Ga0070681_10008600 3300005458 Bacteria 10006
121 Ga0070681_10056463 3300005458 Bacteria 3907
122 Ga0070681_10073742 3300005458 Bacteria 3375
123 Ga0070681_10093747 3300005458 Bacteria 2951
124 Ga0070681_10130798 3300005458 Bacteria 2442
125 Ga0070681_10449461 3300005458 Bacteria 1201
126 Ga0068867_100027107 3300005459 Bacteria 4116
127 Ga0068867_100398096 3300005459 Bacteria 1161
128 Ga0070685_10013633 3300005466 Bacteria 4291
129 Ga0070698_100495937 3300005471 Bacteria 1159
130 Ga0070698_100671425 3300005471 Bacteria 978
131 Ga0070699_100004951 3300005518 Bacteria 11749
132 Ga0070679_100008568 3300005530 Bacteria 9635
133 Ga0070679_100012111 3300005530 Bacteria 8239
134 Ga0070679_100075408 3300005530 Bacteria 3362
135 Ga0070679_100119920 3300005530 Bacteria 2615
136 Ga0070679_100422188 3300005530 Bacteria 1279
137 Ga0070684_100027940 3300005535 Bacteria 4768
138 Ga0070684_100148121 3300005535 Bacteria 2125
139 Ga0070684_100212676 3300005535 Bacteria 1762
140 Ga0070697_100026984 3300005536 Bacteria 4593
141 Ga0070697_100460557 3300005536 Bacteria 1108
142 Ga0068853_100026288 3300005539 Bacteria 4887
143 Ga0068853_100049178 3300005539 Bacteria 3623
144 Ga0068853_100075350 3300005539 Bacteria 2944
145 Ga0068853_100089098 3300005539 Bacteria 2710
146 Ga0068853_100223183 3300005539 Bacteria 1722
147 Ga0068853_100427623 3300005539 Bacteria 1243
148 Ga0070672_100035470 3300005543 Bacteria 3792
149 Ga0070672_100128515 3300005543 Bacteria 2081
150 Ga0070672_100229123 3300005543 Bacteria 1560
151 Ga0070686_100018490 3300005544 Bacteria 4091
152 Ga0070696_100290547 3300005546 Bacteria 1249
153 Ga0070693_100019524 3300005547 Bacteria 3555
154 Ga0070693_100050777 3300005547 Bacteria 2372
155 Ga0070693_100363524 3300005547 Bacteria 994
156 Ga0070665_100100848 3300005548 Bacteria 2891
157 Ga0070665_100133374 3300005548 Bacteria 2485
158 Ga0070665_100255887 3300005548 Bacteria 1752
159 Ga0070665_100419582 3300005548 Bacteria 1347
160 Ga0070704_100055201 3300005549 Bacteria 2815
161 Ga0070704_100061113 3300005549 Bacteria 2695
162 Ga0068855_100125468 3300005563 Bacteria 2935
163 Ga0068855_100136451 3300005563 Bacteria 2799
164 Ga0068855_100148989 3300005563 Bacteria 2661
165 Ga0068855_100187013 3300005563 Bacteria 2339
166 Ga0068855_100400596 3300005563 Bacteria 1504
167 Ga0068855_100442924 3300005563 Bacteria 1418
168 Ga0068855_100866528 3300005563 Bacteria 956
169 Ga0070664_100221821 3300005564 Bacteria 1692
170 Ga0070664_100311239 3300005564 Bacteria 1425
171 Ga0068857_100123071 3300005577 Bacteria 2337
172 Ga0068857_100316031 3300005577 Bacteria 1442
173 Ga0068854_100008298 3300005578 Bacteria 6670
174 Ga0068854_100017829 3300005578 Bacteria 4758
175 Ga0068854_100175095 3300005578 Bacteria 1672
176 Ga0068856_100006410 3300005614 Bacteria 11545
177 Ga0068856_100019463 3300005614 Bacteria 6589
178 Ga0068856_100077437 3300005614 Bacteria 3295
179 Ga0068856_100097345 3300005614 Bacteria 2931
180 Ga0068856_100492401 3300005614 Bacteria 1247
181 Ga0070702_100026608 3300005615 Bacteria 3110
182 Ga0068852_100016237 3300005616 Bacteria 5800
183 Ga0068852_100108085 3300005616 Bacteria 2524
184 Ga0068852_100260370 3300005616 Bacteria 1665
185 Ga0068852_100708737 3300005616 Bacteria 1017
186 Ga0068859_100046809 3300005617 Bacteria 4343
187 Ga0068859_100178426 3300005617 Bacteria 2206
188 Ga0068859_100316000 3300005617 Bacteria 1656
189 Ga0068859_100401058 3300005617 Bacteria 1467
190 Ga0068859_100591992 3300005617 Bacteria 1202
191 Ga0068859_100757730 3300005617 Bacteria 1060
192 Ga0068864_100030864 3300005618 Bacteria 4544
193 Ga0068864_100193359 3300005618 Bacteria 1866
194 Ga0068864_100378621 3300005618 Bacteria 1341
195 Ga0068866_10155194 3300005718 Bacteria 1330
196 Ga0068866_10187795 3300005718 Bacteria 1226
197 Ga0068861_100038870 3300005719 Bacteria 3548
198 Ga0068861_100621031 3300005719 Bacteria 994
199 Ga0068861_100741690 3300005719 Bacteria 916
200 Ga0068861_100866072 3300005719 Bacteria 853
201 Ga0068851_10003850 3300005834 Bacteria 6714
202 Ga0068851_10042924 3300005834 Bacteria 2278
203 Ga0068870_10002916 3300005840 Bacteria 7205
204 Ga0068870_10120381 3300005840 Bacteria 1511
205 Ga0068863_100025497 3300005841 Bacteria 5637
206 Ga0068858_100074670 3300005842 Bacteria 3148
207 Ga0068858_100088274 3300005842 Bacteria 2885
208 Ga0068860_100003385 3300005843 Bacteria 16406
209 Ga0068860_100734013 3300005843 Bacteria 999
210 Ga0068862_100026407 3300005844 Bacteria 4880
211 Ga0081455_10029463 3300005937 Bacteria 5005
212 Ga0081455_10050468 3300005937 Bacteria 3578
213 Ga0081455_10069468 3300005937 Bacteria 2929
214 Ga0081455_10086007 3300005937 Bacteria 2562
215 Ga0081455_10089463 3300005937 Bacteria 2498
216 Ga0081455_10188683 3300005937 Bacteria 1555
217 Ga0081455_10298241 3300005937 Bacteria 1158
218 Ga0081538_10009993 3300005981 Bacteria 7826
219 Ga0081538_10021985 3300005981 Bacteria 4635
220 Ga0081538_10151176 3300005981 Bacteria 1051
221 Ga0081538_10179447 3300005981 Bacteria 909
222 Ga0081540_1000297 3300005983 Bacteria 51592
223 Ga0081540_1005566 3300005983 Bacteria 9382
224 Ga0081540_1005578 3300005983 Bacteria 9373
225 Ga0081540_1005635 3300005983 Bacteria 9325
226 Ga0081540_1005788 3300005983 Bacteria 9148
227 Ga0081540_1010271 3300005983 Bacteria 6356
228 Ga0081540_1012941 3300005983 Bacteria 5452
229 Ga0081540_1026519 3300005983 Bacteria 3306
230 Ga0081540_1031359 3300005983 Bacteria 2924
231 Ga0081540_1046748 3300005983 Bacteria 2182
232 Ga0081540_1054487 3300005983 Bacteria 1954
233 Ga0081540_1062738 3300005983 Bacteria 1763
234 Ga0081539_10000425 3300005985 Bacteria 89942
235 Ga0081539_10001098 3300005985 Bacteria 49182
236 Ga0081539_10010784 3300005985 Bacteria 7355
237 Ga0081539_10033511 3300005985 Bacteria 3125
238 Ga0081539_10048626 3300005985 Bacteria 2411
239 Ga0070717_10000959 3300006028 Bacteria 19227
240 Ga0070717_10032149 3300006028 Bacteria 4226
241 Ga0070717_10066690 3300006028 Bacteria 2994
242 Ga0070717_10126720 3300006028 Bacteria 2192
243 Ga0070717_10196019 3300006028 Bacteria 1767
244 Ga0070717_10203536 3300006028 Bacteria 1735
245 Ga0070717_10252148 3300006028 Bacteria 1559
246 Ga0070717_10261306 3300006028 Bacteria 1532
247 Ga0075365_10001973 3300006038 Bacteria 9695
248 Ga0075365_10002915 3300006038 Bacteria 8635
249 Ga0075365_10029444 3300006038 Bacteria 3510
250 Ga0075365_10066978 3300006038 Bacteria 2410
251 Ga0075365_10074576 3300006038 Bacteria 2288
252 Ga0075365_10094709 3300006038 Bacteria 2038
253 Ga0075368_10013948 3300006042 Bacteria 2958
254 Ga0075363_100004089 3300006048 Bacteria 6322
255 Ga0075363_100040761 3300006048 Bacteria 2448
256 Ga0075364_10071316 3300006051 Bacteria 2288
257 Ga0075364_10130779 3300006051 Bacteria 1684
258 Ga0075364_10275501 3300006051 Bacteria 1144
259 Ga0070715_10002654 3300006163 Bacteria 5535
260 Ga0070715_10023346 3300006163 Bacteria 2422
261 Ga0070715_10088665 3300006163 Bacteria 1418
262 Ga0070715_10203114 3300006163 Bacteria 1008
263 Ga0070716_100002220 3300006173 Bacteria 8943
264 Ga0070716_100040223 3300006173 Bacteria 2600
265 Ga0070716_100058529 3300006173 Bacteria 2218
266 Ga0070716_100096426 3300006173 Bacteria 1802
267 Ga0070712_100163364 3300006175 Bacteria 1721
268 Ga0070712_100200928 3300006175 Bacteria 1566
269 Ga0075362_10037679 3300006177 Bacteria 2121
270 Ga0075362_10182958 3300006177 Bacteria 1016
271 Ga0075367_10019167 3300006178 Bacteria 3790
272 Ga0075367_10031100 3300006178 Bacteria 3065
273 Ga0075367_10033542 3300006178 Bacteria 2960
274 Ga0075367_10082992 3300006178 Bacteria 1941
275 Ga0075367_10098026 3300006178 Bacteria 1789
276 Ga0075367_10222384 3300006178 Bacteria 1182
277 Ga0075369_10005998 3300006186 Bacteria 4573
278 Ga0075369_10045879 3300006186 Bacteria 1880
279 Ga0075369_10052741 3300006186 Bacteria 1763
280 Ga0075366_10001342 3300006195 Bacteria 12294
281 Ga0075366_10084870 3300006195 Bacteria 1893
282 Ga0097621_100023761 3300006237 Bacteria 4776
283 Ga0097621_100276690 3300006237 Bacteria 1477
284 Ga0075370_10009275 3300006353 Bacteria 5104
285 Ga0075370_10019271 3300006353 Bacteria 3715
286 Ga0075370_10102535 3300006353 Bacteria 1657
287 Ga0075370_10140984 3300006353 Bacteria 1409
288 Ga0068871_100071108 3300006358 Bacteria 2861
289 Ga0075428_100014624 3300006844 Bacteria 8715
290 Ga0075428_100158933 3300006844 Bacteria 2453
291 Ga0075428_100364147 3300006844 Bacteria 1551
292 Ga0075428_100367630 3300006844 Bacteria 1543
293 Ga0075428_100421291 3300006844 Bacteria 1430
294 Ga0075430_100000164 3300006846 Bacteria 43703
295 Ga0075430_100184701 3300006846 Bacteria 1734
296 Ga0075431_100033662 3300006847 Bacteria 5280
297 Ga0075431_100073601 3300006847 Bacteria 3525
298 Ga0075433_10246367 3300006852 Bacteria 1586
299 Ga0075434_100013700 3300006871 Bacteria 7729
300 Ga0075434_100233811 3300006871 Bacteria 1858
301 Ga0075429_100190761 3300006880 Bacteria 1795
302 Ga0075429_100336613 3300006880 Bacteria 1321
303 Ga0068865_100019538 3300006881 Bacteria 4385
304 Ga0068865_100712750 3300006881 Bacteria 858
305 Ga0075436_100037967 3300006914 Bacteria 3325
306 Ga0075436_100162870 3300006914 Bacteria 1573
307 Ga0097620_100046812 3300006931 Bacteria 4343
308 Ga0097620_100178423 3300006931 Bacteria 2206
309 Ga0097620_100315980 3300006931 Bacteria 1656
310 Ga0097620_100401085 3300006931 Bacteria 1467
311 Ga0097620_100592027 3300006931 Bacteria 1202
312 Ga0097620_100757757 3300006931 Bacteria 1060
313 Ga0099824_1008875 3300006942 Bacteria 12635
314 Ga0099822_1017500 3300006943 Bacteria 7646
315 Ga0075435_100115860 3300007076 Bacteria 2231
316 Ga0099794_10009521 3300007265 Bacteria 4090
317 Ga0099794_10075640 3300007265 Bacteria 1655
318 Ga0099795_10019465 3300007788 Bacteria 2198
319 Ga0105240_10019788 3300009093 Bacteria 8990
320 Ga0105240_10046064 3300009093 Bacteria 5528
321 Ga0105240_10154772 3300009093 Bacteria 2728
322 Ga0105240_10186062 3300009093 Bacteria 2446
323 Ga0105240_10488420 3300009093 Bacteria 1371
324 Ga0105240_10567384 3300009093 Bacteria 1254
325 Ga0105245_10023790 3300009098 Bacteria 5378
326 Ga0105245_10037769 3300009098 Bacteria 4294
327 Ga0105245_10183787 3300009098 Bacteria 1999
328 Ga0105247_10005771 3300009101 Bacteria 7752
329 Ga0105247_10059249 3300009101 Bacteria 2370
330 Ga0105247_10079666 3300009101 Bacteria 2062
331 Ga0105247_10084624 3300009101 Bacteria 2004
332 Ga0114129_10004595 3300009147 Bacteria 19485
333 Ga0114129_10056443 3300009147 Bacteria 5500
334 Ga0114129_10136649 3300009147 Bacteria 3363
335 Ga0114129_10157307 3300009147 Bacteria 3107
336 Ga0114129_10290517 3300009147 Bacteria 2182
337 Ga0114129_10620096 3300009147 Bacteria 1399
338 Ga0114129_10636286 3300009147 Bacteria 1378
339 Ga0114129_10882658 3300009147 Bacteria 1134
340 Ga0105243_10042458 3300009148 Bacteria 3560
341 Ga0105243_10174079 3300009148 Bacteria 1867
342 Ga0105241_10015112 3300009174 Bacteria 5655
343 Ga0105241_10112672 3300009174 Bacteria 2180
344 Ga0105241_10458000 3300009174 Bacteria 1129
345 Ga0105242_10066376 3300009176 Bacteria 2979
346 Ga0105242_10072541 3300009176 Bacteria 2860
347 Ga0105248_10006264 3300009177 Bacteria 13045
348 Ga0105248_10067991 3300009177 Bacteria 4000
349 Ga0105248_10126024 3300009177 Bacteria 2889
350 Ga0105248_10149282 3300009177 Bacteria 2637
351 Ga0105237_10124757 3300009545 Bacteria 2569
352 Ga0105237_10154163 3300009545 Bacteria 2294
353 Ga0105237_10751541 3300009545 Bacteria 982
354 Ga0105237_10838451 3300009545 Bacteria 926
355 Ga0105238_10025742 3300009551 Bacteria 5999
356 Ga0105238_10028483 3300009551 Bacteria 5691
357 Ga0105238_10151170 3300009551 Bacteria 2297
358 Ga0105238_10289693 3300009551 Bacteria 1619
359 Ga0105249_10023825 3300009553 Bacteria 5498
360 Ga0105249_10193252 3300009553 Bacteria 1987
361 Ga0105249_10297898 3300009553 Bacteria 1616
362 Ga0105249_10454875 3300009553 Bacteria 1319
363 Ga0099796_10011096 3300010159 Bacteria 2502
364 Ga0105239_10040946 3300010375 Bacteria 5078
365 Ga0105239_10129115 3300010375 Bacteria 2810
366 Ga0105239_10157911 3300010375 Bacteria 2533
367 Ga0105239_10192059 3300010375 Bacteria 2285
368 Ga0105246_10055196 3300011119 Bacteria 2741
369 Ga0105246_10058684 3300011119 Bacteria 2667
370 Ga0157370_10133092 3300013104 Bacteria 2319
371 Ga0157369_10004497 3300013105 Bacteria 16430
372 Ga0157369_10139055 3300013105 Bacteria 2570
373 Ga0157369_10150184 3300013105 Bacteria 2462
374 Ga0157374_10041399 3300013296 Bacteria 4245
375 Ga0157378_10152330 3300013297 Bacteria 2155
376 Ga0163162_10009179 3300013306 Bacteria 9624
377 Ga0163162_10053414 3300013306 Bacteria 4061
378 Ga0163162_10069682 3300013306 Bacteria 3569
379 Ga0163162_10353438 3300013306 Bacteria 1602
380 Ga0157372_10101997 3300013307 Bacteria 3277
381 Ga0157375_10196062 3300013308 Bacteria 2175
382 Ga0163163_10010079 3300014325 Bacteria 8477
383 Ga0163163_10033404 3300014325 Bacteria 4976
384 Ga0163163_10097355 3300014325 Bacteria 2962
385 Ga0163163_10120027 3300014325 Bacteria 2662
386 Ga0163163_10176189 3300014325 Bacteria 2185
387 Ga0163163_10206104 3300014325 Bacteria 2015
388 Ga0157380_10118996 3300014326 Bacteria 2234
389 Ga0157380_10328269 3300014326 Bacteria 1422
390 Ga0157380_10588329 3300014326 Bacteria 1099
391 Ga0157377_10359615 3300014745 Bacteria 979
392 Ga0157379_10041001 3300014968 Bacteria 4133
393 Ga0157379_10050265 3300014968 Bacteria 3721
394 Ga0157379_10369775 3300014968 Bacteria 1314
395 Ga0157376_10190593 3300014969 Bacteria 1880
396 Ga0206356_10905645 3300020070 Bacteria 1124
397 Ga0206353_10627821 3300020082 Bacteria 1922
398 Ga0213874_10047226 3300021377 Bacteria 1309
399 Ga0213876_10014482 3300021384 Bacteria 4177
400 Ga0213876_10097578 3300021384 Bacteria 1557
401 Ga0213876_10103081 3300021384 Bacteria 1513
402 Ga0213876_10230774 3300021384 Bacteria 984
403 Ga0213875_10000046 3300021388 Bacteria 149850
404 Ga0213875_10070888 3300021388 Bacteria 1627
405 Ga0213871_10013420 3300021441 Bacteria 1924
406 Ga0209677_100501 3300025253 Bacteria 22041
407 Ga0209148_1000707 3300025254 Bacteria 26803
408 Ga0209233_1009216 3300025261 Bacteria 3014
409 Ga0209233_1013279 3300025261 Bacteria 2355
410 Ga0209455_1005738 3300025272 Bacteria 3779
411 Ga0209564_1000503 3300025295 Bacteria 64437
412 Ga0209564_1007349 3300025295 Bacteria 5706
413 Ga0209758_1001932 3300025297 Bacteria 22507
414 Ga0209758_1006390 3300025297 Bacteria 8493
415 Ga0207656_10047520 3300025321 Bacteria 1845
416 Ga0207656_10137044 3300025321 Bacteria 1151
417 Ga0207682_10000375 3300025893 Bacteria 20659
418 Ga0207682_10060269 3300025893 Bacteria 1587
419 Ga0207682_10141055 3300025893 Bacteria 1081
420 Ga0207692_10001396 3300025898 Bacteria 9039
421 Ga0207692_10007186 3300025898 Bacteria 4550
422 Ga0207692_10008471 3300025898 Bacteria 4253
423 Ga0207692_10030924 3300025898 Bacteria 2559
424 Ga0207692_10096913 3300025898 Bacteria 1611
425 Ga0207642_10024442 3300025899 Bacteria 2428
426 Ga0207710_10028188 3300025900 Bacteria 2437
427 Ga0207710_10076141 3300025900 Bacteria 1548
428 Ga0207710_10277226 3300025900 Bacteria 843
429 Ga0207688_10000839 3300025901 Bacteria 15435
430 Ga0207680_10021253 3300025903 Bacteria 3509
431 Ga0207680_10121229 3300025903 Bacteria 1710
432 Ga0207647_10009009 3300025904 Bacteria 7112
433 Ga0207685_10072336 3300025905 Bacteria 1401
434 Ga0207685_10081022 3300025905 Bacteria 1343
435 Ga0207685_10152194 3300025905 Bacteria 1048
436 Ga0207699_10003881 3300025906 Bacteria 7143
437 Ga0207699_10008131 3300025906 Bacteria 5162
438 Ga0207699_10028722 3300025906 Bacteria 3094
439 Ga0207699_10179507 3300025906 Bacteria 1422
440 Ga0207645_10036084 3300025907 Bacteria 3174
441 Ga0207645_10118776 3300025907 Bacteria 1715
442 Ga0207645_10190813 3300025907 Bacteria 1346
443 Ga0207643_10001734 3300025908 Bacteria 12227
444 Ga0207643_10027690 3300025908 Bacteria 3144
445 Ga0207705_10164151 3300025909 Bacteria 1670
446 Ga0207684_10488553 3300025910 Bacteria 1056
447 Ga0207654_10034713 3300025911 Bacteria 2804
448 Ga0207654_10077069 3300025911 Bacteria 1997
449 Ga0207707_10012323 3300025912 Bacteria 7431
450 Ga0207707_10203347 3300025912 Bacteria 1727
451 Ga0207695_10010535 3300025913 Bacteria 11305
452 Ga0207695_10034396 3300025913 Bacteria 5512
453 Ga0207695_10268122 3300025913 Bacteria 1604
454 Ga0207671_10036138 3300025914 Bacteria 3662
455 Ga0207671_10081896 3300025914 Bacteria 2421
456 Ga0207671_10213050 3300025914 Bacteria 1512
457 Ga0207693_10002986 3300025915 Bacteria 14649
458 Ga0207693_10003096 3300025915 Bacteria 14328
459 Ga0207693_10076294 3300025915 Bacteria 2625
460 Ga0207693_10099279 3300025915 Bacteria 2283
461 Ga0207693_10137592 3300025915 Bacteria 1920
462 Ga0207693_10184986 3300025915 Bacteria 1640
463 Ga0207693_10190349 3300025915 Bacteria 1615
464 Ga0207663_10001112 3300025916 Bacteria 12359
465 Ga0207663_10006227 3300025916 Bacteria 6087
466 Ga0207663_10053350 3300025916 Bacteria 2525
467 Ga0207663_10081982 3300025916 Bacteria 2114
468 Ga0207663_10096743 3300025916 Bacteria 1973
469 Ga0207663_10123988 3300025916 Bacteria 1774
470 Ga0207660_10047951 3300025917 Bacteria 3022
471 Ga0207660_10125890 3300025917 Bacteria 1946
472 Ga0207660_10208695 3300025917 Bacteria 1528
473 Ga0207660_10577084 3300025917 Bacteria 915
474 Ga0207660_10664856 3300025917 Bacteria 849
475 Ga0207662_10005503 3300025918 Bacteria 6762
476 Ga0207649_10070657 3300025920 Bacteria 2227
477 Ga0207649_10221624 3300025920 Bacteria 1347
478 Ga0207649_10458083 3300025920 Bacteria 964
479 Ga0207652_10080298 3300025921 Bacteria 2851
480 Ga0207652_10214316 3300025921 Bacteria 1734
481 Ga0207681_10057307 3300025923 Bacteria 2662
482 Ga0207694_10001415 3300025924 Bacteria 20567
483 Ga0207694_10150520 3300025924 Bacteria 1874
484 Ga0207694_10225647 3300025924 Bacteria 1529
485 Ga0207694_10250582 3300025924 Bacteria 1449
486 Ga0207694_10340932 3300025924 Bacteria 1239
487 Ga0207650_10004899 3300025925 Bacteria 9136
488 Ga0207650_10010889 3300025925 Bacteria 6250
489 Ga0207650_10114790 3300025925 Bacteria 2089
490 Ga0207650_10243427 3300025925 Bacteria 1454
491 Ga0207659_10027231 3300025926 Bacteria 3867
492 Ga0207687_10082377 3300025927 Bacteria 2328
493 Ga0207687_10121567 3300025927 Bacteria 1954
494 Ga0207700_10001919 3300025928 Bacteria 11831
495 Ga0207700_10045351 3300025928 Bacteria 3243
496 Ga0207700_10069647 3300025928 Bacteria 2701
497 Ga0207700_10078221 3300025928 Bacteria 2572
498 Ga0207700_10138152 3300025928 Bacteria 1999
499 Ga0207700_10145765 3300025928 Bacteria 1951
500 Ga0207700_10530218 3300025928 Bacteria 1044
501 Ga0207664_10004154 3300025929 Bacteria 9774
502 Ga0207664_10104244 3300025929 Bacteria 2348
503 Ga0207664_10190664 3300025929 Bacteria 1764
504 Ga0207664_10214542 3300025929 Bacteria 1667
505 Ga0207664_10475437 3300025929 Bacteria 1117
506 Ga0207644_10034357 3300025931 Bacteria 3547
507 Ga0207644_10111136 3300025931 Bacteria 2072
508 Ga0207644_10413194 3300025931 Bacteria 1104
509 Ga0207644_10425936 3300025931 Bacteria 1088
510 Ga0207690_10017134 3300025932 Bacteria 4419
511 Ga0207690_10349275 3300025932 Bacteria 1169
512 Ga0207690_10421288 3300025932 Bacteria 1068
513 Ga0207706_10006114 3300025933 Bacteria 11182
514 Ga0207706_10032501 3300025933 Bacteria 4646
515 Ga0207706_10037090 3300025933 Bacteria 4329
516 Ga0207706_10096017 3300025933 Bacteria 2607
517 Ga0207706_10339310 3300025933 Bacteria 1307
518 Ga0207686_10093767 3300025934 Bacteria 1989
519 Ga0207686_10299875 3300025934 Bacteria 1193
520 Ga0207709_10039181 3300025935 Bacteria 2829
521 Ga0207670_10007476 3300025936 Bacteria 6097
522 Ga0207670_10142767 3300025936 Bacteria 1767
523 Ga0207670_10498351 3300025936 Bacteria 988
524 Ga0207670_10544921 3300025936 Bacteria 947
525 Ga0207669_10012254 3300025937 Bacteria 4211
526 Ga0207669_10026286 3300025937 Bacteria 3163
527 Ga0207669_10075737 3300025937 Bacteria 2133
528 Ga0207669_10121807 3300025937 Bacteria 1772
529 Ga0207669_10272921 3300025937 Bacteria 1271
530 Ga0207669_10300207 3300025937 Bacteria 1220
531 Ga0207704_10015064 3300025938 Bacteria 3928
532 Ga0207704_10267289 3300025938 Bacteria 1293
533 Ga0207665_10000703 3300025939 Bacteria 22673
534 Ga0207665_10009821 3300025939 Bacteria 6284
535 Ga0207665_10065574 3300025939 Bacteria 2469
536 Ga0207665_10136069 3300025939 Bacteria 1748
537 Ga0207665_10210676 3300025939 Bacteria 1419
538 Ga0207665_10442697 3300025939 Bacteria 996
539 Ga0207691_10006906 3300025940 Bacteria 10950
540 Ga0207691_10021094 3300025940 Bacteria 6155
541 Ga0207691_10121514 3300025940 Bacteria 2314
542 Ga0207711_10044345 3300025941 Bacteria 3796
543 Ga0207711_10054787 3300025941 Bacteria 3423
544 Ga0207711_10344799 3300025941 Bacteria 1379
545 Ga0207689_10038013 3300025942 Bacteria 3988
546 Ga0207661_10000171 3300025944 Bacteria 41708
547 Ga0207661_10068266 3300025944 Bacteria 2894
548 Ga0207661_10243036 3300025944 Bacteria 1598
549 Ga0207661_10401476 3300025944 Bacteria 1243
550 Ga0207661_10509489 3300025944 Bacteria 1100
551 Ga0207661_10539116 3300025944 Bacteria 1068
552 Ga0207679_10131412 3300025945 Bacteria 2009
553 Ga0207679_10258225 3300025945 Bacteria 1485
554 Ga0207667_10011741 3300025949 Bacteria 10158
555 Ga0207667_10081060 3300025949 Bacteria 3362
556 Ga0207667_10108767 3300025949 Bacteria 2859
557 Ga0207667_10179288 3300025949 Bacteria 2176
558 Ga0207667_10194588 3300025949 Bacteria 2080
559 Ga0207651_10033989 3300025960 Bacteria 3296
560 Ga0207651_10166959 3300025960 Bacteria 1732
561 Ga0207651_10587453 3300025960 Bacteria 972
562 Ga0207712_10011151 3300025961 Bacteria 5723
563 Ga0207712_10082474 3300025961 Bacteria 2344
564 Ga0207712_10170495 3300025961 Bacteria 1701
565 Ga0207668_10043690 3300025972 Bacteria 3043
566 Ga0207668_10058189 3300025972 Bacteria 2700
567 Ga0207668_10240016 3300025972 Bacteria 1466
568 Ga0207668_10280394 3300025972 Bacteria 1366
569 Ga0207668_10600740 3300025972 Bacteria 958
570 Ga0207640_10033307 3300025981 Bacteria 3204
571 Ga0207640_10072625 3300025981 Bacteria 2322
572 Ga0207658_10056905 3300025986 Bacteria 2904
573 Ga0207658_10646497 3300025986 Bacteria 953
574 Ga0207677_10006968 3300026023 Bacteria 6216
575 Ga0207677_10039289 3300026023 Bacteria 3111
576 Ga0207677_10232394 3300026023 Bacteria 1486
577 Ga0207677_10374114 3300026023 Bacteria 1200
578 Ga0207677_10530235 3300026023 Bacteria 1023
579 Ga0207703_10023677 3300026035 Bacteria 4829
580 Ga0207703_10027837 3300026035 Bacteria 4452
581 Ga0207703_10184364 3300026035 Bacteria 1844
582 Ga0207639_10102445 3300026041 Bacteria 2317
583 Ga0207639_10195435 3300026041 Bacteria 1731
584 Ga0207639_10321210 3300026041 Bacteria 1375
585 Ga0207639_10400428 3300026041 Bacteria 1236
586 Ga0207678_10006661 3300026067 Bacteria 10240
587 Ga0207678_10011116 3300026067 Bacteria 7907
588 Ga0207678_10046631 3300026067 Bacteria 3747
589 Ga0207678_10065486 3300026067 Bacteria 3120
590 Ga0207678_10092860 3300026067 Bacteria 2579
591 Ga0207678_10145531 3300026067 Bacteria 2022
592 Ga0207678_10165456 3300026067 Bacteria 1888
593 Ga0207708_10007716 3300026075 Bacteria 7966
594 Ga0207708_10124482 3300026075 Bacteria 2011
595 Ga0207708_10140391 3300026075 Bacteria 1895
596 Ga0207702_10000003 3300026078 Bacteria 434196
597 Ga0207702_10000014 3300026078 Bacteria 253304
598 Ga0207702_10029653 3300026078 Bacteria 4554
599 Ga0207702_10033457 3300026078 Bacteria 4294
600 Ga0207641_10014887 3300026088 Bacteria 6377
601 Ga0207648_10004282 3300026089 Bacteria 14717
602 Ga0207648_10016410 3300026089 Bacteria 6767
603 Ga0207648_10023386 3300026089 Bacteria 5536
604 Ga0207648_10110826 3300026089 Bacteria 2409
605 Ga0207676_10025698 3300026095 Bacteria 4371
606 Ga0207676_10103796 3300026095 Bacteria 2363
607 Ga0207676_10221457 3300026095 Bacteria 1685
608 Ga0207676_10299903 3300026095 Bacteria 1467
609 Ga0207674_10009035 3300026116 Bacteria 11446
610 Ga0207674_10120406 3300026116 Bacteria 2592
611 Ga0207674_10277529 3300026116 Bacteria 1623
612 Ga0207675_100004773 3300026118 Bacteria 13059
613 Ga0207675_100094270 3300026118 Bacteria 2816
614 Ga0207675_100336805 3300026118 Bacteria 1476
615 Ga0207675_100441847 3300026118 Bacteria 1288
616 Ga0207675_100458051 3300026118 Bacteria 1265
617 Ga0207683_10000755 3300026121 Bacteria 29385
618 Ga0207683_10011238 3300026121 Bacteria 7632
619 Ga0207683_10018023 3300026121 Bacteria 6021
620 Ga0207683_10039521 3300026121 Bacteria 4116
621 Ga0207683_10068467 3300026121 Bacteria 3133
622 Ga0207683_10090083 3300026121 Bacteria 2731
623 Ga0207683_10340568 3300026121 Bacteria 1375
624 Ga0207698_10048923 3300026142 Bacteria 3213
625 Ga0207698_10208736 3300026142 Bacteria 1755
626 Ga0207698_10649771 3300026142 Bacteria 1045
627 Ga0209589_1000005 3300027357 Bacteria 530958
628 Ga0209489_100005 3300027361 Bacteria 530958
629 Ga0209700_100006 3300027363 Bacteria 530958
630 Ga0209588_1037277 3300027671 Bacteria 1565
631 Ga0268266_10001796 3300028379 Bacteria 24309
632 Ga0268266_10004322 3300028379 Bacteria 13666
633 Ga0268266_10041549 3300028379 Bacteria 3924
634 Ga0268266_10111463 3300028379 Bacteria 2424
635 Ga0268266_10112766 3300028379 Bacteria 2411
636 Ga0268266_10345632 3300028379 Bacteria 1397
637 Ga0268266_10612723 3300028379 Bacteria 1046
638 Ga0268265_10150239 3300028380 Bacteria 1963
639 Ga0268265_10222070 3300028380 Bacteria 1654
640 Ga0268265_10601767 3300028380 Bacteria 1051
641 Ga0268265_10733167 3300028380 Bacteria 958
642 Ga0268264_10000042 3300028381 Bacteria 372069
643 Ga0268264_10026486 3300028381 Bacteria 4738
644 Ga0268264_10320064 3300028381 Bacteria 1466
645 Ga0268264_10406560 3300028381 Bacteria 1309
646 Ga0268264_10613067 3300028381 Bacteria 1074
647 Ga0265323_10066299 3300028653 Bacteria 1243
648 Ga0265336_10000395 3300028666 Bacteria 27433
649 Ga0307515_10153612 3300028794 Bacteria 2391
650 Ga0265338_10000018 3300028800 Bacteria 338910
651 Ga0307511_10055883 3300030521 Bacteria 3093
652 Ga0265762_1028335 3300030760 Bacteria 1054
653 Ga0265760_10028324 3300031090 Bacteria 1643
654 Ga0265332_10000310 3300031238 Bacteria 37390
655 Ga0265332_10056299 3300031238 Bacteria 1685
656 Ga0265325_10001089 3300031241 Bacteria 19547
657 Ga0265325_10002716 3300031241 Bacteria 11818
658 Ga0265325_10093724 3300031241 Bacteria 1477
659 Ga0265340_10001987 3300031247 Bacteria 11699
660 Ga0265340_10007979 3300031247 Bacteria 5736
661 Ga0265340_10030886 3300031247 Bacteria 2683
662 Ga0265340_10064416 3300031247 Bacteria 1747
663 Ga0265339_10004193 3300031249 Bacteria 9881
664 Ga0265339_10006147 3300031249 Bacteria 7913
665 Ga0265339_10013334 3300031249 Bacteria 4984
666 Ga0265339_10075724 3300031249 Bacteria 1786
667 Ga0265339_10133034 3300031249 Bacteria 1270
668 Ga0265339_10223069 3300031249 Bacteria 921
669 Ga0265331_10007124 3300031250 Bacteria 6511
670 Ga0265331_10046709 3300031250 Bacteria 2086
671 Ga0265316_10090899 3300031344 Bacteria 2329
672 Ga0265316_10131649 3300031344 Bacteria 1884
673 Ga0265316_10133634 3300031344 Bacteria 1867
674 Ga0307513_10134366 3300031456 Bacteria 2412
675 Ga0307513_10241889 3300031456 Bacteria 1609
676 Ga0307509_10006260 3300031507 Bacteria 16085
677 Ga0307509_10136610 3300031507 Bacteria 2396
678 Ga0307408_100088322 3300031548 Bacteria 2334
679 Ga0307408_100347141 3300031548 Bacteria 1258
680 Ga0265313_10018919 3300031595 Bacteria 3853
681 Ga0265313_10097247 3300031595 Bacteria 1312
682 Ga0307508_10000125 3300031616 Bacteria 91829
683 Ga0307508_10086418 3300031616 Bacteria 2719
684 Ga0316575_10104860 3300031665 Bacteria 1151
685 Ga0316579_10116103 3300031691 Bacteria 1285
686 Ga0265314_10022428 3300031711 Bacteria 4836
687 Ga0265314_10152826 3300031711 Bacteria 1413
688 Ga0265342_10000175 3300031712 Bacteria 71083
689 Ga0265342_10013040 3300031712 Bacteria 5600
690 Ga0265342_10017256 3300031712 Bacteria 4701
691 Ga0265342_10039041 3300031712 Bacteria 2887
692 Ga0316576_10473465 3300031727 Bacteria 923
693 Ga0307516_10039106 3300031730 Bacteria 4730
694 Ga0307516_10077415 3300031730 Bacteria 3175
695 Ga0307516_10260655 3300031730 Bacteria 1424
696 Ga0307413_10470885 3300031824 Bacteria 1002
697 Ga0307412_10330180 3300031911 Bacteria 1217
698 Ga0307416_100136965 3300032002 Bacteria 2217
699 Ga0307416_100229312 3300032002 Bacteria 1789
700 Ga0307416_100542162 3300032002 Bacteria 1235
701 Ga0307414_10327110 3300032004 Bacteria 1307
702 Ga0307411_10430321 3300032005 Bacteria 1099
703 Ga0307415_100340651 3300032126 Bacteria 1258
704 Ga0307510_10094706 3300033180 Bacteria 2810
705 Ga0307510_10238863 3300033180 Bacteria 1313
706 Ga0315911_1000005 3300033442 Bacteria 426255
707 Ga0373930_0043315 3300034816 Bacteria 965
708 Ga0373940_0057534 3300035088 Bacteria 1105
709 Ga0373944_0008452 3300035089 Bacteria 2781
710 Ga0373951_0033886 3300035091 Bacteria 1212
711 Ga0373952_0024718 3300035092 Bacteria 1292
712 Ga0373923_0010299 3300035111 Bacteria 3397
713 Ga0373923_0082082 3300035111 Bacteria 1399
714 Ga0373923_0091581 3300035111 Bacteria 1331
715 Ga0373932_0023423 3300035112 Bacteria 1652
716 Ga0373936_0001304 3300035113 Bacteria 9034
717 Ga0373936_0004439 3300035113 Bacteria 5306
718 Ga0373936_0169370 3300035113 Bacteria 954
719 Ga0373939_0006221 3300035114 Bacteria 2872
720 Ga0373945_0004834 3300035116 Bacteria 4291
721 Ga0373945_0051161 3300035116 Bacteria 1519
722 Ga0373953_0075990 3300035117 Bacteria 1391
723 Ga0373954_0002374 3300035118 Bacteria 7874
724 Ga0373954_0003435 3300035118 Bacteria 6717
725 Ga0373954_0031099 3300035118 Bacteria 2463
726 Ga0373954_0086208 3300035118 Bacteria 1504
727 Ga0373954_0132503 3300035118 Bacteria 1214
728 Ga0373956_0007265 3300035119 Bacteria 4461
729 Ga0373956_0056583 3300035119 Bacteria 1771
730 Ga0373956_0098807 3300035119 Bacteria 1352
731 Ga0373957_0007813 3300035120 Bacteria 3436
732 Ga0373957_0018156 3300035120 Bacteria 2459
733 Ga0373957_0024301 3300035120 Bacteria 2175
734 Ga0373957_0070135 3300035120 Bacteria 1369
735 Ga0373943_0003366 3300035170 Bacteria 7267
736 Ga0373946_0000442 3300035171 Bacteria 13617
737 Ga0373946_0044695 3300035171 Bacteria 1829
738 Ga0373946_0045305 3300035171 Bacteria 1819
739 Ga0373946_0117914 3300035171 Bacteria 1209
740 Ga0373955_0000590 3300035172 Bacteria 15443
741 Ga0373955_0005428 3300035172 Bacteria 5729
742 Ga0373955_0017758 3300035172 Bacteria 3525
743 Ga0373955_0253440 3300035172 Bacteria 1055
744 Ga0373955_0255113 3300035172 Bacteria 1052
745 Ga0373942_0015083 3300035207 Bacteria 1878
746 Ga0373961_0032870 3300035241 Bacteria 1458
747 Ga0373961_0094157 3300035241 Bacteria 961
748 Ga0373962_0072435 3300035242 Bacteria 1032
749 Ga0316574_0012818 3300035398 Bacteria 4805
750 Ga0373924_0000432 3300035410 Bacteria 12866
751 Ga0373924_0045878 3300035410 Bacteria 1798
752 Ga0373924_0156750 3300035410 Bacteria 997
753 Ga0373931_0087582 3300035691 Bacteria 1730
754 Ga0373931_0092811 3300035691 Bacteria 1685
755 Ga0373931_0206935 3300035691 Bacteria 1175
756 Ga0373931_0217233 3300035691 Bacteria 1149
757 Ga0373935_0000370 3300035692 Bacteria 23018
758 Ga0373935_0144130 3300035692 Bacteria 1611
759 Ga0373935_0285787 3300035692 Bacteria 1162
760 Ga0373927_0006696 3300035695 Bacteria 7840
761 Ga0373927_0012500 3300035695 Bacteria 5652
762 Ga0373927_0014600 3300035695 Bacteria 5195
763 Ga0373927_0044379 3300035695 Bacteria 2876
764 Ga0373927_0203814 3300035695 Bacteria 1299
765 Ga0373927_0440267 3300035695 Bacteria 860
766 Ga0373933_0000180 3300035724 Bacteria 41838
767 Ga0373933_0035942 3300035724 Bacteria 2897
768 Ga0373947_0000476 3300035725 Bacteria 22980
769 Ga0373947_0065531 3300035725 Bacteria 2216
770 Ga0373947_0294705 3300035725 Bacteria 1080
771 Ga0373937_0000009 3300036401 Bacteria 169521
772 Ga0373937_0052741 3300036401 Bacteria 3730
773 Ga0373937_0087639 3300036401 Bacteria 2881
774 Ga0373937_0145999 3300036401 Bacteria 2214
775 Ga0373937_0207301 3300036401 Bacteria 1844
776 Ga0373937_0863660 3300036401 Bacteria 853
777 Ga0316584_0013475 3300036712 Bacteria 5788
778 Ga0373925_0000194 3300037068 Bacteria 66124
779 Ga0373925_0016628 3300037068 Bacteria 5329
780 Ga0373925_0025690 3300037068 Bacteria 4306
781 Ga0373925_0034596 3300037068 Bacteria 3725
782 Ga0373925_0050640 3300037068 Bacteria 3098
783 Ga0373925_0096908 3300037068 Bacteria 2262
784 Ga0373925_0125709 3300037068 Bacteria 1995
785 Ga0373925_0270426 3300037068 Bacteria 1367
786 Ga0373925_0607456 3300037068 Bacteria 901
787 Ga0395899_0184330 3300037312 Bacteria 1463
788 Ga0395900_0000753 3300037418 Bacteria 43021
789 Ga0395900_0011126 3300037418 Bacteria 9197
790 Ga0395900_0087579 3300037418 Bacteria 3200
791 Ga0395900_0132135 3300037418 Bacteria 2558
792 Ga0395900_0476054 3300037418 Bacteria 1202
793 Ga0395898_0005579 3300037466 Bacteria 13568
794 Ga0395898_0096497 3300037466 Bacteria 2840
795 Ga0395898_0693224 3300037466 Bacteria 960
796 Ga0395905_0060003 3300037471 Bacteria 3556
797 Ga0436364_0463993 3300037853 Bacteria 3218
798 Ga0436364_0538474 3300037853 Bacteria 1046
799 Ga0436364_0683264 3300037853 Bacteria 5939
800 Ga0436364_1040387 3300037853 Bacteria 1362
801 Ga0436364_1234925 3300037853 Bacteria 2399
802 Ga0436364_1536805 3300037853 Bacteria 6739
803 Ga0395901_0059586 3300038443 Bacteria 3972
804 Ga0395901_0092860 3300038443 Bacteria 3159
805 Ga0395901_0464498 3300038443 Bacteria 1293
806 Ga0395901_0667611 3300038443 Bacteria 1041
807 Ga0400486_01881 3300038742 Bacteria 8378
808 Ga0436365_0046146 3300039437 Bacteria 1357
809 Ga0436365_0361138 3300039437 Bacteria 1007
810 Ga0436365_0367024 3300039437 Bacteria 1321
811 Ga0436365_0544636 3300039437 Bacteria 4040
812 Ga0436365_0824804 3300039437 Bacteria 1242
813 Ga0436365_0910473 3300039437 Bacteria 3481
814 Ga0436365_0989626 3300039437 Bacteria 2539
815 Ga0436365_1294996 3300039437 Bacteria 3181
816 Ga0436365_1466687 3300039437 Bacteria 3240
817 Ga0436365_1613283 3300039437 Bacteria 846
818 Ga0436365_1626279 3300039437 Bacteria 2657
819 Ga0436365_1802139 3300039437 Bacteria 8542
820 Ga0436365_1853114 3300039437 Bacteria 1292
821 Ga0436365_1860176 3300039437 Bacteria 2655
822 Ga0436360_0121399 3300039438 Bacteria 4193
823 Ga0436360_1258966 3300039438 Bacteria 1390
824 Ga0436361_0082815 3300039447 Bacteria 986
825 Ga0436361_0735205 3300039447 Bacteria 1585
826 Ga0436363_0068476 3300039450 Bacteria 2127
827 Ga0436363_0351229 3300039450 Bacteria 2973
828 Ga0436363_1392773 3300039450 Bacteria 3419
829 Ga0436363_1532888 3300039450 Bacteria 1312
830 Ga0436363_1646089 3300039450 Bacteria 1174
831 Ga0436362_0588599 3300039453 Bacteria 1070
832 Ga0436362_0854921 3300039453 Bacteria 1343
833 Ga0439465_0040206 3300041413 Bacteria 1511
834 Ga0451853_1217131 3300041512 Bacteria 1207
835 Ga0439434_0096840 3300042435 Bacteria 948
836 Ga0451577_0000804 3300042876 Bacteria 47207
837 Ga0466969_0077486 3300044656 Bacteria 1591
838 Ga0466966_0084873 3300044684 Bacteria 1969
839 Ga0466971_0022633 3300044719 Bacteria 2801
840 Ga0466968_0148538 3300044735 Bacteria 1076
841 Ga0466970_0214017 3300044765 Bacteria 1074
842 Ga0466957_0079650 3300044842 Bacteria 2039
843 Ga0466957_0080487 3300044842 Bacteria 2028
844 Ga0466959_0061808 3300045049 Bacteria 2723
845 Ga0466959_0180583 3300045049 Bacteria 1476
846 Ga0466959_0383088 3300045049 Bacteria 957
847 Ga0451576_0893345 3300045051 Bacteria 932
848 Ga0466967_0060568 3300045976 Bacteria 3354
849 Ga0466967_0402828 3300045976 Bacteria 1331
850 Ga0495592_0000018 3300046454 Bacteria 140962
851 Ga0495592_0007391 3300046454 Bacteria 8221
852 Ga0495592_0068737 3300046454 Bacteria 2585
853 Ga0495592_0161451 3300046454 Bacteria 1541
854 Ga0495603_0017965 3300046455 Bacteria 4280
855 Ga0495603_0113311 3300046455 Bacteria 1581
856 Ga0495603_0158464 3300046455 Bacteria 1313
857 Ga0495603_0234644 3300046455 Bacteria 1057
858 Ga0495590_0017697 3300046457 Bacteria 2561
859 Ga0495590_0032303 3300046457 Bacteria 1831
860 Ga0495629_0004511 3300046459 Bacteria 10415
861 Ga0495629_0021300 3300046459 Bacteria 4625
862 Ga0495629_0126087 3300046459 Bacteria 1783
863 Ga0495638_0017089 3300046460 Bacteria 4845
864 Ga0495638_0044424 3300046460 Bacteria 2798
865 Ga0495641_0096094 3300046461 Bacteria 1322
866 Ga0495651_0002271 3300046462 Bacteria 14833
867 Ga0495651_0009620 3300046462 Bacteria 7427
868 Ga0495651_0018113 3300046462 Bacteria 5452
869 Ga0495651_0045413 3300046462 Bacteria 3404
870 Ga0495653_0000032 3300046463 Bacteria 132763
871 Ga0495653_0126812 3300046463 Bacteria 1811
872 Ga0495653_0187883 3300046463 Bacteria 1412
873 Ga0495650_0034912 3300046471 Bacteria 2219
874 Ga0495580_0022914 3300046472 Bacteria 4590
875 Ga0495580_0219499 3300046472 Bacteria 1307
876 Ga0495582_0069661 3300046473 Bacteria 1945
877 Ga0495582_0110989 3300046473 Bacteria 1540
878 Ga0495582_0188030 3300046473 Bacteria 1178
879 Ga0495605_0098354 3300046474 Bacteria 1348
880 Ga0495639_0017286 3300046475 Bacteria 3132
881 Ga0495662_0015632 3300046476 Bacteria 3683
882 Ga0495662_0122774 3300046476 Bacteria 1275
883 Ga0495662_0174289 3300046476 Bacteria 1060
884 Ga0495664_0000010 3300046477 Bacteria 268381
885 Ga0495664_0011721 3300046477 Bacteria 4949
886 Ga0495664_0156048 3300046477 Bacteria 1385
887 Ga0495584_0005969 3300046491 Bacteria 6415
888 Ga0495584_0097225 3300046491 Bacteria 1487
889 Ga0495584_0138620 3300046491 Bacteria 1235
890 Ga0495585_0064951 3300046492 Bacteria 2000
891 Ga0495594_0028740 3300046499 Bacteria 3001
892 Ga0495594_0282177 3300046499 Bacteria 946
893 Ga0495596_0064908 3300046500 Bacteria 1420
894 Ga0495607_0068886 3300046501 Bacteria 1983
895 Ga0495607_0149462 3300046501 Bacteria 1197
896 Ga0495606_0001686 3300046507 Bacteria 28531
897 Ga0495606_0012721 3300046507 Bacteria 6710
898 Ga0495606_0103896 3300046507 Bacteria 1725
899 Ga0495608_0000008 3300046511 Bacteria 268629
900 Ga0495608_0073007 3300046511 Bacteria 2238
901 Ga0495608_0078676 3300046511 Bacteria 2144
902 Ga0495608_0210193 3300046511 Bacteria 1223
903 Ga0495610_0051049 3300046512 Bacteria 2015
904 Ga0495616_0064266 3300046513 Bacteria 1791
905 Ga0495618_0000002 3300046514 Bacteria 271353
906 Ga0495618_0002296 3300046514 Bacteria 12395
907 Ga0495618_0068853 3300046514 Bacteria 2250
908 Ga0495618_0199450 3300046514 Bacteria 1267
909 Ga0495618_0219880 3300046514 Bacteria 1198
910 Ga0495620_0017282 3300046515 Bacteria 3600
911 Ga0495628_0000009 3300046516 Bacteria 237611
912 Ga0495628_0011834 3300046516 Bacteria 7362
913 Ga0495628_0151589 3300046516 Bacteria 1766
914 Ga0495628_0159842 3300046516 Bacteria 1713
915 Ga0495628_0179128 3300046516 Bacteria 1604
916 Ga0495628_0259831 3300046516 Bacteria 1294
917 Ga0495630_0001850 3300046517 Bacteria 14780
918 Ga0495630_0168720 3300046517 Bacteria 1667
919 Ga0495630_0190624 3300046517 Bacteria 1564
920 Ga0495631_0116504 3300046518 Bacteria 1149
921 Ga0495632_0182245 3300046519 Bacteria 962
922 Ga0495648_0002080 3300046524 Bacteria 18945
923 Ga0495663_0065526 3300046525 Bacteria 1148
924 Ga0495663_0089135 3300046525 Bacteria 1004
925 Ga0495666_0169756 3300046526 Bacteria 1009
926 Ga0495652_0000011 3300046529 Bacteria 255329
927 Ga0495652_0040074 3300046529 Bacteria 4049
928 Ga0495652_0088571 3300046529 Bacteria 2536
929 Ga0495652_0165642 3300046529 Bacteria 1711
930 Ga0495652_0265595 3300046529 Bacteria 1264
931 Ga0495665_0030220 3300046531 Bacteria 2900
932 Ga0495665_0248900 3300046531 Bacteria 915
933 Ga0495640_0000009 3300046533 Bacteria 217086
934 Ga0495640_0004134 3300046533 Bacteria 11612
935 Ga0495640_0015032 3300046533 Bacteria 5832
936 Ga0495640_0028702 3300046533 Bacteria 4003
937 Ga0495640_0045669 3300046533 Bacteria 3039
938 Ga0495640_0197743 3300046533 Bacteria 1275
939 Ga0495586_0016981 3300046535 Bacteria 3872
940 Ga0495586_0113785 3300046535 Bacteria 1507
941 Ga0495587_0000006 3300046536 Bacteria 310070
942 Ga0495587_0033796 3300046536 Bacteria 3085
943 Ga0495587_0054241 3300046536 Bacteria 2362
944 Ga0495598_0003846 3300046537 Bacteria 3215
945 Ga0495621_0009676 3300046539 Bacteria 2934
946 Ga0495621_0027282 3300046539 Bacteria 1933
947 Ga0495645_0000010 3300046543 Bacteria 238337
948 Ga0495645_0007861 3300046543 Bacteria 7418
949 Ga0495645_0009133 3300046543 Bacteria 6926
950 Ga0495645_0069213 3300046543 Bacteria 2547
951 Ga0495645_0233748 3300046543 Bacteria 1230
952 Ga0495622_0045681 3300046557 Bacteria 2035
953 Ga0495622_0150699 3300046557 Bacteria 1052
954 Ga0495633_0052795 3300046558 Bacteria 1914
955 Ga0495667_0000005 3300046559 Bacteria 268252
956 Ga0495667_0027393 3300046559 Bacteria 3841
957 Ga0495656_0051429 3300046615 Bacteria 1763
958 Ga0495656_0066339 3300046615 Bacteria 1590
959 Ga0495668_0114593 3300046616 Bacteria 1474
960 Ga0495634_0000223 3300046642 Bacteria 53103
961 Ga0495634_0007776 3300046642 Bacteria 8017
962 Ga0495634_0030340 3300046642 Bacteria 3734
963 Ga0495634_0034428 3300046642 Bacteria 3476
964 Ga0495634_0066724 3300046642 Bacteria 2382
965 Ga0495634_0076735 3300046642 Bacteria 2193
966 Ga0495634_0407853 3300046642 Bacteria 806
967 Ga0495611_0070545 3300046648 Bacteria 1597
968 Ga0495635_0000008 3300046663 Bacteria 268349
969 Ga0495635_0012284 3300046663 Bacteria 5998
970 Ga0495635_0033486 3300046663 Bacteria 3564
971 Ga0495635_0071599 3300046663 Bacteria 2376
972 Ga0495635_0079065 3300046663 Bacteria 2251
973 Ga0495635_0091237 3300046663 Bacteria 2084
974 Ga0495635_0361171 3300046663 Bacteria 968
975 Ga0495659_0011400 3300046664 Bacteria 2865
976 Ga0495659_0076698 3300046664 Bacteria 1261
977 Ga0495661_0004641 3300046665 Bacteria 9884
978 Ga0495588_0154998 3300046674 Bacteria 1211
979 Ga0495588_0203304 3300046674 Bacteria 1046
980 Ga0495657_0000058 3300046675 Bacteria 97827
981 Ga0495657_0007247 3300046675 Bacteria 8593
982 Ga0495657_0129828 3300046675 Bacteria 1579
983 Ga0495599_0000007 3300046678 Bacteria 236638
984 Ga0495599_0019082 3300046678 Bacteria 4275
985 Ga0495623_0000085 3300046679 Bacteria 55527
986 Ga0495623_0028622 3300046679 Bacteria 3584
987 Ga0495623_0077088 3300046679 Bacteria 2067
988 Ga0495623_0116857 3300046679 Bacteria 1611
989 Ga0495646_0000021 3300046680 Bacteria 115358
990 Ga0495646_0019263 3300046680 Bacteria 4322
991 Ga0495646_0223142 3300046680 Bacteria 1018
992 Ga0495647_0021787 3300046681 Bacteria 2311
993 Ga0495647_0022052 3300046681 Bacteria 2299
994 Ga0495658_0025517 3300046683 Bacteria 3159
995 Ga0495658_0028100 3300046683 Bacteria 3033
996 Ga0495658_0263350 3300046683 Bacteria 1085
997 Ga0495613_0121180 3300046689 Bacteria 1878
998 Ga0495613_0123971 3300046689 Bacteria 1854
999 Ga0495613_0180467 3300046689 Bacteria 1495
1000 Ga0495613_0344267 3300046689 Bacteria 1025
1001 Ga0495613_0376692 3300046689 Bacteria 971
1002 Ga0495624_0007573 3300046690 Bacteria 7619
1003 Ga0495624_0062310 3300046690 Bacteria 2333
1004 Ga0495624_0072967 3300046690 Bacteria 2134
1005 Ga0495624_0080796 3300046690 Bacteria 2014
1006 Ga0495624_0316240 3300046690 Bacteria 941
1007 Ga0495670_0026303 3300046691 Bacteria 2880
1008 Ga0495670_0073302 3300046691 Bacteria 1735
1009 Ga0495670_0084771 3300046691 Bacteria 1617
1010 Ga0495671_0099253 3300046692 Bacteria 1424
1011 Ga0495649_0059705 3300046694 Bacteria 2053
1012 Ga0495589_0124507 3300046794 Bacteria 1240
1013 Ga0495600_0000001 3300046809 Bacteria 214870
1014 Ga0495600_0017611 3300046809 Bacteria 4547
1015 Ga0495600_0020140 3300046809 Bacteria 4267
1016 Ga0495660_0153745 3300046810 Bacteria 1134
1017 Ga0495581_0005192 3300047315 Bacteria 7535
1018 Ga0495581_0015392 3300047315 Bacteria 4441
1019 Ga0495581_0108728 3300047315 Bacteria 1612
1020 Ga0495581_0112270 3300047315 Bacteria 1585
1021 Ga0495604_0000012 3300047317 Bacteria 268341
1022 Ga0495604_0006128 3300047317 Bacteria 9545
1023 Ga0495604_0020133 3300047317 Bacteria 5331
1024 Ga0495604_0268583 3300047317 Bacteria 1156
1025 Ga0495604_0269476 3300047317 Bacteria 1154
1026 Ga0495636_0212650 3300047318 Bacteria 886
1027 Ga0495674_0000011 3300047319 Bacteria 270911
1028 Ga0495674_0005473 3300047319 Bacteria 12199
1029 Ga0495674_0201351 3300047319 Bacteria 1651
1030 Ga0495674_0296042 3300047319 Bacteria 1322
1031 Ga0495672_0008564 3300047320 Bacteria 7527
1032 Ga0495672_0124543 3300047320 Bacteria 1365
1033 Ga0495676_0054221 3300047321 Bacteria 3188
1034 Ga0495676_0163092 3300047321 Bacteria 1575
1035 Ga0495676_0313940 3300047321 Bacteria 1054
1036 Ga0495680_0001281 3300047322 Bacteria 27427
1037 Ga0495680_0097431 3300047322 Bacteria 2195
1038 Ga0495680_0191135 3300047322 Bacteria 1473
1039 Ga0495680_0363812 3300047322 Bacteria 1005
1040 Ga0495675_0000096 3300047444 Bacteria 62617
1041 Ga0495675_0063415 3300047444 Bacteria 2338
1042 Ga0495681_0107375 3300047470 Bacteria 1213
1043 Ga0495684_0000084 3300047471 Bacteria 65600
1044 Ga0495684_0000724 3300047471 Bacteria 26578
1045 Ga0495684_0057921 3300047471 Bacteria 2952
1046 Ga0495684_0062950 3300047471 Bacteria 2821
1047 Ga0495684_0170611 3300047471 Bacteria 1618
1048 Ga0495684_0239736 3300047471 Bacteria 1323
1049 Ga0495686_0018833 3300047472 Bacteria 4623
1050 Ga0495686_0075590 3300047472 Bacteria 2065
1051 Ga0495593_0000727 3300047673 Bacteria 19074
1052 Ga0495593_0192672 3300047673 Bacteria 1025
1053 Ga0495602_0000073 3300048088 Bacteria 98745
1054 Ga0495602_0021411 3300048088 Bacteria 6366
1055 Ga0495602_0074922 3300048088 Bacteria 2874
1056 Ga0495602_0085822 3300048088 Bacteria 2629
1057 Ga0495602_0233348 3300048088 Bacteria 1381
1058 Ga0495615_0008934 3300048090 Bacteria 1953
1059 Ga0495615_0020723 3300048090 Bacteria 1477
1060 Ga0496100_0009415 3300048903 Bacteria 5492
1061 Ga0496100_0031044 3300048903 Bacteria 3318
1062 Ga0496100_0032857 3300048903 Bacteria 3241
1063 Ga0496100_0188026 3300048903 Bacteria 1497
1064 Ga0496100_0280409 3300048903 Bacteria 1242
1065 Ga0496101_0022566 3300048904 Bacteria 4334
1066 Ga0496101_0054482 3300048904 Bacteria 2888
1067 Ga0496101_0066385 3300048904 Bacteria 2631
1068 Ga0496101_0066925 3300048904 Bacteria 2622
1069 Ga0496101_0069596 3300048904 Bacteria 2575
1070 Ga0496101_0114285 3300048904 Bacteria 2035
1071 Ga0496101_0116075 3300048904 Bacteria 2020
1072 Ga0496101_0386775 3300048904 Bacteria 1101
1073 Ga0496101_0509849 3300048904 Bacteria 950
1074 Ga0496102_0011175 3300048905 Bacteria 7733
1075 Ga0496102_0023656 3300048905 Bacteria 5459
1076 Ga0496102_0075347 3300048905 Bacteria 3102
1077 Ga0496102_0085995 3300048905 Bacteria 2904
1078 Ga0496102_0105116 3300048905 Bacteria 2627
1079 Ga0496102_0163993 3300048905 Bacteria 2091
1080 Ga0496102_0237816 3300048905 Bacteria 1717
1081 Ga0496102_0337717 3300048905 Bacteria 1419
1082 Ga0496102_0360673 3300048905 Bacteria 1368
1083 Ga0496102_0510332 3300048905 Bacteria 1125
1084 Ga0496102_0691098 3300048905 Bacteria 943
1085 Ga0496103_0005828 3300048906 Bacteria 7355
1086 Ga0496103_0116401 3300048906 Bacteria 1700
1087 Ga0496104_0001003 3300048907 Bacteria 24153
1088 Ga0496104_0003063 3300048907 Bacteria 14409
1089 Ga0496104_0014912 3300048907 Bacteria 7025
1090 Ga0496104_0024353 3300048907 Bacteria 5568
1091 Ga0496104_0039528 3300048907 Bacteria 4416
1092 Ga0496104_0179120 3300048907 Bacteria 2030
1093 Ga0496104_0268839 3300048907 Bacteria 1617
1094 Ga0496104_0466441 3300048907 Bacteria 1174
1095 Ga0496105_0003633 3300048908 Bacteria 11465
1096 Ga0496105_0011042 3300048908 Bacteria 7119
1097 Ga0496105_0023493 3300048908 Bacteria 5001
1098 Ga0496105_0046798 3300048908 Bacteria 3570
1099 Ga0496105_0071620 3300048908 Bacteria 2864
1100 Ga0496105_0168330 3300048908 Bacteria 1797
1101 Ga0496105_0190276 3300048908 Bacteria 1678
1102 Ga0496106_0001280 3300048909 Bacteria 18862
1103 Ga0496106_0004321 3300048909 Bacteria 10554
1104 Ga0496106_0031358 3300048909 Bacteria 3960
1105 Ga0496106_0032992 3300048909 Bacteria 3861
1106 Ga0496106_0065475 3300048909 Bacteria 2767
1107 Ga0496106_0139948 3300048909 Bacteria 1903
1108 Ga0496106_0140463 3300048909 Bacteria 1899
1109 Ga0496106_0207015 3300048909 Bacteria 1562
1110 Ga0496106_0329177 3300048909 Bacteria 1226
1111 Ga0496106_0366507 3300048909 Bacteria 1157
1112 Ga0496107_0023629 3300048910 Bacteria 4346
1113 Ga0496107_0027212 3300048910 Bacteria 4060
1114 Ga0496107_0059834 3300048910 Bacteria 2757
1115 Ga0496107_0248572 3300048910 Bacteria 1323
1116 Ga0496108_0000451 3300048911 Bacteria 32765
1117 Ga0496108_0003585 3300048911 Bacteria 12437
1118 Ga0496108_0079249 3300048911 Bacteria 2781
1119 Ga0496108_0120994 3300048911 Bacteria 2245
1120 Ga0496108_0139762 3300048911 Bacteria 2086
1121 Ga0496108_0206654 3300048911 Bacteria 1704
1122 Ga0496108_0236368 3300048911 Bacteria 1589
1123 Ga0496108_0247318 3300048911 Bacteria 1551
1124 Ga0496108_0290271 3300048911 Bacteria 1424
1125 Ga0496108_0338723 3300048911 Bacteria 1312
1126 Ga0496108_0420318 3300048911 Bacteria 1167
1127 Ga0496108_0693514 3300048911 Bacteria 883
1128 Ga0496109_0000558 3300048912 Bacteria 31145
1129 Ga0496109_0004298 3300048912 Bacteria 11898
1130 Ga0496109_0017610 3300048912 Bacteria 6265
1131 Ga0496109_0041408 3300048912 Bacteria 4172
1132 Ga0496109_0118103 3300048912 Bacteria 2469
1133 Ga0496109_0242824 3300048912 Bacteria 1695
1134 Ga0496109_0327532 3300048912 Bacteria 1446
1135 Ga0496110_0015787 3300048913 Bacteria 6295
1136 Ga0496110_0017400 3300048913 Bacteria 6013
1137 Ga0496110_0095942 3300048913 Bacteria 2657
1138 Ga0496110_0111158 3300048913 Bacteria 2463
1139 Ga0496110_0133773 3300048913 Bacteria 2240
1140 Ga0496110_0166142 3300048913 Bacteria 2001
1141 Ga0496110_0289553 3300048913 Bacteria 1491
1142 Ga0496110_0315894 3300048913 Bacteria 1423
1143 Ga0496110_0385050 3300048913 Bacteria 1278
1144 Ga0496110_0618092 3300048913 Bacteria 982
1145 Ga0496111_0009095 3300048914 Bacteria 6611
1146 Ga0496111_0085324 3300048914 Bacteria 2309
1147 Ga0496111_0144133 3300048914 Bacteria 1765
1148 Ga0496111_0156174 3300048914 Bacteria 1693
1149 Ga0496112_0003249 3300048915 Bacteria 13400
1150 Ga0496112_0049602 3300048915 Bacteria 4115
1151 Ga0496112_0055602 3300048915 Bacteria 3892
1152 Ga0496112_0123797 3300048915 Bacteria 2557
1153 Ga0496112_0133455 3300048915 Bacteria 2453
1154 Ga0496112_0148646 3300048915 Bacteria 2310
1155 Ga0496112_0183184 3300048915 Bacteria 2058
1156 Ga0496112_0212509 3300048915 Bacteria 1891
1157 Ga0496112_0229843 3300048915 Bacteria 1809
1158 Ga0496112_0506737 3300048915 Bacteria 1142
1159 Ga0496113_0009879 3300048916 Bacteria 6285
1160 Ga0496113_0035660 3300048916 Bacteria 3639
1161 Ga0496113_0038460 3300048916 Bacteria 3518
1162 Ga0496113_0051554 3300048916 Bacteria 3071
1163 Ga0496113_0254311 3300048916 Bacteria 1403
1164 Ga0496113_0400697 3300048916 Bacteria 1102
1165 Ga0496114_0019044 3300048917 Bacteria 5561
1166 Ga0496114_0181427 3300048917 Bacteria 1839
1167 Ga0496114_0326089 3300048917 Bacteria 1357
1168 Ga0496114_0468493 3300048917 Bacteria 1115
1169 Ga0496114_0509577 3300048917 Bacteria 1064
1170 Ga0496115_0008727 3300048918 Bacteria 7514
1171 Ga0496115_0014125 3300048918 Bacteria 6043
1172 Ga0496115_0016482 3300048918 Bacteria 5628
1173 Ga0496115_0023060 3300048918 Bacteria 4828
1174 Ga0496115_0028405 3300048918 Bacteria 4384
1175 Ga0496115_0049654 3300048918 Bacteria 3359
1176 Ga0496115_0063285 3300048918 Bacteria 2984
1177 Ga0496115_0076990 3300048918 Bacteria 2712
1178 Ga0496115_0118331 3300048918 Bacteria 2179
1179 Ga0496115_0151874 3300048918 Bacteria 1913
1180 Ga0496115_0271562 3300048918 Bacteria 1393
1181 Ga0496115_0341358 3300048918 Bacteria 1222
1182 Ga0496115_0443580 3300048918 Bacteria 1049
1183 Ga0496115_0464673 3300048918 Bacteria 1021
1184 Ga0496115_0515364 3300048918 Bacteria 959
1185 Ga0496116_0005695 3300048919 Bacteria 11461
1186 Ga0496117_0012118 3300048920 Bacteria 7645
1187 Ga0496117_0155578 3300048920 Bacteria 1346
1188 Ga0496118_0001458 3300048921 Bacteria 35562
1189 Ga0496118_0016977 3300048921 Bacteria 6648
1190 Ga0496118_0040425 3300048921 Bacteria 3708
1191 Ga0496118_0042817 3300048921 Bacteria 3567
1192 Ga0496118_0084764 3300048921 Bacteria 2209
1193 Ga0496118_0241504 3300048921 Bacteria 1034
1194 Ga0496118_0336571 3300048921 Bacteria 811
1195 Ga0496119_0003138 3300048922 Bacteria 17407
1196 Ga0496119_0103754 3300048922 Bacteria 1592
1197 Ga0496119_0107815 3300048922 Bacteria 1552
1198 Ga0496120_0015858 3300048923 Bacteria 4949
1199 Ga0496120_0126500 3300048923 Bacteria 1314
1200 Ga0496121_0000146 3300048924 Bacteria 154459
1201 Ga0496121_0001525 3300048924 Bacteria 38839
1202 Ga0496121_0002110 3300048924 Bacteria 31261
1203 Ga0496121_0009157 3300048924 Bacteria 11444
1204 Ga0496121_0011985 3300048924 Bacteria 9532
1205 Ga0496121_0014155 3300048924 Bacteria 8496
1206 Ga0496121_0039521 3300048924 Bacteria 4155
1207 Ga0496121_0052038 3300048924 Bacteria 3443
1208 Ga0496121_0163058 3300048924 Bacteria 1628
1209 Ga0496121_0338530 3300048924 Bacteria 1006
1210 Ga0496123_0036461 3300048926 Bacteria 3487
1211 Ga0496124_0002217 3300048927 Bacteria 25870
1212 Ga0496124_0042083 3300048927 Bacteria 3935
1213 Ga0496124_0194246 3300048927 Bacteria 1550
1214 Ga0496124_0376298 3300048927 Bacteria 995
1215 Ga0496125_0000099 3300048928 Bacteria 203333
1216 Ga0496125_0009421 3300048928 Bacteria 10037
1217 Ga0496125_0024940 3300048928 Bacteria 5487
1218 Ga0496125_0168760 3300048928 Bacteria 1474
1219 Ga0496126_0010429 3300048929 Bacteria 9736
1220 Ga0496126_0016158 3300048929 Bacteria 7476
1221 Ga0496126_0016652 3300048929 Bacteria 7346
1222 Ga0496126_0017576 3300048929 Bacteria 7125
1223 Ga0496126_0020801 3300048929 Bacteria 6423
1224 Ga0496126_0023009 3300048929 Bacteria 6045
1225 Ga0496126_0023765 3300048929 Bacteria 5934
1226 Ga0496126_0026323 3300048929 Bacteria 5579
1227 Ga0496126_0031408 3300048929 Bacteria 5018
1228 Ga0496126_0051578 3300048929 Bacteria 3744
1229 Ga0496126_0063569 3300048929 Bacteria 3309
1230 Ga0496126_0085476 3300048929 Bacteria 2780
1231 Ga0496126_0258195 3300048929 Bacteria 1450
1232 Ga0496126_0404096 3300048929 Bacteria 1107
1233 Ga0495682_0108351 3300049460 Bacteria 995
1234 Ga0501031_0008069 3300049568 Bacteria 6858
1235 Ga0501031_0054785 3300049568 Bacteria 2598
1236 Ga0501031_0090108 3300049568 Bacteria 2000
1237 Ga0501031_0291222 3300049568 Bacteria 1059
1238 Ga0501032_0001954 3300049569 Bacteria 16232
1239 Ga0501032_0011869 3300049569 Bacteria 6241
1240 Ga0501032_0021294 3300049569 Bacteria 4508
1241 Ga0501032_0021620 3300049569 Bacteria 4472
1242 Ga0501032_0061448 3300049569 Bacteria 2518
1243 Ga0501032_0096865 3300049569 Bacteria 1955
1244 Ga0501032_0132292 3300049569 Bacteria 1645
1245 Ga0501032_0168652 3300049569 Bacteria 1436
1246 Ga0501032_0293148 3300049569 Bacteria 1052
1247 Ga0501033_0002836 3300049570 Bacteria 14522
1248 Ga0501033_0014700 3300049570 Bacteria 5941
1249 Ga0501033_0020903 3300049570 Bacteria 4940
1250 Ga0501033_0046459 3300049570 Bacteria 3228
1251 Ga0501033_0046944 3300049570 Bacteria 3211
1252 Ga0501033_0058986 3300049570 Bacteria 2834
1253 Ga0501033_0155119 3300049570 Bacteria 1650
1254 Ga0501033_0170944 3300049570 Bacteria 1561
1255 Ga0501033_0208738 3300049570 Bacteria 1393
1256 Ga0501033_0449577 3300049570 Bacteria 895
1257 Ga0501034_0001164 3300049571 Bacteria 36430
1258 Ga0501034_0020421 3300049571 Bacteria 6763
1259 Ga0501034_0033298 3300049571 Bacteria 5229
1260 Ga0501034_0121101 3300049571 Bacteria 2603
1261 Ga0501034_0134173 3300049571 Bacteria 2457
1262 Ga0501034_0143980 3300049571 Bacteria 2361
1263 Ga0501034_0148564 3300049571 Bacteria 2320
1264 Ga0501034_0150356 3300049571 Bacteria 2304
1265 Ga0501034_0171302 3300049571 Bacteria 2138
1266 Ga0501034_0226278 3300049571 Bacteria 1821
1267 Ga0501034_0229981 3300049571 Bacteria 1804
1268 Ga0501034_0263387 3300049571 Bacteria 1666
1269 Ga0501034_0355461 3300049571 Bacteria 1393
1270 Ga0501034_0363062 3300049571 Bacteria 1375
1271 Ga0501034_0484745 3300049571 Bacteria 1151
1272 Ga0501034_0705014 3300049571 Bacteria 907
1273 Ga0501036_0004082 3300049572 Bacteria 11750
1274 Ga0501036_0019200 3300049572 Bacteria 5734
1275 Ga0501036_0019549 3300049572 Bacteria 5686
1276 Ga0501036_0021130 3300049572 Bacteria 5466
1277 Ga0501036_0048441 3300049572 Bacteria 3597
1278 Ga0501036_0139275 3300049572 Bacteria 2048
1279 Ga0501036_0212497 3300049572 Bacteria 1625
1280 Ga0501036_0212715 3300049572 Bacteria 1624
1281 Ga0501036_0311880 3300049572 Bacteria 1315
1282 Ga0501036_0606017 3300049572 Bacteria 908
1283 Ga0501036_0780449 3300049572 Bacteria 787
1284 Ga0501037_0003537 3300049573 Bacteria 11343
1285 Ga0501037_0005841 3300049573 Bacteria 8991
1286 Ga0501037_0017803 3300049573 Bacteria 5230
1287 Ga0501037_0046499 3300049573 Bacteria 3182
1288 Ga0501037_0051259 3300049573 Bacteria 3018
1289 Ga0501037_0062081 3300049573 Bacteria 2724
1290 Ga0501037_0143591 3300049573 Bacteria 1708
1291 Ga0501037_0267946 3300049573 Bacteria 1192
1292 Ga0501038_0002740 3300049574 Bacteria 16417
1293 Ga0501038_0006198 3300049574 Bacteria 11061
1294 Ga0501038_0018654 3300049574 Bacteria 6266
1295 Ga0501038_0023039 3300049574 Bacteria 5572
1296 Ga0501038_0031994 3300049574 Bacteria 4645
1297 Ga0501038_0081945 3300049574 Bacteria 2717
1298 Ga0501038_0090993 3300049574 Bacteria 2556
1299 Ga0501038_0091798 3300049574 Bacteria 2543
1300 Ga0501038_0120997 3300049574 Bacteria 2159
1301 Ga0501038_0157448 3300049574 Bacteria 1848
1302 Ga0501038_0164147 3300049574 Bacteria 1803
1303 Ga0501038_0223388 3300049574 Bacteria 1502
1304 Ga0501038_0263084 3300049574 Bacteria 1362
1305 Ga0501038_0266641 3300049574 Bacteria 1351
1306 Ga0501038_0300721 3300049574 Bacteria 1259
1307 Ga0501039_0009338 3300049575 Bacteria 7474
1308 Ga0501039_0022255 3300049575 Bacteria 4866
1309 Ga0501039_0081764 3300049575 Bacteria 2515
1310 Ga0501039_0109261 3300049575 Bacteria 2162
1311 Ga0501039_0158349 3300049575 Bacteria 1779
1312 Ga0501039_0274388 3300049575 Bacteria 1325
1313 Ga0501039_0430471 3300049575 Bacteria 1036
1314 Ga0501039_0571526 3300049575 Bacteria 887
1315 Ga0501040_0120309 3300049576 Bacteria 1842
1316 Ga0501041_0076713 3300049577 Bacteria 2056
1317 Ga0501041_0126473 3300049577 Bacteria 1591
1318 Ga0501042_0010994 3300049578 Bacteria 6092
1319 Ga0501042_0012503 3300049578 Bacteria 5751
1320 Ga0501042_0017967 3300049578 Bacteria 4891
1321 Ga0501042_0074867 3300049578 Bacteria 2423
1322 Ga0501042_0473558 3300049578 Bacteria 909
1323 Ga0501043_0006835 3300049579 Bacteria 9106
1324 Ga0501043_0011558 3300049579 Bacteria 6911
1325 Ga0501043_0011619 3300049579 Bacteria 6893
1326 Ga0501043_0011717 3300049579 Bacteria 6865
1327 Ga0501043_0013054 3300049579 Bacteria 6493
1328 Ga0501043_0028696 3300049579 Bacteria 4368
1329 Ga0501043_0036926 3300049579 Bacteria 3843
1330 Ga0501043_0066286 3300049579 Bacteria 2835
1331 Ga0501043_0789610 3300049579 Bacteria 688
1332 Ga0501046_0064616 3300049580 Bacteria 2856
1333 Ga0501046_0093547 3300049580 Bacteria 2310
1334 Ga0501046_0097271 3300049580 Bacteria 2261
1335 Ga0501046_0138831 3300049580 Bacteria 1840
1336 Ga0501046_0141014 3300049580 Bacteria 1824
1337 Ga0501046_0210479 3300049580 Bacteria 1444
1338 Ga0501046_0440589 3300049580 Bacteria 937
1339 Ga0501047_0000459 3300049581 Bacteria 44977
1340 Ga0501047_0017946 3300049581 Bacteria 6782
1341 Ga0501047_0027821 3300049581 Bacteria 5448
1342 Ga0501047_0033478 3300049581 Bacteria 4960
1343 Ga0501047_0067379 3300049581 Bacteria 3450
1344 Ga0501047_0097423 3300049581 Bacteria 2819
1345 Ga0501047_0130507 3300049581 Bacteria 2393
1346 Ga0501047_0217832 3300049581 Bacteria 1765
1347 Ga0501047_0227606 3300049581 Bacteria 1719
1348 Ga0501047_0244786 3300049581 Bacteria 1643
1349 Ga0501047_0362999 3300049581 Bacteria 1284
1350 Ga0501047_0482194 3300049581 Bacteria 1068
1351 Ga0501047_0532842 3300049581 Bacteria 999
1352 Ga0501047_0564595 3300049581 Bacteria 961
1353 Ga0501048_0006170 3300049582 Bacteria 9124
1354 Ga0501048_0025329 3300049582 Bacteria 4323
1355 Ga0501048_0255468 3300049582 Bacteria 1245
1356 Ga0501067_0021596 3300049583 Bacteria 3562
1357 Ga0501067_0035959 3300049583 Bacteria 2751
1358 Ga0501067_0060855 3300049583 Bacteria 2090
1359 Ga0501068_0009003 3300049584 Bacteria 5570
1360 Ga0501068_0050038 3300049584 Bacteria 2525
1361 Ga0501068_0054407 3300049584 Bacteria 2424
1362 Ga0501068_0066912 3300049584 Bacteria 2188
1363 Ga0501068_0207663 3300049584 Bacteria 1243
1364 Ga0501069_0006392 3300049585 Bacteria 6162
1365 Ga0501069_0013979 3300049585 Bacteria 4288
1366 Ga0501069_0061272 3300049585 Bacteria 2100
1367 Ga0501069_0137319 3300049585 Bacteria 1402
1368 Ga0501070_0004886 3300049586 Bacteria 11453
1369 Ga0501070_0020360 3300049586 Bacteria 5566
1370 Ga0501070_0031866 3300049586 Bacteria 4415
1371 Ga0501070_0039798 3300049586 Bacteria 3920
1372 Ga0501070_0102705 3300049586 Bacteria 2364
1373 Ga0501070_0103992 3300049586 Bacteria 2348
1374 Ga0501070_0176529 3300049586 Bacteria 1758
1375 Ga0501070_0196238 3300049586 Bacteria 1658
1376 Ga0501071_0005326 3300049587 Bacteria 8259
1377 Ga0501071_0019248 3300049587 Bacteria 4736
1378 Ga0501071_0057430 3300049587 Bacteria 2813
1379 Ga0501071_0233936 3300049587 Bacteria 1385
1380 Ga0501072_0008657 3300049588 Bacteria 7724
1381 Ga0501072_0008716 3300049588 Bacteria 7699
1382 Ga0501072_0052098 3300049588 Bacteria 3222
1383 Ga0501072_0091966 3300049588 Bacteria 2409
1384 Ga0501072_0227378 3300049588 Bacteria 1486
1385 Ga0501073_0007155 3300049589 Bacteria 8311
1386 Ga0501073_0043909 3300049589 Bacteria 3151
1387 Ga0501073_0085148 3300049589 Bacteria 2200
1388 Ga0501073_0107786 3300049589 Bacteria 1933
1389 Ga0501074_0005374 3300049590 Bacteria 9216
1390 Ga0501074_0034612 3300049590 Bacteria 3661
1391 Ga0501074_0108886 3300049590 Bacteria 1983
1392 Ga0501074_0232754 3300049590 Bacteria 1311
1393 Ga0501074_0276712 3300049590 Bacteria 1193
1394 Ga0501075_0034247 3300049591 Bacteria 3781
1395 Ga0501075_0036537 3300049591 Bacteria 3667
1396 Ga0501075_0388322 3300049591 Bacteria 1064
1397 Ga0501076_0042510 3300049592 Bacteria 3578
1398 Ga0501076_0142250 3300049592 Bacteria 1949
1399 Ga0501076_0258752 3300049592 Bacteria 1425
1400 Ga0501076_0346372 3300049592 Bacteria 1220
1401 Ga0501076_0568361 3300049592 Bacteria 935
1402 Ga0501077_0038583 3300049593 Bacteria 3042
1403 Ga0501079_0025191 3300049741 Bacteria 4563
1404 Ga0501079_0025723 3300049741 Bacteria 4513
1405 Ga0501079_0064159 3300049741 Bacteria 2833
1406 Ga0501079_0066273 3300049741 Bacteria 2786
1407 Ga0501079_0297363 3300049741 Bacteria 1263
1408 Ga0501080_0030655 3300049742 Bacteria 5011
1409 Ga0501080_0043911 3300049742 Bacteria 4161
1410 Ga0501080_0043954 3300049742 Bacteria 4159
1411 Ga0501080_0058203 3300049742 Bacteria 3597
1412 Ga0501080_0091459 3300049742 Bacteria 2826
1413 Ga0501080_0133557 3300049742 Bacteria 2297
1414 Ga0501080_0181143 3300049742 Bacteria 1938
1415 Ga0501080_0218911 3300049742 Bacteria 1743
1416 Ga0501080_0280095 3300049742 Bacteria 1516
1417 Ga0501080_0369480 3300049742 Bacteria 1293
1418 Ga0501080_0373475 3300049742 Bacteria 1285
1419 Ga0501081_0035257 3300049743 Bacteria 3406
1420 Ga0501081_0058062 3300049743 Bacteria 2677
1421 Ga0501081_0089128 3300049743 Bacteria 2168
1422 Ga0501083_0007711 3300049744 Bacteria 7629
1423 Ga0501083_0027167 3300049744 Bacteria 3950
1424 Ga0501083_0104974 3300049744 Bacteria 1861
1425 Ga0501083_0125908 3300049744 Bacteria 1679
1426 Ga0501083_0193282 3300049744 Bacteria 1328
1427 Ga0501035_0018143 3300049822 Bacteria 6484
1428 Ga0501035_0020783 3300049822 Bacteria 6032
1429 Ga0501035_0045393 3300049822 Bacteria 3953
1430 Ga0501035_0049633 3300049822 Bacteria 3760
1431 Ga0501035_0081794 3300049822 Bacteria 2850
1432 Ga0501035_0086966 3300049822 Bacteria 2754
1433 Ga0501035_0159064 3300049822 Bacteria 1956
1434 Ga0501035_0215697 3300049822 Bacteria 1640
1435 Ga0501035_0241991 3300049822 Bacteria 1534
1436 Ga0501035_0334296 3300049822 Bacteria 1270
1437 Ga0501035_0718269 3300049822 Bacteria 804
1438 Ga0501044_0002231 3300049823 Bacteria 22176
1439 Ga0501044_0014745 3300049823 Bacteria 8425
1440 Ga0501044_0018639 3300049823 Bacteria 7433
1441 Ga0501044_0021198 3300049823 Bacteria 6937
1442 Ga0501044_0034684 3300049823 Bacteria 5289
1443 Ga0501044_0039939 3300049823 Bacteria 4892
1444 Ga0501044_0048900 3300049823 Bacteria 4365
1445 Ga0501044_0060711 3300049823 Bacteria 3869
1446 Ga0501044_0087183 3300049823 Bacteria 3153
1447 Ga0501044_0101310 3300049823 Bacteria 2897
1448 Ga0501044_0130947 3300049823 Bacteria 2502
1449 Ga0501044_0159049 3300049823 Bacteria 2237
1450 Ga0501044_0178512 3300049823 Bacteria 2091
1451 Ga0501044_0214366 3300049823 Bacteria 1878
1452 Ga0501044_0353299 3300049823 Bacteria 1389
1453 Ga0501045_0002076 3300049824 Bacteria 13532
1454 Ga0501045_0096301 3300049824 Bacteria 2190
1455 Ga0501045_0295435 3300049824 Bacteria 1205
1456 nmdc:mga03683_83704_c1 3300050489 Bacteria 1381
1457 nmdc:mga03683_90099_c1 3300050489 Bacteria 1336
1458 nmdc:mga03n38_1503_c1 3300050490 Bacteria 6729
1459 nmdc:mga03n38_233632_c1 3300050490 Bacteria 965
1460 nmdc:mga00v17_16115_c1 3300050491 Bacteria 4209
1461 nmdc:mga00v17_40834_c1 3300050491 Bacteria 2784
1462 nmdc:mga00v17_45574_c1 3300050491 Bacteria 2650
1463 nmdc:mga0yw44_111229_c1 3300050492 Bacteria 1755
1464 nmdc:mga0yw44_12558_c1 3300050492 Bacteria 4421
1465 nmdc:mga0yw44_13089_c1 3300050492 Bacteria 4353
1466 nmdc:mga0yw44_136533_c1 3300050492 Bacteria 1591
1467 nmdc:mga0yw44_4562_c1 3300050492 Bacteria 6380
1468 nmdc:mga0yw44_67357_c1 3300050492 Bacteria 2213
1469 nmdc:mga0yw44_7371_c1 3300050492 Bacteria 5407
1470 nmdc:mga0yw44_89468_c1 3300050492 Bacteria 1943
1471 nmdc:mga0k408_170998_c1 3300050493 Bacteria 1295
1472 nmdc:mga0k408_213452_c1 3300050493 Bacteria 1152
1473 nmdc:mga0k408_2577_c1 3300050493 Bacteria 9620
1474 nmdc:mga0k408_319818_c1 3300050493 Bacteria 926
1475 nmdc:mga06z11_44377_c1 3300050494 Bacteria 2241
1476 nmdc:mga06z11_7051_c1 3300050494 Bacteria 4608
1477 nmdc:mga06z11_71486_c1 3300050494 Bacteria 1837
1478 nmdc:mga07m45_210203_c1 3300050496 Bacteria 1132
1479 nmdc:mga07m45_31160_c2 3300050496 Bacteria 2466
1480 nmdc:mga07m45_314260_c1 3300050496 Bacteria 911
1481 nmdc:mga07m45_52290_c1 3300050496 Bacteria 2306
1482 nmdc:mga07m45_8008_c2 3300050496 Bacteria 4951
1483 nmdc:mga05p37_15155_c1 3300050507 Bacteria 9257
1484 nmdc:mga05p37_15592_c1 3300050507 Bacteria 9133
1485 nmdc:mga05p37_228749_c1 3300050507 Bacteria 2241
1486 nmdc:mga05p37_43733_c1 3300050507 Bacteria 5511
1487 nmdc:mga05p37_61857_c1 3300050507 Bacteria 4608
1488 nmdc:mga05p37_75724_c1 3300050507 Bacteria 4142
1489 nmdc:mga09592_163826_c1 3300050508 Bacteria 1921
1490 nmdc:mga09592_347349_c1 3300050508 Bacteria 1284
1491 nmdc:mga0qj67_129757_c1 3300050509 Bacteria 2041
1492 nmdc:mga0qj67_174206_c1 3300050509 Bacteria 1747
1493 nmdc:mga0qj67_23_c1 3300050509 Bacteria 107313
1494 nmdc:mga0qj67_342693_c1 3300050509 Bacteria 1209
1495 nmdc:mga06r32_114845_c1 3300050510 Bacteria 2651
1496 nmdc:mga06r32_180066_c1 3300050510 Bacteria 2099
1497 nmdc:mga06r32_236994_c1 3300050510 Bacteria 1812
1498 nmdc:mga06r32_698987_c1 3300050510 Bacteria 980
1499 nmdc:mga08y16_110431_c1 3300050511 Bacteria 2863
1500 nmdc:mga08y16_207571_c1 3300050511 Bacteria 2029
1501 nmdc:mga08y16_211963_c1 3300050511 Bacteria 2006
1502 nmdc:mga08y16_243991_c1 3300050511 Bacteria 1856
1503 nmdc:mga08y16_739151_c1 3300050511 Bacteria 981
1504 nmdc:mga0n895_398372_c1 3300050512 Bacteria 1392
1505 nmdc:mga0n895_56085_c1 3300050512 Bacteria 3880
1506 nmdc:mga0n895_968228_c1 3300050512 Bacteria 833
1507 nmdc:mga0rr50_311947_c1 3300050513 Bacteria 1317
1508 nmdc:mga08x19_2830_c1 3300050514 Bacteria 10471
1509 nmdc:mga08x19_50181_c1 3300050514 Bacteria 2677
1510 nmdc:mga0a205_145557_c1 3300050515 Bacteria 2269
1511 nmdc:mga0a205_252815_c1 3300050515 Bacteria 1173
1512 nmdc:mga0a205_270132_c1 3300050515 Bacteria 1577
1513 nmdc:mga0sz30_134503_c1 3300050516 Bacteria 1090
1514 nmdc:mga0sz30_142620_c1 3300050516 Bacteria 1058
1515 nmdc:mga0sz30_14398_c1 3300050516 Bacteria 3112
1516 nmdc:mga0sz30_243354_c1 3300050516 Bacteria 801
1517 Ga0495601_0000009 3300053077 Bacteria 270622
1518 Ga0495601_0039057 3300053077 Bacteria 2971
1519 Ga0495601_0055874 3300053077 Bacteria 2500
1520 Ga0495601_0057707 3300053077 Bacteria 2459
1521 Ga0495601_0065435 3300053077 Bacteria 2314
1522 Ga0495601_0145261 3300053077 Bacteria 1548
1523 Ga0495601_0162009 3300053077 Bacteria 1462
1524 Ga0495612_0000019 3300053078 Bacteria 137844
1525 Ga0495612_0000377 3300053078 Bacteria 17864
1526 Ga0495612_0025416 3300053078 Bacteria 2377
1527 Ga0495612_0027882 3300053078 Bacteria 2272
1528 Ga0495612_0036305 3300053078 Bacteria 2000
1529 Ga0495612_0050490 3300053078 Bacteria 1708
1530 Ga0500635_0015217 3300053080 Bacteria 2268
1531 Ga0495655_0007211 3300053083 Bacteria 2057
1532 Ga0495655_0028734 3300053083 Bacteria 1331
1533 Ga0495655_0078535 3300053083 Bacteria 938
1534 Ga0495595_0000015 3300053084 Bacteria 144946
1535 Ga0495595_0063768 3300053084 Bacteria 1730
1536 Ga0495595_0086540 3300053084 Bacteria 1499
1537 Ga0495595_0105047 3300053084 Bacteria 1366
1538 Ga0495619_0000012 3300053085 Bacteria 268349
1539 Ga0495619_0004501 3300053085 Bacteria 8901
1540 Ga0495619_0016798 3300053085 Bacteria 4634
1541 Ga0495619_0120537 3300053085 Bacteria 1798
1542 Ga0500643_020457 3300053087 Bacteria 2164
1543 Ga0500644_0007090 3300053088 Bacteria 2904
1544 Ga0500651_0052786 3300053093 Bacteria 2549
1545 Ga0500566_0000574 3300053094 Bacteria 20705
1546 Ga0500641_0001161 3300053096 Bacteria 9380
1547 Ga0500648_158849 3300053097 Bacteria 1192
1548 Ga0500650_0003432 3300053098 Bacteria 5509
1549 Ga0500554_002421 3300053102 Bacteria 3668
1550 Ga0500554_008523 3300053102 Bacteria 2414
1551 Ga0500556_0000035 3300053104 Bacteria 145357
1552 Ga0500557_000096 3300053105 Bacteria 28838
1553 Ga0500562_060723 3300053108 Bacteria 1015
1554 Ga0500569_001632 3300053109 Bacteria 4268
1555 Ga0500572_000335 3300053111 Bacteria 16881
1556 Ga0500593_000214 3300053117 Bacteria 23896
1557 Ga0500594_0095949 3300053118 Bacteria 906
1558 Ga0500595_000728 3300053119 Bacteria 19571
1559 Ga0500595_061714 3300053119 Bacteria 1130
1560 Ga0500608_000269 3300053122 Bacteria 20074
1561 Ga0500608_091250 3300053122 Bacteria 1424
1562 Ga0500618_012006 3300053125 Bacteria 2280
1563 Ga0500642_0000027 3300053130 Bacteria 119688
1564 Ga0500642_0000083 3300053130 Bacteria 50718
1565 Ga0500642_0062311 3300053130 Bacteria 1678
1566 Ga0500642_0200788 3300053130 Bacteria 928
1567 Ga0500652_000529 3300053131 Bacteria 13438
1568 Ga0500658_0118352 3300053134 Bacteria 1172
1569 Ga0500559_0000064 3300053136 Bacteria 85844
1570 Ga0500559_0018562 3300053136 Bacteria 2938
1571 Ga0500568_0000004 3300053139 Bacteria 621666
1572 Ga0500568_0000443 3300053139 Bacteria 31089
1573 Ga0500568_0042567 3300053139 Bacteria 1819
1574 Ga0500568_0073161 3300053139 Bacteria 1309
1575 Ga0500577_0006124 3300053142 Bacteria 3294
1576 Ga0500586_003676 3300053145 Bacteria 3663
1577 Ga0500590_133389 3300053148 Bacteria 1146
1578 Ga0500603_003284 3300053150 Bacteria 3475
1579 Ga0500603_008634 3300053150 Bacteria 2266
1580 Ga0500604_0059408 3300053151 Bacteria 1197
1581 Ga0500616_0000054 3300053153 Bacteria 290186
1582 Ga0500616_0051631 3300053153 Bacteria 2166
1583 Ga0500622_0003640 3300053156 Bacteria 10132
1584 Ga0500627_0008813 3300053158 Bacteria 3602
1585 Ga0500627_0017323 3300053158 Bacteria 2829
1586 Ga0500634_0107652 3300053161 Bacteria 1382
1587 Ga0500638_007140 3300053162 Bacteria 4643
1588 Ga0500638_135408 3300053162 Bacteria 1112
1589 Ga0500639_062231 3300053163 Bacteria 1921
1590 Ga0500636_0001203 3300053177 Bacteria 13970
1591 Ga0500636_0024967 3300053177 Bacteria 3532
1592 Ga0500636_0103701 3300053177 Bacteria 1613
1593 Ga0500637_0000080 3300053178 Bacteria 34464
1594 Ga0500637_0057596 3300053178 Bacteria 2221
1595 Ga0500637_0213287 3300053178 Bacteria 1094
1596 Ga0500649_119607 3300053722 Bacteria 1006
1597 Ga0500570_088450 3300053724 Bacteria 1360
1598 Ga0500576_032854 3300053725 Bacteria 2352
1599 Ga0500657_105723 3300053728 Bacteria 1150
1600 Ga0500625_026577 3300053729 Bacteria 2742
1601 Ga0500645_015265 3300053730 Bacteria 2435
1602 Ga0500596_009139 3300053735 Bacteria 1555
1603 Ga0501084_0050780 3300054114 Bacteria 3470
1604 Ga0501084_0156725 3300054114 Bacteria 1920
1605 Ga0501084_0208137 3300054114 Bacteria 1650
1606 Ga0501084_0237414 3300054114 Bacteria 1539
1607 Ga0501084_0593749 3300054114 Bacteria 936
1608 Ga0500661_001305 3300055283 Bacteria 4654
1609 Ga0501082_0008815 3300060353 Bacteria 8699
1610 Ga0501082_0078861 3300060353 Bacteria 2840
1611 Ga0501082_0102542 3300060353 Bacteria 2475
1612 Ga0501082_0144600 3300060353 Bacteria 2064
1613 Ga0501082_0238226 3300060353 Bacteria 1583
1614 Ga0501082_0525482 3300060353 Bacteria 1034
1615 Ga0530510_0069935 3300061734 Bacteria 2547
1616 Ga0530510_0090885 3300061734 Bacteria 2227
1617 Ga0530510_0150706 3300061734 Bacteria 1717
1618 Ga0530510_0196700 3300061734 Bacteria 1497
1619 Ga0530510_0239313 3300061734 Bacteria 1351

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0484745 Ga0501034_0484745_17_622 201
2 3300049579 Ga0501043_0789610 Ga0501043_0789610_13_618 201
3 3300049822 Ga0501035_0718269 Ga0501035_0718269_154_789 211
4 3300053139 Ga0500568_0042567 Ga0500568_0042567_366_1109 224
5 3300049823 Ga0501044_0159049 Ga0501044_0159049_755_1510 225
6 3300046526 Ga0495666_0169756 Ga0495666_0169756_274_990 229
7 3300046664 Ga0495659_0076698 Ga0495659_0076698_14_730 229
8 3300047318 Ga0495636_0212650 Ga0495636_0212650_159_875 229
9 3300042876 Ga0451577_0000804 Ga0451577_0000804_22779_23600 230
10 3300050510 nmdc:mga06r32_698987_c1 nmdc:mga06r32_698987_c1_273_965 230
11 3300006178 Ga0075367_10033542 Ga0075367_100335421 232
12 3300049568 Ga0501031_0291222 Ga0501031_0291222_11_709 232
13 3300047319 Ga0495674_0201351 Ga0495674_0201351_935_1636 233
14 3300048916 Ga0496113_0400697 Ga0496113_0400697_391_1092 233
15 3300049572 Ga0501036_0780449 Ga0501036_0780449_75_776 233
16 3300049580 Ga0501046_0210479 Ga0501046_0210479_22_768 233
17 3300050490 nmdc:mga03n38_233632_c1 nmdc:mga03n38_233632_c1_251_955 233
18 3300026067 Ga0207678_10165456 Ga0207678_101654563 236
19 3300049588 Ga0501072_0008716 Ga0501072_0008716_3515_4237 236
20 3300037418 Ga0395900_0476054 Ga0395900_0476054_269_1027 237
21 3300046642 Ga0495634_0407853 Ga0495634_0407853_12_728 238
22 3300049581 Ga0501047_0027821 Ga0501047_0027821_4541_5296 238
23 3300049586 Ga0501070_0102705 Ga0501070_0102705_607_1362 238
24 3300049742 Ga0501080_0133557 Ga0501080_0133557_1120_1875 238
25 3300049823 Ga0501044_0087183 Ga0501044_0087183_1823_2578 238
26 3300049570 Ga0501033_0046944 Ga0501033_0046944_1243_1998 239
27 3300049592 Ga0501076_0142250 Ga0501076_0142250_786_1541 239
28 3300003203 JGI25406J46586_10011288 JGI25406J46586_100112883 240
29 3300005328 Ga0070676_10160260 Ga0070676_101602602 240
30 3300005330 Ga0070690_100325104 Ga0070690_1003251042 240
31 3300005331 Ga0070670_100028912 Ga0070670_1000289122 240
32 3300005333 Ga0070677_10003744 Ga0070677_100037443 240
33 3300005335 Ga0070666_10148576 Ga0070666_101485762 240
34 3300005338 Ga0068868_100080496 Ga0068868_1000804963 240
35 3300005340 Ga0070689_100013407 Ga0070689_1000134074 240
36 3300005340 Ga0070689_100017936 Ga0070689_1000179364 240
37 3300005343 Ga0070687_100183708 Ga0070687_1001837082 240
38 3300005353 Ga0070669_100203534 Ga0070669_1002035343 240
39 3300005355 Ga0070671_100457826 Ga0070671_1004578262 240
40 3300005356 Ga0070674_100002026 Ga0070674_10000202611 240
41 3300005365 Ga0070688_100079337 Ga0070688_1000793372 240
42 3300005365 Ga0070688_100120457 Ga0070688_1001204573 240
43 3300005366 Ga0070659_100269598 Ga0070659_1002695982 240
44 3300005367 Ga0070667_100318711 Ga0070667_1003187112 240
45 3300005434 Ga0070709_10446297 Ga0070709_104462971 240
46 3300005435 Ga0070714_100110011 Ga0070714_1001100114 240
47 3300005435 Ga0070714_100486162 Ga0070714_1004861621 240
48 3300005439 Ga0070711_100623380 Ga0070711_1006233801 240
49 3300005441 Ga0070700_100368336 Ga0070700_1003683362 240
50 3300005456 Ga0070678_100043308 Ga0070678_1000433084 240
51 3300005459 Ga0068867_100027107 Ga0068867_1000271073 240
52 3300005543 Ga0070672_100128515 Ga0070672_1001285154 240
53 3300005564 Ga0070664_100221821 Ga0070664_1002218213 240
54 3300005578 Ga0068854_100175095 Ga0068854_1001750953 240
55 3300005617 Ga0068859_100591992 Ga0068859_1005919922 240
56 3300005983 Ga0081540_1026519 Ga0081540_10265192 240
57 3300005985 Ga0081539_10010784 Ga0081539_100107842 240
58 3300006028 Ga0070717_10203536 Ga0070717_102035361 240
59 3300006028 Ga0070717_10252148 Ga0070717_102521483 240
60 3300006042 Ga0075368_10013948 Ga0075368_100139484 240
61 3300006048 Ga0075363_100040761 Ga0075363_1000407611 240
62 3300006163 Ga0070715_10023346 Ga0070715_100233463 240
63 3300006173 Ga0070716_100096426 Ga0070716_1000964261 240
64 3300006178 Ga0075367_10222384 Ga0075367_102223841 240
65 3300006353 Ga0075370_10019271 Ga0075370_100192712 240
66 3300006931 Ga0097620_100592027 Ga0097620_1005920272 240
67 3300007788 Ga0099795_10019465 Ga0099795_100194651 240
68 3300009098 Ga0105245_10183787 Ga0105245_101837872 240
69 3300009148 Ga0105243_10174079 Ga0105243_101740793 240
70 3300010159 Ga0099796_10011096 Ga0099796_100110963 240
71 3300013297 Ga0157378_10152330 Ga0157378_101523304 240
72 3300014325 Ga0163163_10176189 Ga0163163_101761893 240
73 3300014745 Ga0157377_10359615 Ga0157377_103596152 240
74 3300014968 Ga0157379_10369775 Ga0157379_103697752 240
75 3300021384 Ga0213876_10103081 Ga0213876_101030813 240
76 3300021384 Ga0213876_10230774 Ga0213876_102307742 240
77 3300021388 Ga0213875_10000046 Ga0213875_1000004670 240
78 3300025893 Ga0207682_10000375 Ga0207682_100003759 240
79 3300025898 Ga0207692_10096913 Ga0207692_100969132 240
80 3300025906 Ga0207699_10179507 Ga0207699_101795073 240
81 3300025907 Ga0207645_10036084 Ga0207645_100360843 240
82 3300025915 Ga0207693_10137592 Ga0207693_101375923 240
83 3300025923 Ga0207681_10057307 Ga0207681_100573073 240
84 3300025924 Ga0207694_10340932 Ga0207694_103409322 240
85 3300025925 Ga0207650_10243427 Ga0207650_102434273 240
86 3300025926 Ga0207659_10027231 Ga0207659_100272314 240
87 3300025927 Ga0207687_10121567 Ga0207687_101215674 240
88 3300025929 Ga0207664_10190664 Ga0207664_101906642 240
89 3300025931 Ga0207644_10034357 Ga0207644_100343572 240
90 3300025931 Ga0207644_10413194 Ga0207644_104131942 240
91 3300025932 Ga0207690_10349275 Ga0207690_103492753 240
92 3300025933 Ga0207706_10037090 Ga0207706_100370902 240
93 3300025933 Ga0207706_10096017 Ga0207706_100960174 240
94 3300025936 Ga0207670_10142767 Ga0207670_101427673 240
95 3300025936 Ga0207670_10544921 Ga0207670_105449212 240
96 3300025939 Ga0207665_10136069 Ga0207665_101360692 240
97 3300025939 Ga0207665_10210676 Ga0207665_102106761 240
98 3300025940 Ga0207691_10021094 Ga0207691_100210943 240
99 3300025961 Ga0207712_10082474 Ga0207712_100824744 240
100 3300025972 Ga0207668_10240016 Ga0207668_102400163 240
101 3300025986 Ga0207658_10056905 Ga0207658_100569052 240
102 3300026089 Ga0207648_10016410 Ga0207648_100164106 240
103 3300026095 Ga0207676_10221457 Ga0207676_102214572 240
104 3300026118 Ga0207675_100458051 Ga0207675_1004580511 240
105 3300026121 Ga0207683_10000755 Ga0207683_1000075521 240
106 3300028379 Ga0268266_10612723 Ga0268266_106127232 240
107 3300028380 Ga0268265_10222070 Ga0268265_102220702 240
108 3300028380 Ga0268265_10733167 Ga0268265_107331671 240
109 3300031238 Ga0265332_10056299 Ga0265332_100562992 240
110 3300031247 Ga0265340_10064416 Ga0265340_100644162 240
111 3300031249 Ga0265339_10075724 Ga0265339_100757242 240
112 3300031344 Ga0265316_10131649 Ga0265316_101316492 240
113 3300031344 Ga0265316_10133634 Ga0265316_101336342 240
114 3300031712 Ga0265342_10039041 Ga0265342_100390412 240
115 3300035111 Ga0373923_0010299 Ga0373923_0010299_686_1432 240
116 3300035113 Ga0373936_0001304 Ga0373936_0001304_4762_5508 240
117 3300035116 Ga0373945_0004834 Ga0373945_0004834_1966_2712 240
118 3300035118 Ga0373954_0003435 Ga0373954_0003435_4682_5428 240
119 3300035119 Ga0373956_0007265 Ga0373956_0007265_1421_2167 240
120 3300035120 Ga0373957_0007813 Ga0373957_0007813_1141_1887 240
121 3300035170 Ga0373943_0003366 Ga0373943_0003366_2544_3290 240
122 3300035171 Ga0373946_0000442 Ga0373946_0000442_2094_2840 240
123 3300035172 Ga0373955_0005428 Ga0373955_0005428_4189_4935 240
124 3300035410 Ga0373924_0000432 Ga0373924_0000432_1679_2425 240
125 3300035692 Ga0373935_0000370 Ga0373935_0000370_16602_17348 240
126 3300035695 Ga0373927_0006696 Ga0373927_0006696_3029_3775 240
127 3300035725 Ga0373947_0000476 Ga0373947_0000476_12625_13371 240
128 3300036401 Ga0373937_0000009 Ga0373937_0000009_86333_87079 240
129 3300037068 Ga0373925_0000194 Ga0373925_0000194_25119_25865 240
130 3300037853 Ga0436364_0463993 Ga0436364_0463993_1790_2524 240
131 3300037853 Ga0436364_1536805 Ga0436364_1536805_3537_4271 240
132 3300038742 Ga0400486_01881 Ga0400486_01881_6392_7129 240
133 3300039437 Ga0436365_0361138 Ga0436365_0361138_150_908 240
134 3300039437 Ga0436365_1466687 Ga0436365_1466687_1779_2543 240
135 3300039453 Ga0436362_0588599 Ga0436362_0588599_253_987 240
136 3300041512 Ga0451853_1217131 Ga0451853_1217131_85_819 240
137 3300044842 Ga0466957_0080487 Ga0466957_0080487_1084_1839 240
138 3300045976 Ga0466967_0402828 Ga0466967_0402828_81_836 240
139 3300046454 Ga0495592_0000018 Ga0495592_0000018_23424_24170 240
140 3300046459 Ga0495629_0004511 Ga0495629_0004511_4906_5652 240
141 3300046462 Ga0495651_0002271 Ga0495651_0002271_26_772 240
142 3300046463 Ga0495653_0000032 Ga0495653_0000032_55534_56280 240
143 3300046477 Ga0495664_0000010 Ga0495664_0000010_181432_182178 240
144 3300046511 Ga0495608_0000008 Ga0495608_0000008_86471_87217 240
145 3300046514 Ga0495618_0000002 Ga0495618_0000002_183705_184451 240
146 3300046514 Ga0495618_0199450 Ga0495618_0199450_330_1103 240
147 3300046516 Ga0495628_0000009 Ga0495628_0000009_181460_182206 240
148 3300046517 Ga0495630_0001850 Ga0495630_0001850_1422_2168 240
149 3300046529 Ga0495652_0000011 Ga0495652_0000011_86161_86907 240
150 3300046533 Ga0495640_0000009 Ga0495640_0000009_34913_35659 240
151 3300046535 Ga0495586_0113785 Ga0495586_0113785_478_1224 240
152 3300046536 Ga0495587_0000006 Ga0495587_0000006_295178_295924 240
153 3300046537 Ga0495598_0003846 Ga0495598_0003846_1618_2352 240
154 3300046539 Ga0495621_0009676 Ga0495621_0009676_139_873 240
155 3300046543 Ga0495645_0000010 Ga0495645_0000010_55534_56280 240
156 3300046559 Ga0495667_0000005 Ga0495667_0000005_181460_182206 240
157 3300046642 Ga0495634_0000223 Ga0495634_0000223_41803_42549 240
158 3300046663 Ga0495635_0000008 Ga0495635_0000008_86144_86890 240
159 3300046675 Ga0495657_0000058 Ga0495657_0000058_40897_41643 240
160 3300046678 Ga0495599_0000007 Ga0495599_0000007_86161_86907 240
161 3300046679 Ga0495623_0000085 Ga0495623_0000085_2532_3278 240
162 3300046680 Ga0495646_0000021 Ga0495646_0000021_86116_86862 240
163 3300046683 Ga0495658_0025517 Ga0495658_0025517_1578_2324 240
164 3300046690 Ga0495624_0007573 Ga0495624_0007573_4741_5487 240
165 3300046809 Ga0495600_0000001 Ga0495600_0000001_86161_86907 240
166 3300047315 Ga0495581_0005192 Ga0495581_0005192_5218_5964 240
167 3300047317 Ga0495604_0000012 Ga0495604_0000012_181447_182193 240
168 3300047319 Ga0495674_0000011 Ga0495674_0000011_183733_184479 240
169 3300047322 Ga0495680_0001281 Ga0495680_0001281_12475_13221 240
170 3300047444 Ga0495675_0000096 Ga0495675_0000096_27917_28663 240
171 3300047471 Ga0495684_0000084 Ga0495684_0000084_9321_10067 240
172 3300047673 Ga0495593_0000727 Ga0495593_0000727_8610_9356 240
173 3300048088 Ga0495602_0000073 Ga0495602_0000073_86144_86890 240
174 3300048090 Ga0495615_0008934 Ga0495615_0008934_746_1480 240
175 3300049570 Ga0501033_0170944 Ga0501033_0170944_265_1020 240
176 3300049571 Ga0501034_0263387 Ga0501034_0263387_501_1256 240
177 3300049581 Ga0501047_0362999 Ga0501047_0362999_169_897 240
178 3300049742 Ga0501080_0091459 Ga0501080_0091459_1729_2463 240
179 3300049744 Ga0501083_0104974 Ga0501083_0104974_633_1367 240
180 3300050496 nmdc:mga07m45_31160_c2 nmdc:mga07m45_31160_c2_1352_2119 240
181 3300050511 nmdc:mga08y16_243991_c1 nmdc:mga08y16_243991_c1_1095_1829 240
182 3300050514 nmdc:mga08x19_2830_c1 nmdc:mga08x19_2830_c1_2462_3208 240
183 3300053077 Ga0495601_0000009 Ga0495601_0000009_86144_86890 240
184 3300053078 Ga0495612_0000019 Ga0495612_0000019_50938_51684 240
185 3300053083 Ga0495655_0028734 Ga0495655_0028734_339_1073 240
186 3300053084 Ga0495595_0000015 Ga0495595_0000015_67399_68145 240
187 3300053085 Ga0495619_0000012 Ga0495619_0000012_86144_86890 240
188 3300053105 Ga0500557_000096 Ga0500557_000096_2039_2794 240
189 3300053130 Ga0500642_0000083 Ga0500642_0000083_47981_48736 240
190 3300053729 Ga0500625_026577 Ga0500625_026577_1883_2638 240
191 iso_pu_bacteria 8054563764 8054567645 240
192 3300031665 Ga0316575_10104860 Ga0316575_101048601 241
193 3300031691 Ga0316579_10116103 Ga0316579_101161032 241
194 3300031727 Ga0316576_10473465 Ga0316576_104734651 241
195 3300035398 Ga0316574_0012818 Ga0316574_0012818_1811_2566 241
196 3300036712 Ga0316584_0013475 Ga0316584_0013475_2848_3603 241
197 3300044735 Ga0466968_0148538 Ga0466968_0148538_225_977 241
198 3300005330 Ga0070690_100015033 Ga0070690_1000150332 242
199 3300005354 Ga0070675_100049538 Ga0070675_1000495384 242
200 3300005356 Ga0070674_100053105 Ga0070674_1000531054 242
201 3300005364 Ga0070673_100184639 Ga0070673_1001846392 242
202 3300005365 Ga0070688_100005393 Ga0070688_1000053937 242
203 3300005437 Ga0070710_10101370 Ga0070710_101013701 242
204 3300005441 Ga0070700_100065836 Ga0070700_1000658362 242
205 3300005456 Ga0070678_100196307 Ga0070678_1001963072 242
206 3300005530 Ga0070679_100075408 Ga0070679_1000754082 242
207 3300005548 Ga0070665_100419582 Ga0070665_1004195821 242
208 3300005617 Ga0068859_100401058 Ga0068859_1004010582 242
209 3300005981 Ga0081538_10021985 Ga0081538_100219853 242
210 3300005983 Ga0081540_1005635 Ga0081540_10056355 242
211 3300006051 Ga0075364_10275501 Ga0075364_102755011 242
212 3300006177 Ga0075362_10037679 Ga0075362_100376793 242
213 3300006178 Ga0075367_10019167 Ga0075367_100191673 242
214 3300006186 Ga0075369_10052741 Ga0075369_100527412 242
215 3300006353 Ga0075370_10102535 Ga0075370_101025352 242
216 3300006844 Ga0075428_100364147 Ga0075428_1003641472 242
217 3300006931 Ga0097620_100401085 Ga0097620_1004010853 242
218 3300009147 Ga0114129_10056443 Ga0114129_100564435 242
219 3300013306 Ga0163162_10353438 Ga0163162_103534382 242
220 3300014325 Ga0163163_10097355 Ga0163163_100973553 242
221 3300014326 Ga0157380_10118996 Ga0157380_101189962 242
222 3300014326 Ga0157380_10588329 Ga0157380_105883292 242
223 3300021384 Ga0213876_10014482 Ga0213876_100144825 242
224 3300025893 Ga0207682_10060269 Ga0207682_100602692 242
225 3300025907 Ga0207645_10118776 Ga0207645_101187762 242
226 3300025921 Ga0207652_10080298 Ga0207652_100802982 242
227 3300025934 Ga0207686_10299875 Ga0207686_102998753 242
228 3300025937 Ga0207669_10012254 Ga0207669_100122543 242
229 3300025937 Ga0207669_10075737 Ga0207669_100757372 242
230 3300026075 Ga0207708_10140391 Ga0207708_101403912 242
231 3300026121 Ga0207683_10039521 Ga0207683_100395213 242
232 3300026121 Ga0207683_10090083 Ga0207683_100900833 242
233 3300028380 Ga0268265_10601767 Ga0268265_106017671 242
234 3300028381 Ga0268264_10320064 Ga0268264_103200642 242
235 3300031238 Ga0265332_10000310 Ga0265332_1000031031 242
236 3300031241 Ga0265325_10002716 Ga0265325_100027167 242
237 3300031241 Ga0265325_10093724 Ga0265325_100937241 242
238 3300031247 Ga0265340_10001987 Ga0265340_100019873 242
239 3300031247 Ga0265340_10007979 Ga0265340_100079794 242
240 3300031249 Ga0265339_10006147 Ga0265339_100061473 242
241 3300031249 Ga0265339_10223069 Ga0265339_102230692 242
242 3300031250 Ga0265331_10007124 Ga0265331_100071243 242
243 3300031344 Ga0265316_10090899 Ga0265316_100908991 242
244 3300031595 Ga0265313_10018919 Ga0265313_100189193 242
245 3300031595 Ga0265313_10097247 Ga0265313_100972473 242
246 3300031711 Ga0265314_10152826 Ga0265314_101528262 242
247 3300031712 Ga0265342_10000175 Ga0265342_1000017554 242
248 3300031712 Ga0265342_10017256 Ga0265342_100172564 242
249 3300035092 Ga0373952_0024718 Ga0373952_0024718_489_1229 242
250 3300035112 Ga0373932_0023423 Ga0373932_0023423_653_1393 242
251 3300035242 Ga0373962_0072435 Ga0373962_0072435_122_862 242
252 3300039437 Ga0436365_0910473 Ga0436365_0910473_1463_2191 242
253 3300039437 Ga0436365_1802139 Ga0436365_1802139_5565_6308 242
254 3300045051 Ga0451576_0893345 Ga0451576_0893345_156_905 242
255 3300048905 Ga0496102_0360673 Ga0496102_0360673_171_914 242
256 3300048908 Ga0496105_0190276 Ga0496105_0190276_714_1457 242
257 3300048909 Ga0496106_0139948 Ga0496106_0139948_1119_1859 242
258 3300048909 Ga0496106_0366507 Ga0496106_0366507_380_1123 242
259 3300048910 Ga0496107_0059834 Ga0496107_0059834_93_836 242
260 3300048911 Ga0496108_0693514 Ga0496108_0693514_119_859 242
261 3300048915 Ga0496112_0229843 Ga0496112_0229843_668_1411 242
262 3300048918 Ga0496115_0076990 Ga0496115_0076990_1484_2227 242
263 3300049568 Ga0501031_0008069 Ga0501031_0008069_4196_4936 242
264 3300049568 Ga0501031_0054785 Ga0501031_0054785_959_1699 242
265 3300049569 Ga0501032_0001954 Ga0501032_0001954_1143_1883 242
266 3300049569 Ga0501032_0021294 Ga0501032_0021294_384_1124 242
267 3300049570 Ga0501033_0014700 Ga0501033_0014700_2135_2875 242
268 3300049571 Ga0501034_0001164 Ga0501034_0001164_29054_29794 242
269 3300049571 Ga0501034_0020421 Ga0501034_0020421_3467_4207 242
270 3300049571 Ga0501034_0033298 Ga0501034_0033298_2135_2875 242
271 3300049571 Ga0501034_0226278 Ga0501034_0226278_979_1719 242
272 3300049572 Ga0501036_0004082 Ga0501036_0004082_9434_10174 242
273 3300049572 Ga0501036_0021130 Ga0501036_0021130_2656_3396 242
274 3300049572 Ga0501036_0311880 Ga0501036_0311880_366_1106 242
275 3300049573 Ga0501037_0005841 Ga0501037_0005841_2656_3396 242
276 3300049573 Ga0501037_0017803 Ga0501037_0017803_3706_4446 242
277 3300049573 Ga0501037_0062081 Ga0501037_0062081_913_1653 242
278 3300049574 Ga0501038_0002740 Ga0501038_0002740_1207_1947 242
279 3300049574 Ga0501038_0090993 Ga0501038_0090993_68_808 242
280 3300049574 Ga0501038_0266641 Ga0501038_0266641_68_808 242
281 3300049574 Ga0501038_0300721 Ga0501038_0300721_432_1172 242
282 3300049575 Ga0501039_0009338 Ga0501039_0009338_3204_3944 242
283 3300049575 Ga0501039_0158349 Ga0501039_0158349_226_966 242
284 3300049576 Ga0501040_0120309 Ga0501040_0120309_1087_1827 242
285 3300049578 Ga0501042_0017967 Ga0501042_0017967_760_1500 242
286 3300049579 Ga0501043_0006835 Ga0501043_0006835_7562_8302 242
287 3300049579 Ga0501043_0013054 Ga0501043_0013054_3399_4139 242
288 3300049579 Ga0501043_0036926 Ga0501043_0036926_1052_1792 242
289 3300049580 Ga0501046_0093547 Ga0501046_0093547_497_1237 242
290 3300049580 Ga0501046_0097271 Ga0501046_0097271_68_808 242
291 3300049580 Ga0501046_0440589 Ga0501046_0440589_68_808 242
292 3300049581 Ga0501047_0000459 Ga0501047_0000459_19616_20356 242
293 3300049581 Ga0501047_0033478 Ga0501047_0033478_2135_2875 242
294 3300049581 Ga0501047_0227606 Ga0501047_0227606_724_1464 242
295 3300049581 Ga0501047_0482194 Ga0501047_0482194_164_910 242
296 3300049581 Ga0501047_0564595 Ga0501047_0564595_49_789 242
297 3300049582 Ga0501048_0006170 Ga0501048_0006170_805_1545 242
298 3300049582 Ga0501048_0025329 Ga0501048_0025329_2186_2926 242
299 3300049583 Ga0501067_0021596 Ga0501067_0021596_1047_1787 242
300 3300049584 Ga0501068_0009003 Ga0501068_0009003_4811_5551 242
301 3300049584 Ga0501068_0066912 Ga0501068_0066912_860_1600 242
302 3300049585 Ga0501069_0006392 Ga0501069_0006392_3288_4028 242
303 3300049585 Ga0501069_0061272 Ga0501069_0061272_1085_1825 242
304 3300049586 Ga0501070_0031866 Ga0501070_0031866_2894_3634 242
305 3300049586 Ga0501070_0039798 Ga0501070_0039798_2204_2944 242
306 3300049586 Ga0501070_0176529 Ga0501070_0176529_50_790 242
307 3300049586 Ga0501070_0196238 Ga0501070_0196238_579_1319 242
308 3300049587 Ga0501071_0005326 Ga0501071_0005326_3090_3830 242
309 3300049588 Ga0501072_0227378 Ga0501072_0227378_522_1262 242
310 3300049589 Ga0501073_0007155 Ga0501073_0007155_3092_3832 242
311 3300049589 Ga0501073_0107786 Ga0501073_0107786_805_1545 242
312 3300049590 Ga0501074_0005374 Ga0501074_0005374_3490_4230 242
313 3300049590 Ga0501074_0232754 Ga0501074_0232754_387_1127 242
314 3300049592 Ga0501076_0258752 Ga0501076_0258752_86_826 242
315 3300049741 Ga0501079_0025723 Ga0501079_0025723_1611_2351 242
316 3300049742 Ga0501080_0030655 Ga0501080_0030655_805_1545 242
317 3300049742 Ga0501080_0043911 Ga0501080_0043911_942_1682 242
318 3300049742 Ga0501080_0181143 Ga0501080_0181143_811_1551 242
319 3300049743 Ga0501081_0089128 Ga0501081_0089128_238_978 242
320 3300049744 Ga0501083_0007711 Ga0501083_0007711_5120_5860 242
321 3300049744 Ga0501083_0027167 Ga0501083_0027167_3074_3814 242
322 3300049744 Ga0501083_0125908 Ga0501083_0125908_579_1319 242
323 3300049822 Ga0501035_0045393 Ga0501035_0045393_96_836 242
324 3300049822 Ga0501035_0215697 Ga0501035_0215697_154_894 242
325 3300049823 Ga0501044_0002231 Ga0501044_0002231_2725_3465 242
326 3300049823 Ga0501044_0034684 Ga0501044_0034684_444_1184 242
327 3300049823 Ga0501044_0048900 Ga0501044_0048900_814_1554 242
328 3300049823 Ga0501044_0060711 Ga0501044_0060711_2153_2893 242
329 3300049824 Ga0501045_0002076 Ga0501045_0002076_4338_5078 242
330 3300050496 nmdc:mga07m45_314260_c1 nmdc:mga07m45_314260_c1_60_800 242
331 3300050496 nmdc:mga07m45_52290_c1 nmdc:mga07m45_52290_c1_1043_1783 242
332 3300050507 nmdc:mga05p37_61857_c1 nmdc:mga05p37_61857_c1_1268_2008 242
333 3300050511 nmdc:mga08y16_110431_c1 nmdc:mga08y16_110431_c1_1987_2742 242
334 3300050511 nmdc:mga08y16_207571_c1 nmdc:mga08y16_207571_c1_572_1312 242
335 3300050512 nmdc:mga0n895_968228_c1 nmdc:mga0n895_968228_c1_28_771 242
336 3300050515 nmdc:mga0a205_145557_c1 nmdc:mga0a205_145557_c1_1458_2213 242
337 3300050516 nmdc:mga0sz30_134503_c1 nmdc:mga0sz30_134503_c1_249_989 242
338 3300050516 nmdc:mga0sz30_142620_c1 nmdc:mga0sz30_142620_c1_187_927 242
339 3300053077 Ga0495601_0055874 Ga0495601_0055874_1039_1779 242
340 3300053083 Ga0495655_0007211 Ga0495655_0007211_546_1286 242
341 3300053117 Ga0500593_000214 Ga0500593_000214_20171_20911 242
342 3300053139 Ga0500568_0000004 Ga0500568_0000004_206688_207458 242
343 3300053153 Ga0500616_0051631 Ga0500616_0051631_1374_2114 242
344 3300054114 Ga0501084_0050780 Ga0501084_0050780_498_1238 242
345 3300060353 Ga0501082_0008815 Ga0501082_0008815_6560_7300 242
346 3300060353 Ga0501082_0078861 Ga0501082_0078861_705_1445 242
347 3300005330 Ga0070690_100097902 Ga0070690_1000979023 243
348 3300005331 Ga0070670_100015459 Ga0070670_1000154595 243
349 3300005336 Ga0070680_100173606 Ga0070680_1001736062 243
350 3300005338 Ga0068868_100040355 Ga0068868_1000403552 243
351 3300005339 Ga0070660_100112612 Ga0070660_1001126121 243
352 3300005340 Ga0070689_100012114 Ga0070689_1000121145 243
353 3300005353 Ga0070669_100258011 Ga0070669_1002580112 243
354 3300005355 Ga0070671_100001610 Ga0070671_10000161010 243
355 3300005364 Ga0070673_100046009 Ga0070673_1000460093 243
356 3300005367 Ga0070667_100222310 Ga0070667_1002223102 243
357 3300005436 Ga0070713_100069892 Ga0070713_1000698923 243
358 3300005439 Ga0070711_100081895 Ga0070711_1000818953 243
359 3300005457 Ga0070662_100161339 Ga0070662_1001613391 243
360 3300005458 Ga0070681_10056463 Ga0070681_100564633 243
361 3300005530 Ga0070679_100008568 Ga0070679_1000085687 243
362 3300005548 Ga0070665_100255887 Ga0070665_1002558872 243
363 3300005719 Ga0068861_100866072 Ga0068861_1008660721 243
364 3300005842 Ga0068858_100088274 Ga0068858_1000882743 243
365 3300005981 Ga0081538_10179447 Ga0081538_101794472 243
366 3300005983 Ga0081540_1000297 Ga0081540_100029713 243
367 3300005983 Ga0081540_1046748 Ga0081540_10467483 243
368 3300006028 Ga0070717_10126720 Ga0070717_101267203 243
369 3300006163 Ga0070715_10203114 Ga0070715_102031142 243
370 3300006177 Ga0075362_10182958 Ga0075362_101829582 243
371 3300006195 Ga0075366_10001342 Ga0075366_1000134210 243
372 3300006195 Ga0075366_10084870 Ga0075366_100848703 243
373 3300006852 Ga0075433_10246367 Ga0075433_102463672 243
374 3300009098 Ga0105245_10037769 Ga0105245_100377697 243
375 3300009147 Ga0114129_10157307 Ga0114129_101573074 243
376 3300009174 Ga0105241_10112672 Ga0105241_101126723 243
377 3300009174 Ga0105241_10458000 Ga0105241_104580002 243
378 3300009177 Ga0105248_10126024 Ga0105248_101260243 243
379 3300009177 Ga0105248_10149282 Ga0105248_101492823 243
380 3300014325 Ga0163163_10120027 Ga0163163_101200273 243
381 3300025297 Ga0209758_1001932 Ga0209758_10019328 243
382 3300025898 Ga0207692_10030924 Ga0207692_100309242 243
383 3300025915 Ga0207693_10184986 Ga0207693_101849862 243
384 3300025916 Ga0207663_10053350 Ga0207663_100533503 243
385 3300025925 Ga0207650_10010889 Ga0207650_100108895 243
386 3300025931 Ga0207644_10111136 Ga0207644_101111363 243
387 3300025933 Ga0207706_10032501 Ga0207706_100325013 243
388 3300025939 Ga0207665_10442697 Ga0207665_104426971 243
389 3300025960 Ga0207651_10033989 Ga0207651_100339893 243
390 3300025960 Ga0207651_10166959 Ga0207651_101669592 243
391 3300025986 Ga0207658_10646497 Ga0207658_106464972 243
392 3300026023 Ga0207677_10039289 Ga0207677_100392893 243
393 3300026035 Ga0207703_10027837 Ga0207703_100278374 243
394 3300026121 Ga0207683_10340568 Ga0207683_103405682 243
395 3300028379 Ga0268266_10041549 Ga0268266_100415495 243
396 3300028381 Ga0268264_10406560 Ga0268264_104065602 243
397 3300031090 Ga0265760_10028324 Ga0265760_100283241 243
398 3300031456 Ga0307513_10134366 Ga0307513_101343664 243
399 3300032005 Ga0307411_10430321 Ga0307411_104303212 243
400 3300035118 Ga0373954_0031099 Ga0373954_0031099_346_1086 243
401 3300035118 Ga0373954_0132503 Ga0373954_0132503_147_887 243
402 3300035119 Ga0373956_0098807 Ga0373956_0098807_256_996 243
403 3300035120 Ga0373957_0018156 Ga0373957_0018156_1170_1910 243
404 3300035171 Ga0373946_0117914 Ga0373946_0117914_231_974 243
405 3300035172 Ga0373955_0017758 Ga0373955_0017758_883_1623 243
406 3300035695 Ga0373927_0012500 Ga0373927_0012500_2814_3554 243
407 3300035724 Ga0373933_0035942 Ga0373933_0035942_1149_1889 243
408 3300036401 Ga0373937_0052741 Ga0373937_0052741_2362_3102 243
409 3300036401 Ga0373937_0207301 Ga0373937_0207301_596_1339 243
410 3300037068 Ga0373925_0125709 Ga0373925_0125709_1097_1840 243
411 3300037853 Ga0436364_1234925 Ga0436364_1234925_681_1424 243
412 3300039437 Ga0436365_0544636 Ga0436365_0544636_2486_3229 243
413 3300039437 Ga0436365_0989626 Ga0436365_0989626_534_1274 243
414 3300039437 Ga0436365_1613283 Ga0436365_1613283_16_783 243
415 3300039438 Ga0436360_1258966 Ga0436360_1258966_337_1080 243
416 3300039447 Ga0436361_0082815 Ga0436361_0082815_108_851 243
417 3300039447 Ga0436361_0735205 Ga0436361_0735205_177_920 243
418 3300039450 Ga0436363_0068476 Ga0436363_0068476_440_1183 243
419 3300041413 Ga0439465_0040206 Ga0439465_0040206_592_1335 243
420 3300042435 Ga0439434_0096840 Ga0439434_0096840_30_773 243
421 3300046454 Ga0495592_0161451 Ga0495592_0161451_408_1148 243
422 3300046457 Ga0495590_0017697 Ga0495590_0017697_213_956 243
423 3300046462 Ga0495651_0018113 Ga0495651_0018113_2295_3035 243
424 3300046463 Ga0495653_0126812 Ga0495653_0126812_915_1655 243
425 3300046472 Ga0495580_0219499 Ga0495580_0219499_99_839 243
426 3300046473 Ga0495582_0188030 Ga0495582_0188030_186_926 243
427 3300046475 Ga0495639_0017286 Ga0495639_0017286_1337_2077 243
428 3300046476 Ga0495662_0015632 Ga0495662_0015632_1975_2715 243
429 3300046491 Ga0495584_0005969 Ga0495584_0005969_5386_6129 243
430 3300046491 Ga0495584_0138620 Ga0495584_0138620_126_869 243
431 3300046511 Ga0495608_0210193 Ga0495608_0210193_455_1195 243
432 3300046514 Ga0495618_0002296 Ga0495618_0002296_553_1293 243
433 3300046514 Ga0495618_0219880 Ga0495618_0219880_333_1073 243
434 3300046516 Ga0495628_0151589 Ga0495628_0151589_722_1465 243
435 3300046517 Ga0495630_0190624 Ga0495630_0190624_813_1553 243
436 3300046529 Ga0495652_0040074 Ga0495652_0040074_997_1737 243
437 3300046533 Ga0495640_0004134 Ga0495640_0004134_6107_6847 243
438 3300046533 Ga0495640_0045669 Ga0495640_0045669_1304_2044 243
439 3300046535 Ga0495586_0016981 Ga0495586_0016981_1932_2672 243
440 3300046536 Ga0495587_0033796 Ga0495587_0033796_1474_2214 243
441 3300046543 Ga0495645_0069213 Ga0495645_0069213_437_1177 243
442 3300046642 Ga0495634_0007776 Ga0495634_0007776_34_774 243
443 3300046642 Ga0495634_0030340 Ga0495634_0030340_642_1382 243
444 3300046642 Ga0495634_0066724 Ga0495634_0066724_721_1461 243
445 3300046663 Ga0495635_0079065 Ga0495635_0079065_661_1401 243
446 3300046679 Ga0495623_0028622 Ga0495623_0028622_2805_3545 243
447 3300046689 Ga0495613_0344267 Ga0495613_0344267_230_973 243
448 3300046690 Ga0495624_0316240 Ga0495624_0316240_167_907 243
449 3300046809 Ga0495600_0017611 Ga0495600_0017611_1025_1765 243
450 3300047317 Ga0495604_0268583 Ga0495604_0268583_386_1126 243
451 3300047319 Ga0495674_0005473 Ga0495674_0005473_7505_8245 243
452 3300047319 Ga0495674_0296042 Ga0495674_0296042_74_814 243
453 3300047320 Ga0495672_0124543 Ga0495672_0124543_70_813 243
454 3300047444 Ga0495675_0063415 Ga0495675_0063415_195_935 243
455 3300047471 Ga0495684_0000724 Ga0495684_0000724_14779_15519 243
456 3300047471 Ga0495684_0062950 Ga0495684_0062950_220_960 243
457 3300047471 Ga0495684_0170611 Ga0495684_0170611_382_1122 243
458 3300048088 Ga0495602_0233348 Ga0495602_0233348_267_1010 243
459 3300048904 Ga0496101_0066925 Ga0496101_0066925_1279_2019 243
460 3300048904 Ga0496101_0509849 Ga0496101_0509849_116_859 243
461 3300048905 Ga0496102_0085995 Ga0496102_0085995_268_1008 243
462 3300048907 Ga0496104_0179120 Ga0496104_0179120_515_1258 243
463 3300048911 Ga0496108_0236368 Ga0496108_0236368_305_1048 243
464 3300048911 Ga0496108_0338723 Ga0496108_0338723_286_1029 243
465 3300048912 Ga0496109_0118103 Ga0496109_0118103_753_1493 243
466 3300048913 Ga0496110_0095942 Ga0496110_0095942_839_1582 243
467 3300048913 Ga0496110_0385050 Ga0496110_0385050_414_1157 243
468 3300048915 Ga0496112_0055602 Ga0496112_0055602_1619_2359 243
469 3300048918 Ga0496115_0271562 Ga0496115_0271562_211_951 243
470 3300048918 Ga0496115_0515364 Ga0496115_0515364_20_772 243
471 3300049571 Ga0501034_0363062 Ga0501034_0363062_510_1253 243
472 3300049574 Ga0501038_0223388 Ga0501038_0223388_605_1348 243
473 3300049575 Ga0501039_0109261 Ga0501039_0109261_180_923 243
474 3300049577 Ga0501041_0126473 Ga0501041_0126473_554_1297 243
475 3300049580 Ga0501046_0141014 Ga0501046_0141014_768_1511 243
476 3300049581 Ga0501047_0244786 Ga0501047_0244786_744_1487 243
477 3300049582 Ga0501048_0255468 Ga0501048_0255468_53_796 243
478 3300049587 Ga0501071_0233936 Ga0501071_0233936_543_1286 243
479 3300049588 Ga0501072_0091966 Ga0501072_0091966_1322_2065 243
480 3300049590 Ga0501074_0108886 Ga0501074_0108886_609_1352 243
481 3300049591 Ga0501075_0034247 Ga0501075_0034247_2717_3460 243
482 3300049592 Ga0501076_0042510 Ga0501076_0042510_1903_2646 243
483 3300049592 Ga0501076_0568361 Ga0501076_0568361_71_814 243
484 3300049593 Ga0501077_0038583 Ga0501077_0038583_471_1214 243
485 3300049741 Ga0501079_0025191 Ga0501079_0025191_1849_2592 243
486 3300049742 Ga0501080_0373475 Ga0501080_0373475_53_796 243
487 3300049743 Ga0501081_0058062 Ga0501081_0058062_662_1405 243
488 3300049824 Ga0501045_0096301 Ga0501045_0096301_976_1719 243
489 3300050489 nmdc:mga03683_83704_c1 nmdc:mga03683_83704_c1_180_923 243
490 3300050493 nmdc:mga0k408_170998_c1 nmdc:mga0k408_170998_c1_178_930 243
491 3300050493 nmdc:mga0k408_2577_c1 nmdc:mga0k408_2577_c1_5202_5945 243
492 3300050507 nmdc:mga05p37_75724_c1 nmdc:mga05p37_75724_c1_351_1094 243
493 3300050508 nmdc:mga09592_163826_c1 nmdc:mga09592_163826_c1_716_1459 243
494 3300050513 nmdc:mga0rr50_311947_c1 nmdc:mga0rr50_311947_c1_377_1111 243
495 3300050515 nmdc:mga0a205_252815_c1 nmdc:mga0a205_252815_c1_171_914 243
496 3300053077 Ga0495601_0065435 Ga0495601_0065435_1498_2241 243
497 3300053077 Ga0495601_0145261 Ga0495601_0145261_572_1315 243
498 3300053078 Ga0495612_0000377 Ga0495612_0000377_6107_6847 243
499 3300053084 Ga0495595_0063768 Ga0495595_0063768_181_924 243
500 3300053085 Ga0495619_0004501 Ga0495619_0004501_3938_4678 243
501 3300053085 Ga0495619_0016798 Ga0495619_0016798_3607_4350 243
502 3300053130 Ga0500642_0200788 Ga0500642_0200788_59_802 243
503 3300054114 Ga0501084_0208137 Ga0501084_0208137_53_796 243
504 3300060353 Ga0501082_0102542 Ga0501082_0102542_875_1618 243
505 3300061734 Ga0530510_0069935 Ga0530510_0069935_1424_2167 243
506 3300061734 Ga0530510_0150706 Ga0530510_0150706_287_1030 243
507 3300005328 Ga0070676_10469751 Ga0070676_104697511 244
508 3300005330 Ga0070690_100035314 Ga0070690_1000353143 244
509 3300005331 Ga0070670_100018725 Ga0070670_1000187252 244
510 3300005331 Ga0070670_100022211 Ga0070670_1000222114 244
511 3300005335 Ga0070666_10044995 Ga0070666_100449954 244
512 3300005338 Ga0068868_100015983 Ga0068868_1000159832 244
513 3300005339 Ga0070660_100166316 Ga0070660_1001663163 244
514 3300005340 Ga0070689_100003230 Ga0070689_1000032307 244
515 3300005341 Ga0070691_10030581 Ga0070691_100305812 244
516 3300005343 Ga0070687_100005935 Ga0070687_1000059356 244
517 3300005344 Ga0070661_100339875 Ga0070661_1003398751 244
518 3300005354 Ga0070675_100013324 Ga0070675_1000133248 244
519 3300005354 Ga0070675_100405536 Ga0070675_1004055361 244
520 3300005355 Ga0070671_100007034 Ga0070671_1000070349 244
521 3300005356 Ga0070674_100056484 Ga0070674_1000564843 244
522 3300005364 Ga0070673_100037233 Ga0070673_1000372332 244
523 3300005365 Ga0070688_100018452 Ga0070688_1000184524 244
524 3300005366 Ga0070659_100256257 Ga0070659_1002562572 244
525 3300005367 Ga0070667_100130204 Ga0070667_1001302042 244
526 3300005436 Ga0070713_100541114 Ga0070713_1005411142 244
527 3300005438 Ga0070701_10009849 Ga0070701_100098494 244
528 3300005439 Ga0070711_100209201 Ga0070711_1002092013 244
529 3300005441 Ga0070700_100008437 Ga0070700_1000084376 244
530 3300005455 Ga0070663_100050622 Ga0070663_1000506223 244
531 3300005458 Ga0070681_10449461 Ga0070681_104494612 244
532 3300005466 Ga0070685_10013633 Ga0070685_100136334 244
533 3300005535 Ga0070684_100027940 Ga0070684_1000279403 244
534 3300005539 Ga0068853_100075350 Ga0068853_1000753502 244
535 3300005543 Ga0070672_100035470 Ga0070672_1000354702 244
536 3300005544 Ga0070686_100018490 Ga0070686_1000184902 244
537 3300005547 Ga0070693_100019524 Ga0070693_1000195243 244
538 3300005549 Ga0070704_100061113 Ga0070704_1000611132 244
539 3300005615 Ga0070702_100026608 Ga0070702_1000266084 244
540 3300005616 Ga0068852_100108085 Ga0068852_1001080852 244
541 3300005617 Ga0068859_100046809 Ga0068859_1000468094 244
542 3300005618 Ga0068864_100030864 Ga0068864_1000308642 244
543 3300005718 Ga0068866_10187795 Ga0068866_101877952 244
544 3300005719 Ga0068861_100038870 Ga0068861_1000388704 244
545 3300005834 Ga0068851_10003850 Ga0068851_100038507 244
546 3300005840 Ga0068870_10002916 Ga0068870_100029163 244
547 3300005841 Ga0068863_100025497 Ga0068863_1000254974 244
548 3300005842 Ga0068858_100074670 Ga0068858_1000746702 244
549 3300005844 Ga0068862_100026407 Ga0068862_1000264074 244
550 3300006038 Ga0075365_10001973 Ga0075365_100019736 244
551 3300006175 Ga0070712_100163364 Ga0070712_1001633642 244
552 3300006178 Ga0075367_10031100 Ga0075367_100311002 244
553 3300006237 Ga0097621_100023761 Ga0097621_1000237614 244
554 3300006353 Ga0075370_10140984 Ga0075370_101409842 244
555 3300006358 Ga0068871_100071108 Ga0068871_1000711082 244
556 3300006871 Ga0075434_100233811 Ga0075434_1002338112 244
557 3300006880 Ga0075429_100336613 Ga0075429_1003366132 244
558 3300006881 Ga0068865_100019538 Ga0068865_1000195381 244
559 3300006931 Ga0097620_100046812 Ga0097620_1000468124 244
560 3300009098 Ga0105245_10023790 Ga0105245_100237907 244
561 3300009101 Ga0105247_10005771 Ga0105247_100057716 244
562 3300009101 Ga0105247_10084624 Ga0105247_100846242 244
563 3300009147 Ga0114129_10004595 Ga0114129_1000459511 244
564 3300009147 Ga0114129_10882658 Ga0114129_108826581 244
565 3300009148 Ga0105243_10042458 Ga0105243_100424584 244
566 3300009176 Ga0105242_10066376 Ga0105242_100663761 244
567 3300009176 Ga0105242_10072541 Ga0105242_100725413 244
568 3300009177 Ga0105248_10006264 Ga0105248_1000626412 244
569 3300009177 Ga0105248_10067991 Ga0105248_100679914 244
570 3300009551 Ga0105238_10151170 Ga0105238_101511703 244
571 3300009551 Ga0105238_10289693 Ga0105238_102896932 244
572 3300009553 Ga0105249_10023825 Ga0105249_100238252 244
573 3300010375 Ga0105239_10192059 Ga0105239_101920594 244
574 3300011119 Ga0105246_10055196 Ga0105246_100551962 244
575 3300011119 Ga0105246_10058684 Ga0105246_100586842 244
576 3300013296 Ga0157374_10041399 Ga0157374_100413993 244
577 3300013306 Ga0163162_10053414 Ga0163162_100534143 244
578 3300013306 Ga0163162_10069682 Ga0163162_100696825 244
579 3300014325 Ga0163163_10010079 Ga0163163_100100794 244
580 3300014968 Ga0157379_10050265 Ga0157379_100502651 244
581 3300014969 Ga0157376_10190593 Ga0157376_101905932 244
582 3300025321 Ga0207656_10047520 Ga0207656_100475203 244
583 3300025900 Ga0207710_10028188 Ga0207710_100281882 244
584 3300025900 Ga0207710_10277226 Ga0207710_102772261 244
585 3300025901 Ga0207688_10000839 Ga0207688_100008397 244
586 3300025903 Ga0207680_10021253 Ga0207680_100212535 244
587 3300025908 Ga0207643_10001734 Ga0207643_100017347 244
588 3300025915 Ga0207693_10190349 Ga0207693_101903492 244
589 3300025916 Ga0207663_10081982 Ga0207663_100819822 244
590 3300025918 Ga0207662_10005503 Ga0207662_100055034 244
591 3300025924 Ga0207694_10250582 Ga0207694_102505822 244
592 3300025925 Ga0207650_10004899 Ga0207650_100048999 244
593 3300025925 Ga0207650_10114790 Ga0207650_101147902 244
594 3300025931 Ga0207644_10425936 Ga0207644_104259361 244
595 3300025932 Ga0207690_10017134 Ga0207690_100171343 244
596 3300025933 Ga0207706_10006114 Ga0207706_100061146 244
597 3300025934 Ga0207686_10093767 Ga0207686_100937673 244
598 3300025935 Ga0207709_10039181 Ga0207709_100391812 244
599 3300025936 Ga0207670_10007476 Ga0207670_100074766 244
600 3300025936 Ga0207670_10498351 Ga0207670_104983511 244
601 3300025937 Ga0207669_10026286 Ga0207669_100262863 244
602 3300025938 Ga0207704_10015064 Ga0207704_100150646 244
603 3300025940 Ga0207691_10006906 Ga0207691_100069066 244
604 3300025941 Ga0207711_10044345 Ga0207711_100443453 244
605 3300025941 Ga0207711_10054787 Ga0207711_100547872 244
606 3300025944 Ga0207661_10243036 Ga0207661_102430363 244
607 3300025945 Ga0207679_10131412 Ga0207679_101314123 244
608 3300025961 Ga0207712_10011151 Ga0207712_100111517 244
609 3300025972 Ga0207668_10600740 Ga0207668_106007401 244
610 3300026023 Ga0207677_10006968 Ga0207677_100069682 244
611 3300026023 Ga0207677_10374114 Ga0207677_103741143 244
612 3300026035 Ga0207703_10023677 Ga0207703_100236772 244
613 3300026067 Ga0207678_10006661 Ga0207678_100066617 244
614 3300026075 Ga0207708_10007716 Ga0207708_100077163 244
615 3300026078 Ga0207702_10029653 Ga0207702_100296533 244
616 3300026088 Ga0207641_10014887 Ga0207641_100148873 244
617 3300026089 Ga0207648_10004282 Ga0207648_100042827 244
618 3300026095 Ga0207676_10025698 Ga0207676_100256986 244
619 3300026116 Ga0207674_10277529 Ga0207674_102775293 244
620 3300026118 Ga0207675_100004773 Ga0207675_1000047737 244
621 3300026121 Ga0207683_10011238 Ga0207683_100112387 244
622 3300026142 Ga0207698_10048923 Ga0207698_100489234 244
623 3300028379 Ga0268266_10111463 Ga0268266_101114632 244
624 3300028381 Ga0268264_10026486 Ga0268264_100264864 244
625 3300031241 Ga0265325_10001089 Ga0265325_1000108915 244
626 3300031247 Ga0265340_10030886 Ga0265340_100308863 244
627 3300034816 Ga0373930_0043315 Ga0373930_0043315_97_843 244
628 3300035088 Ga0373940_0057534 Ga0373940_0057534_322_1068 244
629 3300035089 Ga0373944_0008452 Ga0373944_0008452_16_789 244
630 3300035091 Ga0373951_0033886 Ga0373951_0033886_12_758 244
631 3300035111 Ga0373923_0091581 Ga0373923_0091581_337_1110 244
632 3300035113 Ga0373936_0004439 Ga0373936_0004439_2888_3661 244
633 3300035114 Ga0373939_0006221 Ga0373939_0006221_623_1369 244
634 3300035116 Ga0373945_0051161 Ga0373945_0051161_70_843 244
635 3300035171 Ga0373946_0045305 Ga0373946_0045305_1018_1791 244
636 3300035172 Ga0373955_0255113 Ga0373955_0255113_161_934 244
637 3300035207 Ga0373942_0015083 Ga0373942_0015083_163_909 244
638 3300035691 Ga0373931_0087582 Ga0373931_0087582_685_1431 244
639 3300035691 Ga0373931_0217233 Ga0373931_0217233_49_822 244
640 3300035692 Ga0373935_0144130 Ga0373935_0144130_231_977 244
641 3300035695 Ga0373927_0203814 Ga0373927_0203814_19_765 244
642 3300035695 Ga0373927_0440267 Ga0373927_0440267_71_844 244
643 3300035725 Ga0373947_0294705 Ga0373947_0294705_246_1019 244
644 3300037068 Ga0373925_0025690 Ga0373925_0025690_2032_2778 244
645 3300037068 Ga0373925_0034596 Ga0373925_0034596_2087_2833 244
646 3300037068 Ga0373925_0096908 Ga0373925_0096908_921_1694 244
647 3300039437 Ga0436365_1853114 Ga0436365_1853114_532_1278 244
648 3300046454 Ga0495592_0068737 Ga0495592_0068737_805_1551 244
649 3300046455 Ga0495603_0158464 Ga0495603_0158464_320_1093 244
650 3300046457 Ga0495590_0032303 Ga0495590_0032303_702_1475 244
651 3300046461 Ga0495641_0096094 Ga0495641_0096094_455_1228 244
652 3300046473 Ga0495582_0110989 Ga0495582_0110989_442_1215 244
653 3300046474 Ga0495605_0098354 Ga0495605_0098354_356_1129 244
654 3300046476 Ga0495662_0174289 Ga0495662_0174289_87_860 244
655 3300046477 Ga0495664_0156048 Ga0495664_0156048_10_756 244
656 3300046491 Ga0495584_0097225 Ga0495584_0097225_477_1250 244
657 3300046492 Ga0495585_0064951 Ga0495585_0064951_702_1475 244
658 3300046499 Ga0495594_0028740 Ga0495594_0028740_726_1499 244
659 3300046500 Ga0495596_0064908 Ga0495596_0064908_120_893 244
660 3300046501 Ga0495607_0149462 Ga0495607_0149462_162_935 244
661 3300046511 Ga0495608_0073007 Ga0495608_0073007_803_1549 244
662 3300046513 Ga0495616_0064266 Ga0495616_0064266_801_1574 244
663 3300046516 Ga0495628_0179128 Ga0495628_0179128_315_1088 244
664 3300046516 Ga0495628_0259831 Ga0495628_0259831_12_758 244
665 3300046517 Ga0495630_0168720 Ga0495630_0168720_787_1560 244
666 3300046518 Ga0495631_0116504 Ga0495631_0116504_183_956 244
667 3300046525 Ga0495663_0065526 Ga0495663_0065526_319_1092 244
668 3300046525 Ga0495663_0089135 Ga0495663_0089135_213_986 244
669 3300046529 Ga0495652_0265595 Ga0495652_0265595_424_1197 244
670 3300046531 Ga0495665_0248900 Ga0495665_0248900_21_794 244
671 3300046539 Ga0495621_0027282 Ga0495621_0027282_489_1262 244
672 3300046558 Ga0495633_0052795 Ga0495633_0052795_551_1324 244
673 3300046663 Ga0495635_0091237 Ga0495635_0091237_1001_1774 244
674 3300046674 Ga0495588_0203304 Ga0495588_0203304_157_930 244
675 3300046681 Ga0495647_0022052 Ga0495647_0022052_1018_1791 244
676 3300046683 Ga0495658_0028100 Ga0495658_0028100_159_932 244
677 3300046689 Ga0495613_0180467 Ga0495613_0180467_95_868 244
678 3300046690 Ga0495624_0080796 Ga0495624_0080796_501_1274 244
679 3300046691 Ga0495670_0026303 Ga0495670_0026303_216_989 244
680 3300046691 Ga0495670_0073302 Ga0495670_0073302_909_1682 244
681 3300046692 Ga0495671_0099253 Ga0495671_0099253_519_1292 244
682 3300046694 Ga0495649_0059705 Ga0495649_0059705_81_854 244
683 3300046810 Ga0495660_0153745 Ga0495660_0153745_272_1045 244
684 3300047315 Ga0495581_0108728 Ga0495581_0108728_374_1147 244
685 3300047315 Ga0495581_0112270 Ga0495581_0112270_525_1298 244
686 3300047321 Ga0495676_0054221 Ga0495676_0054221_1294_2067 244
687 3300047321 Ga0495676_0163092 Ga0495676_0163092_474_1247 244
688 3300047322 Ga0495680_0363812 Ga0495680_0363812_64_810 244
689 3300048090 Ga0495615_0020723 Ga0495615_0020723_484_1257 244
690 3300048903 Ga0496100_0009415 Ga0496100_0009415_1797_2570 244
691 3300048903 Ga0496100_0031044 Ga0496100_0031044_143_889 244
692 3300048903 Ga0496100_0188026 Ga0496100_0188026_164_937 244
693 3300048904 Ga0496101_0022566 Ga0496101_0022566_3388_4161 244
694 3300048904 Ga0496101_0066385 Ga0496101_0066385_1671_2444 244
695 3300048905 Ga0496102_0011175 Ga0496102_0011175_1288_2034 244
696 3300048905 Ga0496102_0023656 Ga0496102_0023656_236_1009 244
697 3300048905 Ga0496102_0237816 Ga0496102_0237816_129_902 244
698 3300048906 Ga0496103_0005828 Ga0496103_0005828_3619_4392 244
699 3300048906 Ga0496103_0116401 Ga0496103_0116401_644_1390 244
700 3300048907 Ga0496104_0024353 Ga0496104_0024353_2046_2792 244
701 3300048907 Ga0496104_0039528 Ga0496104_0039528_2697_3470 244
702 3300048908 Ga0496105_0003633 Ga0496105_0003633_951_1724 244
703 3300048908 Ga0496105_0011042 Ga0496105_0011042_2611_3384 244
704 3300048908 Ga0496105_0071620 Ga0496105_0071620_1098_1844 244
705 3300048909 Ga0496106_0031358 Ga0496106_0031358_1391_2164 244
706 3300048909 Ga0496106_0032992 Ga0496106_0032992_1449_2195 244
707 3300048909 Ga0496106_0140463 Ga0496106_0140463_487_1260 244
708 3300048910 Ga0496107_0023629 Ga0496107_0023629_1850_2623 244
709 3300048911 Ga0496108_0000451 Ga0496108_0000451_16156_16929 244
710 3300048911 Ga0496108_0139762 Ga0496108_0139762_320_1066 244
711 3300048912 Ga0496109_0000558 Ga0496109_0000558_3008_3781 244
712 3300048912 Ga0496109_0017610 Ga0496109_0017610_4661_5434 244
713 3300048912 Ga0496109_0041408 Ga0496109_0041408_3102_3848 244
714 3300048913 Ga0496110_0015787 Ga0496110_0015787_1263_2036 244
715 3300048913 Ga0496110_0133773 Ga0496110_0133773_1020_1766 244
716 3300048913 Ga0496110_0315894 Ga0496110_0315894_217_990 244
717 3300048914 Ga0496111_0009095 Ga0496111_0009095_4332_5105 244
718 3300048914 Ga0496111_0085324 Ga0496111_0085324_304_1050 244
719 3300048914 Ga0496111_0144133 Ga0496111_0144133_947_1720 244
720 3300048915 Ga0496112_0133455 Ga0496112_0133455_866_1639 244
721 3300048915 Ga0496112_0148646 Ga0496112_0148646_1226_1999 244
722 3300048915 Ga0496112_0212509 Ga0496112_0212509_1020_1766 244
723 3300048915 Ga0496112_0506737 Ga0496112_0506737_267_1013 244
724 3300048916 Ga0496113_0009879 Ga0496113_0009879_717_1490 244
725 3300048916 Ga0496113_0051554 Ga0496113_0051554_2039_2812 244
726 3300048916 Ga0496113_0254311 Ga0496113_0254311_418_1164 244
727 3300048917 Ga0496114_0019044 Ga0496114_0019044_1391_2164 244
728 3300048918 Ga0496115_0016482 Ga0496115_0016482_174_947 244
729 3300048918 Ga0496115_0023060 Ga0496115_0023060_3945_4718 244
730 3300048918 Ga0496115_0063285 Ga0496115_0063285_129_875 244
731 3300049569 Ga0501032_0021620 Ga0501032_0021620_1151_1897 244
732 3300049569 Ga0501032_0061448 Ga0501032_0061448_217_966 244
733 3300049569 Ga0501032_0168652 Ga0501032_0168652_548_1294 244
734 3300049570 Ga0501033_0046459 Ga0501033_0046459_25_771 244
735 3300049570 Ga0501033_0058986 Ga0501033_0058986_19_765 244
736 3300049570 Ga0501033_0449577 Ga0501033_0449577_49_795 244
737 3300049571 Ga0501034_0121101 Ga0501034_0121101_1440_2186 244
738 3300049571 Ga0501034_0143980 Ga0501034_0143980_1559_2305 244
739 3300049571 Ga0501034_0150356 Ga0501034_0150356_47_796 244
740 3300049571 Ga0501034_0705014 Ga0501034_0705014_105_851 244
741 3300049572 Ga0501036_0019200 Ga0501036_0019200_3601_4350 244
742 3300049572 Ga0501036_0212715 Ga0501036_0212715_192_938 244
743 3300049573 Ga0501037_0051259 Ga0501037_0051259_1860_2609 244
744 3300049574 Ga0501038_0018654 Ga0501038_0018654_2931_3677 244
745 3300049574 Ga0501038_0031994 Ga0501038_0031994_2211_2960 244
746 3300049574 Ga0501038_0157448 Ga0501038_0157448_1035_1781 244
747 3300049574 Ga0501038_0164147 Ga0501038_0164147_1030_1776 244
748 3300049574 Ga0501038_0263084 Ga0501038_0263084_30_776 244
749 3300049575 Ga0501039_0022255 Ga0501039_0022255_1259_2005 244
750 3300049578 Ga0501042_0074867 Ga0501042_0074867_1528_2274 244
751 3300049579 Ga0501043_0011619 Ga0501043_0011619_2475_3224 244
752 3300049579 Ga0501043_0028696 Ga0501043_0028696_1903_2649 244
753 3300049580 Ga0501046_0064616 Ga0501046_0064616_45_794 244
754 3300049581 Ga0501047_0017946 Ga0501047_0017946_2016_2762 244
755 3300049581 Ga0501047_0217832 Ga0501047_0217832_919_1668 244
756 3300049584 Ga0501068_0050038 Ga0501068_0050038_1534_2283 244
757 3300049586 Ga0501070_0004886 Ga0501070_0004886_3588_4334 244
758 3300049586 Ga0501070_0020360 Ga0501070_0020360_759_1505 244
759 3300049586 Ga0501070_0103992 Ga0501070_0103992_188_937 244
760 3300049587 Ga0501071_0019248 Ga0501071_0019248_3190_3936 244
761 3300049588 Ga0501072_0008657 Ga0501072_0008657_3434_4180 244
762 3300049589 Ga0501073_0085148 Ga0501073_0085148_1405_2154 244
763 3300049590 Ga0501074_0276712 Ga0501074_0276712_376_1125 244
764 3300049591 Ga0501075_0036537 Ga0501075_0036537_2056_2802 244
765 3300049741 Ga0501079_0064159 Ga0501079_0064159_1907_2653 244
766 3300049742 Ga0501080_0043954 Ga0501080_0043954_1462_2208 244
767 3300049742 Ga0501080_0058203 Ga0501080_0058203_1212_1961 244
768 3300049742 Ga0501080_0218911 Ga0501080_0218911_381_1127 244
769 3300049743 Ga0501081_0035257 Ga0501081_0035257_244_990 244
770 3300049744 Ga0501083_0193282 Ga0501083_0193282_220_969 244
771 3300049822 Ga0501035_0018143 Ga0501035_0018143_3426_4172 244
772 3300049822 Ga0501035_0086966 Ga0501035_0086966_1908_2657 244
773 3300049823 Ga0501044_0014745 Ga0501044_0014745_4188_4934 244
774 3300049823 Ga0501044_0021198 Ga0501044_0021198_4253_5002 244
775 3300049823 Ga0501044_0101310 Ga0501044_0101310_23_769 244
776 3300049823 Ga0501044_0130947 Ga0501044_0130947_98_844 244
777 3300049823 Ga0501044_0214366 Ga0501044_0214366_705_1451 244
778 3300050492 nmdc:mga0yw44_111229_c1 nmdc:mga0yw44_111229_c1_760_1533 244
779 3300050492 nmdc:mga0yw44_12558_c1 nmdc:mga0yw44_12558_c1_2857_3630 244
780 3300050493 nmdc:mga0k408_213452_c1 nmdc:mga0k408_213452_c1_31_804 244
781 3300050494 nmdc:mga06z11_44377_c1 nmdc:mga06z11_44377_c1_608_1354 244
782 3300050496 nmdc:mga07m45_210203_c1 nmdc:mga07m45_210203_c1_21_794 244
783 3300050507 nmdc:mga05p37_15155_c1 nmdc:mga05p37_15155_c1_7299_8045 244
784 3300050507 nmdc:mga05p37_15592_c1 nmdc:mga05p37_15592_c1_7592_8365 244
785 3300050508 nmdc:mga09592_347349_c1 nmdc:mga09592_347349_c1_16_789 244
786 3300050510 nmdc:mga06r32_236994_c1 nmdc:mga06r32_236994_c1_555_1328 244
787 3300050511 nmdc:mga08y16_211963_c1 nmdc:mga08y16_211963_c1_176_949 244
788 3300050512 nmdc:mga0n895_56085_c1 nmdc:mga0n895_56085_c1_48_821 244
789 3300053077 Ga0495601_0057707 Ga0495601_0057707_1218_1991 244
790 3300053084 Ga0495595_0086540 Ga0495595_0086540_730_1476 244
791 3300053085 Ga0495619_0120537 Ga0495619_0120537_406_1152 244
792 3300054114 Ga0501084_0593749 Ga0501084_0593749_154_900 244
793 3300060353 Ga0501082_0238226 Ga0501082_0238226_62_811 244
794 3300060353 Ga0501082_0525482 Ga0501082_0525482_64_810 244
795 3300061734 Ga0530510_0090885 Ga0530510_0090885_741_1487 244
796 3300005471 Ga0070698_100671425 Ga0070698_1006714252 245
797 3300005549 Ga0070704_100055201 Ga0070704_1000552012 245
798 3300005937 Ga0081455_10089463 Ga0081455_100894632 245
799 3300005983 Ga0081540_1054487 Ga0081540_10544873 245
800 3300006844 Ga0075428_100367630 Ga0075428_1003676302 245
801 3300006846 Ga0075430_100000164 Ga0075430_1000001649 245
802 3300006847 Ga0075431_100033662 Ga0075431_1000336623 245
803 3300009553 Ga0105249_10454875 Ga0105249_104548752 245
804 3300025961 Ga0207712_10170495 Ga0207712_101704952 245
805 3300035241 Ga0373961_0032870 Ga0373961_0032870_685_1434 245
806 3300035241 Ga0373961_0094157 Ga0373961_0094157_102_851 245
807 3300035691 Ga0373931_0206935 Ga0373931_0206935_73_822 245
808 3300039437 Ga0436365_1626279 Ga0436365_1626279_951_1706 245
809 3300048905 Ga0496102_0510332 Ga0496102_0510332_201_956 245
810 3300048907 Ga0496104_0001003 Ga0496104_0001003_5204_5953 245
811 3300048907 Ga0496104_0003063 Ga0496104_0003063_5770_6519 245
812 3300048908 Ga0496105_0023493 Ga0496105_0023493_3458_4207 245
813 3300048908 Ga0496105_0168330 Ga0496105_0168330_504_1253 245
814 3300048909 Ga0496106_0065475 Ga0496106_0065475_134_883 245
815 3300048911 Ga0496108_0079249 Ga0496108_0079249_753_1502 245
816 3300048912 Ga0496109_0242824 Ga0496109_0242824_340_1089 245
817 3300048918 Ga0496115_0008727 Ga0496115_0008727_2953_3702 245
818 3300048918 Ga0496115_0028405 Ga0496115_0028405_2981_3730 245
819 3300048928 Ga0496125_0000099 Ga0496125_0000099_97647_98396 245
820 3300048929 Ga0496126_0085476 Ga0496126_0085476_567_1316 245
821 3300049571 Ga0501034_0355461 Ga0501034_0355461_355_1170 245
822 3300049573 Ga0501037_0143591 Ga0501037_0143591_56_811 245
823 3300050509 nmdc:mga0qj67_129757_c1 nmdc:mga0qj67_129757_c1_104_853 245
824 3300050509 nmdc:mga0qj67_23_c1 nmdc:mga0qj67_23_c1_34941_35693 245
825 3300050510 nmdc:mga06r32_114845_c1 nmdc:mga06r32_114845_c1_1054_1803 245
826 3300060353 Ga0501082_0144600 Ga0501082_0144600_643_1398 245
827 3300021388 Ga0213875_10070888 Ga0213875_100708881 246
828 3300028653 Ga0265323_10066299 Ga0265323_100662992 246
829 3300028666 Ga0265336_10000395 Ga0265336_1000039524 246
830 3300028800 Ga0265338_10000018 Ga0265338_10000018265 246
831 3300036401 Ga0373937_0863660 Ga0373937_0863660_27_785 246
832 3300037853 Ga0436364_0683264 Ga0436364_0683264_3565_4356 246
833 3300039437 Ga0436365_0367024 Ga0436365_0367024_46_837 246
834 3300039450 Ga0436363_1646089 Ga0436363_1646089_390_1142 246
835 3300048913 Ga0496110_0017400 Ga0496110_0017400_575_1342 246
836 3300048924 Ga0496121_0002110 Ga0496121_0002110_9665_10420 246
837 3300048929 Ga0496126_0031408 Ga0496126_0031408_1041_1796 246
838 3300053178 Ga0500637_0213287 Ga0500637_0213287_326_1078 246
839 iso_pu_bacteria 2513237098 2513672531 246
840 iso_pu_bacteria 2524023210 2524466685 246
841 iso_pu_bacteria 2903768456 2903775927 246
842 iso_pu_bacteria 2922386360 2922391546 246
843 iso_pu_bacteria 8056681323 8056685485 246
844 3300002077 JGI24744J21845_10016883 JGI24744J21845_100168832 247
845 3300003203 JGI25406J46586_10002008 JGI25406J46586_1000200811 247
846 3300003215 JGI25153J46596_10013220 JGI25153J46596_100132203 247
847 3300005329 Ga0070683_100652076 Ga0070683_1006520762 247
848 3300005336 Ga0070680_100264188 Ga0070680_1002641882 247
849 3300005338 Ga0068868_100509881 Ga0068868_1005098812 247
850 3300005344 Ga0070661_100229369 Ga0070661_1002293693 247
851 3300005344 Ga0070661_100259604 Ga0070661_1002596042 247
852 3300005347 Ga0070668_100155491 Ga0070668_1001554912 247
853 3300005356 Ga0070674_100212106 Ga0070674_1002121061 247
854 3300005434 Ga0070709_10035409 Ga0070709_100354094 247
855 3300005434 Ga0070709_10365416 Ga0070709_103654162 247
856 3300005435 Ga0070714_100431304 Ga0070714_1004313042 247
857 3300005436 Ga0070713_100037805 Ga0070713_1000378052 247
858 3300005436 Ga0070713_100421166 Ga0070713_1004211661 247
859 3300005455 Ga0070663_100078596 Ga0070663_1000785962 247
860 3300005456 Ga0070678_100816699 Ga0070678_1008166991 247
861 3300005458 Ga0070681_10073742 Ga0070681_100737422 247
862 3300005458 Ga0070681_10093747 Ga0070681_100937473 247
863 3300005458 Ga0070681_10130798 Ga0070681_101307983 247
864 3300005459 Ga0068867_100398096 Ga0068867_1003980962 247
865 3300005530 Ga0070679_100119920 Ga0070679_1001199201 247
866 3300005535 Ga0070684_100148121 Ga0070684_1001481211 247
867 3300005535 Ga0070684_100212676 Ga0070684_1002126761 247
868 3300005539 Ga0068853_100223183 Ga0068853_1002231832 247
869 3300005539 Ga0068853_100427623 Ga0068853_1004276232 247
870 3300005543 Ga0070672_100229123 Ga0070672_1002291232 247
871 3300005547 Ga0070693_100050777 Ga0070693_1000507773 247
872 3300005548 Ga0070665_100100848 Ga0070665_1001008483 247
873 3300005548 Ga0070665_100133374 Ga0070665_1001333743 247
874 3300005563 Ga0068855_100136451 Ga0068855_1001364514 247
875 3300005563 Ga0068855_100187013 Ga0068855_1001870133 247
876 3300005563 Ga0068855_100400596 Ga0068855_1004005962 247
877 3300005577 Ga0068857_100316031 Ga0068857_1003160312 247
878 3300005718 Ga0068866_10155194 Ga0068866_101551942 247
879 3300005719 Ga0068861_100741690 Ga0068861_1007416901 247
880 3300005843 Ga0068860_100734013 Ga0068860_1007340132 247
881 3300005937 Ga0081455_10029463 Ga0081455_100294633 247
882 3300005937 Ga0081455_10050468 Ga0081455_100504683 247
883 3300005937 Ga0081455_10086007 Ga0081455_100860071 247
884 3300005937 Ga0081455_10188683 Ga0081455_101886833 247
885 3300005981 Ga0081538_10009993 Ga0081538_100099938 247
886 3300005983 Ga0081540_1010271 Ga0081540_10102719 247
887 3300005983 Ga0081540_1062738 Ga0081540_10627382 247
888 3300005985 Ga0081539_10001098 Ga0081539_1000109815 247
889 3300005985 Ga0081539_10033511 Ga0081539_100335113 247
890 3300005985 Ga0081539_10048626 Ga0081539_100486263 247
891 3300006028 Ga0070717_10261306 Ga0070717_102613062 247
892 3300006038 Ga0075365_10029444 Ga0075365_100294442 247
893 3300006038 Ga0075365_10074576 Ga0075365_100745761 247
894 3300006048 Ga0075363_100004089 Ga0075363_1000040898 247
895 3300006051 Ga0075364_10130779 Ga0075364_101307791 247
896 3300006175 Ga0070712_100200928 Ga0070712_1002009282 247
897 3300006178 Ga0075367_10082992 Ga0075367_100829924 247
898 3300006186 Ga0075369_10045879 Ga0075369_100458792 247
899 3300006237 Ga0097621_100276690 Ga0097621_1002766902 247
900 3300006353 Ga0075370_10009275 Ga0075370_100092758 247
901 3300006844 Ga0075428_100014624 Ga0075428_1000146247 247
902 3300006844 Ga0075428_100158933 Ga0075428_1001589332 247
903 3300006844 Ga0075428_100421291 Ga0075428_1004212912 247
904 3300006846 Ga0075430_100184701 Ga0075430_1001847013 247
905 3300006847 Ga0075431_100073601 Ga0075431_1000736014 247
906 3300006871 Ga0075434_100013700 Ga0075434_1000137007 247
907 3300006881 Ga0068865_100712750 Ga0068865_1007127502 247
908 3300006914 Ga0075436_100037967 Ga0075436_1000379672 247
909 3300006942 Ga0099824_1008875 Ga0099824_100887513 247
910 3300006943 Ga0099822_1017500 Ga0099822_10175005 247
911 3300009093 Ga0105240_10019788 Ga0105240_100197887 247
912 3300009093 Ga0105240_10154772 Ga0105240_101547722 247
913 3300009093 Ga0105240_10488420 Ga0105240_104884201 247
914 3300009101 Ga0105247_10079666 Ga0105247_100796662 247
915 3300009147 Ga0114129_10136649 Ga0114129_101366494 247
916 3300009147 Ga0114129_10290517 Ga0114129_102905173 247
917 3300009147 Ga0114129_10620096 Ga0114129_106200962 247
918 3300009545 Ga0105237_10154163 Ga0105237_101541633 247
919 3300009545 Ga0105237_10751541 Ga0105237_107515412 247
920 3300009553 Ga0105249_10297898 Ga0105249_102978982 247
921 3300013104 Ga0157370_10133092 Ga0157370_101330923 247
922 3300013105 Ga0157369_10004497 Ga0157369_100044973 247
923 3300013105 Ga0157369_10139055 Ga0157369_101390552 247
924 3300013105 Ga0157369_10150184 Ga0157369_101501842 247
925 3300013307 Ga0157372_10101997 Ga0157372_101019972 247
926 3300013308 Ga0157375_10196062 Ga0157375_101960622 247
927 3300014325 Ga0163163_10206104 Ga0163163_102061043 247
928 3300020070 Ga0206356_10905645 Ga0206356_109056452 247
929 3300020082 Ga0206353_10627821 Ga0206353_106278212 247
930 3300021384 Ga0213876_10097578 Ga0213876_100975782 247
931 3300025261 Ga0209233_1009216 Ga0209233_10092165 247
932 3300025297 Ga0209758_1006390 Ga0209758_10063908 247
933 3300025898 Ga0207692_10007186 Ga0207692_100071865 247
934 3300025899 Ga0207642_10024442 Ga0207642_100244423 247
935 3300025900 Ga0207710_10076141 Ga0207710_100761412 247
936 3300025905 Ga0207685_10081022 Ga0207685_100810221 247
937 3300025906 Ga0207699_10003881 Ga0207699_100038816 247
938 3300025907 Ga0207645_10190813 Ga0207645_101908132 247
939 3300025908 Ga0207643_10027690 Ga0207643_100276901 247
940 3300025909 Ga0207705_10164151 Ga0207705_101641512 247
941 3300025911 Ga0207654_10077069 Ga0207654_100770692 247
942 3300025912 Ga0207707_10012323 Ga0207707_100123237 247
943 3300025912 Ga0207707_10203347 Ga0207707_102033472 247
944 3300025913 Ga0207695_10010535 Ga0207695_100105352 247
945 3300025913 Ga0207695_10268122 Ga0207695_102681222 247
946 3300025914 Ga0207671_10036138 Ga0207671_100361383 247
947 3300025914 Ga0207671_10213050 Ga0207671_102130502 247
948 3300025915 Ga0207693_10099279 Ga0207693_100992794 247
949 3300025916 Ga0207663_10096743 Ga0207663_100967432 247
950 3300025917 Ga0207660_10047951 Ga0207660_100479512 247
951 3300025920 Ga0207649_10458083 Ga0207649_104580831 247
952 3300025924 Ga0207694_10150520 Ga0207694_101505203 247
953 3300025927 Ga0207687_10082377 Ga0207687_100823772 247
954 3300025928 Ga0207700_10138152 Ga0207700_101381522 247
955 3300025929 Ga0207664_10475437 Ga0207664_104754371 247
956 3300025937 Ga0207669_10121807 Ga0207669_101218072 247
957 3300025937 Ga0207669_10272921 Ga0207669_102729212 247
958 3300025938 Ga0207704_10267289 Ga0207704_102672892 247
959 3300025940 Ga0207691_10121514 Ga0207691_101215142 247
960 3300025941 Ga0207711_10344799 Ga0207711_103447991 247
961 3300025944 Ga0207661_10000171 Ga0207661_1000017137 247
962 3300025944 Ga0207661_10068266 Ga0207661_100682662 247
963 3300025944 Ga0207661_10539116 Ga0207661_105391162 247
964 3300025949 Ga0207667_10194588 Ga0207667_101945883 247
965 3300025972 Ga0207668_10058189 Ga0207668_100581893 247
966 3300025972 Ga0207668_10280394 Ga0207668_102803942 247
967 3300025981 Ga0207640_10033307 Ga0207640_100333073 247
968 3300026023 Ga0207677_10530235 Ga0207677_105302352 247
969 3300026035 Ga0207703_10184364 Ga0207703_101843642 247
970 3300026041 Ga0207639_10195435 Ga0207639_101954353 247
971 3300026041 Ga0207639_10321210 Ga0207639_103212102 247
972 3300026067 Ga0207678_10046631 Ga0207678_100466317 247
973 3300026067 Ga0207678_10065486 Ga0207678_100654862 247
974 3300026075 Ga0207708_10124482 Ga0207708_101244822 247
975 3300026089 Ga0207648_10023386 Ga0207648_100233862 247
976 3300026095 Ga0207676_10299903 Ga0207676_102999032 247
977 3300026118 Ga0207675_100094270 Ga0207675_1000942703 247
978 3300026118 Ga0207675_100441847 Ga0207675_1004418471 247
979 3300026121 Ga0207683_10068467 Ga0207683_100684675 247
980 3300027357 Ga0209589_1000005 Ga0209589_1000005305 247
981 3300027361 Ga0209489_100005 Ga0209489_100005305 247
982 3300027363 Ga0209700_100006 Ga0209700_100006305 247
983 3300028379 Ga0268266_10001796 Ga0268266_100017962 247
984 3300028379 Ga0268266_10112766 Ga0268266_101127663 247
985 3300028379 Ga0268266_10345632 Ga0268266_103456322 247
986 3300028380 Ga0268265_10150239 Ga0268265_101502392 247
987 3300028381 Ga0268264_10613067 Ga0268264_106130672 247
988 3300031249 Ga0265339_10004193 Ga0265339_1000419311 247
989 3300031456 Ga0307513_10241889 Ga0307513_102418893 247
990 3300031548 Ga0307408_100347141 Ga0307408_1003471412 247
991 3300031824 Ga0307413_10470885 Ga0307413_104708852 247
992 3300031911 Ga0307412_10330180 Ga0307412_103301802 247
993 3300032002 Ga0307416_100136965 Ga0307416_1001369653 247
994 3300032002 Ga0307416_100542162 Ga0307416_1005421622 247
995 3300032004 Ga0307414_10327110 Ga0307414_103271102 247
996 3300032126 Ga0307415_100340651 Ga0307415_1003406511 247
997 3300033442 Ga0315911_1000005 Ga0315911_1000005267 247
998 3300035111 Ga0373923_0082082 Ga0373923_0082082_105_872 247
999 3300035118 Ga0373954_0086208 Ga0373954_0086208_642_1409 247
1000 3300035120 Ga0373957_0070135 Ga0373957_0070135_352_1119 247
1001 3300035171 Ga0373946_0044695 Ga0373946_0044695_943_1710 247
1002 3300035172 Ga0373955_0253440 Ga0373955_0253440_241_1008 247
1003 3300035410 Ga0373924_0156750 Ga0373924_0156750_17_784 247
1004 3300036401 Ga0373937_0145999 Ga0373937_0145999_1386_2153 247
1005 3300037068 Ga0373925_0016628 Ga0373925_0016628_1166_1933 247
1006 3300037068 Ga0373925_0270426 Ga0373925_0270426_423_1178 247
1007 3300037418 Ga0395900_0011126 Ga0395900_0011126_6374_7129 247
1008 3300037418 Ga0395900_0132135 Ga0395900_0132135_684_1439 247
1009 3300037471 Ga0395905_0060003 Ga0395905_0060003_2672_3427 247
1010 3300037853 Ga0436364_0538474 Ga0436364_0538474_104_865 247
1011 3300037853 Ga0436364_1040387 Ga0436364_1040387_375_1130 247
1012 3300038443 Ga0395901_0092860 Ga0395901_0092860_1860_2615 247
1013 3300038443 Ga0395901_0464498 Ga0395901_0464498_472_1224 247
1014 3300038443 Ga0395901_0667611 Ga0395901_0667611_161_913 247
1015 3300039437 Ga0436365_1294996 Ga0436365_1294996_588_1355 247
1016 3300039437 Ga0436365_1860176 Ga0436365_1860176_1568_2323 247
1017 3300044684 Ga0466966_0084873 Ga0466966_0084873_265_1020 247
1018 3300044719 Ga0466971_0022633 Ga0466971_0022633_1253_2044 247
1019 3300044765 Ga0466970_0214017 Ga0466970_0214017_164_919 247
1020 3300045049 Ga0466959_0061808 Ga0466959_0061808_1380_2135 247
1021 3300045049 Ga0466959_0180583 Ga0466959_0180583_396_1151 247
1022 3300045976 Ga0466967_0060568 Ga0466967_0060568_2479_3234 247
1023 3300046455 Ga0495603_0234644 Ga0495603_0234644_229_996 247
1024 3300046459 Ga0495629_0126087 Ga0495629_0126087_813_1580 247
1025 3300046472 Ga0495580_0022914 Ga0495580_0022914_878_1645 247
1026 3300046473 Ga0495582_0069661 Ga0495582_0069661_233_1000 247
1027 3300046476 Ga0495662_0122774 Ga0495662_0122774_264_1031 247
1028 3300046516 Ga0495628_0159842 Ga0495628_0159842_386_1153 247
1029 3300046529 Ga0495652_0165642 Ga0495652_0165642_207_974 247
1030 3300046531 Ga0495665_0030220 Ga0495665_0030220_1434_2201 247
1031 3300046533 Ga0495640_0015032 Ga0495640_0015032_2371_3138 247
1032 3300046543 Ga0495645_0007861 Ga0495645_0007861_5778_6572 247
1033 3300046543 Ga0495645_0233748 Ga0495645_0233748_128_895 247
1034 3300046615 Ga0495656_0066339 Ga0495656_0066339_86_862 247
1035 3300046642 Ga0495634_0076735 Ga0495634_0076735_986_1753 247
1036 3300046663 Ga0495635_0071599 Ga0495635_0071599_444_1211 247
1037 3300046674 Ga0495588_0154998 Ga0495588_0154998_145_912 247
1038 3300046680 Ga0495646_0019263 Ga0495646_0019263_2628_3395 247
1039 3300046681 Ga0495647_0021787 Ga0495647_0021787_1166_1933 247
1040 3300046683 Ga0495658_0263350 Ga0495658_0263350_306_1073 247
1041 3300046689 Ga0495613_0376692 Ga0495613_0376692_189_956 247
1042 3300046690 Ga0495624_0072967 Ga0495624_0072967_202_969 247
1043 3300046691 Ga0495670_0084771 Ga0495670_0084771_609_1385 247
1044 3300046794 Ga0495589_0124507 Ga0495589_0124507_241_1017 247
1045 3300047315 Ga0495581_0015392 Ga0495581_0015392_1972_2739 247
1046 3300047320 Ga0495672_0008564 Ga0495672_0008564_5666_6421 247
1047 3300047321 Ga0495676_0313940 Ga0495676_0313940_189_956 247
1048 3300047322 Ga0495680_0191135 Ga0495680_0191135_492_1259 247
1049 3300047471 Ga0495684_0057921 Ga0495684_0057921_1824_2591 247
1050 3300048904 Ga0496101_0069596 Ga0496101_0069596_219_995 247
1051 3300048904 Ga0496101_0386775 Ga0496101_0386775_262_1017 247
1052 3300048905 Ga0496102_0075347 Ga0496102_0075347_1546_2322 247
1053 3300048907 Ga0496104_0466441 Ga0496104_0466441_61_816 247
1054 3300048909 Ga0496106_0329177 Ga0496106_0329177_251_1006 247
1055 3300048910 Ga0496107_0248572 Ga0496107_0248572_182_937 247
1056 3300048915 Ga0496112_0183184 Ga0496112_0183184_1254_2009 247
1057 3300048917 Ga0496114_0181427 Ga0496114_0181427_919_1674 247
1058 3300048917 Ga0496114_0326089 Ga0496114_0326089_375_1151 247
1059 3300048921 Ga0496118_0040425 Ga0496118_0040425_1771_2526 247
1060 3300048921 Ga0496118_0241504 Ga0496118_0241504_262_1014 247
1061 3300048922 Ga0496119_0103754 Ga0496119_0103754_764_1519 247
1062 3300048924 Ga0496121_0001525 Ga0496121_0001525_23562_24317 247
1063 3300048924 Ga0496121_0163058 Ga0496121_0163058_592_1347 247
1064 3300048928 Ga0496125_0168760 Ga0496125_0168760_136_927 247
1065 3300048929 Ga0496126_0017576 Ga0496126_0017576_3674_4429 247
1066 3300048929 Ga0496126_0023009 Ga0496126_0023009_4481_5236 247
1067 3300048929 Ga0496126_0063569 Ga0496126_0063569_735_1490 247
1068 3300049568 Ga0501031_0090108 Ga0501031_0090108_479_1234 247
1069 3300049569 Ga0501032_0011869 Ga0501032_0011869_2805_3560 247
1070 3300049569 Ga0501032_0096865 Ga0501032_0096865_760_1515 247
1071 3300049570 Ga0501033_0002836 Ga0501033_0002836_1607_2362 247
1072 3300049571 Ga0501034_0134173 Ga0501034_0134173_1155_1910 247
1073 3300049571 Ga0501034_0171302 Ga0501034_0171302_215_976 247
1074 3300049572 Ga0501036_0019549 Ga0501036_0019549_2358_3113 247
1075 3300049572 Ga0501036_0048441 Ga0501036_0048441_547_1302 247
1076 3300049573 Ga0501037_0003537 Ga0501037_0003537_9816_10571 247
1077 3300049573 Ga0501037_0046499 Ga0501037_0046499_11_766 247
1078 3300049573 Ga0501037_0267946 Ga0501037_0267946_389_1144 247
1079 3300049574 Ga0501038_0006198 Ga0501038_0006198_3292_4047 247
1080 3300049574 Ga0501038_0023039 Ga0501038_0023039_2204_2959 247
1081 3300049574 Ga0501038_0081945 Ga0501038_0081945_1214_1969 247
1082 3300049574 Ga0501038_0091798 Ga0501038_0091798_744_1499 247
1083 3300049574 Ga0501038_0120997 Ga0501038_0120997_820_1581 247
1084 3300049575 Ga0501039_0274388 Ga0501039_0274388_215_970 247
1085 3300049577 Ga0501041_0076713 Ga0501041_0076713_878_1633 247
1086 3300049578 Ga0501042_0010994 Ga0501042_0010994_2797_3552 247
1087 3300049578 Ga0501042_0012503 Ga0501042_0012503_1046_1801 247
1088 3300049579 Ga0501043_0011558 Ga0501043_0011558_272_1027 247
1089 3300049579 Ga0501043_0011717 Ga0501043_0011717_4009_4764 247
1090 3300049580 Ga0501046_0138831 Ga0501046_0138831_1051_1806 247
1091 3300049581 Ga0501047_0097423 Ga0501047_0097423_1248_2003 247
1092 3300049581 Ga0501047_0130507 Ga0501047_0130507_1243_2004 247
1093 3300049581 Ga0501047_0532842 Ga0501047_0532842_83_838 247
1094 3300049583 Ga0501067_0060855 Ga0501067_0060855_92_847 247
1095 3300049584 Ga0501068_0054407 Ga0501068_0054407_1588_2343 247
1096 3300049584 Ga0501068_0207663 Ga0501068_0207663_448_1203 247
1097 3300049585 Ga0501069_0013979 Ga0501069_0013979_2835_3590 247
1098 3300049587 Ga0501071_0057430 Ga0501071_0057430_263_1018 247
1099 3300049588 Ga0501072_0052098 Ga0501072_0052098_577_1332 247
1100 3300049589 Ga0501073_0043909 Ga0501073_0043909_2296_3051 247
1101 3300049590 Ga0501074_0034612 Ga0501074_0034612_623_1378 247
1102 3300049741 Ga0501079_0066273 Ga0501079_0066273_1495_2250 247
1103 3300049741 Ga0501079_0297363 Ga0501079_0297363_482_1237 247
1104 3300049742 Ga0501080_0280095 Ga0501080_0280095_479_1234 247
1105 3300049822 Ga0501035_0020783 Ga0501035_0020783_3654_4409 247
1106 3300049822 Ga0501035_0049633 Ga0501035_0049633_1738_2499 247
1107 3300049822 Ga0501035_0241991 Ga0501035_0241991_475_1230 247
1108 3300049822 Ga0501035_0334296 Ga0501035_0334296_483_1238 247
1109 3300049823 Ga0501044_0039939 Ga0501044_0039939_1779_2534 247
1110 3300049823 Ga0501044_0353299 Ga0501044_0353299_387_1148 247
1111 3300049824 Ga0501045_0295435 Ga0501045_0295435_181_936 247
1112 3300050489 nmdc:mga03683_90099_c1 nmdc:mga03683_90099_c1_105_860 247
1113 3300050490 nmdc:mga03n38_1503_c1 nmdc:mga03n38_1503_c1_2317_3072 247
1114 3300050491 nmdc:mga00v17_40834_c1 nmdc:mga00v17_40834_c1_734_1534 247
1115 3300050492 nmdc:mga0yw44_13089_c1 nmdc:mga0yw44_13089_c1_2032_2832 247
1116 3300050492 nmdc:mga0yw44_67357_c1 nmdc:mga0yw44_67357_c1_317_1072 247
1117 3300050492 nmdc:mga0yw44_89468_c1 nmdc:mga0yw44_89468_c1_672_1427 247
1118 3300050493 nmdc:mga0k408_319818_c1 nmdc:mga0k408_319818_c1_148_903 247
1119 3300050494 nmdc:mga06z11_7051_c1 nmdc:mga06z11_7051_c1_3243_3998 247
1120 3300050496 nmdc:mga07m45_8008_c2 nmdc:mga07m45_8008_c2_1687_2442 247
1121 3300050507 nmdc:mga05p37_43733_c1 nmdc:mga05p37_43733_c1_2611_3405 247
1122 3300050509 nmdc:mga0qj67_174206_c1 nmdc:mga0qj67_174206_c1_803_1603 247
1123 3300050510 nmdc:mga06r32_180066_c1 nmdc:mga06r32_180066_c1_361_1155 247
1124 3300050511 nmdc:mga08y16_739151_c1 nmdc:mga08y16_739151_c1_167_922 247
1125 3300050514 nmdc:mga08x19_50181_c1 nmdc:mga08x19_50181_c1_1047_1901 247
1126 3300050516 nmdc:mga0sz30_243354_c1 nmdc:mga0sz30_243354_c1_13_768 247
1127 3300053077 Ga0495601_0039057 Ga0495601_0039057_233_1000 247
1128 3300053078 Ga0495612_0027882 Ga0495612_0027882_861_1655 247
1129 3300053078 Ga0495612_0036305 Ga0495612_0036305_381_1148 247
1130 3300053083 Ga0495655_0078535 Ga0495655_0078535_17_772 247
1131 3300054114 Ga0501084_0156725 Ga0501084_0156725_236_991 247
1132 3300054114 Ga0501084_0237414 Ga0501084_0237414_334_1089 247
1133 3300061734 Ga0530510_0239313 Ga0530510_0239313_167_922 247
1134 iso_pu_bacteria 2508501128 2509146536 247
1135 iso_pu_bacteria 2513237096 2513655382 247
1136 iso_pu_bacteria 2513237102 2513702471 247
1137 iso_pu_bacteria 2513237104 2513716787 247
1138 iso_pu_bacteria 2513237137 2513860054 247
1139 iso_pu_bacteria 2513237145 2513916540 247
1140 iso_pu_bacteria 2517572143 2517889869 247
1141 iso_pu_bacteria 2524023228 2524532943 247
1142 iso_pu_bacteria 2643221651 2644290242 247
1143 iso_pu_bacteria 2667528175 2671121107 247
1144 iso_pu_bacteria 2728368998 2728751736 247
1145 iso_pu_bacteria 2791355197 2793073401 247
1146 iso_pu_bacteria 2824617872 2824618912 247
1147 iso_pu_bacteria 2824626560 2824632928 247
1148 iso_pu_bacteria 2824635225 2824642627 247
1149 iso_pu_bacteria 2824644064 2824650875 247
1150 iso_pu_bacteria 2824714736 2824720727 247
1151 iso_pu_bacteria 2824723954 2824730671 247
1152 iso_pu_bacteria 2844315083 2844321368 247
1153 iso_pu_bacteria 2881364244 2881367755 247
1154 iso_pu_bacteria 2903727486 2903731442 247
1155 iso_pu_bacteria 2903748898 2903749011 247
1156 iso_pu_bacteria 2904690495 2904692694 247
1157 iso_pu_bacteria 2904699407 2904711210 247
1158 iso_pu_bacteria 2906602504 2906607982 247
1159 iso_pu_bacteria 2906610324 2906612394 247
1160 iso_pu_bacteria 2906635258 2906637846 247
1161 iso_pu_bacteria 2906660503 2906663435 247
1162 iso_pu_bacteria 2908756301 2908757666 247
1163 iso_pu_bacteria 2922425934 2922426899 247
1164 iso_pu_bacteria 2935630451 2935633060 247
1165 iso_pu_bacteria 2941507105 2941509638 247
1166 iso_pu_bacteria 2941515067 2941517467 247
1167 iso_pu_bacteria 2941523033 2941526580 247
1168 iso_pu_bacteria 3005483717 3005485976 247
1169 iso_pu_bacteria 3005587118 3005591798 247
1170 iso_pu_bacteria 3005594810 3005601720 247
1171 iso_pu_bacteria 8006933436 8006937398 247
1172 iso_pu_bacteria 8006973647 8006977427 247
1173 iso_pu_bacteria 8019555841 8019561228 247
1174 iso_pu_bacteria 8019565922 8019571318 247
1175 iso_pu_bacteria 8056673599 8056678903 247
1176 iso_pu_bacteria 8056689827 8056692023 247
1177 iso_pu_bacteria 8056967851 8056971817 247
1178 3300001989 JGI24739J22299_10004386 JGI24739J22299_100043863 248
1179 3300001990 JGI24737J22298_10036272 JGI24737J22298_100362722 248
1180 3300002067 JGI24735J21928_10043583 JGI24735J21928_100435832 248
1181 3300003203 JGI25406J46586_10000123 JGI25406J46586_1000012324 248
1182 3300003659 JGI25404J52841_10006783 JGI25404J52841_100067833 248
1183 3300003659 JGI25404J52841_10029708 JGI25404J52841_100297082 248
1184 3300005262 Ga0065165_1077181 Ga0065165_10771811 248
1185 3300005335 Ga0070666_10066295 Ga0070666_100662952 248
1186 3300005336 Ga0070680_100287855 Ga0070680_1002878552 248
1187 3300005344 Ga0070661_100076325 Ga0070661_1000763251 248
1188 3300005347 Ga0070668_100277548 Ga0070668_1002775481 248
1189 3300005354 Ga0070675_100267317 Ga0070675_1002673172 248
1190 3300005354 Ga0070675_100373682 Ga0070675_1003736821 248
1191 3300005364 Ga0070673_100386636 Ga0070673_1003866362 248
1192 3300005434 Ga0070709_10003714 Ga0070709_100037148 248
1193 3300005434 Ga0070709_10010860 Ga0070709_100108606 248
1194 3300005434 Ga0070709_10016287 Ga0070709_100162872 248
1195 3300005434 Ga0070709_10385356 Ga0070709_103853561 248
1196 3300005435 Ga0070714_100004426 Ga0070714_1000044269 248
1197 3300005435 Ga0070714_100019687 Ga0070714_1000196871 248
1198 3300005435 Ga0070714_100134438 Ga0070714_1001344381 248
1199 3300005435 Ga0070714_100192220 Ga0070714_1001922202 248
1200 3300005435 Ga0070714_100361523 Ga0070714_1003615232 248
1201 3300005436 Ga0070713_100004454 Ga0070713_1000044543 248
1202 3300005436 Ga0070713_100090424 Ga0070713_1000904244 248
1203 3300005436 Ga0070713_100681252 Ga0070713_1006812521 248
1204 3300005437 Ga0070710_10004296 Ga0070710_100042962 248
1205 3300005437 Ga0070710_10007859 Ga0070710_100078596 248
1206 3300005439 Ga0070711_100013653 Ga0070711_1000136533 248
1207 3300005439 Ga0070711_100079146 Ga0070711_1000791463 248
1208 3300005439 Ga0070711_100648559 Ga0070711_1006485591 248
1209 3300005455 Ga0070663_100084289 Ga0070663_1000842893 248
1210 3300005455 Ga0070663_100124267 Ga0070663_1001242672 248
1211 3300005456 Ga0070678_100172924 Ga0070678_1001729243 248
1212 3300005458 Ga0070681_10008600 Ga0070681_100086002 248
1213 3300005471 Ga0070698_100495937 Ga0070698_1004959372 248
1214 3300005518 Ga0070699_100004951 Ga0070699_10000495112 248
1215 3300005530 Ga0070679_100012111 Ga0070679_1000121115 248
1216 3300005530 Ga0070679_100422188 Ga0070679_1004221882 248
1217 3300005536 Ga0070697_100026984 Ga0070697_1000269844 248
1218 3300005536 Ga0070697_100460557 Ga0070697_1004605572 248
1219 3300005539 Ga0068853_100026288 Ga0068853_1000262883 248
1220 3300005539 Ga0068853_100049178 Ga0068853_1000491783 248
1221 3300005539 Ga0068853_100089098 Ga0068853_1000890985 248
1222 3300005546 Ga0070696_100290547 Ga0070696_1002905471 248
1223 3300005547 Ga0070693_100363524 Ga0070693_1003635241 248
1224 3300005563 Ga0068855_100125468 Ga0068855_1001254684 248
1225 3300005563 Ga0068855_100148989 Ga0068855_1001489896 248
1226 3300005563 Ga0068855_100442924 Ga0068855_1004429242 248
1227 3300005563 Ga0068855_100866528 Ga0068855_1008665282 248
1228 3300005564 Ga0070664_100311239 Ga0070664_1003112392 248
1229 3300005577 Ga0068857_100123071 Ga0068857_1001230713 248
1230 3300005578 Ga0068854_100008298 Ga0068854_1000082986 248
1231 3300005578 Ga0068854_100017829 Ga0068854_1000178293 248
1232 3300005614 Ga0068856_100006410 Ga0068856_1000064104 248
1233 3300005614 Ga0068856_100019463 Ga0068856_1000194636 248
1234 3300005614 Ga0068856_100077437 Ga0068856_1000774374 248
1235 3300005614 Ga0068856_100097345 Ga0068856_1000973453 248
1236 3300005614 Ga0068856_100492401 Ga0068856_1004924012 248
1237 3300005616 Ga0068852_100016237 Ga0068852_1000162376 248
1238 3300005616 Ga0068852_100260370 Ga0068852_1002603702 248
1239 3300005616 Ga0068852_100708737 Ga0068852_1007087372 248
1240 3300005617 Ga0068859_100178426 Ga0068859_1001784262 248
1241 3300005617 Ga0068859_100316000 Ga0068859_1003160004 248
1242 3300005617 Ga0068859_100757730 Ga0068859_1007577301 248
1243 3300005618 Ga0068864_100193359 Ga0068864_1001933592 248
1244 3300005618 Ga0068864_100378621 Ga0068864_1003786212 248
1245 3300005719 Ga0068861_100621031 Ga0068861_1006210311 248
1246 3300005834 Ga0068851_10042924 Ga0068851_100429244 248
1247 3300005840 Ga0068870_10120381 Ga0068870_101203813 248
1248 3300005843 Ga0068860_100003385 Ga0068860_1000033857 248
1249 3300005937 Ga0081455_10069468 Ga0081455_100694682 248
1250 3300005937 Ga0081455_10298241 Ga0081455_102982412 248
1251 3300005981 Ga0081538_10151176 Ga0081538_101511761 248
1252 3300005983 Ga0081540_1005566 Ga0081540_10055661 248
1253 3300005983 Ga0081540_1005578 Ga0081540_10055787 248
1254 3300005983 Ga0081540_1005788 Ga0081540_10057886 248
1255 3300005983 Ga0081540_1012941 Ga0081540_10129414 248
1256 3300005983 Ga0081540_1031359 Ga0081540_10313593 248
1257 3300005985 Ga0081539_10000425 Ga0081539_1000042528 248
1258 3300006028 Ga0070717_10000959 Ga0070717_1000095913 248
1259 3300006028 Ga0070717_10032149 Ga0070717_100321493 248
1260 3300006028 Ga0070717_10066690 Ga0070717_100666902 248
1261 3300006028 Ga0070717_10196019 Ga0070717_101960191 248
1262 3300006038 Ga0075365_10002915 Ga0075365_100029154 248
1263 3300006038 Ga0075365_10066978 Ga0075365_100669782 248
1264 3300006038 Ga0075365_10094709 Ga0075365_100947094 248
1265 3300006051 Ga0075364_10071316 Ga0075364_100713161 248
1266 3300006163 Ga0070715_10002654 Ga0070715_100026542 248
1267 3300006163 Ga0070715_10088665 Ga0070715_100886652 248
1268 3300006173 Ga0070716_100002220 Ga0070716_10000222015 248
1269 3300006173 Ga0070716_100040223 Ga0070716_1000402233 248
1270 3300006173 Ga0070716_100058529 Ga0070716_1000585293 248
1271 3300006178 Ga0075367_10098026 Ga0075367_100980261 248
1272 3300006186 Ga0075369_10005998 Ga0075369_100059983 248
1273 3300006880 Ga0075429_100190761 Ga0075429_1001907612 248
1274 3300006914 Ga0075436_100162870 Ga0075436_1001628702 248
1275 3300006931 Ga0097620_100178423 Ga0097620_1001784232 248
1276 3300006931 Ga0097620_100315980 Ga0097620_1003159804 248
1277 3300006931 Ga0097620_100757757 Ga0097620_1007577571 248
1278 3300007076 Ga0075435_100115860 Ga0075435_1001158603 248
1279 3300007265 Ga0099794_10009521 Ga0099794_100095215 248
1280 3300007265 Ga0099794_10075640 Ga0099794_100756402 248
1281 3300009093 Ga0105240_10046064 Ga0105240_100460642 248
1282 3300009093 Ga0105240_10186062 Ga0105240_101860622 248
1283 3300009093 Ga0105240_10567384 Ga0105240_105673842 248
1284 3300009101 Ga0105247_10059249 Ga0105247_100592492 248
1285 3300009147 Ga0114129_10636286 Ga0114129_106362861 248
1286 3300009174 Ga0105241_10015112 Ga0105241_100151122 248
1287 3300009545 Ga0105237_10124757 Ga0105237_101247573 248
1288 3300009545 Ga0105237_10838451 Ga0105237_108384512 248
1289 3300009551 Ga0105238_10025742 Ga0105238_100257423 248
1290 3300009551 Ga0105238_10028483 Ga0105238_100284833 248
1291 3300009553 Ga0105249_10193252 Ga0105249_101932522 248
1292 3300010375 Ga0105239_10040946 Ga0105239_100409464 248
1293 3300010375 Ga0105239_10129115 Ga0105239_101291152 248
1294 3300010375 Ga0105239_10157911 Ga0105239_101579113 248
1295 3300013306 Ga0163162_10009179 Ga0163162_100091793 248
1296 3300014325 Ga0163163_10033404 Ga0163163_100334043 248
1297 3300014326 Ga0157380_10328269 Ga0157380_103282692 248
1298 3300014968 Ga0157379_10041001 Ga0157379_100410012 248
1299 3300021377 Ga0213874_10047226 Ga0213874_100472262 248
1300 3300021441 Ga0213871_10013420 Ga0213871_100134203 248
1301 3300025253 Ga0209677_100501 Ga0209677_1005012 248
1302 3300025254 Ga0209148_1000707 Ga0209148_10007073 248
1303 3300025261 Ga0209233_1013279 Ga0209233_10132794 248
1304 3300025272 Ga0209455_1005738 Ga0209455_10057383 248
1305 3300025295 Ga0209564_1000503 Ga0209564_100050319 248
1306 3300025295 Ga0209564_1007349 Ga0209564_10073495 248
1307 3300025321 Ga0207656_10137044 Ga0207656_101370441 248
1308 3300025893 Ga0207682_10141055 Ga0207682_101410552 248
1309 3300025898 Ga0207692_10001396 Ga0207692_100013967 248
1310 3300025898 Ga0207692_10008471 Ga0207692_100084712 248
1311 3300025903 Ga0207680_10121229 Ga0207680_101212292 248
1312 3300025904 Ga0207647_10009009 Ga0207647_100090095 248
1313 3300025905 Ga0207685_10072336 Ga0207685_100723362 248
1314 3300025905 Ga0207685_10152194 Ga0207685_101521942 248
1315 3300025906 Ga0207699_10008131 Ga0207699_100081313 248
1316 3300025906 Ga0207699_10028722 Ga0207699_100287222 248
1317 3300025910 Ga0207684_10488553 Ga0207684_104885532 248
1318 3300025911 Ga0207654_10034713 Ga0207654_100347133 248
1319 3300025913 Ga0207695_10034396 Ga0207695_100343965 248
1320 3300025914 Ga0207671_10081896 Ga0207671_100818962 248
1321 3300025915 Ga0207693_10002986 Ga0207693_100029862 248
1322 3300025915 Ga0207693_10003096 Ga0207693_100030968 248
1323 3300025915 Ga0207693_10076294 Ga0207693_100762943 248
1324 3300025916 Ga0207663_10001112 Ga0207663_100011127 248
1325 3300025916 Ga0207663_10006227 Ga0207663_100062275 248
1326 3300025916 Ga0207663_10123988 Ga0207663_101239882 248
1327 3300025917 Ga0207660_10125890 Ga0207660_101258904 248
1328 3300025917 Ga0207660_10208695 Ga0207660_102086953 248
1329 3300025917 Ga0207660_10577084 Ga0207660_105770841 248
1330 3300025917 Ga0207660_10664856 Ga0207660_106648561 248
1331 3300025920 Ga0207649_10070657 Ga0207649_100706573 248
1332 3300025920 Ga0207649_10221624 Ga0207649_102216243 248
1333 3300025921 Ga0207652_10214316 Ga0207652_102143162 248
1334 3300025924 Ga0207694_10001415 Ga0207694_100014157 248
1335 3300025924 Ga0207694_10225647 Ga0207694_102256472 248
1336 3300025928 Ga0207700_10001919 Ga0207700_100019198 248
1337 3300025928 Ga0207700_10045351 Ga0207700_100453512 248
1338 3300025928 Ga0207700_10069647 Ga0207700_100696474 248
1339 3300025928 Ga0207700_10078221 Ga0207700_100782213 248
1340 3300025928 Ga0207700_10145765 Ga0207700_101457652 248
1341 3300025928 Ga0207700_10530218 Ga0207700_105302182 248
1342 3300025929 Ga0207664_10004154 Ga0207664_100041543 248
1343 3300025929 Ga0207664_10104244 Ga0207664_101042442 248
1344 3300025929 Ga0207664_10214542 Ga0207664_102145421 248
1345 3300025932 Ga0207690_10421288 Ga0207690_104212882 248
1346 3300025933 Ga0207706_10339310 Ga0207706_103393102 248
1347 3300025937 Ga0207669_10300207 Ga0207669_103002072 248
1348 3300025939 Ga0207665_10000703 Ga0207665_1000070313 248
1349 3300025939 Ga0207665_10009821 Ga0207665_100098217 248
1350 3300025939 Ga0207665_10065574 Ga0207665_100655742 248
1351 3300025942 Ga0207689_10038013 Ga0207689_100380133 248
1352 3300025944 Ga0207661_10401476 Ga0207661_104014761 248
1353 3300025944 Ga0207661_10509489 Ga0207661_105094892 248
1354 3300025945 Ga0207679_10258225 Ga0207679_102582252 248
1355 3300025949 Ga0207667_10011741 Ga0207667_100117411 248
1356 3300025949 Ga0207667_10081060 Ga0207667_100810602 248
1357 3300025949 Ga0207667_10108767 Ga0207667_101087673 248
1358 3300025949 Ga0207667_10179288 Ga0207667_101792884 248
1359 3300025960 Ga0207651_10587453 Ga0207651_105874532 248
1360 3300025972 Ga0207668_10043690 Ga0207668_100436903 248
1361 3300025981 Ga0207640_10072625 Ga0207640_100726252 248
1362 3300026023 Ga0207677_10232394 Ga0207677_102323942 248
1363 3300026041 Ga0207639_10102445 Ga0207639_101024454 248
1364 3300026041 Ga0207639_10400428 Ga0207639_104004282 248
1365 3300026067 Ga0207678_10011116 Ga0207678_100111169 248
1366 3300026067 Ga0207678_10092860 Ga0207678_100928603 248
1367 3300026067 Ga0207678_10145531 Ga0207678_101455312 248
1368 3300026078 Ga0207702_10000003 Ga0207702_1000000318 248
1369 3300026078 Ga0207702_10000014 Ga0207702_10000014256 248
1370 3300026078 Ga0207702_10033457 Ga0207702_100334574 248
1371 3300026089 Ga0207648_10110826 Ga0207648_101108262 248
1372 3300026095 Ga0207676_10103796 Ga0207676_101037962 248
1373 3300026116 Ga0207674_10009035 Ga0207674_100090354 248
1374 3300026116 Ga0207674_10120406 Ga0207674_101204064 248
1375 3300026118 Ga0207675_100336805 Ga0207675_1003368052 248
1376 3300026121 Ga0207683_10018023 Ga0207683_100180236 248
1377 3300026142 Ga0207698_10208736 Ga0207698_102087362 248
1378 3300026142 Ga0207698_10649771 Ga0207698_106497712 248
1379 3300027671 Ga0209588_1037277 Ga0209588_10372773 248
1380 3300028379 Ga0268266_10004322 Ga0268266_1000432211 248
1381 3300028381 Ga0268264_10000042 Ga0268264_1000004212 248
1382 3300028794 Ga0307515_10153612 Ga0307515_101536124 248
1383 3300030521 Ga0307511_10055883 Ga0307511_100558834 248
1384 3300030760 Ga0265762_1028335 Ga0265762_10283351 248
1385 3300031249 Ga0265339_10013334 Ga0265339_100133342 248
1386 3300031249 Ga0265339_10133034 Ga0265339_101330342 248
1387 3300031250 Ga0265331_10046709 Ga0265331_100467092 248
1388 3300031507 Ga0307509_10006260 Ga0307509_1000626017 248
1389 3300031507 Ga0307509_10136610 Ga0307509_101366103 248
1390 3300031548 Ga0307408_100088322 Ga0307408_1000883222 248
1391 3300031616 Ga0307508_10000125 Ga0307508_1000012563 248
1392 3300031616 Ga0307508_10086418 Ga0307508_100864183 248
1393 3300031711 Ga0265314_10022428 Ga0265314_100224284 248
1394 3300031712 Ga0265342_10013040 Ga0265342_100130402 248
1395 3300031730 Ga0307516_10039106 Ga0307516_100391066 248
1396 3300031730 Ga0307516_10077415 Ga0307516_100774152 248
1397 3300031730 Ga0307516_10260655 Ga0307516_102606552 248
1398 3300032002 Ga0307416_100229312 Ga0307416_1002293122 248
1399 3300033180 Ga0307510_10094706 Ga0307510_100947064 248
1400 3300033180 Ga0307510_10238863 Ga0307510_102388632 248
1401 3300035113 Ga0373936_0169370 Ga0373936_0169370_104_871 248
1402 3300035117 Ga0373953_0075990 Ga0373953_0075990_52_810 248
1403 3300035118 Ga0373954_0002374 Ga0373954_0002374_7038_7796 248
1404 3300035119 Ga0373956_0056583 Ga0373956_0056583_429_1187 248
1405 3300035120 Ga0373957_0024301 Ga0373957_0024301_1136_1894 248
1406 3300035172 Ga0373955_0000590 Ga0373955_0000590_13707_14465 248
1407 3300035410 Ga0373924_0045878 Ga0373924_0045878_286_1044 248
1408 3300035691 Ga0373931_0092811 Ga0373931_0092811_377_1168 248
1409 3300035692 Ga0373935_0285787 Ga0373935_0285787_318_1076 248
1410 3300035695 Ga0373927_0014600 Ga0373927_0014600_2375_3232 248
1411 3300035695 Ga0373927_0044379 Ga0373927_0044379_710_1468 248
1412 3300035724 Ga0373933_0000180 Ga0373933_0000180_33004_33783 248
1413 3300035725 Ga0373947_0065531 Ga0373947_0065531_617_1375 248
1414 3300036401 Ga0373937_0087639 Ga0373937_0087639_178_969 248
1415 3300037068 Ga0373925_0050640 Ga0373925_0050640_189_1046 248
1416 3300037068 Ga0373925_0607456 Ga0373925_0607456_29_784 248
1417 3300037312 Ga0395899_0184330 Ga0395899_0184330_570_1328 248
1418 3300037418 Ga0395900_0000753 Ga0395900_0000753_33161_33916 248
1419 3300037418 Ga0395900_0087579 Ga0395900_0087579_2147_2905 248
1420 3300037466 Ga0395898_0005579 Ga0395898_0005579_4699_5454 248
1421 3300037466 Ga0395898_0096497 Ga0395898_0096497_169_969 248
1422 3300037466 Ga0395898_0693224 Ga0395898_0693224_175_933 248
1423 3300038443 Ga0395901_0059586 Ga0395901_0059586_2892_3647 248
1424 3300039437 Ga0436365_0046146 Ga0436365_0046146_408_1163 248
1425 3300039437 Ga0436365_0824804 Ga0436365_0824804_416_1174 248
1426 3300039438 Ga0436360_0121399 Ga0436360_0121399_583_1341 248
1427 3300039450 Ga0436363_0351229 Ga0436363_0351229_1185_1940 248
1428 3300039450 Ga0436363_1392773 Ga0436363_1392773_1503_2261 248
1429 3300039450 Ga0436363_1532888 Ga0436363_1532888_260_1060 248
1430 3300039453 Ga0436362_0854921 Ga0436362_0854921_545_1303 248
1431 3300044656 Ga0466969_0077486 Ga0466969_0077486_374_1132 248
1432 3300044842 Ga0466957_0079650 Ga0466957_0079650_521_1279 248
1433 3300045049 Ga0466959_0383088 Ga0466959_0383088_16_774 248
1434 3300046454 Ga0495592_0007391 Ga0495592_0007391_2270_3028 248
1435 3300046455 Ga0495603_0017965 Ga0495603_0017965_15_803 248
1436 3300046455 Ga0495603_0113311 Ga0495603_0113311_242_1006 248
1437 3300046459 Ga0495629_0021300 Ga0495629_0021300_2939_3694 248
1438 3300046460 Ga0495638_0017089 Ga0495638_0017089_2279_3037 248
1439 3300046460 Ga0495638_0044424 Ga0495638_0044424_1920_2678 248
1440 3300046462 Ga0495651_0009620 Ga0495651_0009620_4931_5689 248
1441 3300046462 Ga0495651_0045413 Ga0495651_0045413_2472_3236 248
1442 3300046463 Ga0495653_0187883 Ga0495653_0187883_603_1361 248
1443 3300046471 Ga0495650_0034912 Ga0495650_0034912_531_1286 248
1444 3300046477 Ga0495664_0011721 Ga0495664_0011721_1058_1816 248
1445 3300046499 Ga0495594_0282177 Ga0495594_0282177_178_933 248
1446 3300046501 Ga0495607_0068886 Ga0495607_0068886_362_1120 248
1447 3300046507 Ga0495606_0001686 Ga0495606_0001686_6039_6797 248
1448 3300046507 Ga0495606_0012721 Ga0495606_0012721_121_876 248
1449 3300046507 Ga0495606_0103896 Ga0495606_0103896_650_1408 248
1450 3300046511 Ga0495608_0078676 Ga0495608_0078676_1109_1867 248
1451 3300046512 Ga0495610_0051049 Ga0495610_0051049_1190_1948 248
1452 3300046514 Ga0495618_0068853 Ga0495618_0068853_458_1216 248
1453 3300046515 Ga0495620_0017282 Ga0495620_0017282_1688_2446 248
1454 3300046516 Ga0495628_0011834 Ga0495628_0011834_1571_2329 248
1455 3300046519 Ga0495632_0182245 Ga0495632_0182245_101_856 248
1456 3300046524 Ga0495648_0002080 Ga0495648_0002080_12921_13679 248
1457 3300046529 Ga0495652_0088571 Ga0495652_0088571_148_903 248
1458 3300046533 Ga0495640_0028702 Ga0495640_0028702_2886_3641 248
1459 3300046533 Ga0495640_0197743 Ga0495640_0197743_447_1205 248
1460 3300046536 Ga0495587_0054241 Ga0495587_0054241_1042_1800 248
1461 3300046543 Ga0495645_0009133 Ga0495645_0009133_1831_2589 248
1462 3300046557 Ga0495622_0045681 Ga0495622_0045681_1081_1938 248
1463 3300046557 Ga0495622_0150699 Ga0495622_0150699_252_1010 248
1464 3300046559 Ga0495667_0027393 Ga0495667_0027393_1386_2150 248
1465 3300046615 Ga0495656_0051429 Ga0495656_0051429_874_1683 248
1466 3300046616 Ga0495668_0114593 Ga0495668_0114593_264_1022 248
1467 3300046642 Ga0495634_0034428 Ga0495634_0034428_2149_2904 248
1468 3300046648 Ga0495611_0070545 Ga0495611_0070545_394_1152 248
1469 3300046663 Ga0495635_0012284 Ga0495635_0012284_4614_5369 248
1470 3300046663 Ga0495635_0033486 Ga0495635_0033486_2474_3232 248
1471 3300046663 Ga0495635_0361171 Ga0495635_0361171_10_768 248
1472 3300046664 Ga0495659_0011400 Ga0495659_0011400_1117_1926 248
1473 3300046665 Ga0495661_0004641 Ga0495661_0004641_2177_2935 248
1474 3300046675 Ga0495657_0007247 Ga0495657_0007247_5155_5910 248
1475 3300046675 Ga0495657_0129828 Ga0495657_0129828_563_1321 248
1476 3300046678 Ga0495599_0019082 Ga0495599_0019082_916_1674 248
1477 3300046679 Ga0495623_0077088 Ga0495623_0077088_407_1165 248
1478 3300046679 Ga0495623_0116857 Ga0495623_0116857_807_1598 248
1479 3300046680 Ga0495646_0223142 Ga0495646_0223142_155_913 248
1480 3300046689 Ga0495613_0121180 Ga0495613_0121180_641_1396 248
1481 3300046689 Ga0495613_0123971 Ga0495613_0123971_721_1479 248
1482 3300046690 Ga0495624_0062310 Ga0495624_0062310_1158_1913 248
1483 3300046809 Ga0495600_0020140 Ga0495600_0020140_921_1676 248
1484 3300047317 Ga0495604_0006128 Ga0495604_0006128_72_827 248
1485 3300047317 Ga0495604_0020133 Ga0495604_0020133_774_1532 248
1486 3300047317 Ga0495604_0269476 Ga0495604_0269476_199_963 248
1487 3300047322 Ga0495680_0097431 Ga0495680_0097431_420_1178 248
1488 3300047470 Ga0495681_0107375 Ga0495681_0107375_397_1155 248
1489 3300047471 Ga0495684_0239736 Ga0495684_0239736_80_838 248
1490 3300047472 Ga0495686_0018833 Ga0495686_0018833_1830_2588 248
1491 3300047472 Ga0495686_0075590 Ga0495686_0075590_483_1241 248
1492 3300047673 Ga0495593_0192672 Ga0495593_0192672_71_826 248
1493 3300048088 Ga0495602_0021411 Ga0495602_0021411_679_1434 248
1494 3300048088 Ga0495602_0074922 Ga0495602_0074922_88_846 248
1495 3300048088 Ga0495602_0085822 Ga0495602_0085822_1827_2585 248
1496 3300048903 Ga0496100_0032857 Ga0496100_0032857_1489_2280 248
1497 3300048903 Ga0496100_0280409 Ga0496100_0280409_50_808 248
1498 3300048904 Ga0496101_0054482 Ga0496101_0054482_2104_2874 248
1499 3300048904 Ga0496101_0114285 Ga0496101_0114285_323_1114 248
1500 3300048904 Ga0496101_0116075 Ga0496101_0116075_906_1664 248
1501 3300048905 Ga0496102_0105116 Ga0496102_0105116_1291_2082 248
1502 3300048905 Ga0496102_0163993 Ga0496102_0163993_711_1469 248
1503 3300048905 Ga0496102_0337717 Ga0496102_0337717_241_999 248
1504 3300048905 Ga0496102_0691098 Ga0496102_0691098_28_783 248
1505 3300048907 Ga0496104_0014912 Ga0496104_0014912_1805_2560 248
1506 3300048907 Ga0496104_0268839 Ga0496104_0268839_513_1304 248
1507 3300048908 Ga0496105_0046798 Ga0496105_0046798_72_827 248
1508 3300048909 Ga0496106_0001280 Ga0496106_0001280_5160_5924 248
1509 3300048909 Ga0496106_0004321 Ga0496106_0004321_7693_8451 248
1510 3300048909 Ga0496106_0207015 Ga0496106_0207015_438_1229 248
1511 3300048910 Ga0496107_0027212 Ga0496107_0027212_3155_3946 248
1512 3300048911 Ga0496108_0003585 Ga0496108_0003585_2670_3428 248
1513 3300048911 Ga0496108_0120994 Ga0496108_0120994_1068_1859 248
1514 3300048911 Ga0496108_0206654 Ga0496108_0206654_231_1001 248
1515 3300048911 Ga0496108_0247318 Ga0496108_0247318_272_1030 248
1516 3300048911 Ga0496108_0290271 Ga0496108_0290271_448_1206 248
1517 3300048911 Ga0496108_0420318 Ga0496108_0420318_117_875 248
1518 3300048912 Ga0496109_0004298 Ga0496109_0004298_2444_3202 248
1519 3300048912 Ga0496109_0327532 Ga0496109_0327532_255_1013 248
1520 3300048913 Ga0496110_0111158 Ga0496110_0111158_980_1738 248
1521 3300048913 Ga0496110_0166142 Ga0496110_0166142_896_1687 248
1522 3300048913 Ga0496110_0289553 Ga0496110_0289553_336_1094 248
1523 3300048913 Ga0496110_0618092 Ga0496110_0618092_159_914 248
1524 3300048914 Ga0496111_0156174 Ga0496111_0156174_258_1049 248
1525 3300048915 Ga0496112_0003249 Ga0496112_0003249_3654_4412 248
1526 3300048915 Ga0496112_0049602 Ga0496112_0049602_2801_3592 248
1527 3300048915 Ga0496112_0123797 Ga0496112_0123797_452_1270 248
1528 3300048916 Ga0496113_0035660 Ga0496113_0035660_646_1404 248
1529 3300048916 Ga0496113_0038460 Ga0496113_0038460_746_1504 248
1530 3300048917 Ga0496114_0468493 Ga0496114_0468493_44_835 248
1531 3300048917 Ga0496114_0509577 Ga0496114_0509577_109_879 248
1532 3300048918 Ga0496115_0014125 Ga0496115_0014125_265_1029 248
1533 3300048918 Ga0496115_0049654 Ga0496115_0049654_2351_3106 248
1534 3300048918 Ga0496115_0118331 Ga0496115_0118331_515_1273 248
1535 3300048918 Ga0496115_0151874 Ga0496115_0151874_479_1270 248
1536 3300048918 Ga0496115_0341358 Ga0496115_0341358_270_1028 248
1537 3300048918 Ga0496115_0443580 Ga0496115_0443580_86_844 248
1538 3300048918 Ga0496115_0464673 Ga0496115_0464673_98_898 248
1539 3300048919 Ga0496116_0005695 Ga0496116_0005695_8732_9490 248
1540 3300048920 Ga0496117_0012118 Ga0496117_0012118_5648_6406 248
1541 3300048920 Ga0496117_0155578 Ga0496117_0155578_56_814 248
1542 3300048921 Ga0496118_0001458 Ga0496118_0001458_21189_21953 248
1543 3300048921 Ga0496118_0016977 Ga0496118_0016977_1290_2048 248
1544 3300048921 Ga0496118_0042817 Ga0496118_0042817_874_1668 248
1545 3300048921 Ga0496118_0084764 Ga0496118_0084764_1297_2055 248
1546 3300048921 Ga0496118_0336571 Ga0496118_0336571_20_778 248
1547 3300048922 Ga0496119_0003138 Ga0496119_0003138_13501_14256 248
1548 3300048922 Ga0496119_0107815 Ga0496119_0107815_669_1436 248
1549 3300048923 Ga0496120_0015858 Ga0496120_0015858_3239_3994 248
1550 3300048923 Ga0496120_0126500 Ga0496120_0126500_145_903 248
1551 3300048924 Ga0496121_0000146 Ga0496121_0000146_65051_65815 248
1552 3300048924 Ga0496121_0009157 Ga0496121_0009157_8538_9296 248
1553 3300048924 Ga0496121_0011985 Ga0496121_0011985_7746_8540 248
1554 3300048924 Ga0496121_0014155 Ga0496121_0014155_5709_6500 248
1555 3300048924 Ga0496121_0039521 Ga0496121_0039521_1306_2064 248
1556 3300048924 Ga0496121_0052038 Ga0496121_0052038_1358_2116 248
1557 3300048924 Ga0496121_0338530 Ga0496121_0338530_64_822 248
1558 3300048926 Ga0496123_0036461 Ga0496123_0036461_1664_2422 248
1559 3300048927 Ga0496124_0002217 Ga0496124_0002217_23088_23852 248
1560 3300048927 Ga0496124_0042083 Ga0496124_0042083_788_1546 248
1561 3300048927 Ga0496124_0194246 Ga0496124_0194246_351_1106 248
1562 3300048927 Ga0496124_0376298 Ga0496124_0376298_118_876 248
1563 3300048928 Ga0496125_0009421 Ga0496125_0009421_1233_1991 248
1564 3300048928 Ga0496125_0024940 Ga0496125_0024940_1240_1998 248
1565 3300048929 Ga0496126_0010429 Ga0496126_0010429_3009_3767 248
1566 3300048929 Ga0496126_0016158 Ga0496126_0016158_6181_6939 248
1567 3300048929 Ga0496126_0016652 Ga0496126_0016652_3180_3944 248
1568 3300048929 Ga0496126_0020801 Ga0496126_0020801_3752_4510 248
1569 3300048929 Ga0496126_0023765 Ga0496126_0023765_4425_5183 248
1570 3300048929 Ga0496126_0026323 Ga0496126_0026323_2818_3576 248
1571 3300048929 Ga0496126_0051578 Ga0496126_0051578_1062_1820 248
1572 3300048929 Ga0496126_0258195 Ga0496126_0258195_342_1100 248
1573 3300048929 Ga0496126_0404096 Ga0496126_0404096_243_1037 248
1574 3300049460 Ga0495682_0108351 Ga0495682_0108351_142_897 248
1575 3300049569 Ga0501032_0132292 Ga0501032_0132292_50_808 248
1576 3300049569 Ga0501032_0293148 Ga0501032_0293148_116_874 248
1577 3300049570 Ga0501033_0020903 Ga0501033_0020903_572_1330 248
1578 3300049570 Ga0501033_0155119 Ga0501033_0155119_518_1276 248
1579 3300049570 Ga0501033_0208738 Ga0501033_0208738_570_1328 248
1580 3300049571 Ga0501034_0148564 Ga0501034_0148564_886_1644 248
1581 3300049571 Ga0501034_0229981 Ga0501034_0229981_639_1397 248
1582 3300049572 Ga0501036_0139275 Ga0501036_0139275_620_1378 248
1583 3300049572 Ga0501036_0212497 Ga0501036_0212497_625_1383 248
1584 3300049572 Ga0501036_0606017 Ga0501036_0606017_65_823 248
1585 3300049575 Ga0501039_0081764 Ga0501039_0081764_805_1563 248
1586 3300049575 Ga0501039_0430471 Ga0501039_0430471_232_990 248
1587 3300049575 Ga0501039_0571526 Ga0501039_0571526_80_838 248
1588 3300049578 Ga0501042_0473558 Ga0501042_0473558_25_828 248
1589 3300049579 Ga0501043_0066286 Ga0501043_0066286_554_1312 248
1590 3300049581 Ga0501047_0067379 Ga0501047_0067379_1082_1840 248
1591 3300049583 Ga0501067_0035959 Ga0501067_0035959_532_1290 248
1592 3300049585 Ga0501069_0137319 Ga0501069_0137319_563_1321 248
1593 3300049591 Ga0501075_0388322 Ga0501075_0388322_138_941 248
1594 3300049592 Ga0501076_0346372 Ga0501076_0346372_232_1035 248
1595 3300049742 Ga0501080_0369480 Ga0501080_0369480_227_985 248
1596 3300049822 Ga0501035_0081794 Ga0501035_0081794_1735_2493 248
1597 3300049822 Ga0501035_0159064 Ga0501035_0159064_736_1494 248
1598 3300049823 Ga0501044_0018639 Ga0501044_0018639_3586_4344 248
1599 3300049823 Ga0501044_0178512 Ga0501044_0178512_740_1498 248
1600 3300050491 nmdc:mga00v17_16115_c1 nmdc:mga00v17_16115_c1_2587_3345 248
1601 3300050491 nmdc:mga00v17_45574_c1 nmdc:mga00v17_45574_c1_46_804 248
1602 3300050492 nmdc:mga0yw44_136533_c1 nmdc:mga0yw44_136533_c1_105_863 248
1603 3300050492 nmdc:mga0yw44_4562_c1 nmdc:mga0yw44_4562_c1_3874_4632 248
1604 3300050492 nmdc:mga0yw44_7371_c1 nmdc:mga0yw44_7371_c1_2876_3634 248
1605 3300050494 nmdc:mga06z11_71486_c1 nmdc:mga06z11_71486_c1_78_836 248
1606 3300050507 nmdc:mga05p37_228749_c1 nmdc:mga05p37_228749_c1_77_895 248
1607 3300050509 nmdc:mga0qj67_342693_c1 nmdc:mga0qj67_342693_c1_216_1025 248
1608 3300050512 nmdc:mga0n895_398372_c1 nmdc:mga0n895_398372_c1_156_956 248
1609 3300050515 nmdc:mga0a205_270132_c1 nmdc:mga0a205_270132_c1_409_1227 248
1610 3300050516 nmdc:mga0sz30_14398_c1 nmdc:mga0sz30_14398_c1_1288_2046 248
1611 3300053077 Ga0495601_0162009 Ga0495601_0162009_175_966 248
1612 3300053078 Ga0495612_0025416 Ga0495612_0025416_88_846 248
1613 3300053078 Ga0495612_0050490 Ga0495612_0050490_16_774 248
1614 3300053080 Ga0500635_0015217 Ga0500635_0015217_1168_2025 248
1615 3300053084 Ga0495595_0105047 Ga0495595_0105047_258_1037 248
1616 3300053087 Ga0500643_020457 Ga0500643_020457_427_1185 248
1617 3300053088 Ga0500644_0007090 Ga0500644_0007090_584_1342 248
1618 3300053093 Ga0500651_0052786 Ga0500651_0052786_854_1711 248
1619 3300053094 Ga0500566_0000574 Ga0500566_0000574_19616_20473 248
1620 3300053096 Ga0500641_0001161 Ga0500641_0001161_6692_7450 248
1621 3300053097 Ga0500648_158849 Ga0500648_158849_214_972 248
1622 3300053098 Ga0500650_0003432 Ga0500650_0003432_1815_2573 248
1623 3300053102 Ga0500554_002421 Ga0500554_002421_2698_3456 248
1624 3300053102 Ga0500554_008523 Ga0500554_008523_651_1409 248
1625 3300053104 Ga0500556_0000035 Ga0500556_0000035_45180_45938 248
1626 3300053108 Ga0500562_060723 Ga0500562_060723_105_863 248
1627 3300053109 Ga0500569_001632 Ga0500569_001632_604_1362 248
1628 3300053111 Ga0500572_000335 Ga0500572_000335_8373_9131 248
1629 3300053118 Ga0500594_0095949 Ga0500594_0095949_28_786 248
1630 3300053119 Ga0500595_000728 Ga0500595_000728_10109_10867 248
1631 3300053119 Ga0500595_061714 Ga0500595_061714_322_1077 248
1632 3300053122 Ga0500608_000269 Ga0500608_000269_10706_11563 248
1633 3300053122 Ga0500608_091250 Ga0500608_091250_256_1014 248
1634 3300053125 Ga0500618_012006 Ga0500618_012006_764_1621 248
1635 3300053130 Ga0500642_0000027 Ga0500642_0000027_60652_61410 248
1636 3300053130 Ga0500642_0062311 Ga0500642_0062311_561_1319 248
1637 3300053131 Ga0500652_000529 Ga0500652_000529_3349_4107 248
1638 3300053134 Ga0500658_0118352 Ga0500658_0118352_119_877 248
1639 3300053136 Ga0500559_0000064 Ga0500559_0000064_56057_56914 248
1640 3300053136 Ga0500559_0018562 Ga0500559_0018562_1786_2544 248
1641 3300053139 Ga0500568_0000443 Ga0500568_0000443_21119_21877 248
1642 3300053139 Ga0500568_0073161 Ga0500568_0073161_237_992 248
1643 3300053142 Ga0500577_0006124 Ga0500577_0006124_699_1457 248
1644 3300053145 Ga0500586_003676 Ga0500586_003676_2267_3025 248
1645 3300053148 Ga0500590_133389 Ga0500590_133389_234_992 248
1646 3300053150 Ga0500603_003284 Ga0500603_003284_1762_2526 248
1647 3300053150 Ga0500603_008634 Ga0500603_008634_292_1050 248
1648 3300053151 Ga0500604_0059408 Ga0500604_0059408_30_788 248
1649 3300053153 Ga0500616_0000054 Ga0500616_0000054_241198_241956 248
1650 3300053156 Ga0500622_0003640 Ga0500622_0003640_1133_1891 248
1651 3300053158 Ga0500627_0008813 Ga0500627_0008813_1679_2437 248
1652 3300053158 Ga0500627_0017323 Ga0500627_0017323_1766_2524 248
1653 3300053161 Ga0500634_0107652 Ga0500634_0107652_166_924 248
1654 3300053162 Ga0500638_007140 Ga0500638_007140_1885_2643 248
1655 3300053162 Ga0500638_135408 Ga0500638_135408_242_1006 248
1656 3300053163 Ga0500639_062231 Ga0500639_062231_944_1702 248
1657 3300053177 Ga0500636_0001203 Ga0500636_0001203_6715_7572 248
1658 3300053177 Ga0500636_0024967 Ga0500636_0024967_826_1584 248
1659 3300053177 Ga0500636_0103701 Ga0500636_0103701_180_1037 248
1660 3300053178 Ga0500637_0000080 Ga0500637_0000080_15866_16624 248
1661 3300053178 Ga0500637_0057596 Ga0500637_0057596_382_1239 248
1662 3300053722 Ga0500649_119607 Ga0500649_119607_127_882 248
1663 3300053724 Ga0500570_088450 Ga0500570_088450_378_1136 248
1664 3300053725 Ga0500576_032854 Ga0500576_032854_1461_2219 248
1665 3300053728 Ga0500657_105723 Ga0500657_105723_155_1012 248
1666 3300053730 Ga0500645_015265 Ga0500645_015265_1095_1853 248
1667 3300053735 Ga0500596_009139 Ga0500596_009139_368_1126 248
1668 3300055283 Ga0500661_001305 Ga0500661_001305_1576_2334 248
1669 3300061734 Ga0530510_0196700 Ga0530510_0196700_96_899 248
1670 iso_pu_bacteria 2513237141 2513892410 248
1671 iso_pu_bacteria 2602042107 2603860655 248
1672 iso_pu_bacteria 2857524615 2857525614 248
1673 iso_pu_bacteria 2893066018 2893070662 248
1674 iso_pu_bacteria 2919073203 2919074578 248

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

53

195

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kyo-assembly1.cif.gz_B psabc from streptococcus pneumoniae in complex with fab 0.9404 2 224
2nq2-assembly1.cif.gz_D an inward-facing conformation of a putative metal-chelate type abc transporter. 0.8946 2 226
7kyo-assembly1.cif.gz_B psabc from streptococcus pneumoniae in complex with fab 0.8942 2 224
2nq2-assembly1.cif.gz_C an inward-facing conformation of a putative metal-chelate type abc transporter. 0.8824 2 226
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.8799 2 215
ID Description Score Start End Superfamily
af_P15031_2_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9239 2 223 3.40.50.300
af_Q58429_1_224_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9102 2 218 3.40.50.300
af_Q2G072_1_252_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8939 2 224 3.40.50.300
af_P23878_8_259_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8917 1 224 3.40.50.300
af_Q9VRG3_1356_1574_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8914 2 206 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A6B3VVJ0-F1-model_v4 deleted 0.943 2 188
AF-A0A1J4MZI6-F1-model_v4 ABC transporter 0.9312 2 226 GO:0005524
GO:0005886
GO:0006826
GO:0016887
AF-A0A2T0V6S8-F1-model_v4 Zinc/manganese transport system ATP-binding protein 0.9175 2 206 GO:0005524
GO:0016887
AF-A0A3A4U7V5-F1-model_v4 ABC transporter ATP-binding protein 0.9142 21 223 GO:0005524
GO:0016887
AF-A0A1H5GCX7-F1-model_v4 Iron complex transport system ATP-binding protein 0.9115 2 226 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
88.67 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map