F495224

General Info

Members Datasets Scaffolds Average Seq Length
1655 347 1655 188

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10355840|Ga0157373_103558401
Length 225
Sequence VGNVLDQSLSALGFMDGAAGIASFAEAAKPYNAGRGTMLSLPNLLTLSRILAVPILVFLLWRPAPVDYAITFVLYCIVGITDYFDGYLARAWGSISKLGQFLDPIADKIMVAAVIVMLIASRKANPVPEIDGLNLIPALVILLREIIVSGLREYLAGLQVSVPVSALAKWKTTLQLVALGALILGGALPHQPWVHLVGIICLWFAAGLTLITGYDYLRVGLRHME

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
83 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
107 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
124 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
125 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
127 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
129 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
132 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
199 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
200 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
201 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
202 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
203 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
204 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
205 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
206 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
207 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
208 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
209 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
210 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
211 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
212 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
213 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
214 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
215 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
216 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
217 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
218 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
220 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
221 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
222 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
223 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
224 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
225 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
226 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
227 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
228 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
229 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
230 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
231 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
232 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
233 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
234 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
235 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
236 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
237 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
238 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
239 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
240 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
241 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
242 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
243 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
244 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
245 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
246 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
247 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
248 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
249 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
250 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
251 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
252 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
253 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
254 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
255 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
256 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
257 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
258 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
259 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
260 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
261 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
262 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
263 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
264 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
265 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
266 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
267 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
268 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
269 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
270 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
271 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
272 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
273 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
274 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
275 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
276 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
277 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
278 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
279 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
280 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
281 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
282 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
283 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
284 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
285 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
286 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
287 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
288 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
289 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
290 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
291 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
292 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
293 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
294 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
295 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
296 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
297 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
298 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
299 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
300 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
301 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
302 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
303 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
304 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
305 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
306 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
307 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
308 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
309 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
310 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
311 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
312 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
313 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
314 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
315 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
316 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
317 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
318 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
319 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
320 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
321 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
322 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
323 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
324 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
325 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
326 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
327 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
328 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
329 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
330 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
331 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
332 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
333 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
334 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
335 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
336 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
337 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
338 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
339 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
340 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
341 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
342 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
343 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
344 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
345 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
346 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
347 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.81
Nodule 0
Rhizoplane 4.05
Rhizosphere 92.75
Stem 0
Stem Tuber 0
Unclassified 1.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1005307 3300001904 Bacteria 2178
2 JGI24736J21556_1016639 3300001904 Bacteria 1169
3 JGI24741J21665_1000275 3300001915 Bacteria 15451
4 JGI24741J21665_1000905 3300001915 Bacteria 8936
5 JGI24741J21665_1004763 3300001915 Bacteria 2946
6 JGI24741J21665_1006277 3300001915 Bacteria 2401
7 JGI24741J21665_1010381 3300001915 Bacteria 1669
8 JGI24741J21665_1013393 3300001915 Bacteria 1392
9 JGI24741J21665_1020529 3300001915 Bacteria 1038
10 JGI24747J21853_1015495 3300001978 Bacteria 800
11 JGI24740J21852_10002192 3300001979 Bacteria 8929
12 JGI24740J21852_10004085 3300001979 Bacteria 6316
13 JGI24740J21852_10006098 3300001979 Bacteria 5037
14 JGI24740J21852_10016150 3300001979 Bacteria 2705
15 JGI24740J21852_10020477 3300001979 Bacteria 2306
16 JGI24740J21852_10022185 3300001979 Bacteria 2190
17 JGI24740J21852_10066603 3300001979 Bacteria 977
18 JGI24739J22299_10008245 3300001989 Bacteria 3888
19 JGI24739J22299_10015335 3300001989 Bacteria 2782
20 JGI24739J22299_10027711 3300001989 Bacteria 1978
21 JGI24737J22298_10006639 3300001990 Bacteria 3941
22 JGI24737J22298_10006915 3300001990 Bacteria 3849
23 JGI24737J22298_10007117 3300001990 Bacteria 3791
24 JGI24737J22298_10008878 3300001990 Bacteria 3355
25 JGI24737J22298_10023678 3300001990 Bacteria 1947
26 JGI24737J22298_10114216 3300001990 Bacteria 798
27 JGI24743J22301_10017671 3300001991 Bacteria 1341
28 JGI24743J22301_10027488 3300001991 Bacteria 1110
29 JGI24735J21928_10005471 3300002067 Bacteria 4213
30 JGI24735J21928_10011426 3300002067 Bacteria 2815
31 JGI24735J21928_10024856 3300002067 Bacteria 1809
32 JGI24735J21928_10032259 3300002067 Bacteria 1551
33 JGI24735J21928_10103214 3300002067 Bacteria 819
34 JGI24738J21930_10005798 3300002075 Bacteria 2935
35 JGI24738J21930_10017629 3300002075 Bacteria 1499
36 JGI25153J46596_10000002 3300003215 Bacteria 653569
37 Ga0055525_1000104 3300003759 Bacteria 134560
38 Ga0055542_1000025 3300003762 Bacteria 263538
39 Ga0055529_1000014 3300003763 Bacteria 367283
40 Ga0065704_10109949 3300005289 Bacteria 1970
41 Ga0065712_10112711 3300005290 Bacteria 1778
42 Ga0065715_10000404 3300005293 Bacteria 15507
43 Ga0065715_10576100 3300005293 Bacteria 702
44 Ga0070658_10000013 3300005327 Bacteria 267776
45 Ga0070658_10000621 3300005327 Bacteria 30615
46 Ga0070658_10037552 3300005327 Bacteria 3905
47 Ga0070658_10042471 3300005327 Bacteria 3672
48 Ga0070658_10053424 3300005327 Bacteria 3279
49 Ga0070658_10058340 3300005327 Bacteria 3141
50 Ga0070658_10059414 3300005327 Bacteria 3113
51 Ga0070658_10060755 3300005327 Bacteria 3078
52 Ga0070658_10070183 3300005327 Bacteria 2868
53 Ga0070658_10076988 3300005327 Bacteria 2736
54 Ga0070658_10078019 3300005327 Bacteria 2718
55 Ga0070658_10083827 3300005327 Bacteria 2621
56 Ga0070658_10084961 3300005327 Bacteria 2602
57 Ga0070658_10106886 3300005327 Bacteria 2315
58 Ga0070658_10131939 3300005327 Bacteria 2082
59 Ga0070658_10139640 3300005327 Bacteria 2023
60 Ga0070658_10467308 3300005327 Bacteria 1088
61 Ga0070658_10488769 3300005327 Bacteria 1062
62 Ga0070658_10507188 3300005327 Bacteria 1042
63 Ga0070658_10552564 3300005327 Bacteria 996
64 Ga0070658_10772654 3300005327 Bacteria 834
65 Ga0070676_10092442 3300005328 Bacteria 1855
66 Ga0070676_10113199 3300005328 Bacteria 1692
67 Ga0070683_100003807 3300005329 Bacteria 12325
68 Ga0070683_100017720 3300005329 Bacteria 6293
69 Ga0070683_100017806 3300005329 Bacteria 6278
70 Ga0070683_100088489 3300005329 Bacteria 2905
71 Ga0070683_100090024 3300005329 Bacteria 2880
72 Ga0070690_100000975 3300005330 Bacteria 14573
73 Ga0070690_100637857 3300005330 Bacteria 812
74 Ga0070670_100001793 3300005331 Bacteria 17481
75 Ga0070670_100003621 3300005331 Bacteria 12862
76 Ga0070670_100014320 3300005331 Bacteria 6804
77 Ga0070670_100019164 3300005331 Bacteria 5868
78 Ga0070670_100019881 3300005331 Bacteria 5765
79 Ga0070670_100021575 3300005331 Bacteria 5538
80 Ga0070670_100059607 3300005331 Bacteria 3276
81 Ga0070670_100177304 3300005331 Bacteria 1850
82 Ga0070670_100178920 3300005331 Bacteria 1841
83 Ga0070670_100329121 3300005331 Bacteria 1340
84 Ga0070677_10001172 3300005333 Bacteria 8403
85 Ga0070677_10041961 3300005333 Bacteria 1809
86 Ga0070677_10102136 3300005333 Bacteria 1266
87 Ga0068869_100077982 3300005334 Bacteria 2466
88 Ga0068869_100937565 3300005334 Bacteria 751
89 Ga0070666_10018007 3300005335 Bacteria 4534
90 Ga0070666_10040464 3300005335 Bacteria 3111
91 Ga0070666_10044892 3300005335 Bacteria 2962
92 Ga0070666_10225384 3300005335 Bacteria 1323
93 Ga0070680_100002095 3300005336 Bacteria 14733
94 Ga0070680_100002826 3300005336 Bacteria 12903
95 Ga0070680_100004105 3300005336 Bacteria 10908
96 Ga0070680_100007978 3300005336 Bacteria 8082
97 Ga0070680_100029151 3300005336 Bacteria 4433
98 Ga0070680_100031955 3300005336 Bacteria 4233
99 Ga0070680_100033294 3300005336 Bacteria 4153
100 Ga0070680_100050835 3300005336 Bacteria 3381
101 Ga0070680_100067459 3300005336 Bacteria 2934
102 Ga0070680_100135342 3300005336 Bacteria 2064
103 Ga0070680_100837710 3300005336 Bacteria 793
104 Ga0070682_100023584 3300005337 Bacteria 3654
105 Ga0070682_100116758 3300005337 Bacteria 1786
106 Ga0068868_100004297 3300005338 Bacteria 9976
107 Ga0068868_100014704 3300005338 Bacteria 5772
108 Ga0068868_100069728 3300005338 Bacteria 2802
109 Ga0068868_100110463 3300005338 Bacteria 2233
110 Ga0068868_100565195 3300005338 Bacteria 1004
111 Ga0068868_100743002 3300005338 Bacteria 881
112 Ga0070660_100000292 3300005339 Bacteria 33415
113 Ga0070660_100002275 3300005339 Bacteria 13195
114 Ga0070660_100002676 3300005339 Bacteria 12241
115 Ga0070660_100028243 3300005339 Bacteria 4195
116 Ga0070660_100031872 3300005339 Bacteria 3962
117 Ga0070660_100039484 3300005339 Bacteria 3588
118 Ga0070660_100086702 3300005339 Bacteria 2463
119 Ga0070660_100113408 3300005339 Bacteria 2159
120 Ga0070660_100120938 3300005339 Bacteria 2089
121 Ga0070660_100165230 3300005339 Bacteria 1785
122 Ga0070660_100168324 3300005339 Bacteria 1769
123 Ga0070660_100221552 3300005339 Bacteria 1538
124 Ga0070660_100276879 3300005339 Bacteria 1372
125 Ga0070660_100287349 3300005339 Bacteria 1346
126 Ga0070660_100292591 3300005339 Bacteria 1334
127 Ga0070660_100372963 3300005339 Bacteria 1177
128 Ga0070660_100445602 3300005339 Bacteria 1074
129 Ga0070660_100771920 3300005339 Bacteria 808
130 Ga0070689_100041464 3300005340 Bacteria 3534
131 Ga0070689_100405718 3300005340 Bacteria 1153
132 Ga0070687_100161463 3300005343 Bacteria 1325
133 Ga0070661_100005164 3300005344 Bacteria 8988
134 Ga0070661_100006011 3300005344 Bacteria 8354
135 Ga0070661_100011275 3300005344 Bacteria 6227
136 Ga0070661_100013976 3300005344 Bacteria 5644
137 Ga0070661_100027769 3300005344 Bacteria 4077
138 Ga0070661_100029712 3300005344 Bacteria 3945
139 Ga0070661_100033475 3300005344 Bacteria 3722
140 Ga0070661_100047459 3300005344 Bacteria 3143
141 Ga0070661_100070859 3300005344 Bacteria 2564
142 Ga0070661_100079017 3300005344 Bacteria 2427
143 Ga0070661_100109887 3300005344 Bacteria 2058
144 Ga0070661_100121802 3300005344 Bacteria 1954
145 Ga0070661_100146165 3300005344 Bacteria 1785
146 Ga0070661_100151923 3300005344 Bacteria 1751
147 Ga0070661_100255814 3300005344 Bacteria 1353
148 Ga0070661_100270220 3300005344 Bacteria 1316
149 Ga0070661_100287714 3300005344 Bacteria 1276
150 Ga0070661_100303749 3300005344 Bacteria 1243
151 Ga0070661_100503731 3300005344 Bacteria 969
152 Ga0070661_100819336 3300005344 Bacteria 765
153 Ga0070692_10000460 3300005345 Bacteria 12435
154 Ga0070692_10001029 3300005345 Bacteria 9613
155 Ga0070692_10013194 3300005345 Bacteria 3847
156 Ga0070692_10081653 3300005345 Bacteria 1742
157 Ga0070692_10098843 3300005345 Bacteria 1597
158 Ga0070668_100002166 3300005347 Bacteria 14379
159 Ga0070668_100088429 3300005347 Bacteria 2439
160 Ga0070668_100706494 3300005347 Bacteria 889
161 Ga0070669_100032494 3300005353 Bacteria 3769
162 Ga0070669_100055113 3300005353 Bacteria 2913
163 Ga0070675_100006070 3300005354 Bacteria 9255
164 Ga0070675_100037261 3300005354 Bacteria 3961
165 Ga0070675_100061877 3300005354 Bacteria 3092
166 Ga0070675_100080172 3300005354 Bacteria 2721
167 Ga0070675_100269435 3300005354 Bacteria 1494
168 Ga0070675_100432769 3300005354 Bacteria 1178
169 Ga0070675_100489070 3300005354 Bacteria 1108
170 Ga0070671_100002146 3300005355 Bacteria 15236
171 Ga0070671_100003748 3300005355 Bacteria 11935
172 Ga0070671_100004611 3300005355 Bacteria 10927
173 Ga0070671_100012700 3300005355 Bacteria 6788
174 Ga0070671_100022396 3300005355 Bacteria 5160
175 Ga0070671_100028527 3300005355 Bacteria 4596
176 Ga0070671_100039349 3300005355 Bacteria 3925
177 Ga0070671_100061442 3300005355 Bacteria 3129
178 Ga0070671_100086725 3300005355 Bacteria 2619
179 Ga0070671_100176187 3300005355 Bacteria 1810
180 Ga0070671_100538714 3300005355 Bacteria 1006
181 Ga0070674_100013432 3300005356 Bacteria 5063
182 Ga0070674_100026668 3300005356 Bacteria 3778
183 Ga0070674_100077051 3300005356 Bacteria 2373
184 Ga0070674_100184958 3300005356 Bacteria 1598
185 Ga0070674_100214293 3300005356 Bacteria 1495
186 Ga0070674_100437335 3300005356 Bacteria 1077
187 Ga0070673_100000995 3300005364 Bacteria 16070
188 Ga0070673_100003078 3300005364 Bacteria 10322
189 Ga0070673_100008886 3300005364 Bacteria 6713
190 Ga0070673_100015223 3300005364 Bacteria 5395
191 Ga0070673_100035919 3300005364 Bacteria 3762
192 Ga0070673_100524367 3300005364 Bacteria 1074
193 Ga0070673_100614921 3300005364 Bacteria 992
194 Ga0070673_100701184 3300005364 Bacteria 929
195 Ga0070688_100176627 3300005365 Bacteria 1478
196 Ga0070659_100006502 3300005366 Bacteria 8436
197 Ga0070659_100010818 3300005366 Bacteria 6729
198 Ga0070659_100014992 3300005366 Bacteria 5797
199 Ga0070659_100017370 3300005366 Bacteria 5413
200 Ga0070659_100020008 3300005366 Bacteria 5081
201 Ga0070659_100020644 3300005366 Bacteria 5007
202 Ga0070659_100039913 3300005366 Bacteria 3666
203 Ga0070659_100045782 3300005366 Bacteria 3428
204 Ga0070659_100054594 3300005366 Bacteria 3147
205 Ga0070659_100123302 3300005366 Bacteria 2101
206 Ga0070659_100155624 3300005366 Bacteria 1867
207 Ga0070659_100183878 3300005366 Bacteria 1716
208 Ga0070659_100243351 3300005366 Bacteria 1489
209 Ga0070659_100277184 3300005366 Bacteria 1394
210 Ga0070659_100440584 3300005366 Bacteria 1104
211 Ga0070659_100543000 3300005366 Bacteria 994
212 Ga0070659_100583329 3300005366 Bacteria 959
213 Ga0070659_100595482 3300005366 Bacteria 950
214 Ga0070659_100772268 3300005366 Bacteria 834
215 Ga0070659_100835108 3300005366 Bacteria 802
216 Ga0070667_100004119 3300005367 Bacteria 12292
217 Ga0070667_100073154 3300005367 Bacteria 2922
218 Ga0070667_100093040 3300005367 Bacteria 2595
219 Ga0070667_100096185 3300005367 Bacteria 2554
220 Ga0070667_100282018 3300005367 Bacteria 1492
221 Ga0070667_100360004 3300005367 Bacteria 1318
222 Ga0070709_10337008 3300005434 Bacteria 1111
223 Ga0070714_100006882 3300005435 Bacteria 8812
224 Ga0070714_100008944 3300005435 Bacteria 7838
225 Ga0070714_100022003 3300005435 Bacteria 5223
226 Ga0070714_100023913 3300005435 Bacteria 5025
227 Ga0070714_100035022 3300005435 Bacteria 4206
228 Ga0070714_100104375 3300005435 Bacteria 2501
229 Ga0070714_100116145 3300005435 Bacteria 2376
230 Ga0070713_100007630 3300005436 Bacteria 7614
231 Ga0070713_100014226 3300005436 Bacteria 5899
232 Ga0070713_100154752 3300005436 Bacteria 2042
233 Ga0070713_100447267 3300005436 Bacteria 1213
234 Ga0070701_10295504 3300005438 Bacteria 994
235 Ga0070694_100005307 3300005444 Bacteria 7794
236 Ga0070663_100004737 3300005455 Bacteria 8026
237 Ga0070663_100011736 3300005455 Bacteria 5513
238 Ga0070663_100019984 3300005455 Bacteria 4424
239 Ga0070663_100029359 3300005455 Bacteria 3757
240 Ga0070663_100046077 3300005455 Bacteria 3083
241 Ga0070663_100055383 3300005455 Bacteria 2838
242 Ga0070663_100078622 3300005455 Bacteria 2418
243 Ga0070663_100081717 3300005455 Bacteria 2376
244 Ga0070663_100094066 3300005455 Bacteria 2225
245 Ga0070663_100115084 3300005455 Bacteria 2025
246 Ga0070663_100483376 3300005455 Bacteria 1026
247 Ga0070678_100011541 3300005456 Bacteria 5457
248 Ga0070678_100011880 3300005456 Bacteria 5389
249 Ga0070678_100012771 3300005456 Bacteria 5237
250 Ga0070678_100017466 3300005456 Bacteria 4621
251 Ga0070678_100120181 3300005456 Bacteria 2070
252 Ga0070678_100277941 3300005456 Bacteria 1415
253 Ga0070662_100001710 3300005457 Bacteria 13501
254 Ga0070662_100001767 3300005457 Bacteria 13295
255 Ga0070662_100008913 3300005457 Bacteria 6540
256 Ga0070662_100042864 3300005457 Bacteria 3234
257 Ga0070662_100052169 3300005457 Bacteria 2955
258 Ga0070662_100069466 3300005457 Bacteria 2592
259 Ga0070662_100083480 3300005457 Bacteria 2384
260 Ga0070662_100108347 3300005457 Bacteria 2113
261 Ga0070662_100144674 3300005457 Bacteria 1846
262 Ga0070662_100182549 3300005457 Bacteria 1655
263 Ga0070662_100194528 3300005457 Bacteria 1606
264 Ga0070681_10065948 3300005458 Bacteria 3589
265 Ga0070681_10099770 3300005458 Bacteria 2849
266 Ga0070681_10273433 3300005458 Bacteria 1601
267 Ga0070681_10516432 3300005458 Bacteria 1108
268 Ga0070681_10558901 3300005458 Bacteria 1058
269 Ga0068867_100024875 3300005459 Bacteria 4294
270 Ga0068867_100029478 3300005459 Bacteria 3954
271 Ga0068867_100051821 3300005459 Bacteria 3027
272 Ga0070685_10085069 3300005466 Bacteria 1904
273 Ga0070685_10261635 3300005466 Bacteria 1151
274 Ga0070679_100020767 3300005530 Bacteria 6406
275 Ga0070679_100119874 3300005530 Bacteria 2616
276 Ga0070679_100125523 3300005530 Bacteria 2549
277 Ga0070679_100142677 3300005530 Bacteria 2374
278 Ga0070679_100183190 3300005530 Bacteria 2066
279 Ga0070679_100620822 3300005530 Bacteria 1024
280 Ga0070679_100708029 3300005530 Bacteria 950
281 Ga0070679_100994387 3300005530 Bacteria 783
282 Ga0070679_101228236 3300005530 Bacteria 695
283 Ga0070684_100002809 3300005535 Bacteria 12917
284 Ga0070684_100005959 3300005535 Bacteria 9391
285 Ga0070684_100008971 3300005535 Bacteria 7855
286 Ga0070684_100111644 3300005535 Bacteria 2452
287 Ga0070684_100231440 3300005535 Bacteria 1687
288 Ga0068853_100023202 3300005539 Bacteria 5192
289 Ga0068853_100037971 3300005539 Bacteria 4101
290 Ga0068853_100053807 3300005539 Bacteria 3467
291 Ga0068853_100095575 3300005539 Bacteria 2620
292 Ga0068853_100185580 3300005539 Bacteria 1888
293 Ga0068853_100230834 3300005539 Bacteria 1693
294 Ga0068853_100924020 3300005539 Bacteria 838
295 Ga0070672_100000482 3300005543 Bacteria 23162
296 Ga0070672_100001617 3300005543 Bacteria 14007
297 Ga0070672_100042697 3300005543 Bacteria 3492
298 Ga0070672_100107374 3300005543 Bacteria 2272
299 Ga0070672_100142293 3300005543 Bacteria 1979
300 Ga0070672_100164058 3300005543 Bacteria 1845
301 Ga0070672_100376559 3300005543 Bacteria 1214
302 Ga0070672_100421770 3300005543 Bacteria 1146
303 Ga0070686_100048910 3300005544 Bacteria 2681
304 Ga0070686_101012470 3300005544 Bacteria 682
305 Ga0070695_100066139 3300005545 Bacteria 2355
306 Ga0070693_100245932 3300005547 Bacteria 1183
307 Ga0070665_100000226 3300005548 Bacteria 94176
308 Ga0070665_100012999 3300005548 Bacteria 8384
309 Ga0070665_100018505 3300005548 Bacteria 6982
310 Ga0070665_100126785 3300005548 Bacteria 2555
311 Ga0070665_100249528 3300005548 Bacteria 1776
312 Ga0070665_100355102 3300005548 Bacteria 1471
313 Ga0070665_101026542 3300005548 Bacteria 837
314 Ga0068855_100009143 3300005563 Bacteria 11968
315 Ga0068855_100009305 3300005563 Bacteria 11862
316 Ga0068855_100025452 3300005563 Bacteria 7080
317 Ga0068855_100060594 3300005563 Bacteria 4425
318 Ga0068855_100185320 3300005563 Bacteria 2351
319 Ga0068855_100251061 3300005563 Bacteria 1973
320 Ga0068855_100288069 3300005563 Bacteria 1821
321 Ga0068855_100290025 3300005563 Bacteria 1814
322 Ga0068855_100307392 3300005563 Bacteria 1755
323 Ga0068855_100308329 3300005563 Bacteria 1752
324 Ga0068855_100672805 3300005563 Bacteria 1110
325 Ga0068855_100892553 3300005563 Bacteria 939
326 Ga0068855_100961945 3300005563 Bacteria 899
327 Ga0068855_101091922 3300005563 Bacteria 834
328 Ga0070664_100004011 3300005564 Bacteria 11822
329 Ga0070664_100004751 3300005564 Bacteria 10894
330 Ga0070664_100017818 3300005564 Bacteria 5832
331 Ga0070664_100019031 3300005564 Bacteria 5646
332 Ga0070664_100027820 3300005564 Bacteria 4701
333 Ga0070664_100028456 3300005564 Bacteria 4649
334 Ga0070664_100036997 3300005564 Bacteria 4102
335 Ga0070664_100073135 3300005564 Bacteria 2940
336 Ga0070664_100150692 3300005564 Bacteria 2053
337 Ga0070664_100200116 3300005564 Bacteria 1782
338 Ga0070664_100214185 3300005564 Bacteria 1722
339 Ga0070664_100258763 3300005564 Bacteria 1566
340 Ga0068857_100007161 3300005577 Bacteria 9609
341 Ga0068857_100009126 3300005577 Bacteria 8605
342 Ga0068857_100022950 3300005577 Bacteria 5489
343 Ga0068857_100062321 3300005577 Bacteria 3315
344 Ga0068857_100099662 3300005577 Bacteria 2606
345 Ga0068857_100166545 3300005577 Bacteria 2002
346 Ga0068857_100511467 3300005577 Bacteria 1128
347 Ga0068857_100614600 3300005577 Bacteria 1028
348 Ga0068857_100688485 3300005577 Bacteria 971
349 Ga0068854_100005470 3300005578 Bacteria 8025
350 Ga0068854_100007242 3300005578 Bacteria 7083
351 Ga0068854_100023772 3300005578 Bacteria 4189
352 Ga0068854_100041960 3300005578 Bacteria 3235
353 Ga0068854_100146497 3300005578 Bacteria 1817
354 Ga0068854_100205538 3300005578 Bacteria 1550
355 Ga0068854_100322277 3300005578 Bacteria 1256
356 Ga0068854_100323305 3300005578 Bacteria 1254
357 Ga0068854_100323670 3300005578 Bacteria 1254
358 Ga0068854_100442421 3300005578 Bacteria 1084
359 Ga0068854_100689817 3300005578 Bacteria 880
360 Ga0068856_100006488 3300005614 Bacteria 11473
361 Ga0068856_100026603 3300005614 Bacteria 5641
362 Ga0068856_100041610 3300005614 Bacteria 4516
363 Ga0068856_100078513 3300005614 Bacteria 3273
364 Ga0068856_100130367 3300005614 Bacteria 2519
365 Ga0068856_100154608 3300005614 Bacteria 2304
366 Ga0068856_100167254 3300005614 Bacteria 2210
367 Ga0068856_100297090 3300005614 Bacteria 1632
368 Ga0068856_100470454 3300005614 Bacteria 1278
369 Ga0068856_100490220 3300005614 Bacteria 1250
370 Ga0068856_100594435 3300005614 Bacteria 1128
371 Ga0068856_101045715 3300005614 Bacteria 834
372 Ga0068856_101111095 3300005614 Bacteria 808
373 Ga0068852_100000780 3300005616 Bacteria 20902
374 Ga0068852_100002189 3300005616 Bacteria 13410
375 Ga0068852_100017688 3300005616 Bacteria 5599
376 Ga0068852_100034726 3300005616 Bacteria 4199
377 Ga0068852_100047517 3300005616 Bacteria 3662
378 Ga0068852_100109864 3300005616 Bacteria 2505
379 Ga0068852_100121968 3300005616 Bacteria 2388
380 Ga0068852_100179511 3300005616 Bacteria 1990
381 Ga0068852_100189999 3300005616 Bacteria 1937
382 Ga0068852_100221014 3300005616 Bacteria 1801
383 Ga0068852_100252703 3300005616 Bacteria 1689
384 Ga0068852_100306236 3300005616 Bacteria 1539
385 Ga0068852_100342015 3300005616 Bacteria 1458
386 Ga0068852_100407378 3300005616 Bacteria 1339
387 Ga0068852_100497505 3300005616 Bacteria 1213
388 Ga0068852_100544352 3300005616 Bacteria 1160
389 Ga0068852_100757330 3300005616 Bacteria 983
390 Ga0068852_101215525 3300005616 Bacteria 775
391 Ga0068852_101394042 3300005616 Bacteria 723
392 Ga0068859_100003376 3300005617 Bacteria 16233
393 Ga0068859_100011644 3300005617 Bacteria 8841
394 Ga0068859_100029265 3300005617 Bacteria 5526
395 Ga0068859_100099201 3300005617 Bacteria 2968
396 Ga0068859_100102175 3300005617 Bacteria 2924
397 Ga0068859_100184142 3300005617 Bacteria 2172
398 Ga0068859_100296385 3300005617 Bacteria 1710
399 Ga0068864_100000716 3300005618 Bacteria 27804
400 Ga0068864_100007189 3300005618 Bacteria 9146
401 Ga0068864_100030568 3300005618 Bacteria 4565
402 Ga0068864_100041908 3300005618 Bacteria 3916
403 Ga0068864_100075692 3300005618 Bacteria 2940
404 Ga0068864_100138044 3300005618 Bacteria 2197
405 Ga0068864_100174250 3300005618 Bacteria 1963
406 Ga0068864_100374809 3300005618 Bacteria 1347
407 Ga0068866_10377655 3300005718 Bacteria 908
408 Ga0068861_100034144 3300005719 Bacteria 3760
409 Ga0068861_100116738 3300005719 Bacteria 2146
410 Ga0068861_100656044 3300005719 Bacteria 970
411 Ga0068851_10008326 3300005834 Bacteria 4794
412 Ga0068851_10011272 3300005834 Bacteria 4189
413 Ga0068851_10034497 3300005834 Bacteria 2526
414 Ga0068851_10041897 3300005834 Bacteria 2303
415 Ga0068851_10088129 3300005834 Bacteria 1630
416 Ga0068851_10323094 3300005834 Bacteria 892
417 Ga0068851_10392874 3300005834 Bacteria 815
418 Ga0068870_10243541 3300005840 Bacteria 1111
419 Ga0068863_100001961 3300005841 Bacteria 20447
420 Ga0068863_100008814 3300005841 Bacteria 9850
421 Ga0068863_100011229 3300005841 Bacteria 8680
422 Ga0068863_100022629 3300005841 Bacteria 6002
423 Ga0068863_100055577 3300005841 Bacteria 3748
424 Ga0068863_100094661 3300005841 Bacteria 2835
425 Ga0068863_100105286 3300005841 Bacteria 2684
426 Ga0068863_100110400 3300005841 Bacteria 2619
427 Ga0068863_100159590 3300005841 Bacteria 2160
428 Ga0068858_100000642 3300005842 Bacteria 36408
429 Ga0068858_100004459 3300005842 Bacteria 13721
430 Ga0068858_100030657 3300005842 Bacteria 4994
431 Ga0068858_100055982 3300005842 Bacteria 3645
432 Ga0068858_100196002 3300005842 Bacteria 1909
433 Ga0068858_100392349 3300005842 Bacteria 1333
434 Ga0068860_100019853 3300005843 Bacteria 6517
435 Ga0068860_100053149 3300005843 Bacteria 3852
436 Ga0068860_100090482 3300005843 Bacteria 2915
437 Ga0068860_100455531 3300005843 Bacteria 1272
438 Ga0068860_100479325 3300005843 Bacteria 1240
439 Ga0068860_101376179 3300005843 Bacteria 727
440 Ga0068862_100095319 3300005844 Bacteria 2596
441 Ga0068862_100098159 3300005844 Bacteria 2558
442 Ga0068862_100169492 3300005844 Bacteria 1954
443 Ga0068862_100182804 3300005844 Bacteria 1883
444 Ga0068862_101205744 3300005844 Bacteria 755
445 Ga0081539_10033273 3300005985 Bacteria 3143
446 Ga0081539_10074513 3300005985 Bacteria 1807
447 Ga0070717_10002889 3300006028 Bacteria 12195
448 Ga0075365_10513759 3300006038 Bacteria 847
449 Ga0070716_100158059 3300006173 Bacteria 1465
450 Ga0070712_100018385 3300006175 Bacteria 4540
451 Ga0070712_100051022 3300006175 Bacteria 2881
452 Ga0075369_10032479 3300006186 Bacteria 2208
453 Ga0075366_10157047 3300006195 Bacteria 1378
454 Ga0075366_10211207 3300006195 Bacteria 1181
455 Ga0097621_100055075 3300006237 Bacteria 3247
456 Ga0097621_100195317 3300006237 Bacteria 1754
457 Ga0097621_100679005 3300006237 Bacteria 947
458 Ga0097621_101121100 3300006237 Bacteria 739
459 Ga0075370_10286577 3300006353 Bacteria 978
460 Ga0068871_100004648 3300006358 Bacteria 9590
461 Ga0068871_100045352 3300006358 Bacteria 3538
462 Ga0068871_100137305 3300006358 Bacteria 2077
463 Ga0075431_100050200 3300006847 Bacteria 4302
464 Ga0075429_100380274 3300006880 Bacteria 1236
465 Ga0068865_100041567 3300006881 Bacteria 3129
466 Ga0068865_100089595 3300006881 Bacteria 2228
467 Ga0068865_100170530 3300006881 Bacteria 1668
468 Ga0068865_100737593 3300006881 Bacteria 845
469 Ga0097620_100003376 3300006931 Bacteria 16233
470 Ga0097620_100011643 3300006931 Bacteria 8841
471 Ga0097620_100029264 3300006931 Bacteria 5526
472 Ga0097620_100099201 3300006931 Bacteria 2968
473 Ga0097620_100102180 3300006931 Bacteria 2924
474 Ga0097620_100184151 3300006931 Bacteria 2172
475 Ga0097620_100296401 3300006931 Bacteria 1710
476 Ga0075435_100083437 3300007076 Bacteria 2627
477 Ga0105250_10071186 3300009092 Bacteria 1404
478 Ga0105240_10036403 3300009093 Bacteria 6332
479 Ga0105240_10050742 3300009093 Bacteria 5228
480 Ga0105240_10065704 3300009093 Bacteria 4502
481 Ga0105240_10072355 3300009093 Bacteria 4261
482 Ga0105240_10100438 3300009093 Bacteria 3521
483 Ga0105240_10227835 3300009093 Bacteria 2167
484 Ga0111539_10103379 3300009094 Bacteria 3344
485 Ga0105245_10059524 3300009098 Bacteria 3440
486 Ga0105245_10064855 3300009098 Bacteria 3302
487 Ga0105245_10130216 3300009098 Bacteria 2359
488 Ga0105245_10179486 3300009098 Bacteria 2022
489 Ga0105247_10097125 3300009101 Bacteria 1879
490 Ga0105247_10291003 3300009101 Bacteria 1130
491 Ga0105243_10000213 3300009148 Bacteria 67585
492 Ga0105243_10026034 3300009148 Bacteria 4476
493 Ga0105243_10083438 3300009148 Bacteria 2614
494 Ga0105243_10686753 3300009148 Bacteria 996
495 Ga0105241_10329989 3300009174 Bacteria 1318
496 Ga0105241_10366956 3300009174 Bacteria 1254
497 Ga0105241_10895247 3300009174 Bacteria 824
498 Ga0105242_10011421 3300009176 Bacteria 6828
499 Ga0105242_10029287 3300009176 Bacteria 4391
500 Ga0105242_10573557 3300009176 Bacteria 1085
501 Ga0105248_10001772 3300009177 Bacteria 24028
502 Ga0105248_10008090 3300009177 Bacteria 11542
503 Ga0105248_10023558 3300009177 Bacteria 6839
504 Ga0105248_10033985 3300009177 Bacteria 5700
505 Ga0105248_10034417 3300009177 Bacteria 5664
506 Ga0105248_10046685 3300009177 Bacteria 4855
507 Ga0105248_10108374 3300009177 Bacteria 3132
508 Ga0105248_10293649 3300009177 Bacteria 1830
509 Ga0105248_10299327 3300009177 Bacteria 1811
510 Ga0105237_10014995 3300009545 Bacteria 8077
511 Ga0105237_10067815 3300009545 Bacteria 3561
512 Ga0105237_10158678 3300009545 Bacteria 2259
513 Ga0105237_10308411 3300009545 Bacteria 1586
514 Ga0105238_10012445 3300009551 Bacteria 8582
515 Ga0105238_10123456 3300009551 Bacteria 2569
516 Ga0105238_10151955 3300009551 Bacteria 2290
517 Ga0105238_10244734 3300009551 Bacteria 1771
518 Ga0105238_10409859 3300009551 Bacteria 1349
519 Ga0105238_10488600 3300009551 Bacteria 1231
520 Ga0105238_11072834 3300009551 Bacteria 828
521 Ga0105238_11081901 3300009551 Bacteria 824
522 Ga0105249_10006822 3300009553 Bacteria 9955
523 Ga0105249_10021736 3300009553 Bacteria 5745
524 Ga0105249_10507355 3300009553 Bacteria 1252
525 Ga0105239_10102886 3300010375 Bacteria 3161
526 Ga0105239_10324058 3300010375 Bacteria 1738
527 Ga0105239_10406932 3300010375 Bacteria 1540
528 Ga0105239_10599632 3300010375 Bacteria 1256
529 Ga0105246_10074858 3300011119 Bacteria 2395
530 Ga0105246_10313770 3300011119 Bacteria 1271
531 Ga0157327_1012387 3300012512 Bacteria 840
532 Ga0157326_1002954 3300012513 Bacteria 1797
533 Ga0157373_10020464 3300013100 Bacteria 4809
534 Ga0157373_10039550 3300013100 Bacteria 3376
535 Ga0157373_10048638 3300013100 Bacteria 3023
536 Ga0157373_10061734 3300013100 Bacteria 2654
537 Ga0157373_10066321 3300013100 Bacteria 2554
538 Ga0157373_10112412 3300013100 Bacteria 1915
539 Ga0157373_10121551 3300013100 Bacteria 1835
540 Ga0157373_10132271 3300013100 Bacteria 1754
541 Ga0157373_10186941 3300013100 Bacteria 1459
542 Ga0157373_10211010 3300013100 Bacteria 1369
543 Ga0157373_10294906 3300013100 Bacteria 1150
544 Ga0157373_10319874 3300013100 Bacteria 1104
545 Ga0157373_10355840 3300013100 Bacteria 1045
546 Ga0157371_10000059 3300013102 Bacteria 170541
547 Ga0157371_10010430 3300013102 Bacteria 7238
548 Ga0157371_10023169 3300013102 Bacteria 4540
549 Ga0157371_10028922 3300013102 Bacteria 4012
550 Ga0157371_10031035 3300013102 Bacteria 3850
551 Ga0157371_10031672 3300013102 Bacteria 3810
552 Ga0157371_10125755 3300013102 Bacteria 1823
553 Ga0157371_10148166 3300013102 Bacteria 1673
554 Ga0157371_10149470 3300013102 Bacteria 1665
555 Ga0157371_10244958 3300013102 Bacteria 1290
556 Ga0157371_10309589 3300013102 Bacteria 1144
557 Ga0157371_10471902 3300013102 Bacteria 924
558 Ga0157371_10526587 3300013102 Bacteria 874
559 Ga0157371_10569202 3300013102 Bacteria 841
560 Ga0157370_10001517 3300013104 Bacteria 28707
561 Ga0157370_10030709 3300013104 Bacteria 5263
562 Ga0157370_10079475 3300013104 Bacteria 3088
563 Ga0157370_10084885 3300013104 Bacteria 2975
564 Ga0157370_10089235 3300013104 Bacteria 2896
565 Ga0157370_10101658 3300013104 Bacteria 2692
566 Ga0157370_10126912 3300013104 Bacteria 2381
567 Ga0157370_10139218 3300013104 Bacteria 2261
568 Ga0157370_10159008 3300013104 Bacteria 2102
569 Ga0157370_10256990 3300013104 Bacteria 1615
570 Ga0157370_10491531 3300013104 Bacteria 1127
571 Ga0157370_10603773 3300013104 Bacteria 1005
572 Ga0157370_10750340 3300013104 Bacteria 889
573 Ga0157370_11084001 3300013104 Bacteria 724
574 Ga0157369_10000201 3300013105 Bacteria 82836
575 Ga0157369_10011815 3300013105 Bacteria 9917
576 Ga0157369_10032604 3300013105 Bacteria 5728
577 Ga0157369_10050586 3300013105 Bacteria 4499
578 Ga0157369_10051385 3300013105 Bacteria 4460
579 Ga0157369_10063659 3300013105 Bacteria 3973
580 Ga0157369_10074576 3300013105 Bacteria 3638
581 Ga0157369_10290683 3300013105 Bacteria 1701
582 Ga0157369_10384446 3300013105 Bacteria 1457
583 Ga0157369_10386468 3300013105 Bacteria 1452
584 Ga0157369_10486957 3300013105 Bacteria 1276
585 Ga0157369_10600631 3300013105 Bacteria 1136
586 Ga0157369_10631080 3300013105 Bacteria 1105
587 Ga0157369_10737704 3300013105 Bacteria 1014
588 Ga0157369_10881441 3300013105 Bacteria 918
589 Ga0157374_10004801 3300013296 Bacteria 11345
590 Ga0157374_10012198 3300013296 Bacteria 7468
591 Ga0157374_10056725 3300013296 Bacteria 3657
592 Ga0157374_10067150 3300013296 Bacteria 3371
593 Ga0157374_10227665 3300013296 Bacteria 1831
594 Ga0157374_10232179 3300013296 Bacteria 1812
595 Ga0157374_10306601 3300013296 Bacteria 1571
596 Ga0157374_10488603 3300013296 Bacteria 1235
597 Ga0157374_10701800 3300013296 Bacteria 1025
598 Ga0157378_10002131 3300013297 Bacteria 17601
599 Ga0157378_10055263 3300013297 Bacteria 3536
600 Ga0157378_10078495 3300013297 Bacteria 2978
601 Ga0157378_10571359 3300013297 Bacteria 1139
602 Ga0163162_10016498 3300013306 Bacteria 7216
603 Ga0163162_10051750 3300013306 Bacteria 4122
604 Ga0163162_10053659 3300013306 Bacteria 4052
605 Ga0163162_10158119 3300013306 Bacteria 2387
606 Ga0163162_10246404 3300013306 Bacteria 1918
607 Ga0163162_10767938 3300013306 Bacteria 1082
608 Ga0163162_10774284 3300013306 Bacteria 1078
609 Ga0163162_11418076 3300013306 Bacteria 790
610 Ga0163162_11421586 3300013306 Bacteria 789
611 Ga0157372_10044687 3300013307 Bacteria 4910
612 Ga0157372_10076321 3300013307 Bacteria 3783
613 Ga0157372_10077732 3300013307 Bacteria 3749
614 Ga0157372_10100963 3300013307 Bacteria 3293
615 Ga0157372_10101700 3300013307 Bacteria 3282
616 Ga0157372_10143455 3300013307 Bacteria 2754
617 Ga0157372_10555367 3300013307 Bacteria 1338
618 Ga0157372_10995408 3300013307 Bacteria 971
619 Ga0157372_11121821 3300013307 Bacteria 910
620 Ga0157372_11665630 3300013307 Bacteria 734
621 Ga0157375_10000628 3300013308 Bacteria 31364
622 Ga0157375_10005662 3300013308 Bacteria 10873
623 Ga0157375_10010643 3300013308 Bacteria 8099
624 Ga0157375_10036423 3300013308 Bacteria 4707
625 Ga0157375_10394985 3300013308 Bacteria 1550
626 Ga0157375_11069884 3300013308 Bacteria 943
627 Ga0163163_10001581 3300014325 Bacteria 19174
628 Ga0163163_10017559 3300014325 Bacteria 6678
629 Ga0163163_10069124 3300014325 Bacteria 3516
630 Ga0163163_10337827 3300014325 Bacteria 1561
631 Ga0163163_10399775 3300014325 Bacteria 1432
632 Ga0163163_11489799 3300014325 Bacteria 738
633 Ga0157380_10006064 3300014326 Bacteria 8471
634 Ga0157377_10102284 3300014745 Bacteria 1709
635 Ga0157377_10523142 3300014745 Bacteria 833
636 Ga0157379_10006904 3300014968 Bacteria 9818
637 Ga0157379_10135239 3300014968 Bacteria 2220
638 Ga0157379_10223708 3300014968 Bacteria 1705
639 Ga0157379_10441692 3300014968 Bacteria 1200
640 Ga0157376_10013327 3300014969 Bacteria 6132
641 Ga0163161_10008005 3300017792 Bacteria 7309
642 Ga0163161_10117068 3300017792 Bacteria 1998
643 Ga0213876_10004311 3300021384 Bacteria 7972
644 Ga0213876_10058085 3300021384 Bacteria 2042
645 Ga0213875_10003717 3300021388 Bacteria 8598
646 Ga0209563_100116 3300025230 Bacteria 134661
647 Ga0209646_1003071 3300025246 Bacteria 3404
648 Ga0209148_1000011 3300025254 Bacteria 1196503
649 Ga0209233_1024294 3300025261 Bacteria 1518
650 Ga0207666_1000661 3300025271 Bacteria 4134
651 Ga0209455_1000006 3300025272 Bacteria 1196503
652 Ga0209758_1000001 3300025297 Bacteria 1981790
653 Ga0207697_10057127 3300025315 Bacteria 1620
654 Ga0207697_10225478 3300025315 Bacteria 827
655 Ga0207656_10009031 3300025321 Bacteria 3694
656 Ga0207656_10017763 3300025321 Bacteria 2791
657 Ga0207656_10024815 3300025321 Bacteria 2428
658 Ga0207656_10046213 3300025321 Bacteria 1867
659 Ga0207656_10100153 3300025321 Bacteria 1327
660 Ga0207656_10127553 3300025321 Bacteria 1189
661 Ga0207656_10260571 3300025321 Bacteria 851
662 Ga0207696_1044138 3300025711 Bacteria 1294
663 Ga0207682_10096857 3300025893 Bacteria 1286
664 Ga0207710_10138377 3300025900 Bacteria 1174
665 Ga0207710_10242790 3300025900 Bacteria 899
666 Ga0207688_10040501 3300025901 Bacteria 2589
667 Ga0207688_10041422 3300025901 Bacteria 2562
668 Ga0207688_10137939 3300025901 Bacteria 1434
669 Ga0207688_10211734 3300025901 Bacteria 1165
670 Ga0207688_10343569 3300025901 Bacteria 919
671 Ga0207680_10017198 3300025903 Bacteria 3816
672 Ga0207680_10064871 3300025903 Bacteria 2240
673 Ga0207680_10078098 3300025903 Bacteria 2072
674 Ga0207680_10198057 3300025903 Bacteria 1367
675 Ga0207647_10002185 3300025904 Bacteria 14916
676 Ga0207647_10002253 3300025904 Bacteria 14695
677 Ga0207647_10010193 3300025904 Bacteria 6640
678 Ga0207647_10011244 3300025904 Bacteria 6284
679 Ga0207647_10020677 3300025904 Bacteria 4409
680 Ga0207647_10056128 3300025904 Bacteria 2417
681 Ga0207647_10059246 3300025904 Bacteria 2343
682 Ga0207699_10006940 3300025906 Bacteria 5514
683 Ga0207645_10018349 3300025907 Bacteria 4604
684 Ga0207645_10043709 3300025907 Bacteria 2867
685 Ga0207645_10064610 3300025907 Bacteria 2338
686 Ga0207645_10367677 3300025907 Bacteria 964
687 Ga0207645_10718365 3300025907 Bacteria 679
688 Ga0207643_10337360 3300025908 Bacteria 944
689 Ga0207705_10000002 3300025909 Bacteria 2046852
690 Ga0207705_10000197 3300025909 Bacteria 61058
691 Ga0207705_10001531 3300025909 Bacteria 18346
692 Ga0207705_10008123 3300025909 Bacteria 7685
693 Ga0207705_10009761 3300025909 Bacteria 6985
694 Ga0207705_10010079 3300025909 Bacteria 6878
695 Ga0207705_10023463 3300025909 Bacteria 4400
696 Ga0207705_10025066 3300025909 Bacteria 4257
697 Ga0207705_10028878 3300025909 Bacteria 3953
698 Ga0207705_10045167 3300025909 Bacteria 3166
699 Ga0207705_10072990 3300025909 Bacteria 2489
700 Ga0207705_10083429 3300025909 Bacteria 2331
701 Ga0207705_10088512 3300025909 Bacteria 2265
702 Ga0207705_10113567 3300025909 Bacteria 2003
703 Ga0207705_10145847 3300025909 Bacteria 1771
704 Ga0207705_10153721 3300025909 Bacteria 1725
705 Ga0207705_10160023 3300025909 Bacteria 1691
706 Ga0207705_10212578 3300025909 Bacteria 1467
707 Ga0207705_10222125 3300025909 Bacteria 1435
708 Ga0207705_10255888 3300025909 Bacteria 1336
709 Ga0207705_10292368 3300025909 Bacteria 1248
710 Ga0207705_10437614 3300025909 Bacteria 1013
711 Ga0207705_10491249 3300025909 Bacteria 953
712 Ga0207705_10530115 3300025909 Bacteria 915
713 Ga0207654_10017183 3300025911 Bacteria 3779
714 Ga0207654_10021170 3300025911 Bacteria 3455
715 Ga0207654_10074794 3300025911 Bacteria 2022
716 Ga0207707_10053133 3300025912 Bacteria 3527
717 Ga0207707_10059955 3300025912 Bacteria 3311
718 Ga0207707_10255593 3300025912 Bacteria 1521
719 Ga0207707_10399019 3300025912 Bacteria 1181
720 Ga0207695_10027280 3300025913 Bacteria 6362
721 Ga0207695_10051482 3300025913 Bacteria 4324
722 Ga0207695_10095462 3300025913 Bacteria 2977
723 Ga0207695_10127308 3300025913 Bacteria 2508
724 Ga0207695_10391265 3300025913 Bacteria 1275
725 Ga0207671_10133564 3300025914 Bacteria 1907
726 Ga0207671_10289874 3300025914 Bacteria 1292
727 Ga0207671_10300004 3300025914 Bacteria 1269
728 Ga0207693_10016452 3300025915 Bacteria 5909
729 Ga0207693_10029157 3300025915 Bacteria 4362
730 Ga0207660_10000486 3300025917 Bacteria 26452
731 Ga0207660_10004335 3300025917 Bacteria 9252
732 Ga0207660_10018885 3300025917 Bacteria 4603
733 Ga0207660_10028327 3300025917 Bacteria 3830
734 Ga0207660_10040569 3300025917 Bacteria 3260
735 Ga0207660_10171572 3300025917 Bacteria 1679
736 Ga0207660_10300405 3300025917 Bacteria 1278
737 Ga0207660_10301590 3300025917 Bacteria 1276
738 Ga0207660_10343688 3300025917 Bacteria 1195
739 Ga0207660_10531958 3300025917 Bacteria 955
740 Ga0207660_10924118 3300025917 Bacteria 712
741 Ga0207657_10000443 3300025919 Bacteria 43872
742 Ga0207657_10000468 3300025919 Bacteria 42779
743 Ga0207657_10000962 3300025919 Bacteria 30503
744 Ga0207657_10002144 3300025919 Bacteria 21379
745 Ga0207657_10006400 3300025919 Bacteria 12224
746 Ga0207657_10008544 3300025919 Bacteria 10382
747 Ga0207657_10008661 3300025919 Bacteria 10301
748 Ga0207657_10009276 3300025919 Bacteria 9912
749 Ga0207657_10013729 3300025919 Bacteria 7928
750 Ga0207657_10014819 3300025919 Bacteria 7589
751 Ga0207657_10017445 3300025919 Bacteria 6881
752 Ga0207657_10024901 3300025919 Bacteria 5531
753 Ga0207657_10050952 3300025919 Bacteria 3600
754 Ga0207657_10055261 3300025919 Bacteria 3430
755 Ga0207657_10095949 3300025919 Bacteria 2467
756 Ga0207657_10114704 3300025919 Bacteria 2221
757 Ga0207657_10163240 3300025919 Bacteria 1808
758 Ga0207657_10165153 3300025919 Bacteria 1796
759 Ga0207657_10189365 3300025919 Bacteria 1661
760 Ga0207657_10195724 3300025919 Bacteria 1628
761 Ga0207657_10212639 3300025919 Bacteria 1551
762 Ga0207657_10226608 3300025919 Bacteria 1496
763 Ga0207657_10316102 3300025919 Bacteria 1235
764 Ga0207657_10377666 3300025919 Bacteria 1116
765 Ga0207657_10733883 3300025919 Bacteria 766
766 Ga0207657_10838862 3300025919 Bacteria 709
767 Ga0207649_10001155 3300025920 Bacteria 15892
768 Ga0207649_10001739 3300025920 Bacteria 12503
769 Ga0207649_10015100 3300025920 Bacteria 4336
770 Ga0207649_10017964 3300025920 Bacteria 4012
771 Ga0207649_10022491 3300025920 Bacteria 3643
772 Ga0207649_10027490 3300025920 Bacteria 3338
773 Ga0207649_10030074 3300025920 Bacteria 3213
774 Ga0207649_10037880 3300025920 Bacteria 2916
775 Ga0207649_10048553 3300025920 Bacteria 2618
776 Ga0207649_10088743 3300025920 Bacteria 2020
777 Ga0207649_10139487 3300025920 Bacteria 1657
778 Ga0207649_10155084 3300025920 Bacteria 1581
779 Ga0207649_10160701 3300025920 Bacteria 1556
780 Ga0207649_10185803 3300025920 Bacteria 1458
781 Ga0207649_10514381 3300025920 Bacteria 912
782 Ga0207652_10001035 3300025921 Bacteria 25477
783 Ga0207652_10089311 3300025921 Bacteria 2706
784 Ga0207652_10198512 3300025921 Bacteria 1805
785 Ga0207652_10296152 3300025921 Bacteria 1460
786 Ga0207652_10441825 3300025921 Bacteria 1173
787 Ga0207652_10482327 3300025921 Bacteria 1117
788 Ga0207681_10001506 3300025923 Bacteria 15035
789 Ga0207681_10021541 3300025923 Bacteria 4099
790 Ga0207681_10038204 3300025923 Bacteria 3179
791 Ga0207681_10170332 3300025923 Bacteria 1650
792 Ga0207681_10592186 3300025923 Bacteria 916
793 Ga0207694_10000827 3300025924 Bacteria 27549
794 Ga0207694_10026849 3300025924 Bacteria 4384
795 Ga0207694_10048173 3300025924 Bacteria 3297
796 Ga0207694_10053090 3300025924 Bacteria 3142
797 Ga0207694_10118117 3300025924 Bacteria 2115
798 Ga0207694_10152003 3300025924 Bacteria 1865
799 Ga0207694_10259170 3300025924 Bacteria 1424
800 Ga0207694_10308753 3300025924 Bacteria 1303
801 Ga0207650_10000818 3300025925 Bacteria 23885
802 Ga0207650_10003491 3300025925 Bacteria 10800
803 Ga0207650_10013727 3300025925 Bacteria 5615
804 Ga0207650_10094598 3300025925 Bacteria 2289
805 Ga0207650_10118802 3300025925 Bacteria 2056
806 Ga0207650_10230154 3300025925 Bacteria 1495
807 Ga0207650_10897330 3300025925 Bacteria 753
808 Ga0207659_10001512 3300025926 Bacteria 13838
809 Ga0207659_10144335 3300025926 Bacteria 1851
810 Ga0207659_10220841 3300025926 Bacteria 1524
811 Ga0207659_10382959 3300025926 Bacteria 1173
812 Ga0207659_10415103 3300025926 Bacteria 1128
813 Ga0207659_10515537 3300025926 Bacteria 1013
814 Ga0207659_10643511 3300025926 Bacteria 906
815 Ga0207687_10028441 3300025927 Bacteria 3755
816 Ga0207687_10030769 3300025927 Bacteria 3622
817 Ga0207687_10119874 3300025927 Bacteria 1966
818 Ga0207700_10037527 3300025928 Bacteria 3510
819 Ga0207700_10116548 3300025928 Bacteria 2158
820 Ga0207700_10726114 3300025928 Bacteria 887
821 Ga0207664_10009182 3300025929 Bacteria 6929
822 Ga0207664_10016142 3300025929 Bacteria 5441
823 Ga0207664_10052197 3300025929 Bacteria 3233
824 Ga0207664_10074862 3300025929 Bacteria 2737
825 Ga0207664_10177725 3300025929 Bacteria 1826
826 Ga0207664_10211926 3300025929 Bacteria 1676
827 Ga0207644_10000196 3300025931 Bacteria 43119
828 Ga0207644_10000683 3300025931 Bacteria 21431
829 Ga0207644_10003126 3300025931 Bacteria 10659
830 Ga0207644_10003168 3300025931 Bacteria 10585
831 Ga0207644_10004471 3300025931 Bacteria 9079
832 Ga0207644_10007550 3300025931 Bacteria 7089
833 Ga0207644_10022270 3300025931 Bacteria 4328
834 Ga0207644_10028222 3300025931 Bacteria 3883
835 Ga0207644_10028505 3300025931 Bacteria 3866
836 Ga0207644_10181214 3300025931 Bacteria 1651
837 Ga0207690_10003253 3300025932 Bacteria 9747
838 Ga0207690_10005982 3300025932 Bacteria 7210
839 Ga0207690_10006965 3300025932 Bacteria 6701
840 Ga0207690_10010263 3300025932 Bacteria 5562
841 Ga0207690_10020149 3300025932 Bacteria 4117
842 Ga0207690_10022399 3300025932 Bacteria 3930
843 Ga0207690_10034734 3300025932 Bacteria 3250
844 Ga0207690_10045718 3300025932 Bacteria 2894
845 Ga0207690_10068217 3300025932 Bacteria 2442
846 Ga0207690_10092032 3300025932 Bacteria 2145
847 Ga0207690_10102186 3300025932 Bacteria 2049
848 Ga0207690_10181157 3300025932 Bacteria 1586
849 Ga0207690_10194018 3300025932 Bacteria 1538
850 Ga0207690_10211430 3300025932 Bacteria 1479
851 Ga0207690_10394965 3300025932 Bacteria 1102
852 Ga0207690_10421685 3300025932 Bacteria 1068
853 Ga0207690_10436349 3300025932 Bacteria 1050
854 Ga0207690_10481849 3300025932 Bacteria 1001
855 Ga0207690_10503655 3300025932 Bacteria 980
856 Ga0207690_11076308 3300025932 Bacteria 670
857 Ga0207706_10000840 3300025933 Bacteria 31741
858 Ga0207706_10000866 3300025933 Bacteria 31146
859 Ga0207706_10001130 3300025933 Bacteria 27174
860 Ga0207706_10012742 3300025933 Bacteria 7653
861 Ga0207706_10035267 3300025933 Bacteria 4448
862 Ga0207706_10053907 3300025933 Bacteria 3550
863 Ga0207706_10055114 3300025933 Bacteria 3507
864 Ga0207706_10061235 3300025933 Bacteria 3314
865 Ga0207706_10067609 3300025933 Bacteria 3144
866 Ga0207706_10081956 3300025933 Bacteria 2835
867 Ga0207706_10108224 3300025933 Bacteria 2446
868 Ga0207706_10170397 3300025933 Bacteria 1913
869 Ga0207706_10178136 3300025933 Bacteria 1867
870 Ga0207706_10268476 3300025933 Bacteria 1489
871 Ga0207706_10434869 3300025933 Bacteria 1136
872 Ga0207706_10546602 3300025933 Bacteria 997
873 Ga0207686_10051273 3300025934 Bacteria 2570
874 Ga0207709_10000018 3300025935 Bacteria 431545
875 Ga0207709_10008926 3300025935 Bacteria 5534
876 Ga0207709_10173194 3300025935 Bacteria 1517
877 Ga0207709_10307926 3300025935 Bacteria 1180
878 Ga0207670_10025891 3300025936 Bacteria 3689
879 Ga0207670_10242397 3300025936 Bacteria 1389
880 Ga0207669_10000068 3300025937 Bacteria 52240
881 Ga0207669_10003644 3300025937 Bacteria 6684
882 Ga0207669_10017469 3300025937 Bacteria 3680
883 Ga0207669_10048574 3300025937 Bacteria 2522
884 Ga0207669_10064969 3300025937 Bacteria 2261
885 Ga0207669_10134445 3300025937 Bacteria 1705
886 Ga0207669_10135032 3300025937 Bacteria 1702
887 Ga0207669_10259342 3300025937 Bacteria 1299
888 Ga0207704_10002295 3300025938 Bacteria 8602
889 Ga0207704_10017580 3300025938 Bacteria 3712
890 Ga0207704_10129047 3300025938 Bacteria 1747
891 Ga0207704_10319002 3300025938 Bacteria 1198
892 Ga0207665_10013298 3300025939 Bacteria 5410
893 Ga0207691_10000705 3300025940 Bacteria 33075
894 Ga0207691_10001025 3300025940 Bacteria 27647
895 Ga0207691_10014489 3300025940 Bacteria 7519
896 Ga0207691_10028701 3300025940 Bacteria 5206
897 Ga0207691_10103916 3300025940 Bacteria 2533
898 Ga0207691_10112598 3300025940 Bacteria 2418
899 Ga0207691_10115922 3300025940 Bacteria 2378
900 Ga0207691_10326890 3300025940 Bacteria 1314
901 Ga0207711_10000044 3300025941 Bacteria 157113
902 Ga0207711_10000567 3300025941 Bacteria 37685
903 Ga0207711_10001908 3300025941 Bacteria 18939
904 Ga0207711_10003425 3300025941 Bacteria 13721
905 Ga0207711_10009332 3300025941 Bacteria 8191
906 Ga0207711_10011201 3300025941 Bacteria 7451
907 Ga0207711_10018079 3300025941 Bacteria 5861
908 Ga0207711_10023294 3300025941 Bacteria 5182
909 Ga0207711_10294255 3300025941 Bacteria 1497
910 Ga0207689_10005042 3300025942 Bacteria 11903
911 Ga0207661_10010702 3300025944 Bacteria 6610
912 Ga0207661_10012427 3300025944 Bacteria 6187
913 Ga0207661_10128967 3300025944 Bacteria 2163
914 Ga0207679_10020437 3300025945 Bacteria 4468
915 Ga0207679_10029743 3300025945 Bacteria 3806
916 Ga0207679_10039124 3300025945 Bacteria 3385
917 Ga0207679_10090650 3300025945 Bacteria 2364
918 Ga0207679_10356474 3300025945 Bacteria 1276
919 Ga0207679_10420730 3300025945 Bacteria 1179
920 Ga0207679_10488189 3300025945 Bacteria 1097
921 Ga0207679_10686668 3300025945 Bacteria 928
922 Ga0207667_10006200 3300025949 Bacteria 14517
923 Ga0207667_10011406 3300025949 Bacteria 10329
924 Ga0207667_10042004 3300025949 Bacteria 4863
925 Ga0207667_10043138 3300025949 Bacteria 4787
926 Ga0207667_10055601 3300025949 Bacteria 4160
927 Ga0207667_10059830 3300025949 Bacteria 3988
928 Ga0207667_10082828 3300025949 Bacteria 3322
929 Ga0207667_10176138 3300025949 Bacteria 2197
930 Ga0207667_10206875 3300025949 Bacteria 2012
931 Ga0207667_10262837 3300025949 Bacteria 1765
932 Ga0207667_10281690 3300025949 Bacteria 1699
933 Ga0207667_10530242 3300025949 Bacteria 1192
934 Ga0207667_10866861 3300025949 Bacteria 896
935 Ga0207667_10894020 3300025949 Bacteria 880
936 Ga0207667_11280000 3300025949 Bacteria 710
937 Ga0207651_10001251 3300025960 Bacteria 11431
938 Ga0207651_10002016 3300025960 Bacteria 9545
939 Ga0207651_10002614 3300025960 Bacteria 8605
940 Ga0207651_10019458 3300025960 Bacteria 4070
941 Ga0207651_10025639 3300025960 Bacteria 3668
942 Ga0207651_10061923 3300025960 Bacteria 2605
943 Ga0207651_10191007 3300025960 Bacteria 1633
944 Ga0207651_10508037 3300025960 Bacteria 1043
945 Ga0207712_10003387 3300025961 Bacteria 10081
946 Ga0207712_10006254 3300025961 Bacteria 7506
947 Ga0207712_10028459 3300025961 Bacteria 3739
948 Ga0207668_10000729 3300025972 Bacteria 20122
949 Ga0207668_10003245 3300025972 Bacteria 9538
950 Ga0207668_10015464 3300025972 Bacteria 4741
951 Ga0207668_10178370 3300025972 Bacteria 1673
952 Ga0207668_10688954 3300025972 Bacteria 897
953 Ga0207668_11008577 3300025972 Bacteria 744
954 Ga0207640_10000560 3300025981 Bacteria 22254
955 Ga0207640_10008683 3300025981 Bacteria 5650
956 Ga0207640_10012845 3300025981 Bacteria 4784
957 Ga0207640_10036628 3300025981 Bacteria 3082
958 Ga0207640_10037868 3300025981 Bacteria 3038
959 Ga0207640_10043758 3300025981 Bacteria 2864
960 Ga0207640_10233246 3300025981 Bacteria 1417
961 Ga0207640_10280122 3300025981 Bacteria 1309
962 Ga0207640_10383300 3300025981 Bacteria 1140
963 Ga0207658_10003798 3300025986 Bacteria 10633
964 Ga0207658_10011532 3300025986 Bacteria 6017
965 Ga0207658_10015873 3300025986 Bacteria 5171
966 Ga0207658_10023660 3300025986 Bacteria 4290
967 Ga0207658_10023742 3300025986 Bacteria 4283
968 Ga0207658_10026685 3300025986 Bacteria 4051
969 Ga0207658_10054876 3300025986 Bacteria 2950
970 Ga0207658_10073853 3300025986 Bacteria 2589
971 Ga0207658_10079767 3300025986 Bacteria 2505
972 Ga0207658_11062593 3300025986 Bacteria 739
973 Ga0207677_10005707 3300026023 Bacteria 6771
974 Ga0207677_10033650 3300026023 Bacteria 3310
975 Ga0207703_10014891 3300026035 Bacteria 6069
976 Ga0207703_10015184 3300026035 Bacteria 6009
977 Ga0207703_10019804 3300026035 Bacteria 5260
978 Ga0207703_10055651 3300026035 Bacteria 3219
979 Ga0207639_10000990 3300026041 Bacteria 19349
980 Ga0207639_10022105 3300026041 Bacteria 4578
981 Ga0207639_10064947 3300026041 Bacteria 2831
982 Ga0207639_10074993 3300026041 Bacteria 2658
983 Ga0207639_10134124 3300026041 Bacteria 2054
984 Ga0207639_10163772 3300026041 Bacteria 1877
985 Ga0207639_10186692 3300026041 Bacteria 1768
986 Ga0207639_10216648 3300026041 Bacteria 1651
987 Ga0207639_10265943 3300026041 Bacteria 1502
988 Ga0207639_10296456 3300026041 Bacteria 1428
989 Ga0207639_11543057 3300026041 Bacteria 623
990 Ga0207678_10003048 3300026067 Bacteria 15159
991 Ga0207678_10003985 3300026067 Bacteria 13281
992 Ga0207678_10007964 3300026067 Bacteria 9345
993 Ga0207678_10016258 3300026067 Bacteria 6530
994 Ga0207678_10021371 3300026067 Bacteria 5675
995 Ga0207678_10023365 3300026067 Bacteria 5406
996 Ga0207678_10035770 3300026067 Bacteria 4323
997 Ga0207678_10041105 3300026067 Bacteria 4008
998 Ga0207678_10075580 3300026067 Bacteria 2886
999 Ga0207678_10077134 3300026067 Bacteria 2854
1000 Ga0207678_10240826 3300026067 Bacteria 1549
1001 Ga0207678_10312340 3300026067 Bacteria 1351
1002 Ga0207702_10001111 3300026078 Bacteria 27466
1003 Ga0207702_10002086 3300026078 Bacteria 19309
1004 Ga0207702_10024512 3300026078 Bacteria 5006
1005 Ga0207702_10025380 3300026078 Bacteria 4918
1006 Ga0207702_10029638 3300026078 Bacteria 4555
1007 Ga0207702_10034812 3300026078 Bacteria 4212
1008 Ga0207702_10112040 3300026078 Bacteria 2428
1009 Ga0207702_10158750 3300026078 Bacteria 2064
1010 Ga0207702_10198566 3300026078 Bacteria 1858
1011 Ga0207702_10212725 3300026078 Bacteria 1798
1012 Ga0207702_10260575 3300026078 Bacteria 1632
1013 Ga0207702_10313391 3300026078 Bacteria 1492
1014 Ga0207702_10363826 3300026078 Bacteria 1387
1015 Ga0207702_10576574 3300026078 Bacteria 1102
1016 Ga0207702_10634019 3300026078 Bacteria 1050
1017 Ga0207702_10781700 3300026078 Bacteria 943
1018 Ga0207641_10005321 3300026088 Bacteria 10989
1019 Ga0207641_10046505 3300026088 Bacteria 3658
1020 Ga0207641_10052770 3300026088 Bacteria 3444
1021 Ga0207641_10080010 3300026088 Bacteria 2834
1022 Ga0207641_10103102 3300026088 Bacteria 2516
1023 Ga0207641_10106241 3300026088 Bacteria 2481
1024 Ga0207641_10251252 3300026088 Bacteria 1651
1025 Ga0207641_10310991 3300026088 Bacteria 1491
1026 Ga0207641_10500544 3300026088 Bacteria 1180
1027 Ga0207648_10002898 3300026089 Bacteria 18154
1028 Ga0207648_10010776 3300026089 Bacteria 8638
1029 Ga0207648_10072619 3300026089 Bacteria 2998
1030 Ga0207648_10093664 3300026089 Bacteria 2627
1031 Ga0207648_10120400 3300026089 Bacteria 2308
1032 Ga0207676_10003029 3300026095 Bacteria 11987
1033 Ga0207676_10006599 3300026095 Bacteria 8208
1034 Ga0207676_10061896 3300026095 Bacteria 2965
1035 Ga0207676_10172079 3300026095 Bacteria 1888
1036 Ga0207676_10421167 3300026095 Bacteria 1252
1037 Ga0207676_10439736 3300026095 Bacteria 1227
1038 Ga0207674_10000410 3300026116 Bacteria 55768
1039 Ga0207674_10002803 3300026116 Bacteria 21702
1040 Ga0207674_10005074 3300026116 Bacteria 15715
1041 Ga0207674_10014333 3300026116 Bacteria 8758
1042 Ga0207674_10015759 3300026116 Bacteria 8291
1043 Ga0207674_10020766 3300026116 Bacteria 7088
1044 Ga0207674_10027592 3300026116 Bacteria 6003
1045 Ga0207674_10058960 3300026116 Bacteria 3886
1046 Ga0207674_10098836 3300026116 Bacteria 2901
1047 Ga0207674_10147731 3300026116 Bacteria 2309
1048 Ga0207674_10472081 3300026116 Bacteria 1212
1049 Ga0207674_10931900 3300026116 Bacteria 837
1050 Ga0207675_100011384 3300026118 Bacteria 8326
1051 Ga0207675_100035218 3300026118 Bacteria 4670
1052 Ga0207675_100965873 3300026118 Bacteria 870
1053 Ga0207683_10003325 3300026121 Bacteria 14012
1054 Ga0207683_10003836 3300026121 Bacteria 13025
1055 Ga0207683_10005798 3300026121 Bacteria 10593
1056 Ga0207683_10013902 3300026121 Bacteria 6863
1057 Ga0207683_10023091 3300026121 Bacteria 5345
1058 Ga0207683_10028924 3300026121 Bacteria 4795
1059 Ga0207698_10010764 3300026142 Bacteria 5901
1060 Ga0207698_10016631 3300026142 Bacteria 4967
1061 Ga0207698_10020965 3300026142 Bacteria 4511
1062 Ga0207698_10039128 3300026142 Bacteria 3510
1063 Ga0207698_10157680 3300026142 Bacteria 1980
1064 Ga0207698_10406296 3300026142 Bacteria 1303
1065 Ga0207698_10479870 3300026142 Bacteria 1206
1066 Ga0207698_10488250 3300026142 Bacteria 1196
1067 Ga0207698_10513971 3300026142 Bacteria 1168
1068 Ga0207698_10595718 3300026142 Bacteria 1089
1069 Ga0207698_10887416 3300026142 Bacteria 898
1070 Ga0207698_11066099 3300026142 Bacteria 820
1071 Ga0207698_11128337 3300026142 Bacteria 797
1072 Ga0209996_1027522 3300027395 Bacteria 818
1073 Ga0209971_1036698 3300027682 Bacteria 1180
1074 Ga0209974_10001035 3300027876 Bacteria 9826
1075 Ga0268266_10000002 3300028379 Bacteria 3059047
1076 Ga0268266_10036777 3300028379 Bacteria 4170
1077 Ga0268266_10040623 3300028379 Bacteria 3965
1078 Ga0268266_10166573 3300028379 Bacteria 1997
1079 Ga0268266_10207698 3300028379 Bacteria 1795
1080 Ga0268266_10300597 3300028379 Bacteria 1497
1081 Ga0268266_10301313 3300028379 Bacteria 1495
1082 Ga0268265_10004178 3300028380 Bacteria 10114
1083 Ga0268265_10019528 3300028380 Bacteria 4713
1084 Ga0268265_10046912 3300028380 Bacteria 3233
1085 Ga0268265_10098863 3300028380 Bacteria 2351
1086 Ga0268265_10200403 3300028380 Bacteria 1731
1087 Ga0268265_10461802 3300028380 Bacteria 1188
1088 Ga0268264_10000338 3300028381 Bacteria 72206
1089 Ga0268264_10006757 3300028381 Bacteria 9640
1090 Ga0268264_10120257 3300028381 Bacteria 2314
1091 Ga0268264_10585837 3300028381 Bacteria 1098
1092 Ga0268264_10721314 3300028381 Bacteria 991
1093 Ga0268264_10767376 3300028381 Bacteria 961
1094 Ga0316177_1110053 3300030731 Bacteria 1580
1095 Ga0307513_10379964 3300031456 Bacteria 1152
1096 Ga0307509_10482920 3300031507 Bacteria 927
1097 Ga0307408_100010788 3300031548 Bacteria 6028
1098 Ga0307408_100141329 3300031548 Bacteria 1890
1099 Ga0307408_100446788 3300031548 Bacteria 1121
1100 Ga0307405_10002714 3300031731 Bacteria 7912
1101 Ga0307405_10047861 3300031731 Bacteria 2634
1102 Ga0307405_10103501 3300031731 Bacteria 1914
1103 Ga0307405_10123642 3300031731 Bacteria 1775
1104 Ga0307405_10480136 3300031731 Bacteria 992
1105 Ga0307413_10023813 3300031824 Bacteria 3324
1106 Ga0307413_10024662 3300031824 Bacteria 3282
1107 Ga0307413_10134133 3300031824 Bacteria 1699
1108 Ga0307413_10237393 3300031824 Bacteria 1343
1109 Ga0307413_10247484 3300031824 Bacteria 1320
1110 Ga0307413_11041345 3300031824 Bacteria 704
1111 Ga0307410_10003142 3300031852 Bacteria 8209
1112 Ga0307410_10023044 3300031852 Bacteria 3862
1113 Ga0307410_10197762 3300031852 Bacteria 1533
1114 Ga0307410_10201525 3300031852 Bacteria 1519
1115 Ga0307410_10234298 3300031852 Bacteria 1419
1116 Ga0307410_10246340 3300031852 Bacteria 1387
1117 Ga0307410_10284222 3300031852 Bacteria 1299
1118 Ga0307410_10321758 3300031852 Bacteria 1227
1119 Ga0307410_10583201 3300031852 Bacteria 930
1120 Ga0307406_10003693 3300031901 Bacteria 8333
1121 Ga0307406_10004678 3300031901 Bacteria 7458
1122 Ga0307406_10012186 3300031901 Bacteria 4898
1123 Ga0307406_10144752 3300031901 Bacteria 1687
1124 Ga0307406_10166778 3300031901 Bacteria 1589
1125 Ga0307406_10477730 3300031901 Bacteria 1006
1126 Ga0307406_10649772 3300031901 Bacteria 875
1127 Ga0307406_11090670 3300031901 Bacteria 689
1128 Ga0307407_10001719 3300031903 Bacteria 8148
1129 Ga0307407_10017599 3300031903 Bacteria 3592
1130 Ga0307407_10034380 3300031903 Bacteria 2774
1131 Ga0307407_10034474 3300031903 Bacteria 2772
1132 Ga0307407_10064549 3300031903 Bacteria 2152
1133 Ga0307407_10132547 3300031903 Bacteria 1596
1134 Ga0307407_10192512 3300031903 Bacteria 1360
1135 Ga0307407_10412798 3300031903 Bacteria 971
1136 Ga0307407_10835615 3300031903 Bacteria 703
1137 Ga0307412_10004047 3300031911 Bacteria 8173
1138 Ga0307412_10047507 3300031911 Bacteria 2820
1139 Ga0307412_10090486 3300031911 Bacteria 2139
1140 Ga0307412_10133210 3300031911 Bacteria 1808
1141 Ga0307412_10191520 3300031911 Bacteria 1546
1142 Ga0307412_10248720 3300031911 Bacteria 1379
1143 Ga0307412_11046200 3300031911 Bacteria 724
1144 Ga0307409_100015550 3300031995 Bacteria 4998
1145 Ga0307409_100016162 3300031995 Bacteria 4928
1146 Ga0307409_100021394 3300031995 Bacteria 4433
1147 Ga0307409_100035127 3300031995 Bacteria 3669
1148 Ga0307409_100204784 3300031995 Bacteria 1768
1149 Ga0307409_100260573 3300031995 Bacteria 1591
1150 Ga0307409_100277743 3300031995 Bacteria 1546
1151 Ga0307409_100297140 3300031995 Bacteria 1500
1152 Ga0307409_100307913 3300031995 Bacteria 1477
1153 Ga0307409_100464995 3300031995 Bacteria 1224
1154 Ga0307409_100849553 3300031995 Bacteria 923
1155 Ga0307409_100861699 3300031995 Bacteria 917
1156 Ga0307416_100003206 3300032002 Bacteria 9587
1157 Ga0307416_100017484 3300032002 Bacteria 5021
1158 Ga0307416_100079733 3300032002 Bacteria 2760
1159 Ga0307416_100138314 3300032002 Bacteria 2208
1160 Ga0307416_100171222 3300032002 Bacteria 2021
1161 Ga0307416_100184509 3300032002 Bacteria 1959
1162 Ga0307416_100241663 3300032002 Bacteria 1750
1163 Ga0307416_100249020 3300032002 Bacteria 1728
1164 Ga0307414_10005175 3300032004 Bacteria 7162
1165 Ga0307414_10018451 3300032004 Bacteria 4296
1166 Ga0307414_10165807 3300032004 Bacteria 1760
1167 Ga0307414_10256090 3300032004 Bacteria 1458
1168 Ga0307414_10261874 3300032004 Bacteria 1443
1169 Ga0307414_10266431 3300032004 Bacteria 1432
1170 Ga0307414_10299068 3300032004 Bacteria 1360
1171 Ga0307414_10304000 3300032004 Bacteria 1351
1172 Ga0307414_10416731 3300032004 Bacteria 1170
1173 Ga0307414_11150883 3300032004 Bacteria 717
1174 Ga0307411_10003411 3300032005 Bacteria 7367
1175 Ga0307411_10009410 3300032005 Bacteria 5134
1176 Ga0307411_10021792 3300032005 Bacteria 3758
1177 Ga0307411_10050193 3300032005 Bacteria 2715
1178 Ga0307411_10125571 3300032005 Bacteria 1865
1179 Ga0307411_10197028 3300032005 Bacteria 1543
1180 Ga0307411_10322773 3300032005 Bacteria 1247
1181 Ga0307411_10666104 3300032005 Bacteria 903
1182 Ga0307411_10745343 3300032005 Bacteria 857
1183 Ga0307411_11250209 3300032005 Bacteria 675
1184 Ga0307415_100003613 3300032126 Bacteria 7902
1185 Ga0307415_100003658 3300032126 Bacteria 7862
1186 Ga0307415_100046965 3300032126 Bacteria 2904
1187 Ga0307415_100048041 3300032126 Bacteria 2877
1188 Ga0307415_100063706 3300032126 Bacteria 2562
1189 Ga0307415_100103301 3300032126 Bacteria 2096
1190 Ga0307415_100160124 3300032126 Bacteria 1743
1191 Ga0307415_100198036 3300032126 Bacteria 1591
1192 Ga0307415_100200286 3300032126 Bacteria 1584
1193 Ga0307415_100428246 3300032126 Bacteria 1138
1194 Ga0307510_10189699 3300033180 Bacteria 1605
1195 Ga0307510_10486343 3300033180 Bacteria 676
1196 Ga0373943_0143482 3300035170 Bacteria 1288
1197 Ga0373931_0035097 3300035691 Bacteria 2606
1198 Ga0373935_0029922 3300035692 Bacteria 3372
1199 Ga0373935_0529772 3300035692 Bacteria 857
1200 Ga0373927_0213061 3300035695 Bacteria 1269
1201 Ga0373925_0007654 3300037068 Bacteria 7868
1202 Ga0395899_0000103 3300037312 Bacteria 147274
1203 Ga0395899_0001385 3300037312 Bacteria 20802
1204 Ga0395899_0001799 3300037312 Bacteria 17765
1205 Ga0395899_0002564 3300037312 Bacteria 14694
1206 Ga0395899_0015642 3300037312 Bacteria 5786
1207 Ga0395899_0020357 3300037312 Bacteria 5031
1208 Ga0395899_0024773 3300037312 Bacteria 4534
1209 Ga0395899_0024899 3300037312 Bacteria 4520
1210 Ga0395899_0037206 3300037312 Bacteria 3649
1211 Ga0395899_0047200 3300037312 Bacteria 3207
1212 Ga0395899_0065795 3300037312 Bacteria 2663
1213 Ga0395899_0074101 3300037312 Bacteria 2487
1214 Ga0395899_0074448 3300037312 Bacteria 2481
1215 Ga0395899_0127859 3300037312 Bacteria 1816
1216 Ga0395899_0173706 3300037312 Bacteria 1516
1217 Ga0395899_0189947 3300037312 Bacteria 1437
1218 Ga0395899_0237853 3300037312 Bacteria 1254
1219 Ga0395899_0288487 3300037312 Bacteria 1114
1220 Ga0395899_0358895 3300037312 Bacteria 973
1221 Ga0395899_0586790 3300037312 Bacteria 711
1222 Ga0395900_0000093 3300037418 Bacteria 166505
1223 Ga0395900_0000862 3300037418 Bacteria 40012
1224 Ga0395900_0006491 3300037418 Bacteria 12195
1225 Ga0395900_0006570 3300037418 Bacteria 12115
1226 Ga0395900_0007490 3300037418 Bacteria 11275
1227 Ga0395900_0009496 3300037418 Bacteria 9972
1228 Ga0395900_0012443 3300037418 Bacteria 8701
1229 Ga0395900_0021609 3300037418 Bacteria 6578
1230 Ga0395900_0023881 3300037418 Bacteria 6256
1231 Ga0395900_0031712 3300037418 Bacteria 5432
1232 Ga0395900_0033954 3300037418 Bacteria 5251
1233 Ga0395900_0050442 3300037418 Bacteria 4286
1234 Ga0395900_0052438 3300037418 Bacteria 4199
1235 Ga0395900_0059395 3300037418 Bacteria 3936
1236 Ga0395900_0109833 3300037418 Bacteria 2833
1237 Ga0395900_0118241 3300037418 Bacteria 2720
1238 Ga0395900_0128400 3300037418 Bacteria 2599
1239 Ga0395900_0135829 3300037418 Bacteria 2519
1240 Ga0395900_0151075 3300037418 Bacteria 2372
1241 Ga0395900_0165660 3300037418 Bacteria 2252
1242 Ga0395900_0194163 3300037418 Bacteria 2057
1243 Ga0395900_0214555 3300037418 Bacteria 1942
1244 Ga0395900_0231268 3300037418 Bacteria 1859
1245 Ga0395900_0248210 3300037418 Bacteria 1782
1246 Ga0395900_0314878 3300037418 Bacteria 1547
1247 Ga0395900_0347400 3300037418 Bacteria 1457
1248 Ga0395900_0369686 3300037418 Bacteria 1404
1249 Ga0395900_0382010 3300037418 Bacteria 1376
1250 Ga0395900_0385502 3300037418 Bacteria 1369
1251 Ga0395900_0463431 3300037418 Bacteria 1222
1252 Ga0395900_0480961 3300037418 Bacteria 1194
1253 Ga0395900_0485406 3300037418 Bacteria 1187
1254 Ga0395900_0607104 3300037418 Bacteria 1034
1255 Ga0395900_0661902 3300037418 Bacteria 980
1256 Ga0395900_0771792 3300037418 Bacteria 891
1257 Ga0395900_0771878 3300037418 Bacteria 890
1258 Ga0395900_0800122 3300037418 Bacteria 871
1259 Ga0395900_0888772 3300037418 Bacteria 815
1260 Ga0395900_1152609 3300037418 Bacteria 691
1261 Ga0395898_0000053 3300037466 Bacteria 279600
1262 Ga0395898_0002184 3300037466 Bacteria 23910
1263 Ga0395898_0007615 3300037466 Bacteria 11495
1264 Ga0395898_0007670 3300037466 Bacteria 11460
1265 Ga0395898_0007743 3300037466 Bacteria 11404
1266 Ga0395898_0008057 3300037466 Bacteria 11167
1267 Ga0395898_0024413 3300037466 Bacteria 6097
1268 Ga0395898_0052453 3300037466 Bacteria 3984
1269 Ga0395898_0061968 3300037466 Bacteria 3633
1270 Ga0395898_0076651 3300037466 Bacteria 3228
1271 Ga0395898_0095507 3300037466 Bacteria 2856
1272 Ga0395898_0097750 3300037466 Bacteria 2819
1273 Ga0395898_0115087 3300037466 Bacteria 2577
1274 Ga0395898_0141695 3300037466 Bacteria 2301
1275 Ga0395898_0164011 3300037466 Bacteria 2125
1276 Ga0395898_0169476 3300037466 Bacteria 2087
1277 Ga0395898_0222298 3300037466 Bacteria 1801
1278 Ga0395898_0222723 3300037466 Bacteria 1799
1279 Ga0395898_0223201 3300037466 Bacteria 1797
1280 Ga0395898_0394478 3300037466 Bacteria 1319
1281 Ga0395898_0410155 3300037466 Bacteria 1291
1282 Ga0395898_0829552 3300037466 Bacteria 864
1283 Ga0395898_1247816 3300037466 Bacteria 673
1284 Ga0395905_0000031 3300037471 Bacteria 286757
1285 Ga0395905_0000501 3300037471 Bacteria 53793
1286 Ga0395905_0001302 3300037471 Bacteria 30624
1287 Ga0395905_0003189 3300037471 Bacteria 17660
1288 Ga0395905_0003199 3300037471 Bacteria 17636
1289 Ga0395905_0005682 3300037471 Bacteria 12680
1290 Ga0395905_0006394 3300037471 Bacteria 11865
1291 Ga0395905_0008961 3300037471 Bacteria 9819
1292 Ga0395905_0010719 3300037471 Bacteria 8889
1293 Ga0395905_0013358 3300037471 Bacteria 7869
1294 Ga0395905_0017739 3300037471 Bacteria 6758
1295 Ga0395905_0018559 3300037471 Bacteria 6600
1296 Ga0395905_0020888 3300037471 Bacteria 6200
1297 Ga0395905_0027864 3300037471 Bacteria 5327
1298 Ga0395905_0044774 3300037471 Bacteria 4151
1299 Ga0395905_0052004 3300037471 Bacteria 3836
1300 Ga0395905_0060952 3300037471 Bacteria 3528
1301 Ga0395905_0062146 3300037471 Bacteria 3493
1302 Ga0395905_0074111 3300037471 Bacteria 3190
1303 Ga0395905_0075712 3300037471 Bacteria 3154
1304 Ga0395905_0076579 3300037471 Bacteria 3135
1305 Ga0395905_0083602 3300037471 Bacteria 2991
1306 Ga0395905_0090447 3300037471 Bacteria 2869
1307 Ga0395905_0090476 3300037471 Bacteria 2869
1308 Ga0395905_0091346 3300037471 Bacteria 2854
1309 Ga0395905_0095470 3300037471 Bacteria 2790
1310 Ga0395905_0110079 3300037471 Bacteria 2586
1311 Ga0395905_0111648 3300037471 Bacteria 2567
1312 Ga0395905_0118413 3300037471 Bacteria 2489
1313 Ga0395905_0141987 3300037471 Bacteria 2259
1314 Ga0395905_0145713 3300037471 Bacteria 2228
1315 Ga0395905_0163368 3300037471 Bacteria 2092
1316 Ga0395905_0165430 3300037471 Bacteria 2078
1317 Ga0395905_0174046 3300037471 Bacteria 2021
1318 Ga0395905_0246119 3300037471 Bacteria 1670
1319 Ga0395905_0250793 3300037471 Bacteria 1653
1320 Ga0395905_0290518 3300037471 Bacteria 1521
1321 Ga0395905_0321743 3300037471 Bacteria 1436
1322 Ga0395905_0397533 3300037471 Bacteria 1273
1323 Ga0395905_0508353 3300037471 Bacteria 1105
1324 Ga0395905_0556705 3300037471 Bacteria 1048
1325 Ga0395905_0663455 3300037471 Bacteria 945
1326 Ga0395905_0710990 3300037471 Bacteria 907
1327 Ga0395905_0762310 3300037471 Bacteria 870
1328 Ga0395905_0942385 3300037471 Bacteria 766
1329 Ga0395905_1434786 3300037471 Bacteria 594
1330 Ga0436364_0142050 3300037853 Bacteria 28809
1331 Ga0395901_0000140 3300038443 Bacteria 94487
1332 Ga0395901_0000163 3300038443 Bacteria 87103
1333 Ga0395901_0002476 3300038443 Bacteria 18740
1334 Ga0395901_0002602 3300038443 Bacteria 18273
1335 Ga0395901_0004299 3300038443 Bacteria 14365
1336 Ga0395901_0007270 3300038443 Bacteria 11175
1337 Ga0395901_0007987 3300038443 Bacteria 10679
1338 Ga0395901_0014591 3300038443 Bacteria 7986
1339 Ga0395901_0015826 3300038443 Bacteria 7686
1340 Ga0395901_0032674 3300038443 Bacteria 5367
1341 Ga0395901_0035963 3300038443 Bacteria 5117
1342 Ga0395901_0036894 3300038443 Bacteria 5053
1343 Ga0395901_0051165 3300038443 Bacteria 4293
1344 Ga0395901_0056126 3300038443 Bacteria 4097
1345 Ga0395901_0058826 3300038443 Bacteria 3998
1346 Ga0395901_0062838 3300038443 Bacteria 3864
1347 Ga0395901_0075747 3300038443 Bacteria 3510
1348 Ga0395901_0095605 3300038443 Bacteria 3113
1349 Ga0395901_0132015 3300038443 Bacteria 2624
1350 Ga0395901_0170556 3300038443 Bacteria 2283
1351 Ga0395901_0215129 3300038443 Bacteria 2010
1352 Ga0395901_0240287 3300038443 Bacteria 1889
1353 Ga0395901_0252884 3300038443 Bacteria 1835
1354 Ga0395901_0278869 3300038443 Bacteria 1737
1355 Ga0395901_0371383 3300038443 Bacteria 1473
1356 Ga0395901_0475294 3300038443 Bacteria 1275
1357 Ga0395901_0503754 3300038443 Bacteria 1232
1358 Ga0395901_0505898 3300038443 Bacteria 1229
1359 Ga0395901_0973276 3300038443 Bacteria 826
1360 Ga0395901_1050632 3300038443 Bacteria 787
1361 Ga0395901_1210973 3300038443 Bacteria 720
1362 Ga0395901_1276073 3300038443 Bacteria 697
1363 Ga0395901_1338605 3300038443 Bacteria 677
1364 Ga0436365_1282680 3300039437 Bacteria 7043
1365 Ga0436365_1458644 3300039437 Bacteria 7999
1366 Ga0436363_0922173 3300039450 Bacteria 642
1367 Ga0439461_0013831 3300041410 Bacteria 1527
1368 Ga0439465_0056672 3300041413 Bacteria 1292
1369 Ga0451853_3733171 3300041512 Bacteria 730
1370 Ga0439448_0000322 3300042005 Bacteria 10611
1371 Ga0439448_0096186 3300042005 Bacteria 1003
1372 Ga0439449_0061746 3300042007 Bacteria 1383
1373 Ga0439455_0004592 3300042012 Bacteria 2747
1374 Ga0450898_061832 3300042134 Bacteria 738
1375 Ga0439446_0164969 3300042156 Bacteria 734
1376 Ga0439458_0000133 3300042157 Bacteria 15728
1377 Ga0439458_0000630 3300042157 Bacteria 9139
1378 Ga0439434_0053688 3300042435 Bacteria 1252
1379 Ga0439464_0009234 3300042439 Bacteria 2593
1380 Ga0466969_0000621 3300044656 Bacteria 19186
1381 Ga0466969_0020718 3300044656 Bacteria 3403
1382 Ga0466969_0033556 3300044656 Bacteria 2606
1383 Ga0466969_0393847 3300044656 Bacteria 629
1384 Ga0466972_0050351 3300044658 Bacteria 2011
1385 Ga0466965_0047269 3300044683 Bacteria 2131
1386 Ga0466965_0158962 3300044683 Bacteria 1184
1387 Ga0466966_0000007 3300044684 Bacteria 155702
1388 Ga0466966_0008485 3300044684 Bacteria 6802
1389 Ga0466966_0029669 3300044684 Bacteria 3556
1390 Ga0466966_0235363 3300044684 Bacteria 1104
1391 Ga0466961_0009637 3300044693 Bacteria 6149
1392 Ga0466961_0010371 3300044693 Bacteria 5944
1393 Ga0466961_0021929 3300044693 Bacteria 4110
1394 Ga0466961_0047784 3300044693 Bacteria 2736
1395 Ga0466961_0155232 3300044693 Bacteria 1428
1396 Ga0466961_0401030 3300044693 Bacteria 832
1397 Ga0466963_0006775 3300044694 Bacteria 6811
1398 Ga0466963_0027439 3300044694 Bacteria 3646
1399 Ga0466963_0029758 3300044694 Bacteria 3518
1400 Ga0466963_0036704 3300044694 Bacteria 3197
1401 Ga0466963_0089706 3300044694 Bacteria 2092
1402 Ga0466963_0098412 3300044694 Bacteria 1999
1403 Ga0466963_0115431 3300044694 Bacteria 1845
1404 Ga0466963_0116500 3300044694 Bacteria 1836
1405 Ga0466963_0160456 3300044694 Bacteria 1564
1406 Ga0466963_0179392 3300044694 Bacteria 1478
1407 Ga0466963_0205073 3300044694 Bacteria 1379
1408 Ga0466963_0267219 3300044694 Bacteria 1201
1409 Ga0466963_0404024 3300044694 Bacteria 963
1410 Ga0466964_0002327 3300044706 Bacteria 6738
1411 Ga0466964_0089737 3300044706 Bacteria 1336
1412 Ga0466964_0172560 3300044706 Bacteria 1019
1413 Ga0466971_0006485 3300044719 Bacteria 5085
1414 Ga0466971_0008923 3300044719 Bacteria 4382
1415 Ga0466971_0018819 3300044719 Bacteria 3062
1416 Ga0466971_0032883 3300044719 Bacteria 2324
1417 Ga0466971_0099606 3300044719 Bacteria 1335
1418 Ga0466971_0129278 3300044719 Bacteria 1172
1419 Ga0466971_0139584 3300044719 Bacteria 1128
1420 Ga0466968_0001195 3300044735 Bacteria 9182
1421 Ga0466970_0014937 3300044765 Bacteria 3992
1422 Ga0466970_0025411 3300044765 Bacteria 3100
1423 Ga0466970_0070277 3300044765 Bacteria 1882
1424 Ga0466970_0133139 3300044765 Bacteria 1366
1425 Ga0466970_0134600 3300044765 Bacteria 1359
1426 Ga0466970_0283041 3300044765 Bacteria 933
1427 Ga0466957_0001433 3300044842 Bacteria 12457
1428 Ga0466957_0002504 3300044842 Bacteria 9881
1429 Ga0466957_0026759 3300044842 Bacteria 3423
1430 Ga0466957_0040332 3300044842 Bacteria 2819
1431 Ga0466957_0119154 3300044842 Bacteria 1681
1432 Ga0466957_0129743 3300044842 Bacteria 1614
1433 Ga0466957_0142024 3300044842 Bacteria 1547
1434 Ga0466957_0204976 3300044842 Bacteria 1297
1435 Ga0466957_0297814 3300044842 Bacteria 1083
1436 Ga0466957_0395310 3300044842 Bacteria 945
1437 Ga0466960_0031149 3300044901 Bacteria 2459
1438 Ga0466960_0075259 3300044901 Bacteria 1689
1439 Ga0466960_0299901 3300044901 Bacteria 905
1440 Ga0466959_0013314 3300045049 Bacteria 5960
1441 Ga0466959_0016786 3300045049 Bacteria 5357
1442 Ga0466959_0098591 3300045049 Bacteria 2093
1443 Ga0466959_0119188 3300045049 Bacteria 1877
1444 Ga0466959_0159951 3300045049 Bacteria 1584
1445 Ga0466959_0174118 3300045049 Bacteria 1508
1446 Ga0466959_0435178 3300045049 Bacteria 890
1447 Ga0466958_0001865 3300045836 Bacteria 10293
1448 Ga0466958_0005586 3300045836 Bacteria 6782
1449 Ga0466958_0006030 3300045836 Bacteria 6569
1450 Ga0466958_0016995 3300045836 Bacteria 4197
1451 Ga0466958_0043741 3300045836 Bacteria 2698
1452 Ga0466958_0053911 3300045836 Bacteria 2438
1453 Ga0466958_0105484 3300045836 Bacteria 1756
1454 Ga0466958_0127183 3300045836 Bacteria 1598
1455 Ga0466958_0143221 3300045836 Bacteria 1506
1456 Ga0466958_0308971 3300045836 Bacteria 1015
1457 Ga0466958_0312796 3300045836 Bacteria 1009
1458 Ga0466967_0002551 3300045976 Bacteria 11415
1459 Ga0466967_0003894 3300045976 Bacteria 9905
1460 Ga0466967_0017710 3300045976 Bacteria 5667
1461 Ga0466967_0018472 3300045976 Bacteria 5574
1462 Ga0466967_0036403 3300045976 Bacteria 4201
1463 Ga0466967_0039130 3300045976 Bacteria 4074
1464 Ga0466967_0048122 3300045976 Bacteria 3722
1465 Ga0466967_0062345 3300045976 Bacteria 3309
1466 Ga0466967_0084062 3300045976 Bacteria 2879
1467 Ga0466967_0098140 3300045976 Bacteria 2674
1468 Ga0466967_0104587 3300045976 Bacteria 2592
1469 Ga0466967_0109991 3300045976 Bacteria 2530
1470 Ga0466967_0149099 3300045976 Bacteria 2184
1471 Ga0466967_0185202 3300045976 Bacteria 1966
1472 Ga0466967_0242433 3300045976 Bacteria 1720
1473 Ga0466967_0287746 3300045976 Bacteria 1578
1474 Ga0466967_0289017 3300045976 Bacteria 1574
1475 Ga0466967_0316172 3300045976 Bacteria 1505
1476 Ga0466967_0350066 3300045976 Bacteria 1430
1477 Ga0466967_0408287 3300045976 Bacteria 1322
1478 Ga0466967_0790193 3300045976 Bacteria 942
1479 Ga0466967_0834858 3300045976 Bacteria 915
1480 Ga0466967_1395963 3300045976 Bacteria 697
1481 Ga0466967_1567063 3300045976 Bacteria 656
1482 Ga0495629_0290789 3300046459 Bacteria 1120
1483 Ga0495650_0000174 3300046471 Bacteria 142519
1484 Ga0495584_0075098 3300046491 Bacteria 1699
1485 Ga0495585_0001099 3300046492 Bacteria 22247
1486 Ga0495585_0207296 3300046492 Bacteria 995
1487 Ga0495583_0000593 3300046506 Bacteria 49619
1488 Ga0495583_0003260 3300046506 Bacteria 12612
1489 Ga0495583_0043813 3300046506 Bacteria 2081
1490 Ga0495606_0000306 3300046507 Bacteria 84561
1491 Ga0495606_0144270 3300046507 Bacteria 1403
1492 Ga0495643_0003033 3300046522 Bacteria 12624
1493 Ga0495643_0132748 3300046522 Bacteria 1248
1494 Ga0495648_0000747 3300046524 Bacteria 34745
1495 Ga0495642_0080523 3300046528 Bacteria 1371
1496 Ga0495642_0156659 3300046528 Bacteria 986
1497 Ga0495598_0004707 3300046537 Bacteria 2975
1498 Ga0495621_0001621 3300046539 Bacteria 5879
1499 Ga0495621_0003826 3300046539 Bacteria 4180
1500 Ga0495621_0004893 3300046539 Bacteria 3804
1501 Ga0495621_0070506 3300046539 Bacteria 1286
1502 Ga0495622_0008558 3300046557 Bacteria 4742
1503 Ga0495622_0093263 3300046557 Bacteria 1382
1504 Ga0495633_0000580 3300046558 Bacteria 35487
1505 Ga0495633_0022523 3300046558 Bacteria 3134
1506 Ga0495668_0000072 3300046616 Bacteria 167170
1507 Ga0495668_0010783 3300046616 Bacteria 5514
1508 Ga0495611_0023521 3300046648 Bacteria 2675
1509 Ga0495611_0093302 3300046648 Bacteria 1392
1510 Ga0495625_0003023 3300046660 Bacteria 17259
1511 Ga0495625_0081249 3300046660 Bacteria 2256
1512 Ga0495669_0001039 3300046684 Bacteria 11573
1513 Ga0495669_0003343 3300046684 Bacteria 6603
1514 Ga0495669_0012805 3300046684 Bacteria 3571
1515 Ga0495669_0026711 3300046684 Bacteria 2523
1516 Ga0495669_0065140 3300046684 Bacteria 1654
1517 Ga0495670_0034649 3300046691 Bacteria 2515
1518 Ga0495670_0069455 3300046691 Bacteria 1781
1519 Ga0495670_0273215 3300046691 Bacteria 903
1520 Ga0495671_0085862 3300046692 Bacteria 1542
1521 Ga0495600_0002120 3300046809 Bacteria 11231
1522 Ga0495660_0075549 3300046810 Bacteria 1777
1523 Ga0495636_0081643 3300047318 Bacteria 1393
1524 Ga0495683_0063825 3300047323 Bacteria 1819
1525 Ga0495687_000045 3300047443 Bacteria 211968
1526 Ga0495687_000240 3300047443 Bacteria 75621
1527 Ga0495677_0022489 3300047445 Bacteria 2288
1528 Ga0495677_0033336 3300047445 Bacteria 1877
1529 Ga0495677_0107450 3300047445 Bacteria 1059
1530 Ga0495681_0016684 3300047470 Bacteria 4104
1531 Ga0496100_0017630 3300048903 Bacteria 4219
1532 Ga0496100_0022557 3300048903 Bacteria 3810
1533 Ga0496100_0496159 3300048903 Bacteria 940
1534 Ga0496101_0000651 3300048904 Bacteria 20945
1535 Ga0496101_0015674 3300048904 Bacteria 5114
1536 Ga0496101_0048298 3300048904 Bacteria 3058
1537 Ga0496101_0060197 3300048904 Bacteria 2755
1538 Ga0496101_0670085 3300048904 Bacteria 819
1539 Ga0496102_0002195 3300048905 Bacteria 16757
1540 Ga0496102_0021520 3300048905 Bacteria 5703
1541 Ga0496102_0635075 3300048905 Bacteria 991
1542 Ga0496103_0000404 3300048906 Bacteria 38247
1543 Ga0496103_0014866 3300048906 Bacteria 4627
1544 Ga0496104_0170243 3300048907 Bacteria 2089
1545 Ga0496104_0211514 3300048907 Bacteria 1851
1546 Ga0496104_0260158 3300048907 Bacteria 1648
1547 Ga0496104_0539136 3300048907 Bacteria 1078
1548 Ga0496105_0003692 3300048908 Bacteria 11392
1549 Ga0496105_0246806 3300048908 Bacteria 1447
1550 Ga0496106_0007914 3300048909 Bacteria 7856
1551 Ga0496106_0272767 3300048909 Bacteria 1355
1552 Ga0496107_0000593 3300048910 Bacteria 20196
1553 Ga0496107_0021466 3300048910 Bacteria 4563
1554 Ga0496107_0090361 3300048910 Bacteria 2237
1555 Ga0496107_0111103 3300048910 Bacteria 2014
1556 Ga0496107_0237270 3300048910 Bacteria 1357
1557 Ga0496107_0336343 3300048910 Bacteria 1123
1558 Ga0496108_0000396 3300048911 Bacteria 35971
1559 Ga0496108_0002584 3300048911 Bacteria 14509
1560 Ga0496108_0025841 3300048911 Bacteria 4842
1561 Ga0496108_0044171 3300048911 Bacteria 3720
1562 Ga0496108_0102734 3300048911 Bacteria 2439
1563 Ga0496109_0002022 3300048912 Bacteria 16815
1564 Ga0496109_0043336 3300048912 Bacteria 4078
1565 Ga0496109_0047395 3300048912 Bacteria 3907
1566 Ga0496109_0190635 3300048912 Bacteria 1926
1567 Ga0496109_0250235 3300048912 Bacteria 1669
1568 Ga0496110_0002181 3300048913 Bacteria 14631
1569 Ga0496110_0011799 3300048913 Bacteria 7172
1570 Ga0496110_0017806 3300048913 Bacteria 5946
1571 Ga0496110_0025153 3300048913 Bacteria 5084
1572 Ga0496110_0173596 3300048913 Bacteria 1956
1573 Ga0496110_1103166 3300048913 Bacteria 702
1574 Ga0496111_0000917 3300048914 Bacteria 16063
1575 Ga0496111_0012549 3300048914 Bacteria 5741
1576 Ga0496111_0025286 3300048914 Bacteria 4189
1577 Ga0496111_0048543 3300048914 Bacteria 3058
1578 Ga0496111_0065813 3300048914 Bacteria 2631
1579 Ga0496112_0007858 3300048915 Bacteria 9496
1580 Ga0496112_0025295 3300048915 Bacteria 5700
1581 Ga0496112_0063477 3300048915 Bacteria 3643
1582 Ga0496112_0090706 3300048915 Bacteria 3025
1583 Ga0496112_0104952 3300048915 Bacteria 2796
1584 Ga0496112_0166729 3300048915 Bacteria 2168
1585 Ga0496112_0422904 3300048915 Bacteria 1271
1586 Ga0496113_0004906 3300048916 Bacteria 8285
1587 Ga0496113_0007008 3300048916 Bacteria 7208
1588 Ga0496113_0011296 3300048916 Bacteria 5949
1589 Ga0496113_0030474 3300048916 Bacteria 3905
1590 Ga0496113_0097418 3300048916 Bacteria 2275
1591 Ga0496113_0333036 3300048916 Bacteria 1217
1592 Ga0496113_0779152 3300048916 Bacteria 760
1593 Ga0496114_0000092 3300048917 Bacteria 64974
1594 Ga0496114_0017827 3300048917 Bacteria 5739
1595 Ga0496114_0058179 3300048917 Bacteria 3227
1596 Ga0496115_0000009 3300048918 Bacteria 234372
1597 Ga0496115_0003182 3300048918 Bacteria 11797
1598 Ga0496116_0019202 3300048919 Bacteria 5240
1599 Ga0496117_0000724 3300048920 Bacteria 51893
1600 Ga0496118_0004337 3300048921 Bacteria 16890
1601 Ga0496119_0118956 3300048922 Bacteria 1455
1602 Ga0496121_0005204 3300048924 Bacteria 16856
1603 Ga0496123_0031139 3300048926 Bacteria 3887
1604 Ga0496124_0000050 3300048927 Bacteria 258041
1605 Ga0496125_0001759 3300048928 Bacteria 30051
1606 Ga0496126_0000930 3300048929 Bacteria 50554
1607 Ga0496126_0120614 3300048929 Bacteria 2275
1608 Ga0495682_0161926 3300049460 Bacteria 797
1609 Ga0501067_0034153 3300049583 Bacteria 2822
1610 Ga0501069_0053151 3300049585 Bacteria 2256
1611 Ga0501074_0536263 3300049590 Bacteria 829
1612 Ga0501076_0525317 3300049592 Bacteria 976
1613 Ga0501201_003718 3300049651 Bacteria 1406
1614 Ga0501202_029167 3300049652 Bacteria 1143
1615 Ga0501217_008521 3300049661 Bacteria 2218
1616 Ga0501223_025384 3300049663 Bacteria 1153
1617 Ga0501233_004947 3300049668 Bacteria 2463
1618 Ga0501242_006115 3300049674 Bacteria 1369
1619 Ga0501247_025513 3300049677 Bacteria 786
1620 Ga0501257_033062 3300049686 Bacteria 1252
1621 Ga0501258_002575 3300049687 Bacteria 1603
1622 Ga0501225_0016822 3300049705 Bacteria 2032
1623 Ga0501234_009653 3300049707 Bacteria 1507
1624 Ga0501245_009230 3300049708 Bacteria 1414
1625 Ga0501080_0103901 3300049742 Bacteria 2635
1626 Ga0501081_0637272 3300049743 Bacteria 799
1627 Ga0501263_009704 3300049760 Bacteria 1169
1628 Ga0501273_001155 3300049770 Bacteria 2432
1629 nmdc:mga0k408_181012_c1 3300050493 Bacteria 1257
1630 nmdc:mga09592_307820_c1 3300050508 Bacteria 1373
1631 nmdc:mga06r32_42891_c1 3300050510 Bacteria 4304
1632 nmdc:mga08y16_81113_c1 3300050511 Bacteria 3382
1633 nmdc:mga0n895_351716_c1 3300050512 Bacteria 1492
1634 nmdc:mga0rr50_212867_c1 3300050513 Bacteria 1593
1635 nmdc:mga08x19_628098_c1 3300050514 Bacteria 761
1636 Ga0500610_0000327 3300053079 Bacteria 14365
1637 Ga0500643_003145 3300053087 Bacteria 8076
1638 Ga0500647_0195579 3300053091 Bacteria 920
1639 Ga0500594_0000617 3300053118 Bacteria 7612
1640 Ga0500595_000578 3300053119 Bacteria 21839
1641 Ga0500642_0000484 3300053130 Bacteria 12323
1642 Ga0500658_0000177 3300053134 Bacteria 30497
1643 Ga0500568_0001623 3300053139 Bacteria 14174
1644 Ga0500604_0000018 3300053151 Bacteria 78699
1645 Ga0500616_0000419 3300053153 Bacteria 56812
1646 Ga0500636_0000204 3300053177 Bacteria 32149
1647 Ga0500645_000138 3300053730 Bacteria 57099
1648 Ga0500596_001810 3300053735 Bacteria 4296
1649 Ga0500587_002504 3300053739 Bacteria 2611
1650 Ga0500661_010604 3300055283 Bacteria 1677
1651 Ga0466962_0057170 3300061719 Bacteria 1862
1652 Ga0466962_0097225 3300061719 Bacteria 1412
1653 Ga0466962_0118080 3300061719 Bacteria 1279
1654 Ga0466962_0143451 3300061719 Bacteria 1157
1655 Ga0466962_0163067 3300061719 Bacteria 1084

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041512 Ga0451853_3733171 Ga0451853_3733171_205_657 150
2 3300045976 Ga0466967_0350066 Ga0466967_0350066_467_1018 174
3 3300025909 Ga0207705_10000002 Ga0207705_10000002515 177
4 3300053087 Ga0500643_003145 Ga0500643_003145_6126_6689 180
5 3300005616 Ga0068852_101394042 Ga0068852_1013940421 181
6 3300032004 Ga0307414_10005175 Ga0307414_100051756 181
7 3300046557 Ga0495622_0093263 Ga0495622_0093263_39_623 181
8 3300046684 Ga0495669_0001039 Ga0495669_0001039_9469_10017 181
9 3300053118 Ga0500594_0000617 Ga0500594_0000617_2047_2631 181
10 3300001915 JGI24741J21665_1000275 JGI24741J21665_100027515 182
11 3300001978 JGI24747J21853_1015495 JGI24747J21853_10154952 182
12 3300001979 JGI24740J21852_10006098 JGI24740J21852_100060986 182
13 3300001989 JGI24739J22299_10015335 JGI24739J22299_100153352 182
14 3300001990 JGI24737J22298_10006639 JGI24737J22298_100066396 182
15 3300001990 JGI24737J22298_10006915 JGI24737J22298_100069152 182
16 3300002067 JGI24735J21928_10103214 JGI24735J21928_101032142 182
17 3300003215 JGI25153J46596_10000002 JGI25153J46596_1000000221 182
18 3300003759 Ga0055525_1000104 Ga0055525_1000104105 182
19 3300003762 Ga0055542_1000025 Ga0055542_1000025215 182
20 3300003763 Ga0055529_1000014 Ga0055529_100001438 182
21 3300005327 Ga0070658_10000621 Ga0070658_1000062117 182
22 3300005328 Ga0070676_10092442 Ga0070676_100924422 182
23 3300005331 Ga0070670_100019164 Ga0070670_1000191647 182
24 3300005344 Ga0070661_100029712 Ga0070661_1000297125 182
25 3300005344 Ga0070661_100146165 Ga0070661_1001461652 182
26 3300005354 Ga0070675_100489070 Ga0070675_1004890701 182
27 3300005364 Ga0070673_100701184 Ga0070673_1007011842 182
28 3300005366 Ga0070659_100835108 Ga0070659_1008351081 182
29 3300005367 Ga0070667_100093040 Ga0070667_1000930403 182
30 3300005456 Ga0070678_100017466 Ga0070678_1000174662 182
31 3300005548 Ga0070665_100000226 Ga0070665_10000022666 182
32 3300005548 Ga0070665_100355102 Ga0070665_1003551023 182
33 3300006038 Ga0075365_10513759 Ga0075365_105137592 182
34 3300006186 Ga0075369_10032479 Ga0075369_100324792 182
35 3300006195 Ga0075366_10157047 Ga0075366_101570472 182
36 3300006237 Ga0097621_100195317 Ga0097621_1001953172 182
37 3300006353 Ga0075370_10286577 Ga0075370_102865771 182
38 3300006358 Ga0068871_100137305 Ga0068871_1001373052 182
39 3300006881 Ga0068865_100170530 Ga0068865_1001705302 182
40 3300009148 Ga0105243_10000213 Ga0105243_1000021341 182
41 3300009174 Ga0105241_10329989 Ga0105241_103299892 182
42 3300009176 Ga0105242_10573557 Ga0105242_105735572 182
43 3300009551 Ga0105238_11072834 Ga0105238_110728342 182
44 3300012513 Ga0157326_1002954 Ga0157326_10029542 182
45 3300013102 Ga0157371_10000059 Ga0157371_10000059161 182
46 3300013104 Ga0157370_10603773 Ga0157370_106037732 182
47 3300013297 Ga0157378_10002131 Ga0157378_100021314 182
48 3300013297 Ga0157378_10571359 Ga0157378_105713592 182
49 3300017792 Ga0163161_10117068 Ga0163161_101170681 182
50 3300025230 Ga0209563_100116 Ga0209563_10011633 182
51 3300025246 Ga0209646_1003071 Ga0209646_10030714 182
52 3300025254 Ga0209148_1000011 Ga0209148_100001139 182
53 3300025261 Ga0209233_1024294 Ga0209233_10242943 182
54 3300025272 Ga0209455_1000006 Ga0209455_10000061155 182
55 3300025297 Ga0209758_1000001 Ga0209758_1000001820 182
56 3300025321 Ga0207656_10024815 Ga0207656_100248152 182
57 3300025901 Ga0207688_10343569 Ga0207688_103435691 182
58 3300025904 Ga0207647_10020677 Ga0207647_100206775 182
59 3300025907 Ga0207645_10018349 Ga0207645_100183498 182
60 3300025907 Ga0207645_10043709 Ga0207645_100437093 182
61 3300025909 Ga0207705_10000197 Ga0207705_1000019736 182
62 3300025911 Ga0207654_10017183 Ga0207654_100171832 182
63 3300025913 Ga0207695_10127308 Ga0207695_101273082 182
64 3300025919 Ga0207657_10024901 Ga0207657_100249016 182
65 3300025920 Ga0207649_10001155 Ga0207649_100011554 182
66 3300025920 Ga0207649_10037880 Ga0207649_100378803 182
67 3300025923 Ga0207681_10592186 Ga0207681_105921862 182
68 3300025924 Ga0207694_10048173 Ga0207694_100481732 182
69 3300025926 Ga0207659_10144335 Ga0207659_101443352 182
70 3300025932 Ga0207690_10005982 Ga0207690_100059826 182
71 3300025932 Ga0207690_10034734 Ga0207690_100347345 182
72 3300025933 Ga0207706_10061235 Ga0207706_100612353 182
73 3300025935 Ga0207709_10000018 Ga0207709_10000018103 182
74 3300025937 Ga0207669_10000068 Ga0207669_1000006851 182
75 3300025937 Ga0207669_10003644 Ga0207669_1000364410 182
76 3300025938 Ga0207704_10017580 Ga0207704_100175805 182
77 3300025945 Ga0207679_10039124 Ga0207679_100391245 182
78 3300025949 Ga0207667_10006200 Ga0207667_100062009 182
79 3300025981 Ga0207640_10280122 Ga0207640_102801222 182
80 3300025986 Ga0207658_10011532 Ga0207658_100115326 182
81 3300026067 Ga0207678_10077134 Ga0207678_100771344 182
82 3300026078 Ga0207702_10001111 Ga0207702_100011118 182
83 3300026089 Ga0207648_10120400 Ga0207648_101204003 182
84 3300026116 Ga0207674_10058960 Ga0207674_100589602 182
85 3300026121 Ga0207683_10005798 Ga0207683_100057987 182
86 3300028379 Ga0268266_10000002 Ga0268266_100000022859 182
87 3300028379 Ga0268266_10300597 Ga0268266_103005973 182
88 3300031456 Ga0307513_10379964 Ga0307513_103799641 182
89 3300031507 Ga0307509_10482920 Ga0307509_104829201 182
90 3300033180 Ga0307510_10486343 Ga0307510_104863431 182
91 3300046459 Ga0495629_0290789 Ga0495629_0290789_259_810 182
92 3300046471 Ga0495650_0000174 Ga0495650_0000174_82761_83312 182
93 3300046491 Ga0495584_0075098 Ga0495584_0075098_521_1072 182
94 3300046492 Ga0495585_0001099 Ga0495585_0001099_2803_3354 182
95 3300046492 Ga0495585_0207296 Ga0495585_0207296_11_568 182
96 3300046506 Ga0495583_0000593 Ga0495583_0000593_40334_40885 182
97 3300046506 Ga0495583_0003260 Ga0495583_0003260_11876_12427 182
98 3300046506 Ga0495583_0043813 Ga0495583_0043813_735_1286 182
99 3300046507 Ga0495606_0000306 Ga0495606_0000306_52297_52848 182
100 3300046507 Ga0495606_0144270 Ga0495606_0144270_182_733 182
101 3300046522 Ga0495643_0003033 Ga0495643_0003033_3329_3880 182
102 3300046522 Ga0495643_0132748 Ga0495643_0132748_185_736 182
103 3300046524 Ga0495648_0000747 Ga0495648_0000747_17012_17563 182
104 3300046528 Ga0495642_0156659 Ga0495642_0156659_251_802 182
105 3300046557 Ga0495622_0008558 Ga0495622_0008558_2143_2694 182
106 3300046558 Ga0495633_0000580 Ga0495633_0000580_20526_21077 182
107 3300046558 Ga0495633_0022523 Ga0495633_0022523_980_1531 182
108 3300046616 Ga0495668_0000072 Ga0495668_0000072_140873_141424 182
109 3300046648 Ga0495611_0023521 Ga0495611_0023521_1167_1718 182
110 3300046648 Ga0495611_0093302 Ga0495611_0093302_803_1360 182
111 3300046660 Ga0495625_0003023 Ga0495625_0003023_13714_14265 182
112 3300046660 Ga0495625_0081249 Ga0495625_0081249_861_1412 182
113 3300046691 Ga0495670_0069455 Ga0495670_0069455_775_1326 182
114 3300046692 Ga0495671_0085862 Ga0495671_0085862_661_1218 182
115 3300046809 Ga0495600_0002120 Ga0495600_0002120_8555_9106 182
116 3300046810 Ga0495660_0075549 Ga0495660_0075549_1167_1718 182
117 3300047318 Ga0495636_0081643 Ga0495636_0081643_716_1267 182
118 3300047323 Ga0495683_0063825 Ga0495683_0063825_473_1024 182
119 3300047443 Ga0495687_000045 Ga0495687_000045_142049_142600 182
120 3300047443 Ga0495687_000240 Ga0495687_000240_16714_17265 182
121 3300047445 Ga0495677_0033336 Ga0495677_0033336_726_1277 182
122 3300047470 Ga0495681_0016684 Ga0495681_0016684_2012_2563 182
123 3300048904 Ga0496101_0670085 Ga0496101_0670085_27_578 182
124 3300048905 Ga0496102_0002195 Ga0496102_0002195_15553_16104 182
125 3300048906 Ga0496103_0000404 Ga0496103_0000404_25088_25639 182
126 3300048907 Ga0496104_0260158 Ga0496104_0260158_640_1191 182
127 3300048908 Ga0496105_0003692 Ga0496105_0003692_10015_10566 182
128 3300048913 Ga0496110_0173596 Ga0496110_0173596_495_1046 182
129 3300048914 Ga0496111_0048543 Ga0496111_0048543_2107_2658 182
130 3300048916 Ga0496113_0333036 Ga0496113_0333036_87_638 182
131 3300048917 Ga0496114_0017827 Ga0496114_0017827_803_1354 182
132 3300048918 Ga0496115_0000009 Ga0496115_0000009_26298_26849 182
133 3300048919 Ga0496116_0019202 Ga0496116_0019202_3950_4501 182
134 3300048920 Ga0496117_0000724 Ga0496117_0000724_17033_17584 182
135 3300048921 Ga0496118_0004337 Ga0496118_0004337_771_1322 182
136 3300048922 Ga0496119_0118956 Ga0496119_0118956_716_1267 182
137 3300048924 Ga0496121_0005204 Ga0496121_0005204_15554_16105 182
138 3300048926 Ga0496123_0031139 Ga0496123_0031139_135_686 182
139 3300048927 Ga0496124_0000050 Ga0496124_0000050_49732_50283 182
140 3300048928 Ga0496125_0001759 Ga0496125_0001759_28792_29343 182
141 3300048929 Ga0496126_0000930 Ga0496126_0000930_34451_35002 182
142 3300049460 Ga0495682_0161926 Ga0495682_0161926_199_750 182
143 3300050493 nmdc:mga0k408_181012_c1 nmdc:mga0k408_181012_c1_167_718 182
144 3300053079 Ga0500610_0000327 Ga0500610_0000327_7720_8271 182
145 3300053091 Ga0500647_0195579 Ga0500647_0195579_93_644 182
146 3300053119 Ga0500595_000578 Ga0500595_000578_8090_8641 182
147 3300053130 Ga0500642_0000484 Ga0500642_0000484_10992_11549 182
148 3300053177 Ga0500636_0000204 Ga0500636_0000204_3202_3753 182
149 3300053730 Ga0500645_000138 Ga0500645_000138_55092_55643 182
150 3300053735 Ga0500596_001810 Ga0500596_001810_901_1452 182
151 3300055283 Ga0500661_010604 Ga0500661_010604_696_1247 182
152 3300025927 Ga0207687_10028441 Ga0207687_100284414 183
153 3300005327 Ga0070658_10000013 Ga0070658_1000001367 187
154 3300005339 Ga0070660_100002275 Ga0070660_1000022757 187
155 3300005339 Ga0070660_100771920 Ga0070660_1007719201 187
156 3300005345 Ga0070692_10000460 Ga0070692_1000046011 187
157 3300005366 Ga0070659_100006502 Ga0070659_1000065029 187
158 3300005366 Ga0070659_100054594 Ga0070659_1000545942 187
159 3300021384 Ga0213876_10004311 Ga0213876_100043114 187
160 3300025919 Ga0207657_10000443 Ga0207657_1000044310 187
161 3300025919 Ga0207657_10838862 Ga0207657_108388621 187
162 3300025932 Ga0207690_10006965 Ga0207690_100069652 187
163 3300025932 Ga0207690_10194018 Ga0207690_101940182 187
164 3300039437 Ga0436365_1458644 Ga0436365_1458644_1952_2515 187
165 3300001904 JGI24736J21556_1016639 JGI24736J21556_10166392 188
166 3300001915 JGI24741J21665_1004763 JGI24741J21665_10047632 188
167 3300001915 JGI24741J21665_1006277 JGI24741J21665_10062773 188
168 3300001915 JGI24741J21665_1020529 JGI24741J21665_10205292 188
169 3300001979 JGI24740J21852_10002192 JGI24740J21852_100021922 188
170 3300001979 JGI24740J21852_10016150 JGI24740J21852_100161502 188
171 3300001979 JGI24740J21852_10022185 JGI24740J21852_100221853 188
172 3300001979 JGI24740J21852_10066603 JGI24740J21852_100666032 188
173 3300001989 JGI24739J22299_10027711 JGI24739J22299_100277112 188
174 3300001990 JGI24737J22298_10008878 JGI24737J22298_100088782 188
175 3300001990 JGI24737J22298_10023678 JGI24737J22298_100236782 188
176 3300001990 JGI24737J22298_10114216 JGI24737J22298_101142161 188
177 3300001991 JGI24743J22301_10027488 JGI24743J22301_100274881 188
178 3300002067 JGI24735J21928_10005471 JGI24735J21928_100054712 188
179 3300002067 JGI24735J21928_10011426 JGI24735J21928_100114262 188
180 3300002067 JGI24735J21928_10024856 JGI24735J21928_100248562 188
181 3300002067 JGI24735J21928_10032259 JGI24735J21928_100322591 188
182 3300002075 JGI24738J21930_10017629 JGI24738J21930_100176292 188
183 3300005293 Ga0065715_10576100 Ga0065715_105761001 188
184 3300005327 Ga0070658_10037552 Ga0070658_100375522 188
185 3300005327 Ga0070658_10042471 Ga0070658_100424712 188
186 3300005327 Ga0070658_10053424 Ga0070658_100534242 188
187 3300005327 Ga0070658_10058340 Ga0070658_100583402 188
188 3300005327 Ga0070658_10059414 Ga0070658_100594142 188
189 3300005327 Ga0070658_10060755 Ga0070658_100607553 188
190 3300005327 Ga0070658_10070183 Ga0070658_100701832 188
191 3300005327 Ga0070658_10078019 Ga0070658_100780193 188
192 3300005327 Ga0070658_10083827 Ga0070658_100838272 188
193 3300005327 Ga0070658_10084961 Ga0070658_100849612 188
194 3300005327 Ga0070658_10131939 Ga0070658_101319393 188
195 3300005327 Ga0070658_10139640 Ga0070658_101396401 188
196 3300005327 Ga0070658_10488769 Ga0070658_104887691 188
197 3300005327 Ga0070658_10507188 Ga0070658_105071881 188
198 3300005327 Ga0070658_10552564 Ga0070658_105525641 188
199 3300005327 Ga0070658_10772654 Ga0070658_107726542 188
200 3300005328 Ga0070676_10113199 Ga0070676_101131991 188
201 3300005329 Ga0070683_100003807 Ga0070683_1000038077 188
202 3300005329 Ga0070683_100017720 Ga0070683_1000177203 188
203 3300005329 Ga0070683_100017806 Ga0070683_1000178062 188
204 3300005329 Ga0070683_100090024 Ga0070683_1000900242 188
205 3300005330 Ga0070690_100000975 Ga0070690_1000009756 188
206 3300005331 Ga0070670_100003621 Ga0070670_1000036212 188
207 3300005331 Ga0070670_100019881 Ga0070670_1000198815 188
208 3300005331 Ga0070670_100021575 Ga0070670_1000215752 188
209 3300005331 Ga0070670_100177304 Ga0070670_1001773042 188
210 3300005331 Ga0070670_100178920 Ga0070670_1001789201 188
211 3300005331 Ga0070670_100329121 Ga0070670_1003291212 188
212 3300005333 Ga0070677_10041961 Ga0070677_100419611 188
213 3300005333 Ga0070677_10102136 Ga0070677_101021362 188
214 3300005334 Ga0068869_100937565 Ga0068869_1009375651 188
215 3300005335 Ga0070666_10040464 Ga0070666_100404641 188
216 3300005335 Ga0070666_10044892 Ga0070666_100448922 188
217 3300005335 Ga0070666_10225384 Ga0070666_102253842 188
218 3300005336 Ga0070680_100002095 Ga0070680_1000020955 188
219 3300005336 Ga0070680_100002826 Ga0070680_1000028261 188
220 3300005336 Ga0070680_100004105 Ga0070680_1000041057 188
221 3300005336 Ga0070680_100007978 Ga0070680_1000079782 188
222 3300005336 Ga0070680_100029151 Ga0070680_1000291512 188
223 3300005336 Ga0070680_100031955 Ga0070680_1000319553 188
224 3300005336 Ga0070680_100033294 Ga0070680_1000332944 188
225 3300005336 Ga0070680_100050835 Ga0070680_1000508352 188
226 3300005336 Ga0070680_100067459 Ga0070680_1000674593 188
227 3300005336 Ga0070680_100135342 Ga0070680_1001353422 188
228 3300005336 Ga0070680_100837710 Ga0070680_1008377101 188
229 3300005337 Ga0070682_100023584 Ga0070682_1000235843 188
230 3300005338 Ga0068868_100004297 Ga0068868_1000042974 188
231 3300005338 Ga0068868_100069728 Ga0068868_1000697282 188
232 3300005338 Ga0068868_100110463 Ga0068868_1001104632 188
233 3300005338 Ga0068868_100565195 Ga0068868_1005651951 188
234 3300005338 Ga0068868_100743002 Ga0068868_1007430021 188
235 3300005339 Ga0070660_100000292 Ga0070660_10000029239 188
236 3300005339 Ga0070660_100002676 Ga0070660_10000267612 188
237 3300005339 Ga0070660_100028243 Ga0070660_1000282432 188
238 3300005339 Ga0070660_100031872 Ga0070660_1000318722 188
239 3300005339 Ga0070660_100039484 Ga0070660_1000394842 188
240 3300005339 Ga0070660_100086702 Ga0070660_1000867022 188
241 3300005339 Ga0070660_100120938 Ga0070660_1001209382 188
242 3300005339 Ga0070660_100165230 Ga0070660_1001652302 188
243 3300005339 Ga0070660_100168324 Ga0070660_1001683242 188
244 3300005339 Ga0070660_100276879 Ga0070660_1002768791 188
245 3300005339 Ga0070660_100287349 Ga0070660_1002873492 188
246 3300005339 Ga0070660_100292591 Ga0070660_1002925911 188
247 3300005339 Ga0070660_100372963 Ga0070660_1003729632 188
248 3300005339 Ga0070660_100445602 Ga0070660_1004456022 188
249 3300005340 Ga0070689_100405718 Ga0070689_1004057182 188
250 3300005344 Ga0070661_100005164 Ga0070661_1000051644 188
251 3300005344 Ga0070661_100006011 Ga0070661_1000060117 188
252 3300005344 Ga0070661_100011275 Ga0070661_1000112757 188
253 3300005344 Ga0070661_100013976 Ga0070661_1000139767 188
254 3300005344 Ga0070661_100027769 Ga0070661_1000277694 188
255 3300005344 Ga0070661_100033475 Ga0070661_1000334752 188
256 3300005344 Ga0070661_100047459 Ga0070661_1000474592 188
257 3300005344 Ga0070661_100070859 Ga0070661_1000708592 188
258 3300005344 Ga0070661_100079017 Ga0070661_1000790172 188
259 3300005344 Ga0070661_100109887 Ga0070661_1001098872 188
260 3300005344 Ga0070661_100121802 Ga0070661_1001218022 188
261 3300005344 Ga0070661_100151923 Ga0070661_1001519232 188
262 3300005344 Ga0070661_100255814 Ga0070661_1002558142 188
263 3300005344 Ga0070661_100303749 Ga0070661_1003037492 188
264 3300005344 Ga0070661_100503731 Ga0070661_1005037311 188
265 3300005344 Ga0070661_100819336 Ga0070661_1008193361 188
266 3300005345 Ga0070692_10081653 Ga0070692_100816531 188
267 3300005345 Ga0070692_10098843 Ga0070692_100988432 188
268 3300005347 Ga0070668_100088429 Ga0070668_1000884292 188
269 3300005347 Ga0070668_100706494 Ga0070668_1007064942 188
270 3300005354 Ga0070675_100037261 Ga0070675_1000372613 188
271 3300005354 Ga0070675_100080172 Ga0070675_1000801724 188
272 3300005354 Ga0070675_100269435 Ga0070675_1002694351 188
273 3300005355 Ga0070671_100002146 Ga0070671_10000214611 188
274 3300005355 Ga0070671_100003748 Ga0070671_1000037482 188
275 3300005355 Ga0070671_100004611 Ga0070671_10000461113 188
276 3300005355 Ga0070671_100012700 Ga0070671_1000127002 188
277 3300005355 Ga0070671_100022396 Ga0070671_1000223966 188
278 3300005355 Ga0070671_100028527 Ga0070671_1000285273 188
279 3300005355 Ga0070671_100039349 Ga0070671_1000393492 188
280 3300005355 Ga0070671_100061442 Ga0070671_1000614424 188
281 3300005355 Ga0070671_100176187 Ga0070671_1001761872 188
282 3300005355 Ga0070671_100538714 Ga0070671_1005387142 188
283 3300005356 Ga0070674_100013432 Ga0070674_1000134321 188
284 3300005356 Ga0070674_100026668 Ga0070674_1000266684 188
285 3300005356 Ga0070674_100077051 Ga0070674_1000770512 188
286 3300005356 Ga0070674_100184958 Ga0070674_1001849582 188
287 3300005356 Ga0070674_100214293 Ga0070674_1002142932 188
288 3300005356 Ga0070674_100437335 Ga0070674_1004373351 188
289 3300005364 Ga0070673_100003078 Ga0070673_10000307810 188
290 3300005364 Ga0070673_100008886 Ga0070673_1000088864 188
291 3300005364 Ga0070673_100015223 Ga0070673_1000152232 188
292 3300005364 Ga0070673_100614921 Ga0070673_1006149211 188
293 3300005365 Ga0070688_100176627 Ga0070688_1001766272 188
294 3300005366 Ga0070659_100014992 Ga0070659_1000149922 188
295 3300005366 Ga0070659_100017370 Ga0070659_1000173702 188
296 3300005366 Ga0070659_100020008 Ga0070659_1000200084 188
297 3300005366 Ga0070659_100020644 Ga0070659_1000206443 188
298 3300005366 Ga0070659_100045782 Ga0070659_1000457824 188
299 3300005366 Ga0070659_100123302 Ga0070659_1001233022 188
300 3300005366 Ga0070659_100155624 Ga0070659_1001556242 188
301 3300005366 Ga0070659_100183878 Ga0070659_1001838782 188
302 3300005366 Ga0070659_100243351 Ga0070659_1002433512 188
303 3300005366 Ga0070659_100277184 Ga0070659_1002771842 188
304 3300005366 Ga0070659_100440584 Ga0070659_1004405842 188
305 3300005366 Ga0070659_100543000 Ga0070659_1005430001 188
306 3300005366 Ga0070659_100583329 Ga0070659_1005833292 188
307 3300005366 Ga0070659_100595482 Ga0070659_1005954821 188
308 3300005366 Ga0070659_100772268 Ga0070659_1007722681 188
309 3300005367 Ga0070667_100004119 Ga0070667_1000041192 188
310 3300005367 Ga0070667_100073154 Ga0070667_1000731542 188
311 3300005367 Ga0070667_100282018 Ga0070667_1002820182 188
312 3300005434 Ga0070709_10337008 Ga0070709_103370082 188
313 3300005435 Ga0070714_100006882 Ga0070714_1000068827 188
314 3300005435 Ga0070714_100008944 Ga0070714_1000089444 188
315 3300005435 Ga0070714_100022003 Ga0070714_1000220034 188
316 3300005435 Ga0070714_100023913 Ga0070714_1000239133 188
317 3300005435 Ga0070714_100035022 Ga0070714_1000350224 188
318 3300005435 Ga0070714_100104375 Ga0070714_1001043754 188
319 3300005436 Ga0070713_100007630 Ga0070713_1000076306 188
320 3300005436 Ga0070713_100014226 Ga0070713_1000142262 188
321 3300005436 Ga0070713_100154752 Ga0070713_1001547521 188
322 3300005436 Ga0070713_100447267 Ga0070713_1004472671 188
323 3300005438 Ga0070701_10295504 Ga0070701_102955041 188
324 3300005455 Ga0070663_100004737 Ga0070663_1000047373 188
325 3300005455 Ga0070663_100019984 Ga0070663_1000199842 188
326 3300005455 Ga0070663_100029359 Ga0070663_1000293592 188
327 3300005455 Ga0070663_100046077 Ga0070663_1000460772 188
328 3300005455 Ga0070663_100081717 Ga0070663_1000817172 188
329 3300005455 Ga0070663_100115084 Ga0070663_1001150842 188
330 3300005455 Ga0070663_100483376 Ga0070663_1004833761 188
331 3300005456 Ga0070678_100011541 Ga0070678_1000115412 188
332 3300005456 Ga0070678_100011880 Ga0070678_1000118802 188
333 3300005456 Ga0070678_100012771 Ga0070678_1000127717 188
334 3300005456 Ga0070678_100277941 Ga0070678_1002779412 188
335 3300005457 Ga0070662_100001710 Ga0070662_1000017102 188
336 3300005457 Ga0070662_100001767 Ga0070662_1000017679 188
337 3300005457 Ga0070662_100052169 Ga0070662_1000521692 188
338 3300005457 Ga0070662_100069466 Ga0070662_1000694664 188
339 3300005457 Ga0070662_100083480 Ga0070662_1000834803 188
340 3300005457 Ga0070662_100108347 Ga0070662_1001083472 188
341 3300005457 Ga0070662_100144674 Ga0070662_1001446741 188
342 3300005457 Ga0070662_100182549 Ga0070662_1001825492 188
343 3300005457 Ga0070662_100194528 Ga0070662_1001945282 188
344 3300005458 Ga0070681_10065948 Ga0070681_100659482 188
345 3300005458 Ga0070681_10099770 Ga0070681_100997702 188
346 3300005458 Ga0070681_10273433 Ga0070681_102734331 188
347 3300005458 Ga0070681_10516432 Ga0070681_105164321 188
348 3300005458 Ga0070681_10558901 Ga0070681_105589011 188
349 3300005459 Ga0068867_100024875 Ga0068867_1000248754 188
350 3300005459 Ga0068867_100029478 Ga0068867_1000294782 188
351 3300005459 Ga0068867_100051821 Ga0068867_1000518214 188
352 3300005466 Ga0070685_10085069 Ga0070685_100850692 188
353 3300005530 Ga0070679_100020767 Ga0070679_1000207674 188
354 3300005530 Ga0070679_100119874 Ga0070679_1001198744 188
355 3300005530 Ga0070679_100125523 Ga0070679_1001255233 188
356 3300005530 Ga0070679_100142677 Ga0070679_1001426772 188
357 3300005530 Ga0070679_100183190 Ga0070679_1001831902 188
358 3300005530 Ga0070679_100708029 Ga0070679_1007080291 188
359 3300005530 Ga0070679_100994387 Ga0070679_1009943871 188
360 3300005535 Ga0070684_100002809 Ga0070684_1000028097 188
361 3300005535 Ga0070684_100005959 Ga0070684_10000595910 188
362 3300005535 Ga0070684_100008971 Ga0070684_1000089714 188
363 3300005535 Ga0070684_100111644 Ga0070684_1001116442 188
364 3300005535 Ga0070684_100231440 Ga0070684_1002314402 188
365 3300005539 Ga0068853_100023202 Ga0068853_1000232023 188
366 3300005539 Ga0068853_100037971 Ga0068853_1000379714 188
367 3300005539 Ga0068853_100053807 Ga0068853_1000538072 188
368 3300005539 Ga0068853_100095575 Ga0068853_1000955752 188
369 3300005539 Ga0068853_100185580 Ga0068853_1001855801 188
370 3300005539 Ga0068853_100230834 Ga0068853_1002308342 188
371 3300005539 Ga0068853_100924020 Ga0068853_1009240202 188
372 3300005543 Ga0070672_100000482 Ga0070672_1000004822 188
373 3300005543 Ga0070672_100001617 Ga0070672_1000016177 188
374 3300005543 Ga0070672_100107374 Ga0070672_1001073742 188
375 3300005543 Ga0070672_100164058 Ga0070672_1001640582 188
376 3300005543 Ga0070672_100421770 Ga0070672_1004217702 188
377 3300005544 Ga0070686_100048910 Ga0070686_1000489101 188
378 3300005544 Ga0070686_101012470 Ga0070686_1010124701 188
379 3300005547 Ga0070693_100245932 Ga0070693_1002459321 188
380 3300005548 Ga0070665_100012999 Ga0070665_1000129993 188
381 3300005548 Ga0070665_100249528 Ga0070665_1002495282 188
382 3300005548 Ga0070665_101026542 Ga0070665_1010265421 188
383 3300005563 Ga0068855_100009305 Ga0068855_1000093057 188
384 3300005563 Ga0068855_100025452 Ga0068855_1000254527 188
385 3300005563 Ga0068855_100185320 Ga0068855_1001853202 188
386 3300005563 Ga0068855_100251061 Ga0068855_1002510612 188
387 3300005563 Ga0068855_100288069 Ga0068855_1002880692 188
388 3300005563 Ga0068855_100290025 Ga0068855_1002900252 188
389 3300005563 Ga0068855_100307392 Ga0068855_1003073921 188
390 3300005563 Ga0068855_100308329 Ga0068855_1003083292 188
391 3300005563 Ga0068855_100672805 Ga0068855_1006728051 188
392 3300005563 Ga0068855_100961945 Ga0068855_1009619452 188
393 3300005563 Ga0068855_101091922 Ga0068855_1010919221 188
394 3300005564 Ga0070664_100004011 Ga0070664_1000040119 188
395 3300005564 Ga0070664_100004751 Ga0070664_10000475110 188
396 3300005564 Ga0070664_100017818 Ga0070664_1000178186 188
397 3300005564 Ga0070664_100019031 Ga0070664_1000190311 188
398 3300005564 Ga0070664_100027820 Ga0070664_1000278203 188
399 3300005564 Ga0070664_100073135 Ga0070664_1000731353 188
400 3300005564 Ga0070664_100150692 Ga0070664_1001506922 188
401 3300005564 Ga0070664_100200116 Ga0070664_1002001162 188
402 3300005564 Ga0070664_100214185 Ga0070664_1002141852 188
403 3300005564 Ga0070664_100258763 Ga0070664_1002587632 188
404 3300005577 Ga0068857_100007161 Ga0068857_1000071615 188
405 3300005577 Ga0068857_100009126 Ga0068857_1000091269 188
406 3300005577 Ga0068857_100099662 Ga0068857_1000996622 188
407 3300005577 Ga0068857_100511467 Ga0068857_1005114672 188
408 3300005577 Ga0068857_100614600 Ga0068857_1006146001 188
409 3300005577 Ga0068857_100688485 Ga0068857_1006884851 188
410 3300005578 Ga0068854_100023772 Ga0068854_1000237722 188
411 3300005578 Ga0068854_100041960 Ga0068854_1000419603 188
412 3300005578 Ga0068854_100146497 Ga0068854_1001464971 188
413 3300005578 Ga0068854_100322277 Ga0068854_1003222772 188
414 3300005578 Ga0068854_100323305 Ga0068854_1003233052 188
415 3300005578 Ga0068854_100323670 Ga0068854_1003236702 188
416 3300005578 Ga0068854_100442421 Ga0068854_1004424211 188
417 3300005614 Ga0068856_100006488 Ga0068856_1000064882 188
418 3300005614 Ga0068856_100026603 Ga0068856_1000266037 188
419 3300005614 Ga0068856_100078513 Ga0068856_1000785132 188
420 3300005614 Ga0068856_100130367 Ga0068856_1001303671 188
421 3300005614 Ga0068856_100154608 Ga0068856_1001546082 188
422 3300005614 Ga0068856_100167254 Ga0068856_1001672542 188
423 3300005614 Ga0068856_100297090 Ga0068856_1002970902 188
424 3300005614 Ga0068856_100470454 Ga0068856_1004704542 188
425 3300005614 Ga0068856_100594435 Ga0068856_1005944352 188
426 3300005614 Ga0068856_101045715 Ga0068856_1010457152 188
427 3300005614 Ga0068856_101111095 Ga0068856_1011110951 188
428 3300005616 Ga0068852_100000780 Ga0068852_1000007804 188
429 3300005616 Ga0068852_100017688 Ga0068852_1000176887 188
430 3300005616 Ga0068852_100034726 Ga0068852_1000347262 188
431 3300005616 Ga0068852_100047517 Ga0068852_1000475173 188
432 3300005616 Ga0068852_100109864 Ga0068852_1001098642 188
433 3300005616 Ga0068852_100121968 Ga0068852_1001219682 188
434 3300005616 Ga0068852_100179511 Ga0068852_1001795112 188
435 3300005616 Ga0068852_100221014 Ga0068852_1002210142 188
436 3300005616 Ga0068852_100252703 Ga0068852_1002527032 188
437 3300005616 Ga0068852_100306236 Ga0068852_1003062362 188
438 3300005616 Ga0068852_100342015 Ga0068852_1003420152 188
439 3300005616 Ga0068852_100407378 Ga0068852_1004073783 188
440 3300005616 Ga0068852_100497505 Ga0068852_1004975052 188
441 3300005616 Ga0068852_100544352 Ga0068852_1005443521 188
442 3300005616 Ga0068852_101215525 Ga0068852_1012155251 188
443 3300005617 Ga0068859_100102175 Ga0068859_1001021753 188
444 3300005617 Ga0068859_100184142 Ga0068859_1001841422 188
445 3300005617 Ga0068859_100296385 Ga0068859_1002963852 188
446 3300005618 Ga0068864_100007189 Ga0068864_1000071894 188
447 3300005618 Ga0068864_100030568 Ga0068864_1000305684 188
448 3300005618 Ga0068864_100041908 Ga0068864_1000419082 188
449 3300005618 Ga0068864_100075692 Ga0068864_1000756922 188
450 3300005618 Ga0068864_100174250 Ga0068864_1001742502 188
451 3300005618 Ga0068864_100374809 Ga0068864_1003748092 188
452 3300005719 Ga0068861_100034144 Ga0068861_1000341445 188
453 3300005719 Ga0068861_100656044 Ga0068861_1006560442 188
454 3300005834 Ga0068851_10008326 Ga0068851_100083264 188
455 3300005834 Ga0068851_10011272 Ga0068851_100112723 188
456 3300005834 Ga0068851_10034497 Ga0068851_100344972 188
457 3300005834 Ga0068851_10041897 Ga0068851_100418972 188
458 3300005834 Ga0068851_10088129 Ga0068851_100881292 188
459 3300005834 Ga0068851_10323094 Ga0068851_103230942 188
460 3300005834 Ga0068851_10392874 Ga0068851_103928741 188
461 3300005841 Ga0068863_100001961 Ga0068863_10000196122 188
462 3300005841 Ga0068863_100008814 Ga0068863_1000088142 188
463 3300005841 Ga0068863_100011229 Ga0068863_10001122910 188
464 3300005841 Ga0068863_100055577 Ga0068863_1000555774 188
465 3300005841 Ga0068863_100094661 Ga0068863_1000946612 188
466 3300005841 Ga0068863_100105286 Ga0068863_1001052861 188
467 3300005841 Ga0068863_100159590 Ga0068863_1001595902 188
468 3300005842 Ga0068858_100004459 Ga0068858_10000445911 188
469 3300005842 Ga0068858_100055982 Ga0068858_1000559824 188
470 3300005842 Ga0068858_100196002 Ga0068858_1001960022 188
471 3300005842 Ga0068858_100392349 Ga0068858_1003923492 188
472 3300005843 Ga0068860_101376179 Ga0068860_1013761791 188
473 3300005844 Ga0068862_100169492 Ga0068862_1001694922 188
474 3300006028 Ga0070717_10002889 Ga0070717_1000288914 188
475 3300006173 Ga0070716_100158059 Ga0070716_1001580592 188
476 3300006175 Ga0070712_100018385 Ga0070712_1000183852 188
477 3300006195 Ga0075366_10211207 Ga0075366_102112072 188
478 3300006237 Ga0097621_100055075 Ga0097621_1000550752 188
479 3300006237 Ga0097621_100679005 Ga0097621_1006790052 188
480 3300006237 Ga0097621_101121100 Ga0097621_1011211002 188
481 3300006358 Ga0068871_100004648 Ga0068871_1000046482 188
482 3300006358 Ga0068871_100045352 Ga0068871_1000453522 188
483 3300006847 Ga0075431_100050200 Ga0075431_1000502002 188
484 3300006881 Ga0068865_100041567 Ga0068865_1000415674 188
485 3300006881 Ga0068865_100737593 Ga0068865_1007375931 188
486 3300006931 Ga0097620_100102180 Ga0097620_1001021803 188
487 3300006931 Ga0097620_100184151 Ga0097620_1001841512 188
488 3300006931 Ga0097620_100296401 Ga0097620_1002964012 188
489 3300009093 Ga0105240_10036403 Ga0105240_100364037 188
490 3300009093 Ga0105240_10065704 Ga0105240_100657042 188
491 3300009093 Ga0105240_10072355 Ga0105240_100723554 188
492 3300009093 Ga0105240_10100438 Ga0105240_101004382 188
493 3300009098 Ga0105245_10064855 Ga0105245_100648552 188
494 3300009098 Ga0105245_10130216 Ga0105245_101302161 188
495 3300009098 Ga0105245_10179486 Ga0105245_101794861 188
496 3300009101 Ga0105247_10097125 Ga0105247_100971252 188
497 3300009148 Ga0105243_10026034 Ga0105243_100260342 188
498 3300009148 Ga0105243_10686753 Ga0105243_106867531 188
499 3300009174 Ga0105241_10895247 Ga0105241_108952471 188
500 3300009176 Ga0105242_10011421 Ga0105242_100114217 188
501 3300009177 Ga0105248_10001772 Ga0105248_1000177217 188
502 3300009177 Ga0105248_10008090 Ga0105248_100080907 188
503 3300009177 Ga0105248_10033985 Ga0105248_100339852 188
504 3300009177 Ga0105248_10046685 Ga0105248_100466855 188
505 3300009177 Ga0105248_10108374 Ga0105248_101083744 188
506 3300009177 Ga0105248_10293649 Ga0105248_102936492 188
507 3300009177 Ga0105248_10299327 Ga0105248_102993272 188
508 3300009545 Ga0105237_10014995 Ga0105237_100149954 188
509 3300009545 Ga0105237_10067815 Ga0105237_100678152 188
510 3300009545 Ga0105237_10158678 Ga0105237_101586782 188
511 3300009551 Ga0105238_10012445 Ga0105238_1001244511 188
512 3300009551 Ga0105238_10123456 Ga0105238_101234562 188
513 3300009551 Ga0105238_10151955 Ga0105238_101519553 188
514 3300009551 Ga0105238_10244734 Ga0105238_102447342 188
515 3300009551 Ga0105238_10409859 Ga0105238_104098592 188
516 3300009551 Ga0105238_10488600 Ga0105238_104886002 188
517 3300009551 Ga0105238_11081901 Ga0105238_110819012 188
518 3300010375 Ga0105239_10102886 Ga0105239_101028864 188
519 3300010375 Ga0105239_10324058 Ga0105239_103240582 188
520 3300010375 Ga0105239_10599632 Ga0105239_105996321 188
521 3300012512 Ga0157327_1012387 Ga0157327_10123871 188
522 3300013100 Ga0157373_10020464 Ga0157373_100204647 188
523 3300013100 Ga0157373_10039550 Ga0157373_100395502 188
524 3300013100 Ga0157373_10048638 Ga0157373_100486382 188
525 3300013100 Ga0157373_10061734 Ga0157373_100617343 188
526 3300013100 Ga0157373_10066321 Ga0157373_100663213 188
527 3300013100 Ga0157373_10112412 Ga0157373_101124122 188
528 3300013100 Ga0157373_10186941 Ga0157373_101869412 188
529 3300013100 Ga0157373_10211010 Ga0157373_102110102 188
530 3300013100 Ga0157373_10294906 Ga0157373_102949062 188
531 3300013100 Ga0157373_10355840 Ga0157373_103558401 188
532 3300013102 Ga0157371_10028922 Ga0157371_100289222 188
533 3300013102 Ga0157371_10031672 Ga0157371_100316722 188
534 3300013102 Ga0157371_10125755 Ga0157371_101257552 188
535 3300013102 Ga0157371_10149470 Ga0157371_101494702 188
536 3300013102 Ga0157371_10244958 Ga0157371_102449582 188
537 3300013102 Ga0157371_10526587 Ga0157371_105265871 188
538 3300013104 Ga0157370_10001517 Ga0157370_100015172 188
539 3300013104 Ga0157370_10030709 Ga0157370_100307092 188
540 3300013104 Ga0157370_10079475 Ga0157370_100794752 188
541 3300013104 Ga0157370_10084885 Ga0157370_100848854 188
542 3300013104 Ga0157370_10089235 Ga0157370_100892354 188
543 3300013104 Ga0157370_10101658 Ga0157370_101016582 188
544 3300013104 Ga0157370_10126912 Ga0157370_101269122 188
545 3300013104 Ga0157370_10139218 Ga0157370_101392182 188
546 3300013104 Ga0157370_10159008 Ga0157370_101590082 188
547 3300013104 Ga0157370_10256990 Ga0157370_102569902 188
548 3300013104 Ga0157370_11084001 Ga0157370_110840011 188
549 3300013105 Ga0157369_10011815 Ga0157369_100118154 188
550 3300013105 Ga0157369_10032604 Ga0157369_100326042 188
551 3300013105 Ga0157369_10051385 Ga0157369_100513851 188
552 3300013105 Ga0157369_10063659 Ga0157369_100636592 188
553 3300013105 Ga0157369_10074576 Ga0157369_100745763 188
554 3300013105 Ga0157369_10290683 Ga0157369_102906832 188
555 3300013105 Ga0157369_10384446 Ga0157369_103844462 188
556 3300013105 Ga0157369_10386468 Ga0157369_103864682 188
557 3300013105 Ga0157369_10486957 Ga0157369_104869572 188
558 3300013105 Ga0157369_10600631 Ga0157369_106006312 188
559 3300013105 Ga0157369_10631080 Ga0157369_106310802 188
560 3300013105 Ga0157369_10737704 Ga0157369_107377041 188
561 3300013105 Ga0157369_10881441 Ga0157369_108814411 188
562 3300013296 Ga0157374_10004801 Ga0157374_100048012 188
563 3300013296 Ga0157374_10012198 Ga0157374_100121987 188
564 3300013296 Ga0157374_10056725 Ga0157374_100567254 188
565 3300013296 Ga0157374_10067150 Ga0157374_100671504 188
566 3300013296 Ga0157374_10227665 Ga0157374_102276652 188
567 3300013296 Ga0157374_10232179 Ga0157374_102321792 188
568 3300013296 Ga0157374_10306601 Ga0157374_103066012 188
569 3300013296 Ga0157374_10488603 Ga0157374_104886032 188
570 3300013296 Ga0157374_10701800 Ga0157374_107018002 188
571 3300013297 Ga0157378_10055263 Ga0157378_100552633 188
572 3300013297 Ga0157378_10078495 Ga0157378_100784952 188
573 3300013306 Ga0163162_10016498 Ga0163162_100164989 188
574 3300013306 Ga0163162_10053659 Ga0163162_100536592 188
575 3300013306 Ga0163162_10158119 Ga0163162_101581192 188
576 3300013306 Ga0163162_10767938 Ga0163162_107679382 188
577 3300013306 Ga0163162_10774284 Ga0163162_107742842 188
578 3300013307 Ga0157372_10044687 Ga0157372_100446872 188
579 3300013307 Ga0157372_10076321 Ga0157372_100763211 188
580 3300013307 Ga0157372_10077732 Ga0157372_100777322 188
581 3300013307 Ga0157372_10101700 Ga0157372_101017002 188
582 3300013307 Ga0157372_10143455 Ga0157372_101434554 188
583 3300013307 Ga0157372_10555367 Ga0157372_105553672 188
584 3300013307 Ga0157372_10995408 Ga0157372_109954082 188
585 3300013307 Ga0157372_11121821 Ga0157372_111218211 188
586 3300013307 Ga0157372_11665630 Ga0157372_116656301 188
587 3300013308 Ga0157375_10000628 Ga0157375_100006287 188
588 3300013308 Ga0157375_10005662 Ga0157375_100056628 188
589 3300013308 Ga0157375_10010643 Ga0157375_100106438 188
590 3300013308 Ga0157375_10036423 Ga0157375_100364232 188
591 3300013308 Ga0157375_10394985 Ga0157375_103949851 188
592 3300014325 Ga0163163_10017559 Ga0163163_100175594 188
593 3300014325 Ga0163163_10069124 Ga0163163_100691242 188
594 3300014325 Ga0163163_10337827 Ga0163163_103378272 188
595 3300014745 Ga0157377_10102284 Ga0157377_101022842 188
596 3300014968 Ga0157379_10135239 Ga0157379_101352392 188
597 3300014969 Ga0157376_10013327 Ga0157376_100133272 188
598 3300021384 Ga0213876_10058085 Ga0213876_100580852 188
599 3300021388 Ga0213875_10003717 Ga0213875_100037174 188
600 3300025315 Ga0207697_10225478 Ga0207697_102254782 188
601 3300025321 Ga0207656_10009031 Ga0207656_100090314 188
602 3300025321 Ga0207656_10017763 Ga0207656_100177632 188
603 3300025321 Ga0207656_10046213 Ga0207656_100462132 188
604 3300025321 Ga0207656_10100153 Ga0207656_101001532 188
605 3300025321 Ga0207656_10127553 Ga0207656_101275532 188
606 3300025321 Ga0207656_10260571 Ga0207656_102605712 188
607 3300025900 Ga0207710_10138377 Ga0207710_101383771 188
608 3300025901 Ga0207688_10040501 Ga0207688_100405012 188
609 3300025901 Ga0207688_10137939 Ga0207688_101379391 188
610 3300025901 Ga0207688_10211734 Ga0207688_102117341 188
611 3300025903 Ga0207680_10064871 Ga0207680_100648712 188
612 3300025903 Ga0207680_10078098 Ga0207680_100780981 188
613 3300025903 Ga0207680_10198057 Ga0207680_101980571 188
614 3300025904 Ga0207647_10002253 Ga0207647_100022537 188
615 3300025904 Ga0207647_10011244 Ga0207647_100112442 188
616 3300025904 Ga0207647_10059246 Ga0207647_100592462 188
617 3300025906 Ga0207699_10006940 Ga0207699_100069402 188
618 3300025907 Ga0207645_10367677 Ga0207645_103676772 188
619 3300025907 Ga0207645_10718365 Ga0207645_107183651 188
620 3300025909 Ga0207705_10009761 Ga0207705_100097612 188
621 3300025909 Ga0207705_10010079 Ga0207705_100100794 188
622 3300025909 Ga0207705_10023463 Ga0207705_100234632 188
623 3300025909 Ga0207705_10025066 Ga0207705_100250665 188
624 3300025909 Ga0207705_10028878 Ga0207705_100288783 188
625 3300025909 Ga0207705_10045167 Ga0207705_100451672 188
626 3300025909 Ga0207705_10072990 Ga0207705_100729902 188
627 3300025909 Ga0207705_10083429 Ga0207705_100834292 188
628 3300025909 Ga0207705_10088512 Ga0207705_100885122 188
629 3300025909 Ga0207705_10113567 Ga0207705_101135672 188
630 3300025909 Ga0207705_10145847 Ga0207705_101458471 188
631 3300025909 Ga0207705_10153721 Ga0207705_101537212 188
632 3300025909 Ga0207705_10160023 Ga0207705_101600232 188
633 3300025909 Ga0207705_10212578 Ga0207705_102125782 188
634 3300025909 Ga0207705_10222125 Ga0207705_102221252 188
635 3300025909 Ga0207705_10255888 Ga0207705_102558882 188
636 3300025909 Ga0207705_10292368 Ga0207705_102923682 188
637 3300025909 Ga0207705_10437614 Ga0207705_104376142 188
638 3300025909 Ga0207705_10491249 Ga0207705_104912492 188
639 3300025909 Ga0207705_10530115 Ga0207705_105301151 188
640 3300025911 Ga0207654_10021170 Ga0207654_100211702 188
641 3300025911 Ga0207654_10074794 Ga0207654_100747942 188
642 3300025912 Ga0207707_10053133 Ga0207707_100531334 188
643 3300025912 Ga0207707_10059955 Ga0207707_100599552 188
644 3300025912 Ga0207707_10255593 Ga0207707_102555932 188
645 3300025912 Ga0207707_10399019 Ga0207707_103990192 188
646 3300025913 Ga0207695_10095462 Ga0207695_100954622 188
647 3300025913 Ga0207695_10391265 Ga0207695_103912651 188
648 3300025914 Ga0207671_10133564 Ga0207671_101335642 188
649 3300025914 Ga0207671_10289874 Ga0207671_102898742 188
650 3300025915 Ga0207693_10016452 Ga0207693_100164525 188
651 3300025917 Ga0207660_10000486 Ga0207660_100004862 188
652 3300025917 Ga0207660_10004335 Ga0207660_100043357 188
653 3300025917 Ga0207660_10018885 Ga0207660_100188854 188
654 3300025917 Ga0207660_10028327 Ga0207660_100283274 188
655 3300025917 Ga0207660_10040569 Ga0207660_100405694 188
656 3300025917 Ga0207660_10171572 Ga0207660_101715722 188
657 3300025917 Ga0207660_10300405 Ga0207660_103004052 188
658 3300025917 Ga0207660_10301590 Ga0207660_103015902 188
659 3300025917 Ga0207660_10343688 Ga0207660_103436882 188
660 3300025917 Ga0207660_10531958 Ga0207660_105319581 188
661 3300025919 Ga0207657_10000468 Ga0207657_1000046839 188
662 3300025919 Ga0207657_10000962 Ga0207657_100009622 188
663 3300025919 Ga0207657_10006400 Ga0207657_1000640012 188
664 3300025919 Ga0207657_10008544 Ga0207657_100085442 188
665 3300025919 Ga0207657_10008661 Ga0207657_100086615 188
666 3300025919 Ga0207657_10009276 Ga0207657_100092767 188
667 3300025919 Ga0207657_10013729 Ga0207657_100137296 188
668 3300025919 Ga0207657_10014819 Ga0207657_100148196 188
669 3300025919 Ga0207657_10055261 Ga0207657_100552613 188
670 3300025919 Ga0207657_10114704 Ga0207657_101147042 188
671 3300025919 Ga0207657_10163240 Ga0207657_101632402 188
672 3300025919 Ga0207657_10165153 Ga0207657_101651532 188
673 3300025919 Ga0207657_10189365 Ga0207657_101893652 188
674 3300025919 Ga0207657_10195724 Ga0207657_101957242 188
675 3300025919 Ga0207657_10212639 Ga0207657_102126392 188
676 3300025919 Ga0207657_10226608 Ga0207657_102266081 188
677 3300025919 Ga0207657_10316102 Ga0207657_103161022 188
678 3300025919 Ga0207657_10733883 Ga0207657_107338832 188
679 3300025920 Ga0207649_10015100 Ga0207649_100151005 188
680 3300025920 Ga0207649_10017964 Ga0207649_100179643 188
681 3300025920 Ga0207649_10027490 Ga0207649_100274902 188
682 3300025920 Ga0207649_10048553 Ga0207649_100485532 188
683 3300025920 Ga0207649_10088743 Ga0207649_100887432 188
684 3300025920 Ga0207649_10155084 Ga0207649_101550841 188
685 3300025920 Ga0207649_10160701 Ga0207649_101607012 188
686 3300025920 Ga0207649_10185803 Ga0207649_101858032 188
687 3300025920 Ga0207649_10514381 Ga0207649_105143812 188
688 3300025921 Ga0207652_10001035 Ga0207652_1000103522 188
689 3300025921 Ga0207652_10089311 Ga0207652_100893114 188
690 3300025921 Ga0207652_10198512 Ga0207652_101985122 188
691 3300025921 Ga0207652_10296152 Ga0207652_102961522 188
692 3300025921 Ga0207652_10441825 Ga0207652_104418251 188
693 3300025921 Ga0207652_10482327 Ga0207652_104823272 188
694 3300025923 Ga0207681_10170332 Ga0207681_101703322 188
695 3300025924 Ga0207694_10000827 Ga0207694_1000082729 188
696 3300025924 Ga0207694_10026849 Ga0207694_100268493 188
697 3300025924 Ga0207694_10053090 Ga0207694_100530903 188
698 3300025924 Ga0207694_10118117 Ga0207694_101181172 188
699 3300025924 Ga0207694_10152003 Ga0207694_101520032 188
700 3300025924 Ga0207694_10259170 Ga0207694_102591702 188
701 3300025924 Ga0207694_10308753 Ga0207694_103087531 188
702 3300025925 Ga0207650_10094598 Ga0207650_100945981 188
703 3300025925 Ga0207650_10118802 Ga0207650_101188022 188
704 3300025925 Ga0207650_10230154 Ga0207650_102301541 188
705 3300025925 Ga0207650_10897330 Ga0207650_108973301 188
706 3300025926 Ga0207659_10220841 Ga0207659_102208411 188
707 3300025926 Ga0207659_10382959 Ga0207659_103829591 188
708 3300025926 Ga0207659_10515537 Ga0207659_105155372 188
709 3300025927 Ga0207687_10030769 Ga0207687_100307694 188
710 3300025927 Ga0207687_10119874 Ga0207687_101198741 188
711 3300025928 Ga0207700_10037527 Ga0207700_100375274 188
712 3300025928 Ga0207700_10116548 Ga0207700_101165482 188
713 3300025928 Ga0207700_10726114 Ga0207700_107261142 188
714 3300025929 Ga0207664_10009182 Ga0207664_100091824 188
715 3300025929 Ga0207664_10016142 Ga0207664_100161422 188
716 3300025929 Ga0207664_10052197 Ga0207664_100521972 188
717 3300025929 Ga0207664_10074862 Ga0207664_100748623 188
718 3300025929 Ga0207664_10211926 Ga0207664_102119262 188
719 3300025931 Ga0207644_10000196 Ga0207644_100001962 188
720 3300025931 Ga0207644_10000683 Ga0207644_100006837 188
721 3300025931 Ga0207644_10003126 Ga0207644_100031267 188
722 3300025931 Ga0207644_10003168 Ga0207644_1000316814 188
723 3300025931 Ga0207644_10004471 Ga0207644_100044712 188
724 3300025931 Ga0207644_10007550 Ga0207644_100075507 188
725 3300025931 Ga0207644_10022270 Ga0207644_100222702 188
726 3300025931 Ga0207644_10028505 Ga0207644_100285053 188
727 3300025931 Ga0207644_10181214 Ga0207644_101812142 188
728 3300025932 Ga0207690_10020149 Ga0207690_100201492 188
729 3300025932 Ga0207690_10022399 Ga0207690_100223992 188
730 3300025932 Ga0207690_10045718 Ga0207690_100457182 188
731 3300025932 Ga0207690_10068217 Ga0207690_100682171 188
732 3300025932 Ga0207690_10092032 Ga0207690_100920322 188
733 3300025932 Ga0207690_10102186 Ga0207690_101021862 188
734 3300025932 Ga0207690_10181157 Ga0207690_101811572 188
735 3300025932 Ga0207690_10211430 Ga0207690_102114301 188
736 3300025932 Ga0207690_10394965 Ga0207690_103949652 188
737 3300025932 Ga0207690_10421685 Ga0207690_104216852 188
738 3300025932 Ga0207690_10436349 Ga0207690_104363492 188
739 3300025932 Ga0207690_10481849 Ga0207690_104818491 188
740 3300025932 Ga0207690_10503655 Ga0207690_105036552 188
741 3300025932 Ga0207690_11076308 Ga0207690_110763081 188
742 3300025933 Ga0207706_10000840 Ga0207706_1000084022 188
743 3300025933 Ga0207706_10000866 Ga0207706_1000086627 188
744 3300025933 Ga0207706_10035267 Ga0207706_100352672 188
745 3300025933 Ga0207706_10053907 Ga0207706_100539073 188
746 3300025933 Ga0207706_10055114 Ga0207706_100551142 188
747 3300025933 Ga0207706_10081956 Ga0207706_100819562 188
748 3300025933 Ga0207706_10108224 Ga0207706_101082242 188
749 3300025933 Ga0207706_10170397 Ga0207706_101703972 188
750 3300025933 Ga0207706_10434869 Ga0207706_104348692 188
751 3300025933 Ga0207706_10546602 Ga0207706_105466022 188
752 3300025935 Ga0207709_10008926 Ga0207709_100089265 188
753 3300025935 Ga0207709_10307926 Ga0207709_103079262 188
754 3300025936 Ga0207670_10242397 Ga0207670_102423972 188
755 3300025937 Ga0207669_10017469 Ga0207669_100174694 188
756 3300025937 Ga0207669_10048574 Ga0207669_100485742 188
757 3300025937 Ga0207669_10064969 Ga0207669_100649692 188
758 3300025937 Ga0207669_10134445 Ga0207669_101344452 188
759 3300025937 Ga0207669_10135032 Ga0207669_101350322 188
760 3300025938 Ga0207704_10002295 Ga0207704_100022958 188
761 3300025939 Ga0207665_10013298 Ga0207665_100132982 188
762 3300025940 Ga0207691_10000705 Ga0207691_1000070526 188
763 3300025940 Ga0207691_10001025 Ga0207691_1000102530 188
764 3300025940 Ga0207691_10028701 Ga0207691_100287014 188
765 3300025940 Ga0207691_10115922 Ga0207691_101159222 188
766 3300025940 Ga0207691_10326890 Ga0207691_103268902 188
767 3300025941 Ga0207711_10000567 Ga0207711_100005677 188
768 3300025941 Ga0207711_10001908 Ga0207711_1000190813 188
769 3300025941 Ga0207711_10003425 Ga0207711_100034252 188
770 3300025941 Ga0207711_10009332 Ga0207711_100093328 188
771 3300025941 Ga0207711_10011201 Ga0207711_100112017 188
772 3300025941 Ga0207711_10023294 Ga0207711_100232944 188
773 3300025941 Ga0207711_10294255 Ga0207711_102942551 188
774 3300025944 Ga0207661_10010702 Ga0207661_100107024 188
775 3300025944 Ga0207661_10012427 Ga0207661_100124272 188
776 3300025944 Ga0207661_10128967 Ga0207661_101289672 188
777 3300025945 Ga0207679_10020437 Ga0207679_100204371 188
778 3300025945 Ga0207679_10029743 Ga0207679_100297432 188
779 3300025945 Ga0207679_10090650 Ga0207679_100906502 188
780 3300025945 Ga0207679_10356474 Ga0207679_103564742 188
781 3300025945 Ga0207679_10420730 Ga0207679_104207301 188
782 3300025945 Ga0207679_10488189 Ga0207679_104881891 188
783 3300025945 Ga0207679_10686668 Ga0207679_106866681 188
784 3300025949 Ga0207667_10011406 Ga0207667_100114066 188
785 3300025949 Ga0207667_10043138 Ga0207667_100431382 188
786 3300025949 Ga0207667_10055601 Ga0207667_100556012 188
787 3300025949 Ga0207667_10059830 Ga0207667_100598302 188
788 3300025949 Ga0207667_10082828 Ga0207667_100828282 188
789 3300025949 Ga0207667_10262837 Ga0207667_102628372 188
790 3300025949 Ga0207667_10281690 Ga0207667_102816902 188
791 3300025949 Ga0207667_10530242 Ga0207667_105302421 188
792 3300025949 Ga0207667_10866861 Ga0207667_108668611 188
793 3300025949 Ga0207667_10894020 Ga0207667_108940202 188
794 3300025949 Ga0207667_11280000 Ga0207667_112800001 188
795 3300025960 Ga0207651_10002016 Ga0207651_100020162 188
796 3300025960 Ga0207651_10002614 Ga0207651_100026142 188
797 3300025960 Ga0207651_10191007 Ga0207651_101910072 188
798 3300025960 Ga0207651_10508037 Ga0207651_105080372 188
799 3300025972 Ga0207668_10003245 Ga0207668_100032452 188
800 3300025972 Ga0207668_11008577 Ga0207668_110085771 188
801 3300025981 Ga0207640_10008683 Ga0207640_100086832 188
802 3300025981 Ga0207640_10012845 Ga0207640_100128452 188
803 3300025981 Ga0207640_10036628 Ga0207640_100366281 188
804 3300025981 Ga0207640_10037868 Ga0207640_100378682 188
805 3300025981 Ga0207640_10043758 Ga0207640_100437582 188
806 3300025981 Ga0207640_10383300 Ga0207640_103833002 188
807 3300025986 Ga0207658_10003798 Ga0207658_100037984 188
808 3300025986 Ga0207658_10015873 Ga0207658_100158732 188
809 3300025986 Ga0207658_10023660 Ga0207658_100236602 188
810 3300025986 Ga0207658_10054876 Ga0207658_100548762 188
811 3300025986 Ga0207658_10079767 Ga0207658_100797672 188
812 3300025986 Ga0207658_11062593 Ga0207658_110625931 188
813 3300026023 Ga0207677_10005707 Ga0207677_100057072 188
814 3300026023 Ga0207677_10033650 Ga0207677_100336502 188
815 3300026035 Ga0207703_10019804 Ga0207703_100198044 188
816 3300026035 Ga0207703_10055651 Ga0207703_100556512 188
817 3300026041 Ga0207639_10000990 Ga0207639_100009907 188
818 3300026041 Ga0207639_10022105 Ga0207639_100221052 188
819 3300026041 Ga0207639_10064947 Ga0207639_100649472 188
820 3300026041 Ga0207639_10074993 Ga0207639_100749933 188
821 3300026041 Ga0207639_10134124 Ga0207639_101341242 188
822 3300026041 Ga0207639_10163772 Ga0207639_101637722 188
823 3300026041 Ga0207639_10186692 Ga0207639_101866922 188
824 3300026041 Ga0207639_10216648 Ga0207639_102166482 188
825 3300026041 Ga0207639_10265943 Ga0207639_102659432 188
826 3300026041 Ga0207639_11543057 Ga0207639_115430571 188
827 3300026067 Ga0207678_10007964 Ga0207678_100079647 188
828 3300026067 Ga0207678_10021371 Ga0207678_100213714 188
829 3300026067 Ga0207678_10023365 Ga0207678_100233654 188
830 3300026067 Ga0207678_10041105 Ga0207678_100411053 188
831 3300026067 Ga0207678_10075580 Ga0207678_100755802 188
832 3300026067 Ga0207678_10240826 Ga0207678_102408262 188
833 3300026067 Ga0207678_10312340 Ga0207678_103123402 188
834 3300026078 Ga0207702_10002086 Ga0207702_100020862 188
835 3300026078 Ga0207702_10025380 Ga0207702_100253802 188
836 3300026078 Ga0207702_10029638 Ga0207702_100296382 188
837 3300026078 Ga0207702_10034812 Ga0207702_100348124 188
838 3300026078 Ga0207702_10112040 Ga0207702_101120402 188
839 3300026078 Ga0207702_10158750 Ga0207702_101587502 188
840 3300026078 Ga0207702_10198566 Ga0207702_101985662 188
841 3300026078 Ga0207702_10212725 Ga0207702_102127252 188
842 3300026078 Ga0207702_10260575 Ga0207702_102605752 188
843 3300026078 Ga0207702_10313391 Ga0207702_103133912 188
844 3300026078 Ga0207702_10363826 Ga0207702_103638262 188
845 3300026078 Ga0207702_10576574 Ga0207702_105765742 188
846 3300026078 Ga0207702_10634019 Ga0207702_106340191 188
847 3300026078 Ga0207702_10781700 Ga0207702_107817002 188
848 3300026088 Ga0207641_10046505 Ga0207641_100465052 188
849 3300026088 Ga0207641_10052770 Ga0207641_100527704 188
850 3300026088 Ga0207641_10080010 Ga0207641_100800102 188
851 3300026088 Ga0207641_10106241 Ga0207641_101062412 188
852 3300026088 Ga0207641_10251252 Ga0207641_102512522 188
853 3300026088 Ga0207641_10310991 Ga0207641_103109911 188
854 3300026089 Ga0207648_10002898 Ga0207648_1000289819 188
855 3300026089 Ga0207648_10072619 Ga0207648_100726194 188
856 3300026089 Ga0207648_10093664 Ga0207648_100936643 188
857 3300026095 Ga0207676_10003029 Ga0207676_100030295 188
858 3300026095 Ga0207676_10061896 Ga0207676_100618962 188
859 3300026095 Ga0207676_10172079 Ga0207676_101720792 188
860 3300026116 Ga0207674_10000410 Ga0207674_1000041055 188
861 3300026116 Ga0207674_10002803 Ga0207674_1000280315 188
862 3300026116 Ga0207674_10005074 Ga0207674_100050747 188
863 3300026116 Ga0207674_10014333 Ga0207674_100143332 188
864 3300026116 Ga0207674_10020766 Ga0207674_100207664 188
865 3300026116 Ga0207674_10098836 Ga0207674_100988362 188
866 3300026116 Ga0207674_10472081 Ga0207674_104720812 188
867 3300026116 Ga0207674_10931900 Ga0207674_109319001 188
868 3300026118 Ga0207675_100035218 Ga0207675_1000352185 188
869 3300026118 Ga0207675_100965873 Ga0207675_1009658731 188
870 3300026121 Ga0207683_10003325 Ga0207683_1000332515 188
871 3300026121 Ga0207683_10003836 Ga0207683_100038367 188
872 3300026121 Ga0207683_10013902 Ga0207683_100139022 188
873 3300026121 Ga0207683_10028924 Ga0207683_100289242 188
874 3300026142 Ga0207698_10020965 Ga0207698_100209653 188
875 3300026142 Ga0207698_10039128 Ga0207698_100391282 188
876 3300026142 Ga0207698_10157680 Ga0207698_101576802 188
877 3300026142 Ga0207698_10406296 Ga0207698_104062961 188
878 3300026142 Ga0207698_10479870 Ga0207698_104798702 188
879 3300026142 Ga0207698_10488250 Ga0207698_104882502 188
880 3300026142 Ga0207698_10513971 Ga0207698_105139711 188
881 3300026142 Ga0207698_10595718 Ga0207698_105957181 188
882 3300026142 Ga0207698_11066099 Ga0207698_110660992 188
883 3300026142 Ga0207698_11128337 Ga0207698_111283371 188
884 3300028379 Ga0268266_10040623 Ga0268266_100406233 188
885 3300028379 Ga0268266_10166573 Ga0268266_101665732 188
886 3300028379 Ga0268266_10301313 Ga0268266_103013131 188
887 3300028380 Ga0268265_10046912 Ga0268265_100469122 188
888 3300028381 Ga0268264_10721314 Ga0268264_107213141 188
889 3300030731 Ga0316177_1110053 Ga0316177_11100532 188
890 3300031548 Ga0307408_100446788 Ga0307408_1004467882 188
891 3300031731 Ga0307405_10480136 Ga0307405_104801362 188
892 3300031901 Ga0307406_10166778 Ga0307406_101667781 188
893 3300031903 Ga0307407_10017599 Ga0307407_100175994 188
894 3300031911 Ga0307412_10047507 Ga0307412_100475072 188
895 3300031911 Ga0307412_10191520 Ga0307412_101915202 188
896 3300031995 Ga0307409_100464995 Ga0307409_1004649952 188
897 3300031995 Ga0307409_100849553 Ga0307409_1008495531 188
898 3300032002 Ga0307416_100017484 Ga0307416_1000174842 188
899 3300032002 Ga0307416_100171222 Ga0307416_1001712221 188
900 3300032002 Ga0307416_100249020 Ga0307416_1002490202 188
901 3300032004 Ga0307414_10256090 Ga0307414_102560902 188
902 3300032004 Ga0307414_10304000 Ga0307414_103040002 188
903 3300032004 Ga0307414_10416731 Ga0307414_104167311 188
904 3300032126 Ga0307415_100046965 Ga0307415_1000469652 188
905 3300032126 Ga0307415_100198036 Ga0307415_1001980362 188
906 3300035170 Ga0373943_0143482 Ga0373943_0143482_39_605 188
907 3300035691 Ga0373931_0035097 Ga0373931_0035097_15_581 188
908 3300035692 Ga0373935_0029922 Ga0373935_0029922_1149_1715 188
909 3300035692 Ga0373935_0529772 Ga0373935_0529772_188_754 188
910 3300035695 Ga0373927_0213061 Ga0373927_0213061_179_745 188
911 3300037068 Ga0373925_0007654 Ga0373925_0007654_1200_1766 188
912 3300037312 Ga0395899_0000103 Ga0395899_0000103_107475_108041 188
913 3300037312 Ga0395899_0001385 Ga0395899_0001385_3967_4533 188
914 3300037312 Ga0395899_0001799 Ga0395899_0001799_1114_1680 188
915 3300037312 Ga0395899_0002564 Ga0395899_0002564_13444_14010 188
916 3300037312 Ga0395899_0015642 Ga0395899_0015642_1436_2002 188
917 3300037312 Ga0395899_0020357 Ga0395899_0020357_4220_4786 188
918 3300037312 Ga0395899_0024773 Ga0395899_0024773_2187_2753 188
919 3300037312 Ga0395899_0024899 Ga0395899_0024899_1024_1590 188
920 3300037312 Ga0395899_0037206 Ga0395899_0037206_1032_1598 188
921 3300037312 Ga0395899_0047200 Ga0395899_0047200_1381_1947 188
922 3300037312 Ga0395899_0074101 Ga0395899_0074101_900_1466 188
923 3300037312 Ga0395899_0127859 Ga0395899_0127859_1063_1632 188
924 3300037312 Ga0395899_0173706 Ga0395899_0173706_767_1333 188
925 3300037312 Ga0395899_0237853 Ga0395899_0237853_73_639 188
926 3300037312 Ga0395899_0288487 Ga0395899_0288487_413_979 188
927 3300037312 Ga0395899_0358895 Ga0395899_0358895_325_891 188
928 3300037312 Ga0395899_0586790 Ga0395899_0586790_68_634 188
929 3300037418 Ga0395900_0000093 Ga0395900_0000093_162076_162642 188
930 3300037418 Ga0395900_0000862 Ga0395900_0000862_25688_26254 188
931 3300037418 Ga0395900_0006491 Ga0395900_0006491_4934_5500 188
932 3300037418 Ga0395900_0006570 Ga0395900_0006570_7038_7604 188
933 3300037418 Ga0395900_0007490 Ga0395900_0007490_1301_1867 188
934 3300037418 Ga0395900_0009496 Ga0395900_0009496_7803_8369 188
935 3300037418 Ga0395900_0021609 Ga0395900_0021609_4002_4568 188
936 3300037418 Ga0395900_0023881 Ga0395900_0023881_2814_3380 188
937 3300037418 Ga0395900_0031712 Ga0395900_0031712_321_887 188
938 3300037418 Ga0395900_0033954 Ga0395900_0033954_4063_4632 188
939 3300037418 Ga0395900_0050442 Ga0395900_0050442_3710_4276 188
940 3300037418 Ga0395900_0052438 Ga0395900_0052438_155_721 188
941 3300037418 Ga0395900_0059395 Ga0395900_0059395_2357_2923 188
942 3300037418 Ga0395900_0118241 Ga0395900_0118241_1242_1808 188
943 3300037418 Ga0395900_0128400 Ga0395900_0128400_1888_2454 188
944 3300037418 Ga0395900_0135829 Ga0395900_0135829_1769_2335 188
945 3300037418 Ga0395900_0165660 Ga0395900_0165660_1471_2037 188
946 3300037418 Ga0395900_0194163 Ga0395900_0194163_1458_2024 188
947 3300037418 Ga0395900_0214555 Ga0395900_0214555_96_662 188
948 3300037418 Ga0395900_0231268 Ga0395900_0231268_1000_1566 188
949 3300037418 Ga0395900_0314878 Ga0395900_0314878_578_1144 188
950 3300037418 Ga0395900_0369686 Ga0395900_0369686_668_1234 188
951 3300037418 Ga0395900_0385502 Ga0395900_0385502_583_1149 188
952 3300037418 Ga0395900_0463431 Ga0395900_0463431_395_961 188
953 3300037418 Ga0395900_0485406 Ga0395900_0485406_206_772 188
954 3300037418 Ga0395900_0607104 Ga0395900_0607104_296_862 188
955 3300037418 Ga0395900_0661902 Ga0395900_0661902_46_612 188
956 3300037418 Ga0395900_0771792 Ga0395900_0771792_155_721 188
957 3300037418 Ga0395900_0771878 Ga0395900_0771878_21_587 188
958 3300037418 Ga0395900_0800122 Ga0395900_0800122_19_585 188
959 3300037418 Ga0395900_0888772 Ga0395900_0888772_231_800 188
960 3300037418 Ga0395900_1152609 Ga0395900_1152609_22_588 188
961 3300037466 Ga0395898_0000053 Ga0395898_0000053_162076_162642 188
962 3300037466 Ga0395898_0002184 Ga0395898_0002184_19732_20298 188
963 3300037466 Ga0395898_0007615 Ga0395898_0007615_12_578 188
964 3300037466 Ga0395898_0007670 Ga0395898_0007670_8407_8973 188
965 3300037466 Ga0395898_0007743 Ga0395898_0007743_9396_9962 188
966 3300037466 Ga0395898_0008057 Ga0395898_0008057_4173_4739 188
967 3300037466 Ga0395898_0052453 Ga0395898_0052453_1471_2037 188
968 3300037466 Ga0395898_0061968 Ga0395898_0061968_61_630 188
969 3300037466 Ga0395898_0076651 Ga0395898_0076651_450_1016 188
970 3300037466 Ga0395898_0095507 Ga0395898_0095507_1947_2513 188
971 3300037466 Ga0395898_0097750 Ga0395898_0097750_93_659 188
972 3300037466 Ga0395898_0115087 Ga0395898_0115087_87_653 188
973 3300037466 Ga0395898_0141695 Ga0395898_0141695_969_1535 188
974 3300037466 Ga0395898_0164011 Ga0395898_0164011_96_662 188
975 3300037466 Ga0395898_0222298 Ga0395898_0222298_256_822 188
976 3300037466 Ga0395898_0222723 Ga0395898_0222723_214_780 188
977 3300037466 Ga0395898_0223201 Ga0395898_0223201_1165_1731 188
978 3300037466 Ga0395898_0410155 Ga0395898_0410155_439_1005 188
979 3300037466 Ga0395898_1247816 Ga0395898_1247816_43_609 188
980 3300037471 Ga0395905_0000031 Ga0395905_0000031_124116_124682 188
981 3300037471 Ga0395905_0000501 Ga0395905_0000501_51788_52354 188
982 3300037471 Ga0395905_0001302 Ga0395905_0001302_1176_1742 188
983 3300037471 Ga0395905_0003189 Ga0395905_0003189_10872_11438 188
984 3300037471 Ga0395905_0003199 Ga0395905_0003199_7914_8480 188
985 3300037471 Ga0395905_0005682 Ga0395905_0005682_4190_4756 188
986 3300037471 Ga0395905_0008961 Ga0395905_0008961_6629_7195 188
987 3300037471 Ga0395905_0010719 Ga0395905_0010719_7453_8019 188
988 3300037471 Ga0395905_0013358 Ga0395905_0013358_5239_5805 188
989 3300037471 Ga0395905_0017739 Ga0395905_0017739_5030_5596 188
990 3300037471 Ga0395905_0018559 Ga0395905_0018559_3362_3928 188
991 3300037471 Ga0395905_0027864 Ga0395905_0027864_1605_2171 188
992 3300037471 Ga0395905_0044774 Ga0395905_0044774_2114_2680 188
993 3300037471 Ga0395905_0052004 Ga0395905_0052004_1069_1635 188
994 3300037471 Ga0395905_0060952 Ga0395905_0060952_77_643 188
995 3300037471 Ga0395905_0062146 Ga0395905_0062146_108_674 188
996 3300037471 Ga0395905_0074111 Ga0395905_0074111_1609_2175 188
997 3300037471 Ga0395905_0075712 Ga0395905_0075712_2325_2891 188
998 3300037471 Ga0395905_0076579 Ga0395905_0076579_2477_3043 188
999 3300037471 Ga0395905_0083602 Ga0395905_0083602_1342_1908 188
1000 3300037471 Ga0395905_0090447 Ga0395905_0090447_1751_2320 188
1001 3300037471 Ga0395905_0090476 Ga0395905_0090476_82_648 188
1002 3300037471 Ga0395905_0091346 Ga0395905_0091346_1489_2055 188
1003 3300037471 Ga0395905_0095470 Ga0395905_0095470_60_626 188
1004 3300037471 Ga0395905_0110079 Ga0395905_0110079_935_1501 188
1005 3300037471 Ga0395905_0118413 Ga0395905_0118413_1294_1860 188
1006 3300037471 Ga0395905_0141987 Ga0395905_0141987_1097_1675 188
1007 3300037471 Ga0395905_0163368 Ga0395905_0163368_1431_1997 188
1008 3300037471 Ga0395905_0165430 Ga0395905_0165430_517_1083 188
1009 3300037471 Ga0395905_0246119 Ga0395905_0246119_574_1140 188
1010 3300037471 Ga0395905_0290518 Ga0395905_0290518_32_598 188
1011 3300037471 Ga0395905_0397533 Ga0395905_0397533_391_957 188
1012 3300037471 Ga0395905_0508353 Ga0395905_0508353_357_923 188
1013 3300037471 Ga0395905_0556705 Ga0395905_0556705_434_1000 188
1014 3300037471 Ga0395905_0663455 Ga0395905_0663455_174_740 188
1015 3300037471 Ga0395905_0710990 Ga0395905_0710990_170_736 188
1016 3300037471 Ga0395905_0762310 Ga0395905_0762310_198_764 188
1017 3300037471 Ga0395905_0942385 Ga0395905_0942385_52_618 188
1018 3300037471 Ga0395905_1434786 Ga0395905_1434786_16_582 188
1019 3300037853 Ga0436364_0142050 Ga0436364_0142050_5238_5804 188
1020 3300038443 Ga0395901_0000140 Ga0395901_0000140_45144_45710 188
1021 3300038443 Ga0395901_0000163 Ga0395901_0000163_84932_85498 188
1022 3300038443 Ga0395901_0002476 Ga0395901_0002476_1100_1666 188
1023 3300038443 Ga0395901_0002602 Ga0395901_0002602_6111_6677 188
1024 3300038443 Ga0395901_0004299 Ga0395901_0004299_266_832 188
1025 3300038443 Ga0395901_0007270 Ga0395901_0007270_7567_8133 188
1026 3300038443 Ga0395901_0007987 Ga0395901_0007987_4457_5023 188
1027 3300038443 Ga0395901_0014591 Ga0395901_0014591_5785_6351 188
1028 3300038443 Ga0395901_0015826 Ga0395901_0015826_6281_6847 188
1029 3300038443 Ga0395901_0032674 Ga0395901_0032674_3250_3816 188
1030 3300038443 Ga0395901_0035963 Ga0395901_0035963_287_853 188
1031 3300038443 Ga0395901_0036894 Ga0395901_0036894_2855_3421 188
1032 3300038443 Ga0395901_0051165 Ga0395901_0051165_1580_2146 188
1033 3300038443 Ga0395901_0056126 Ga0395901_0056126_1046_1612 188
1034 3300038443 Ga0395901_0058826 Ga0395901_0058826_1209_1775 188
1035 3300038443 Ga0395901_0062838 Ga0395901_0062838_932_1498 188
1036 3300038443 Ga0395901_0095605 Ga0395901_0095605_169_735 188
1037 3300038443 Ga0395901_0170556 Ga0395901_0170556_1349_1915 188
1038 3300038443 Ga0395901_0215129 Ga0395901_0215129_1312_1878 188
1039 3300038443 Ga0395901_0240287 Ga0395901_0240287_965_1531 188
1040 3300038443 Ga0395901_0252884 Ga0395901_0252884_68_634 188
1041 3300038443 Ga0395901_0371383 Ga0395901_0371383_534_1100 188
1042 3300038443 Ga0395901_0475294 Ga0395901_0475294_17_586 188
1043 3300038443 Ga0395901_0503754 Ga0395901_0503754_83_649 188
1044 3300038443 Ga0395901_0505898 Ga0395901_0505898_201_767 188
1045 3300038443 Ga0395901_1050632 Ga0395901_1050632_69_635 188
1046 3300038443 Ga0395901_1210973 Ga0395901_1210973_87_653 188
1047 3300038443 Ga0395901_1276073 Ga0395901_1276073_60_626 188
1048 3300039437 Ga0436365_1282680 Ga0436365_1282680_389_955 188
1049 3300039450 Ga0436363_0922173 Ga0436363_0922173_37_603 188
1050 3300041413 Ga0439465_0056672 Ga0439465_0056672_224_790 188
1051 3300042005 Ga0439448_0000322 Ga0439448_0000322_9058_9624 188
1052 3300042005 Ga0439448_0096186 Ga0439448_0096186_257_823 188
1053 3300042007 Ga0439449_0061746 Ga0439449_0061746_86_652 188
1054 3300042012 Ga0439455_0004592 Ga0439455_0004592_1757_2323 188
1055 3300042134 Ga0450898_061832 Ga0450898_061832_40_606 188
1056 3300042157 Ga0439458_0000133 Ga0439458_0000133_14741_15307 188
1057 3300042157 Ga0439458_0000630 Ga0439458_0000630_2444_3010 188
1058 3300044656 Ga0466969_0020718 Ga0466969_0020718_1193_1759 188
1059 3300044656 Ga0466969_0033556 Ga0466969_0033556_331_897 188
1060 3300044656 Ga0466969_0393847 Ga0466969_0393847_26_592 188
1061 3300044658 Ga0466972_0050351 Ga0466972_0050351_874_1440 188
1062 3300044683 Ga0466965_0047269 Ga0466965_0047269_832_1398 188
1063 3300044683 Ga0466965_0158962 Ga0466965_0158962_132_698 188
1064 3300044684 Ga0466966_0029669 Ga0466966_0029669_85_651 188
1065 3300044684 Ga0466966_0235363 Ga0466966_0235363_101_667 188
1066 3300044693 Ga0466961_0010371 Ga0466961_0010371_1604_2170 188
1067 3300044693 Ga0466961_0021929 Ga0466961_0021929_2247_2813 188
1068 3300044693 Ga0466961_0047784 Ga0466961_0047784_1195_1761 188
1069 3300044693 Ga0466961_0155232 Ga0466961_0155232_840_1406 188
1070 3300044693 Ga0466961_0401030 Ga0466961_0401030_66_632 188
1071 3300044694 Ga0466963_0006775 Ga0466963_0006775_4889_5455 188
1072 3300044694 Ga0466963_0027439 Ga0466963_0027439_1644_2210 188
1073 3300044694 Ga0466963_0036704 Ga0466963_0036704_1138_1707 188
1074 3300044694 Ga0466963_0098412 Ga0466963_0098412_170_739 188
1075 3300044694 Ga0466963_0115431 Ga0466963_0115431_1081_1647 188
1076 3300044694 Ga0466963_0116500 Ga0466963_0116500_1042_1608 188
1077 3300044694 Ga0466963_0160456 Ga0466963_0160456_72_638 188
1078 3300044694 Ga0466963_0179392 Ga0466963_0179392_636_1202 188
1079 3300044694 Ga0466963_0205073 Ga0466963_0205073_516_1082 188
1080 3300044694 Ga0466963_0267219 Ga0466963_0267219_153_719 188
1081 3300044694 Ga0466963_0404024 Ga0466963_0404024_192_758 188
1082 3300044706 Ga0466964_0002327 Ga0466964_0002327_3930_4496 188
1083 3300044706 Ga0466964_0089737 Ga0466964_0089737_44_610 188
1084 3300044706 Ga0466964_0172560 Ga0466964_0172560_148_714 188
1085 3300044719 Ga0466971_0008923 Ga0466971_0008923_2607_3173 188
1086 3300044719 Ga0466971_0018819 Ga0466971_0018819_1205_1771 188
1087 3300044719 Ga0466971_0032883 Ga0466971_0032883_299_865 188
1088 3300044719 Ga0466971_0099606 Ga0466971_0099606_463_1029 188
1089 3300044719 Ga0466971_0129278 Ga0466971_0129278_334_903 188
1090 3300044719 Ga0466971_0139584 Ga0466971_0139584_198_764 188
1091 3300044735 Ga0466968_0001195 Ga0466968_0001195_3708_4274 188
1092 3300044765 Ga0466970_0014937 Ga0466970_0014937_579_1145 188
1093 3300044765 Ga0466970_0070277 Ga0466970_0070277_1219_1785 188
1094 3300044765 Ga0466970_0133139 Ga0466970_0133139_554_1120 188
1095 3300044765 Ga0466970_0134600 Ga0466970_0134600_352_918 188
1096 3300044765 Ga0466970_0283041 Ga0466970_0283041_266_832 188
1097 3300044842 Ga0466957_0001433 Ga0466957_0001433_10279_10848 188
1098 3300044842 Ga0466957_0026759 Ga0466957_0026759_2072_2638 188
1099 3300044842 Ga0466957_0040332 Ga0466957_0040332_1971_2537 188
1100 3300044842 Ga0466957_0119154 Ga0466957_0119154_1046_1612 188
1101 3300044842 Ga0466957_0129743 Ga0466957_0129743_629_1195 188
1102 3300044842 Ga0466957_0142024 Ga0466957_0142024_374_940 188
1103 3300044842 Ga0466957_0204976 Ga0466957_0204976_243_809 188
1104 3300044842 Ga0466957_0297814 Ga0466957_0297814_11_577 188
1105 3300044842 Ga0466957_0395310 Ga0466957_0395310_302_868 188
1106 3300044901 Ga0466960_0031149 Ga0466960_0031149_1590_2168 188
1107 3300044901 Ga0466960_0075259 Ga0466960_0075259_306_872 188
1108 3300044901 Ga0466960_0299901 Ga0466960_0299901_65_631 188
1109 3300045049 Ga0466959_0016786 Ga0466959_0016786_2396_2962 188
1110 3300045049 Ga0466959_0098591 Ga0466959_0098591_162_728 188
1111 3300045049 Ga0466959_0119188 Ga0466959_0119188_374_940 188
1112 3300045049 Ga0466959_0159951 Ga0466959_0159951_558_1124 188
1113 3300045049 Ga0466959_0435178 Ga0466959_0435178_86_652 188
1114 3300045836 Ga0466958_0005586 Ga0466958_0005586_1907_2476 188
1115 3300045836 Ga0466958_0006030 Ga0466958_0006030_2351_2917 188
1116 3300045836 Ga0466958_0016995 Ga0466958_0016995_2250_2816 188
1117 3300045836 Ga0466958_0043741 Ga0466958_0043741_1862_2428 188
1118 3300045836 Ga0466958_0053911 Ga0466958_0053911_1650_2216 188
1119 3300045836 Ga0466958_0105484 Ga0466958_0105484_347_913 188
1120 3300045836 Ga0466958_0127183 Ga0466958_0127183_136_702 188
1121 3300045836 Ga0466958_0143221 Ga0466958_0143221_276_842 188
1122 3300045836 Ga0466958_0308971 Ga0466958_0308971_118_684 188
1123 3300045836 Ga0466958_0312796 Ga0466958_0312796_285_854 188
1124 3300045976 Ga0466967_0002551 Ga0466967_0002551_5976_6542 188
1125 3300045976 Ga0466967_0003894 Ga0466967_0003894_5563_6129 188
1126 3300045976 Ga0466967_0017710 Ga0466967_0017710_864_1430 188
1127 3300045976 Ga0466967_0018472 Ga0466967_0018472_4473_5042 188
1128 3300045976 Ga0466967_0036403 Ga0466967_0036403_1557_2123 188
1129 3300045976 Ga0466967_0039130 Ga0466967_0039130_149_715 188
1130 3300045976 Ga0466967_0048122 Ga0466967_0048122_1736_2302 188
1131 3300045976 Ga0466967_0062345 Ga0466967_0062345_648_1214 188
1132 3300045976 Ga0466967_0084062 Ga0466967_0084062_877_1443 188
1133 3300045976 Ga0466967_0098140 Ga0466967_0098140_39_605 188
1134 3300045976 Ga0466967_0104587 Ga0466967_0104587_659_1225 188
1135 3300045976 Ga0466967_0109991 Ga0466967_0109991_202_768 188
1136 3300045976 Ga0466967_0149099 Ga0466967_0149099_801_1367 188
1137 3300045976 Ga0466967_0185202 Ga0466967_0185202_1334_1900 188
1138 3300045976 Ga0466967_0242433 Ga0466967_0242433_663_1229 188
1139 3300045976 Ga0466967_0287746 Ga0466967_0287746_961_1527 188
1140 3300045976 Ga0466967_0289017 Ga0466967_0289017_597_1163 188
1141 3300045976 Ga0466967_0316172 Ga0466967_0316172_235_801 188
1142 3300045976 Ga0466967_0408287 Ga0466967_0408287_324_890 188
1143 3300045976 Ga0466967_0790193 Ga0466967_0790193_73_639 188
1144 3300045976 Ga0466967_0834858 Ga0466967_0834858_249_815 188
1145 3300045976 Ga0466967_1395963 Ga0466967_1395963_60_626 188
1146 3300045976 Ga0466967_1567063 Ga0466967_1567063_58_624 188
1147 3300046537 Ga0495598_0004707 Ga0495598_0004707_947_1513 188
1148 3300046539 Ga0495621_0001621 Ga0495621_0001621_5020_5586 188
1149 3300046539 Ga0495621_0004893 Ga0495621_0004893_2629_3195 188
1150 3300046539 Ga0495621_0070506 Ga0495621_0070506_120_686 188
1151 3300046684 Ga0495669_0003343 Ga0495669_0003343_5503_6069 188
1152 3300046684 Ga0495669_0012805 Ga0495669_0012805_435_1001 188
1153 3300046684 Ga0495669_0026711 Ga0495669_0026711_1116_1682 188
1154 3300046684 Ga0495669_0065140 Ga0495669_0065140_600_1166 188
1155 3300046691 Ga0495670_0034649 Ga0495670_0034649_1643_2209 188
1156 3300047445 Ga0495677_0022489 Ga0495677_0022489_110_676 188
1157 3300047445 Ga0495677_0107450 Ga0495677_0107450_299_865 188
1158 3300048903 Ga0496100_0017630 Ga0496100_0017630_1034_1600 188
1159 3300048903 Ga0496100_0022557 Ga0496100_0022557_2740_3306 188
1160 3300048903 Ga0496100_0496159 Ga0496100_0496159_222_788 188
1161 3300048904 Ga0496101_0000651 Ga0496101_0000651_6340_6906 188
1162 3300048904 Ga0496101_0015674 Ga0496101_0015674_4171_4737 188
1163 3300048904 Ga0496101_0048298 Ga0496101_0048298_984_1550 188
1164 3300048904 Ga0496101_0060197 Ga0496101_0060197_384_950 188
1165 3300048905 Ga0496102_0021520 Ga0496102_0021520_189_755 188
1166 3300048905 Ga0496102_0635075 Ga0496102_0635075_316_882 188
1167 3300048906 Ga0496103_0014866 Ga0496103_0014866_511_1077 188
1168 3300048907 Ga0496104_0170243 Ga0496104_0170243_861_1427 188
1169 3300048907 Ga0496104_0211514 Ga0496104_0211514_272_838 188
1170 3300048907 Ga0496104_0539136 Ga0496104_0539136_408_974 188
1171 3300048908 Ga0496105_0246806 Ga0496105_0246806_141_707 188
1172 3300048909 Ga0496106_0007914 Ga0496106_0007914_5916_6482 188
1173 3300048909 Ga0496106_0272767 Ga0496106_0272767_129_695 188
1174 3300048910 Ga0496107_0000593 Ga0496107_0000593_14623_15189 188
1175 3300048910 Ga0496107_0021466 Ga0496107_0021466_1568_2134 188
1176 3300048910 Ga0496107_0090361 Ga0496107_0090361_735_1301 188
1177 3300048910 Ga0496107_0111103 Ga0496107_0111103_1352_1918 188
1178 3300048910 Ga0496107_0237270 Ga0496107_0237270_192_758 188
1179 3300048910 Ga0496107_0336343 Ga0496107_0336343_382_948 188
1180 3300048911 Ga0496108_0000396 Ga0496108_0000396_22170_22736 188
1181 3300048911 Ga0496108_0002584 Ga0496108_0002584_6325_6891 188
1182 3300048911 Ga0496108_0025841 Ga0496108_0025841_158_724 188
1183 3300048911 Ga0496108_0044171 Ga0496108_0044171_151_717 188
1184 3300048911 Ga0496108_0102734 Ga0496108_0102734_383_949 188
1185 3300048912 Ga0496109_0002022 Ga0496109_0002022_4780_5346 188
1186 3300048912 Ga0496109_0043336 Ga0496109_0043336_3442_4008 188
1187 3300048912 Ga0496109_0047395 Ga0496109_0047395_2773_3339 188
1188 3300048912 Ga0496109_0190635 Ga0496109_0190635_396_962 188
1189 3300048912 Ga0496109_0250235 Ga0496109_0250235_45_611 188
1190 3300048913 Ga0496110_0002181 Ga0496110_0002181_13679_14245 188
1191 3300048913 Ga0496110_0011799 Ga0496110_0011799_5193_5759 188
1192 3300048913 Ga0496110_0017806 Ga0496110_0017806_286_852 188
1193 3300048913 Ga0496110_0025153 Ga0496110_0025153_1117_1683 188
1194 3300048913 Ga0496110_1103166 Ga0496110_1103166_41_607 188
1195 3300048914 Ga0496111_0000917 Ga0496111_0000917_14347_14913 188
1196 3300048914 Ga0496111_0012549 Ga0496111_0012549_4985_5551 188
1197 3300048914 Ga0496111_0025286 Ga0496111_0025286_286_852 188
1198 3300048914 Ga0496111_0065813 Ga0496111_0065813_1449_2015 188
1199 3300048915 Ga0496112_0007858 Ga0496112_0007858_2014_2580 188
1200 3300048915 Ga0496112_0025295 Ga0496112_0025295_4797_5363 188
1201 3300048915 Ga0496112_0063477 Ga0496112_0063477_586_1152 188
1202 3300048915 Ga0496112_0090706 Ga0496112_0090706_779_1345 188
1203 3300048915 Ga0496112_0104952 Ga0496112_0104952_1115_1681 188
1204 3300048915 Ga0496112_0166729 Ga0496112_0166729_1033_1599 188
1205 3300048915 Ga0496112_0422904 Ga0496112_0422904_255_821 188
1206 3300048916 Ga0496113_0004906 Ga0496113_0004906_6840_7406 188
1207 3300048916 Ga0496113_0007008 Ga0496113_0007008_3075_3641 188
1208 3300048916 Ga0496113_0011296 Ga0496113_0011296_5002_5568 188
1209 3300048916 Ga0496113_0030474 Ga0496113_0030474_151_717 188
1210 3300048916 Ga0496113_0097418 Ga0496113_0097418_580_1146 188
1211 3300048916 Ga0496113_0779152 Ga0496113_0779152_130_696 188
1212 3300048917 Ga0496114_0000092 Ga0496114_0000092_60047_60613 188
1213 3300048917 Ga0496114_0058179 Ga0496114_0058179_2369_2935 188
1214 3300048918 Ga0496115_0003182 Ga0496115_0003182_4901_5467 188
1215 3300048929 Ga0496126_0120614 Ga0496126_0120614_1292_1858 188
1216 3300049583 Ga0501067_0034153 Ga0501067_0034153_1742_2308 188
1217 3300049585 Ga0501069_0053151 Ga0501069_0053151_897_1463 188
1218 3300049590 Ga0501074_0536263 Ga0501074_0536263_28_594 188
1219 3300049651 Ga0501201_003718 Ga0501201_003718_328_894 188
1220 3300049661 Ga0501217_008521 Ga0501217_008521_690_1256 188
1221 3300049663 Ga0501223_025384 Ga0501223_025384_203_769 188
1222 3300049668 Ga0501233_004947 Ga0501233_004947_1481_2047 188
1223 3300049674 Ga0501242_006115 Ga0501242_006115_194_760 188
1224 3300049677 Ga0501247_025513 Ga0501247_025513_84_650 188
1225 3300049686 Ga0501257_033062 Ga0501257_033062_339_905 188
1226 3300049687 Ga0501258_002575 Ga0501258_002575_81_647 188
1227 3300049705 Ga0501225_0016822 Ga0501225_0016822_972_1538 188
1228 3300049707 Ga0501234_009653 Ga0501234_009653_23_589 188
1229 3300049708 Ga0501245_009230 Ga0501245_009230_378_944 188
1230 3300049742 Ga0501080_0103901 Ga0501080_0103901_1180_1749 188
1231 3300049760 Ga0501263_009704 Ga0501263_009704_514_1080 188
1232 3300049770 Ga0501273_001155 Ga0501273_001155_1629_2195 188
1233 3300050510 nmdc:mga06r32_42891_c1 nmdc:mga06r32_42891_c1_478_1044 188
1234 3300053739 Ga0500587_002504 Ga0500587_002504_1033_1599 188
1235 3300061719 Ga0466962_0057170 Ga0466962_0057170_440_1006 188
1236 3300061719 Ga0466962_0097225 Ga0466962_0097225_50_616 188
1237 3300061719 Ga0466962_0118080 Ga0466962_0118080_321_890 188
1238 3300061719 Ga0466962_0143451 Ga0466962_0143451_63_629 188
1239 3300061719 Ga0466962_0163067 Ga0466962_0163067_357_926 188
1240 3300001904 JGI24736J21556_1005307 JGI24736J21556_10053072 189
1241 3300001915 JGI24741J21665_1000905 JGI24741J21665_10009057 189
1242 3300001915 JGI24741J21665_1010381 JGI24741J21665_10103813 189
1243 3300001915 JGI24741J21665_1013393 JGI24741J21665_10133932 189
1244 3300001979 JGI24740J21852_10004085 JGI24740J21852_100040854 189
1245 3300001979 JGI24740J21852_10020477 JGI24740J21852_100204772 189
1246 3300001989 JGI24739J22299_10008245 JGI24739J22299_100082452 189
1247 3300001990 JGI24737J22298_10007117 JGI24737J22298_100071172 189
1248 3300001991 JGI24743J22301_10017671 JGI24743J22301_100176712 189
1249 3300002075 JGI24738J21930_10005798 JGI24738J21930_100057982 189
1250 3300005289 Ga0065704_10109949 Ga0065704_101099492 189
1251 3300005290 Ga0065712_10112711 Ga0065712_101127112 189
1252 3300005293 Ga0065715_10000404 Ga0065715_100004048 189
1253 3300005327 Ga0070658_10076988 Ga0070658_100769882 189
1254 3300005327 Ga0070658_10106886 Ga0070658_101068862 189
1255 3300005327 Ga0070658_10467308 Ga0070658_104673083 189
1256 3300005329 Ga0070683_100088489 Ga0070683_1000884893 189
1257 3300005330 Ga0070690_100637857 Ga0070690_1006378571 189
1258 3300005331 Ga0070670_100001793 Ga0070670_10000179315 189
1259 3300005331 Ga0070670_100014320 Ga0070670_1000143202 189
1260 3300005331 Ga0070670_100059607 Ga0070670_1000596072 189
1261 3300005333 Ga0070677_10001172 Ga0070677_100011722 189
1262 3300005334 Ga0068869_100077982 Ga0068869_1000779821 189
1263 3300005335 Ga0070666_10018007 Ga0070666_100180073 189
1264 3300005337 Ga0070682_100116758 Ga0070682_1001167583 189
1265 3300005338 Ga0068868_100014704 Ga0068868_1000147042 189
1266 3300005339 Ga0070660_100113408 Ga0070660_1001134082 189
1267 3300005339 Ga0070660_100221552 Ga0070660_1002215521 189
1268 3300005340 Ga0070689_100041464 Ga0070689_1000414645 189
1269 3300005343 Ga0070687_100161463 Ga0070687_1001614632 189
1270 3300005344 Ga0070661_100270220 Ga0070661_1002702202 189
1271 3300005344 Ga0070661_100287714 Ga0070661_1002877142 189
1272 3300005345 Ga0070692_10001029 Ga0070692_100010297 189
1273 3300005345 Ga0070692_10013194 Ga0070692_100131944 189
1274 3300005347 Ga0070668_100002166 Ga0070668_1000021667 189
1275 3300005353 Ga0070669_100032494 Ga0070669_1000324947 189
1276 3300005353 Ga0070669_100055113 Ga0070669_1000551134 189
1277 3300005354 Ga0070675_100006070 Ga0070675_1000060704 189
1278 3300005354 Ga0070675_100061877 Ga0070675_1000618772 189
1279 3300005354 Ga0070675_100432769 Ga0070675_1004327692 189
1280 3300005355 Ga0070671_100086725 Ga0070671_1000867252 189
1281 3300005364 Ga0070673_100000995 Ga0070673_1000009958 189
1282 3300005364 Ga0070673_100035919 Ga0070673_1000359192 189
1283 3300005364 Ga0070673_100524367 Ga0070673_1005243671 189
1284 3300005366 Ga0070659_100010818 Ga0070659_1000108186 189
1285 3300005366 Ga0070659_100039913 Ga0070659_1000399132 189
1286 3300005367 Ga0070667_100096185 Ga0070667_1000961852 189
1287 3300005367 Ga0070667_100360004 Ga0070667_1003600042 189
1288 3300005435 Ga0070714_100116145 Ga0070714_1001161452 189
1289 3300005444 Ga0070694_100005307 Ga0070694_1000053073 189
1290 3300005455 Ga0070663_100011736 Ga0070663_1000117365 189
1291 3300005455 Ga0070663_100055383 Ga0070663_1000553832 189
1292 3300005455 Ga0070663_100078622 Ga0070663_1000786222 189
1293 3300005455 Ga0070663_100094066 Ga0070663_1000940662 189
1294 3300005456 Ga0070678_100120181 Ga0070678_1001201812 189
1295 3300005457 Ga0070662_100008913 Ga0070662_1000089135 189
1296 3300005457 Ga0070662_100042864 Ga0070662_1000428641 189
1297 3300005466 Ga0070685_10261635 Ga0070685_102616351 189
1298 3300005530 Ga0070679_100620822 Ga0070679_1006208222 189
1299 3300005530 Ga0070679_101228236 Ga0070679_1012282361 189
1300 3300005543 Ga0070672_100042697 Ga0070672_1000426972 189
1301 3300005543 Ga0070672_100142293 Ga0070672_1001422932 189
1302 3300005543 Ga0070672_100376559 Ga0070672_1003765591 189
1303 3300005545 Ga0070695_100066139 Ga0070695_1000661392 189
1304 3300005548 Ga0070665_100018505 Ga0070665_1000185052 189
1305 3300005548 Ga0070665_100126785 Ga0070665_1001267852 189
1306 3300005563 Ga0068855_100009143 Ga0068855_10000914311 189
1307 3300005563 Ga0068855_100060594 Ga0068855_1000605942 189
1308 3300005563 Ga0068855_100892553 Ga0068855_1008925532 189
1309 3300005564 Ga0070664_100028456 Ga0070664_1000284562 189
1310 3300005564 Ga0070664_100036997 Ga0070664_1000369972 189
1311 3300005577 Ga0068857_100022950 Ga0068857_1000229501 189
1312 3300005577 Ga0068857_100062321 Ga0068857_1000623212 189
1313 3300005577 Ga0068857_100166545 Ga0068857_1001665452 189
1314 3300005578 Ga0068854_100005470 Ga0068854_1000054702 189
1315 3300005578 Ga0068854_100007242 Ga0068854_1000072423 189
1316 3300005578 Ga0068854_100205538 Ga0068854_1002055382 189
1317 3300005578 Ga0068854_100689817 Ga0068854_1006898172 189
1318 3300005614 Ga0068856_100041610 Ga0068856_1000416102 189
1319 3300005614 Ga0068856_100490220 Ga0068856_1004902202 189
1320 3300005616 Ga0068852_100002189 Ga0068852_1000021895 189
1321 3300005616 Ga0068852_100189999 Ga0068852_1001899992 189
1322 3300005616 Ga0068852_100757330 Ga0068852_1007573301 189
1323 3300005617 Ga0068859_100003376 Ga0068859_1000033763 189
1324 3300005617 Ga0068859_100011644 Ga0068859_1000116443 189
1325 3300005617 Ga0068859_100029265 Ga0068859_1000292653 189
1326 3300005617 Ga0068859_100099201 Ga0068859_1000992012 189
1327 3300005618 Ga0068864_100000716 Ga0068864_1000007169 189
1328 3300005618 Ga0068864_100138044 Ga0068864_1001380443 189
1329 3300005718 Ga0068866_10377655 Ga0068866_103776552 189
1330 3300005719 Ga0068861_100116738 Ga0068861_1001167382 189
1331 3300005840 Ga0068870_10243541 Ga0068870_102435412 189
1332 3300005841 Ga0068863_100022629 Ga0068863_1000226292 189
1333 3300005841 Ga0068863_100110400 Ga0068863_1001104002 189
1334 3300005842 Ga0068858_100000642 Ga0068858_1000006427 189
1335 3300005842 Ga0068858_100030657 Ga0068858_1000306577 189
1336 3300005843 Ga0068860_100019853 Ga0068860_1000198538 189
1337 3300005843 Ga0068860_100053149 Ga0068860_1000531492 189
1338 3300005843 Ga0068860_100090482 Ga0068860_1000904822 189
1339 3300005843 Ga0068860_100455531 Ga0068860_1004555312 189
1340 3300005843 Ga0068860_100479325 Ga0068860_1004793252 189
1341 3300005844 Ga0068862_100095319 Ga0068862_1000953193 189
1342 3300005844 Ga0068862_100098159 Ga0068862_1000981592 189
1343 3300005844 Ga0068862_100182804 Ga0068862_1001828041 189
1344 3300005844 Ga0068862_101205744 Ga0068862_1012057441 189
1345 3300005985 Ga0081539_10033273 Ga0081539_100332732 189
1346 3300005985 Ga0081539_10074513 Ga0081539_100745132 189
1347 3300006175 Ga0070712_100051022 Ga0070712_1000510222 189
1348 3300006880 Ga0075429_100380274 Ga0075429_1003802742 189
1349 3300006881 Ga0068865_100089595 Ga0068865_1000895952 189
1350 3300006931 Ga0097620_100003376 Ga0097620_1000033763 189
1351 3300006931 Ga0097620_100011643 Ga0097620_1000116433 189
1352 3300006931 Ga0097620_100029264 Ga0097620_1000292643 189
1353 3300006931 Ga0097620_100099201 Ga0097620_1000992012 189
1354 3300007076 Ga0075435_100083437 Ga0075435_1000834372 189
1355 3300009092 Ga0105250_10071186 Ga0105250_100711862 189
1356 3300009093 Ga0105240_10050742 Ga0105240_100507424 189
1357 3300009093 Ga0105240_10227835 Ga0105240_102278352 189
1358 3300009094 Ga0111539_10103379 Ga0111539_101033794 189
1359 3300009098 Ga0105245_10059524 Ga0105245_100595242 189
1360 3300009101 Ga0105247_10291003 Ga0105247_102910032 189
1361 3300009148 Ga0105243_10083438 Ga0105243_100834382 189
1362 3300009174 Ga0105241_10366956 Ga0105241_103669561 189
1363 3300009176 Ga0105242_10029287 Ga0105242_100292872 189
1364 3300009177 Ga0105248_10023558 Ga0105248_100235588 189
1365 3300009177 Ga0105248_10034417 Ga0105248_100344172 189
1366 3300009545 Ga0105237_10308411 Ga0105237_103084112 189
1367 3300009553 Ga0105249_10006822 Ga0105249_100068222 189
1368 3300009553 Ga0105249_10021736 Ga0105249_100217362 189
1369 3300009553 Ga0105249_10507355 Ga0105249_105073552 189
1370 3300010375 Ga0105239_10406932 Ga0105239_104069322 189
1371 3300011119 Ga0105246_10074858 Ga0105246_100748582 189
1372 3300011119 Ga0105246_10313770 Ga0105246_103137702 189
1373 3300013100 Ga0157373_10121551 Ga0157373_101215512 189
1374 3300013100 Ga0157373_10132271 Ga0157373_101322712 189
1375 3300013100 Ga0157373_10319874 Ga0157373_103198742 189
1376 3300013102 Ga0157371_10010430 Ga0157371_100104307 189
1377 3300013102 Ga0157371_10023169 Ga0157371_100231696 189
1378 3300013102 Ga0157371_10031035 Ga0157371_100310352 189
1379 3300013102 Ga0157371_10148166 Ga0157371_101481663 189
1380 3300013102 Ga0157371_10309589 Ga0157371_103095892 189
1381 3300013102 Ga0157371_10471902 Ga0157371_104719022 189
1382 3300013102 Ga0157371_10569202 Ga0157371_105692021 189
1383 3300013104 Ga0157370_10491531 Ga0157370_104915311 189
1384 3300013104 Ga0157370_10750340 Ga0157370_107503402 189
1385 3300013105 Ga0157369_10000201 Ga0157369_1000020172 189
1386 3300013105 Ga0157369_10050586 Ga0157369_100505863 189
1387 3300013306 Ga0163162_10051750 Ga0163162_100517502 189
1388 3300013306 Ga0163162_10246404 Ga0163162_102464042 189
1389 3300013306 Ga0163162_11418076 Ga0163162_114180761 189
1390 3300013306 Ga0163162_11421586 Ga0163162_114215861 189
1391 3300013307 Ga0157372_10100963 Ga0157372_101009632 189
1392 3300013308 Ga0157375_11069884 Ga0157375_110698841 189
1393 3300014325 Ga0163163_10001581 Ga0163163_1000158115 189
1394 3300014325 Ga0163163_10399775 Ga0163163_103997752 189
1395 3300014325 Ga0163163_11489799 Ga0163163_114897991 189
1396 3300014326 Ga0157380_10006064 Ga0157380_100060642 189
1397 3300014745 Ga0157377_10523142 Ga0157377_105231421 189
1398 3300014968 Ga0157379_10006904 Ga0157379_100069047 189
1399 3300014968 Ga0157379_10223708 Ga0157379_102237082 189
1400 3300014968 Ga0157379_10441692 Ga0157379_104416922 189
1401 3300017792 Ga0163161_10008005 Ga0163161_100080057 189
1402 3300025271 Ga0207666_1000661 Ga0207666_10006614 189
1403 3300025315 Ga0207697_10057127 Ga0207697_100571272 189
1404 3300025711 Ga0207696_1044138 Ga0207696_10441382 189
1405 3300025893 Ga0207682_10096857 Ga0207682_100968571 189
1406 3300025900 Ga0207710_10242790 Ga0207710_102427901 189
1407 3300025901 Ga0207688_10041422 Ga0207688_100414222 189
1408 3300025903 Ga0207680_10017198 Ga0207680_100171985 189
1409 3300025904 Ga0207647_10002185 Ga0207647_100021852 189
1410 3300025904 Ga0207647_10010193 Ga0207647_100101932 189
1411 3300025904 Ga0207647_10056128 Ga0207647_100561282 189
1412 3300025907 Ga0207645_10064610 Ga0207645_100646102 189
1413 3300025908 Ga0207643_10337360 Ga0207643_103373602 189
1414 3300025909 Ga0207705_10001531 Ga0207705_1000153118 189
1415 3300025909 Ga0207705_10008123 Ga0207705_100081236 189
1416 3300025913 Ga0207695_10027280 Ga0207695_100272806 189
1417 3300025913 Ga0207695_10051482 Ga0207695_100514822 189
1418 3300025914 Ga0207671_10300004 Ga0207671_103000042 189
1419 3300025915 Ga0207693_10029157 Ga0207693_100291572 189
1420 3300025917 Ga0207660_10924118 Ga0207660_109241181 189
1421 3300025919 Ga0207657_10002144 Ga0207657_100021448 189
1422 3300025919 Ga0207657_10017445 Ga0207657_100174458 189
1423 3300025919 Ga0207657_10050952 Ga0207657_100509522 189
1424 3300025919 Ga0207657_10095949 Ga0207657_100959492 189
1425 3300025919 Ga0207657_10377666 Ga0207657_103776662 189
1426 3300025920 Ga0207649_10001739 Ga0207649_100017396 189
1427 3300025920 Ga0207649_10022491 Ga0207649_100224913 189
1428 3300025920 Ga0207649_10030074 Ga0207649_100300742 189
1429 3300025920 Ga0207649_10139487 Ga0207649_101394872 189
1430 3300025923 Ga0207681_10001506 Ga0207681_100015067 189
1431 3300025923 Ga0207681_10021541 Ga0207681_100215416 189
1432 3300025923 Ga0207681_10038204 Ga0207681_100382044 189
1433 3300025925 Ga0207650_10000818 Ga0207650_1000081818 189
1434 3300025925 Ga0207650_10003491 Ga0207650_1000349110 189
1435 3300025925 Ga0207650_10013727 Ga0207650_100137273 189
1436 3300025926 Ga0207659_10001512 Ga0207659_100015128 189
1437 3300025926 Ga0207659_10415103 Ga0207659_104151032 189
1438 3300025926 Ga0207659_10643511 Ga0207659_106435111 189
1439 3300025929 Ga0207664_10177725 Ga0207664_101777252 189
1440 3300025931 Ga0207644_10028222 Ga0207644_100282222 189
1441 3300025932 Ga0207690_10003253 Ga0207690_100032535 189
1442 3300025932 Ga0207690_10010263 Ga0207690_100102632 189
1443 3300025933 Ga0207706_10001130 Ga0207706_1000113019 189
1444 3300025933 Ga0207706_10012742 Ga0207706_100127428 189
1445 3300025933 Ga0207706_10067609 Ga0207706_100676092 189
1446 3300025933 Ga0207706_10178136 Ga0207706_101781362 189
1447 3300025933 Ga0207706_10268476 Ga0207706_102684761 189
1448 3300025934 Ga0207686_10051273 Ga0207686_100512732 189
1449 3300025935 Ga0207709_10173194 Ga0207709_101731942 189
1450 3300025936 Ga0207670_10025891 Ga0207670_100258912 189
1451 3300025937 Ga0207669_10259342 Ga0207669_102593421 189
1452 3300025938 Ga0207704_10129047 Ga0207704_101290472 189
1453 3300025938 Ga0207704_10319002 Ga0207704_103190022 189
1454 3300025940 Ga0207691_10014489 Ga0207691_100144892 189
1455 3300025940 Ga0207691_10103916 Ga0207691_101039162 189
1456 3300025940 Ga0207691_10112598 Ga0207691_101125983 189
1457 3300025941 Ga0207711_10000044 Ga0207711_10000044157 189
1458 3300025941 Ga0207711_10018079 Ga0207711_100180792 189
1459 3300025942 Ga0207689_10005042 Ga0207689_1000504211 189
1460 3300025949 Ga0207667_10042004 Ga0207667_100420046 189
1461 3300025949 Ga0207667_10176138 Ga0207667_101761382 189
1462 3300025949 Ga0207667_10206875 Ga0207667_102068752 189
1463 3300025960 Ga0207651_10001251 Ga0207651_100012516 189
1464 3300025960 Ga0207651_10019458 Ga0207651_100194582 189
1465 3300025960 Ga0207651_10025639 Ga0207651_100256392 189
1466 3300025960 Ga0207651_10061923 Ga0207651_100619232 189
1467 3300025961 Ga0207712_10003387 Ga0207712_100033875 189
1468 3300025961 Ga0207712_10006254 Ga0207712_100062547 189
1469 3300025961 Ga0207712_10028459 Ga0207712_100284594 189
1470 3300025972 Ga0207668_10000729 Ga0207668_100007298 189
1471 3300025972 Ga0207668_10015464 Ga0207668_100154642 189
1472 3300025972 Ga0207668_10178370 Ga0207668_101783702 189
1473 3300025972 Ga0207668_10688954 Ga0207668_106889542 189
1474 3300025981 Ga0207640_10000560 Ga0207640_100005602 189
1475 3300025981 Ga0207640_10233246 Ga0207640_102332461 189
1476 3300025986 Ga0207658_10023742 Ga0207658_100237425 189
1477 3300025986 Ga0207658_10026685 Ga0207658_100266852 189
1478 3300025986 Ga0207658_10073853 Ga0207658_100738533 189
1479 3300026035 Ga0207703_10014891 Ga0207703_100148918 189
1480 3300026035 Ga0207703_10015184 Ga0207703_100151845 189
1481 3300026041 Ga0207639_10296456 Ga0207639_102964561 189
1482 3300026067 Ga0207678_10003048 Ga0207678_100030483 189
1483 3300026067 Ga0207678_10003985 Ga0207678_100039858 189
1484 3300026067 Ga0207678_10016258 Ga0207678_100162582 189
1485 3300026067 Ga0207678_10035770 Ga0207678_100357702 189
1486 3300026078 Ga0207702_10024512 Ga0207702_100245122 189
1487 3300026088 Ga0207641_10005321 Ga0207641_100053219 189
1488 3300026088 Ga0207641_10103102 Ga0207641_101031022 189
1489 3300026088 Ga0207641_10500544 Ga0207641_105005442 189
1490 3300026089 Ga0207648_10010776 Ga0207648_100107762 189
1491 3300026095 Ga0207676_10006599 Ga0207676_100065997 189
1492 3300026095 Ga0207676_10421167 Ga0207676_104211672 189
1493 3300026095 Ga0207676_10439736 Ga0207676_104397361 189
1494 3300026116 Ga0207674_10015759 Ga0207674_100157592 189
1495 3300026116 Ga0207674_10027592 Ga0207674_100275922 189
1496 3300026116 Ga0207674_10147731 Ga0207674_101477312 189
1497 3300026118 Ga0207675_100011384 Ga0207675_1000113842 189
1498 3300026121 Ga0207683_10023091 Ga0207683_100230912 189
1499 3300026142 Ga0207698_10010764 Ga0207698_100107644 189
1500 3300026142 Ga0207698_10016631 Ga0207698_100166312 189
1501 3300026142 Ga0207698_10887416 Ga0207698_108874161 189
1502 3300027395 Ga0209996_1027522 Ga0209996_10275221 189
1503 3300027682 Ga0209971_1036698 Ga0209971_10366981 189
1504 3300027876 Ga0209974_10001035 Ga0209974_100010357 189
1505 3300028379 Ga0268266_10036777 Ga0268266_100367774 189
1506 3300028379 Ga0268266_10207698 Ga0268266_102076981 189
1507 3300028380 Ga0268265_10004178 Ga0268265_100041783 189
1508 3300028380 Ga0268265_10019528 Ga0268265_100195282 189
1509 3300028380 Ga0268265_10098863 Ga0268265_100988632 189
1510 3300028380 Ga0268265_10200403 Ga0268265_102004032 189
1511 3300028380 Ga0268265_10461802 Ga0268265_104618021 189
1512 3300028381 Ga0268264_10000338 Ga0268264_100003387 189
1513 3300028381 Ga0268264_10006757 Ga0268264_100067573 189
1514 3300028381 Ga0268264_10120257 Ga0268264_101202572 189
1515 3300028381 Ga0268264_10585837 Ga0268264_105858372 189
1516 3300028381 Ga0268264_10767376 Ga0268264_107673761 189
1517 3300031548 Ga0307408_100010788 Ga0307408_1000107885 189
1518 3300031548 Ga0307408_100141329 Ga0307408_1001413292 189
1519 3300031731 Ga0307405_10002714 Ga0307405_100027143 189
1520 3300031731 Ga0307405_10047861 Ga0307405_100478612 189
1521 3300031731 Ga0307405_10103501 Ga0307405_101035012 189
1522 3300031731 Ga0307405_10123642 Ga0307405_101236422 189
1523 3300031824 Ga0307413_10023813 Ga0307413_100238132 189
1524 3300031824 Ga0307413_10024662 Ga0307413_100246622 189
1525 3300031824 Ga0307413_10134133 Ga0307413_101341333 189
1526 3300031824 Ga0307413_10237393 Ga0307413_102373931 189
1527 3300031824 Ga0307413_10247484 Ga0307413_102474842 189
1528 3300031824 Ga0307413_11041345 Ga0307413_110413451 189
1529 3300031852 Ga0307410_10003142 Ga0307410_100031422 189
1530 3300031852 Ga0307410_10023044 Ga0307410_100230442 189
1531 3300031852 Ga0307410_10197762 Ga0307410_101977622 189
1532 3300031852 Ga0307410_10201525 Ga0307410_102015252 189
1533 3300031852 Ga0307410_10234298 Ga0307410_102342982 189
1534 3300031852 Ga0307410_10246340 Ga0307410_102463402 189
1535 3300031852 Ga0307410_10284222 Ga0307410_102842222 189
1536 3300031852 Ga0307410_10321758 Ga0307410_103217582 189
1537 3300031852 Ga0307410_10583201 Ga0307410_105832011 189
1538 3300031901 Ga0307406_10003693 Ga0307406_1000369312 189
1539 3300031901 Ga0307406_10004678 Ga0307406_100046785 189
1540 3300031901 Ga0307406_10012186 Ga0307406_100121863 189
1541 3300031901 Ga0307406_10144752 Ga0307406_101447522 189
1542 3300031901 Ga0307406_10477730 Ga0307406_104777302 189
1543 3300031901 Ga0307406_10649772 Ga0307406_106497722 189
1544 3300031901 Ga0307406_11090670 Ga0307406_110906701 189
1545 3300031903 Ga0307407_10001719 Ga0307407_100017197 189
1546 3300031903 Ga0307407_10034380 Ga0307407_100343802 189
1547 3300031903 Ga0307407_10034474 Ga0307407_100344742 189
1548 3300031903 Ga0307407_10064549 Ga0307407_100645492 189
1549 3300031903 Ga0307407_10132547 Ga0307407_101325472 189
1550 3300031903 Ga0307407_10192512 Ga0307407_101925121 189
1551 3300031903 Ga0307407_10412798 Ga0307407_104127981 189
1552 3300031903 Ga0307407_10835615 Ga0307407_108356151 189
1553 3300031911 Ga0307412_10004047 Ga0307412_100040476 189
1554 3300031911 Ga0307412_10090486 Ga0307412_100904862 189
1555 3300031911 Ga0307412_10133210 Ga0307412_101332102 189
1556 3300031911 Ga0307412_10248720 Ga0307412_102487202 189
1557 3300031911 Ga0307412_11046200 Ga0307412_110462001 189
1558 3300031995 Ga0307409_100015550 Ga0307409_1000155502 189
1559 3300031995 Ga0307409_100016162 Ga0307409_1000161623 189
1560 3300031995 Ga0307409_100021394 Ga0307409_1000213942 189
1561 3300031995 Ga0307409_100035127 Ga0307409_1000351273 189
1562 3300031995 Ga0307409_100204784 Ga0307409_1002047842 189
1563 3300031995 Ga0307409_100260573 Ga0307409_1002605732 189
1564 3300031995 Ga0307409_100277743 Ga0307409_1002777432 189
1565 3300031995 Ga0307409_100297140 Ga0307409_1002971402 189
1566 3300031995 Ga0307409_100307913 Ga0307409_1003079131 189
1567 3300031995 Ga0307409_100861699 Ga0307409_1008616991 189
1568 3300032002 Ga0307416_100003206 Ga0307416_1000032066 189
1569 3300032002 Ga0307416_100079733 Ga0307416_1000797332 189
1570 3300032002 Ga0307416_100138314 Ga0307416_1001383142 189
1571 3300032002 Ga0307416_100184509 Ga0307416_1001845092 189
1572 3300032002 Ga0307416_100241663 Ga0307416_1002416631 189
1573 3300032004 Ga0307414_10018451 Ga0307414_100184513 189
1574 3300032004 Ga0307414_10165807 Ga0307414_101658071 189
1575 3300032004 Ga0307414_10261874 Ga0307414_102618742 189
1576 3300032004 Ga0307414_10266431 Ga0307414_102664312 189
1577 3300032004 Ga0307414_10299068 Ga0307414_102990682 189
1578 3300032004 Ga0307414_11150883 Ga0307414_111508831 189
1579 3300032005 Ga0307411_10003411 Ga0307411_100034115 189
1580 3300032005 Ga0307411_10009410 Ga0307411_100094105 189
1581 3300032005 Ga0307411_10021792 Ga0307411_100217925 189
1582 3300032005 Ga0307411_10050193 Ga0307411_100501931 189
1583 3300032005 Ga0307411_10125571 Ga0307411_101255712 189
1584 3300032005 Ga0307411_10197028 Ga0307411_101970282 189
1585 3300032005 Ga0307411_10322773 Ga0307411_103227731 189
1586 3300032005 Ga0307411_10666104 Ga0307411_106661042 189
1587 3300032005 Ga0307411_10745343 Ga0307411_107453432 189
1588 3300032005 Ga0307411_11250209 Ga0307411_112502091 189
1589 3300032126 Ga0307415_100003613 Ga0307415_1000036134 189
1590 3300032126 Ga0307415_100003658 Ga0307415_1000036583 189
1591 3300032126 Ga0307415_100048041 Ga0307415_1000480412 189
1592 3300032126 Ga0307415_100063706 Ga0307415_1000637063 189
1593 3300032126 Ga0307415_100103301 Ga0307415_1001033012 189
1594 3300032126 Ga0307415_100160124 Ga0307415_1001601242 189
1595 3300032126 Ga0307415_100200286 Ga0307415_1002002862 189
1596 3300032126 Ga0307415_100428246 Ga0307415_1004282462 189
1597 3300033180 Ga0307510_10189699 Ga0307510_101896992 189
1598 3300037312 Ga0395899_0065795 Ga0395899_0065795_954_1523 189
1599 3300037312 Ga0395899_0074448 Ga0395899_0074448_320_889 189
1600 3300037312 Ga0395899_0189947 Ga0395899_0189947_124_693 189
1601 3300037418 Ga0395900_0012443 Ga0395900_0012443_7272_7841 189
1602 3300037418 Ga0395900_0109833 Ga0395900_0109833_244_813 189
1603 3300037418 Ga0395900_0151075 Ga0395900_0151075_718_1287 189
1604 3300037418 Ga0395900_0248210 Ga0395900_0248210_1125_1694 189
1605 3300037418 Ga0395900_0347400 Ga0395900_0347400_716_1285 189
1606 3300037418 Ga0395900_0382010 Ga0395900_0382010_599_1168 189
1607 3300037418 Ga0395900_0480961 Ga0395900_0480961_562_1131 189
1608 3300037466 Ga0395898_0024413 Ga0395898_0024413_725_1294 189
1609 3300037466 Ga0395898_0169476 Ga0395898_0169476_131_700 189
1610 3300037466 Ga0395898_0394478 Ga0395898_0394478_624_1193 189
1611 3300037466 Ga0395898_0829552 Ga0395898_0829552_200_769 189
1612 3300037471 Ga0395905_0006394 Ga0395905_0006394_6126_6695 189
1613 3300037471 Ga0395905_0020888 Ga0395905_0020888_188_757 189
1614 3300037471 Ga0395905_0111648 Ga0395905_0111648_555_1124 189
1615 3300037471 Ga0395905_0145713 Ga0395905_0145713_126_695 189
1616 3300037471 Ga0395905_0174046 Ga0395905_0174046_764_1333 189
1617 3300037471 Ga0395905_0250793 Ga0395905_0250793_432_1001 189
1618 3300037471 Ga0395905_0321743 Ga0395905_0321743_107_676 189
1619 3300038443 Ga0395901_0075747 Ga0395901_0075747_1307_1876 189
1620 3300038443 Ga0395901_0132015 Ga0395901_0132015_242_811 189
1621 3300038443 Ga0395901_0278869 Ga0395901_0278869_566_1135 189
1622 3300038443 Ga0395901_0973276 Ga0395901_0973276_22_591 189
1623 3300038443 Ga0395901_1338605 Ga0395901_1338605_49_618 189
1624 3300041410 Ga0439461_0013831 Ga0439461_0013831_70_639 189
1625 3300042156 Ga0439446_0164969 Ga0439446_0164969_47_616 189
1626 3300042435 Ga0439434_0053688 Ga0439434_0053688_319_888 189
1627 3300042439 Ga0439464_0009234 Ga0439464_0009234_1878_2450 189
1628 3300044656 Ga0466969_0000621 Ga0466969_0000621_3659_4228 189
1629 3300044684 Ga0466966_0000007 Ga0466966_0000007_109778_110347 189
1630 3300044684 Ga0466966_0008485 Ga0466966_0008485_4167_4736 189
1631 3300044693 Ga0466961_0009637 Ga0466961_0009637_1583_2152 189
1632 3300044694 Ga0466963_0029758 Ga0466963_0029758_313_882 189
1633 3300044694 Ga0466963_0089706 Ga0466963_0089706_432_1001 189
1634 3300044719 Ga0466971_0006485 Ga0466971_0006485_578_1147 189
1635 3300044765 Ga0466970_0025411 Ga0466970_0025411_1444_2013 189
1636 3300044842 Ga0466957_0002504 Ga0466957_0002504_6993_7562 189
1637 3300045049 Ga0466959_0013314 Ga0466959_0013314_4012_4581 189
1638 3300045049 Ga0466959_0174118 Ga0466959_0174118_187_756 189
1639 3300045836 Ga0466958_0001865 Ga0466958_0001865_5432_6001 189
1640 3300046528 Ga0495642_0080523 Ga0495642_0080523_718_1287 189
1641 3300046539 Ga0495621_0003826 Ga0495621_0003826_3466_4035 189
1642 3300046616 Ga0495668_0010783 Ga0495668_0010783_2204_2773 189
1643 3300046691 Ga0495670_0273215 Ga0495670_0273215_88_657 189
1644 3300049592 Ga0501076_0525317 Ga0501076_0525317_144_713 189
1645 3300049652 Ga0501202_029167 Ga0501202_029167_130_699 189
1646 3300049743 Ga0501081_0637272 Ga0501081_0637272_130_699 189
1647 3300050508 nmdc:mga09592_307820_c1 nmdc:mga09592_307820_c1_662_1231 189
1648 3300050511 nmdc:mga08y16_81113_c1 nmdc:mga08y16_81113_c1_2414_2983 189
1649 3300050512 nmdc:mga0n895_351716_c1 nmdc:mga0n895_351716_c1_260_829 189
1650 3300050513 nmdc:mga0rr50_212867_c1 nmdc:mga0rr50_212867_c1_418_987 189
1651 3300050514 nmdc:mga08x19_628098_c1 nmdc:mga08x19_628098_c1_64_633 189
1652 3300053134 Ga0500658_0000177 Ga0500658_0000177_1808_2377 189
1653 3300053139 Ga0500568_0001623 Ga0500568_0001623_569_1147 189
1654 3300053151 Ga0500604_0000018 Ga0500604_0000018_12046_12624 189
1655 3300053153 Ga0500616_0000419 Ga0500616_0000419_39479_40057 189

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01066

CDP-OH_P_transf

CDP-alcohol phosphatidyltransferase

39

211

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7drk-assembly1.cif.gz_B crystal structure of phosphatidylglycerol phosphate synthase in complex with cytidine diphosphate-diacylglycerol 0.7078 5 181
5d92-assembly2.cif.gz_B structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum 0.6793 4 187
7drk-assembly1.cif.gz_B crystal structure of phosphatidylglycerol phosphate synthase in complex with cytidine diphosphate-diacylglycerol 0.6781 5 181
6h53-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis phosphatidylinositol phosphate synthase (pgsa1) in apo form 0.6611 3 181
6h5a-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis phosphatidylinositol phosphate synthase (pgsa1) in complex with manganese and citrate 0.6509 3 184
ID Description Score Start End Superfamily
af_P0ABF8_3_179_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8183 3 181 1.20.120.1760
af_P9WPG3_21_202_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8115 4 188 1.20.120.1760
af_A0A1D6JYP0_117_317_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.79 2 188 1.20.120.1760
af_P9WPG3_21_202_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.7875 4 188 1.20.120.1760
af_A0A1D6JYP0_117_317_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.7824 2 188 1.20.120.1760
ID Description Score Start End GO Terms
AF-F8ETS3-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) 0.9113 1 188 GO:0005886
GO:0008444
GO:0046474
AF-A0A381X5C1-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.9077 1 186 GO:0005886
GO:0008444
GO:0046474
AF-W2V369-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) 0.9068 3 185 GO:0005886
GO:0008444
GO:0046474
AF-F8ETS3-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) 0.9065 1 188 GO:0005886
GO:0008444
GO:0046474
AF-A0A7Y1T4Q5-F1-model_v4 deleted 0.9062 1 188

Feature Viewer

pLDDT pTM Quality
77.11 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map