F495204
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1650 | 731 | 3300 | 231 |
Family's Representative Sequence
| Representative Sequence | 3300005355|Ga0070671_100643588|Ga0070671_1006435881 |
| Length | 259 |
| Sequence | MLRKPIAGLPAMVTLLPLHVKALHMSWRKDDRRAERGYHHGNLKEALLQAALDLIAQKGAAGFTFADAARMAGVSPAAPYRHFRDREELLSSIAQRGFEQFEAALTQAWDDGRPDTVTAFERVGKAYLAFARNEPAFYSAMFESGLPADANPALMAASERAFGVLRAAAERLAALAPPGTPRPPALMMALHIWSMSHGVASLFARGDAARRKLPMSAEDLLEAEVLIYLRGLGFPTERRTQPPPLPEDEKPAGPWGRAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 7 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 8 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 9 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 11 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 78 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 79 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 80 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 84 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 85 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 86 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 89 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 94 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 95 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 96 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 97 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 98 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 99 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 100 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 130 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 131 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 132 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 133 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 134 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 135 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 136 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 137 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 207 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 208 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 209 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 210 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 215 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 216 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 217 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 218 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 219 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 220 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 221 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 222 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 223 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 224 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 225 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 226 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 227 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 228 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 229 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 230 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 231 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 232 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 233 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 234 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 235 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 236 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 237 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 238 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 239 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 240 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 241 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 242 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 243 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 244 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 245 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 246 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 247 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 248 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 249 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 250 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 251 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 252 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 253 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 254 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 255 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 256 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 257 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 258 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 259 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 260 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 261 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 262 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 263 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 264 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 265 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 266 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 267 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 268 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 269 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 270 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 271 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 272 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 273 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 274 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 275 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 276 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 277 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 278 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 279 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 280 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 281 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 282 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 283 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 284 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 285 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 286 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 287 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 288 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 289 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 290 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 291 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 292 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 293 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 294 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 295 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 296 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 297 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 298 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 299 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 300 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 301 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 302 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 391 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 392 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 393 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 394 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 395 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 396 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 397 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 398 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 399 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 400 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 401 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 402 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 403 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 404 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 405 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 406 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 407 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 408 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 409 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 410 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 411 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 412 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 413 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 414 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 415 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 420 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 422 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 423 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 424 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 425 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 426 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 427 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 430 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 431 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 444 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 445 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 447 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 448 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 449 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 450 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 451 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 452 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 453 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 454 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 455 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 456 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 457 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 458 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 459 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 460 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 461 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 462 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 463 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 466 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 467 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 470 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 471 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 472 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 473 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 474 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 475 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 476 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 477 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 478 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 479 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 480 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 481 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 482 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 483 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 484 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 485 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 486 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 487 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 488 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 489 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 490 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 491 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 492 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 493 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 494 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 495 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 496 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 497 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 498 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 499 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 500 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 501 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 502 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 503 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 504 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 505 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 506 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 507 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 508 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 509 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 510 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 511 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 512 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 513 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 514 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 515 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 516 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 517 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 518 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 519 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 520 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 521 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 522 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 523 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 524 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 525 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 526 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 527 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 528 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 529 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 530 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 531 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 532 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 533 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 534 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 535 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 536 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 537 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 538 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 539 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 540 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 541 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 542 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 543 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 544 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 545 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 546 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 547 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 548 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 549 | 2791355199 | |||
| 550 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 551 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 552 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 553 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 554 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 555 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 556 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 557 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 558 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 559 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 560 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 561 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 562 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 563 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 564 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 565 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 566 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 567 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 568 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 569 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 570 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 571 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 572 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 573 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 574 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 575 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 576 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 577 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 578 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 579 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 580 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 581 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 582 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 583 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 584 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 585 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 586 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 587 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 588 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 589 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 590 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 591 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 592 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 593 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 594 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 595 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 596 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 597 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 598 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 599 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 600 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 601 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 602 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 603 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 604 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 605 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 606 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 607 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 608 | 2904699407 | |||
| 609 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 610 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 611 | 2906610324 | |||
| 612 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 613 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 614 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 615 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 616 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 617 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 618 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 619 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 620 | 2922368715 | |||
| 621 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 622 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 623 | 2922425934 | |||
| 624 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 625 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 626 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 627 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 628 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 629 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 630 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 631 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 632 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 633 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 634 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 635 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 636 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 637 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 638 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 639 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 640 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 641 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 642 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 643 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 644 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 645 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 646 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 647 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 648 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 649 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 650 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 651 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 652 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 653 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 654 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 655 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 656 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 657 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 658 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 659 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 660 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 661 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 662 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 663 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 664 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 665 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 666 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 667 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 668 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 669 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 670 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 671 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 672 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 673 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 674 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 675 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 676 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 677 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 678 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 679 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 680 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 681 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 682 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 683 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 684 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 685 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 686 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 687 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 688 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 689 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 690 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 691 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 692 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 693 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 694 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 695 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 696 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 697 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 698 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 699 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 700 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 701 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 702 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 703 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 704 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 705 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 706 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 707 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 708 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 709 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 710 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 711 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 712 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 713 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 714 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 715 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 716 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 717 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 718 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 719 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 720 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 721 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 722 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 723 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 724 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 725 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 726 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 727 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 728 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 729 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 730 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 731 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.11 |
| Metatranscriptomes | 0.24 |
| Isolates | 12.64 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.39 |
| Nodule | 10.79 |
| Rhizoplane | 5.15 |
| Rhizosphere | 63.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070671_100643588 | 3300005355 | Bacteria | 918 |
| 2 | JGI24740J21852_10001580 | 3300001979 | Bacteria | 10465 |
| 3 | JGI24737J22298_10002347 | 3300001990 | Bacteria | 6747 |
| 4 | JGI24735J21928_10028622 | 3300002067 | Bacteria | 1663 |
| 5 | JGI25406J46586_10005617 | 3300003203 | Bacteria | 5805 |
| 6 | JGI25406J46586_10007816 | 3300003203 | Bacteria | 4864 |
| 7 | JGI25406J46586_10008897 | 3300003203 | Bacteria | 4519 |
| 8 | JGI25165J46597_1004728 | 3300003214 | Bacteria | 2822 |
| 9 | JGI25165J46597_1005035 | 3300003214 | Bacteria | 2644 |
| 10 | JGI25153J46596_10002507 | 3300003215 | Bacteria | 10538 |
| 11 | JGI25153J46596_10002543 | 3300003215 | Bacteria | 10454 |
| 12 | JGI25153J46596_10010032 | 3300003215 | Bacteria | 4323 |
| 13 | JGI25153J46596_10026515 | 3300003215 | Bacteria | 2049 |
| 14 | JGI25153J46596_10037403 | 3300003215 | Bacteria | 1543 |
| 15 | rootH2_10168323 | 3300003320 | Bacteria | 1172 |
| 16 | JGI25160J50197_1003540 | 3300003354 | Bacteria | 6958 |
| 17 | JGI25160J50197_1009667 | 3300003354 | Bacteria | 3554 |
| 18 | JGI25404J52841_10004139 | 3300003659 | Bacteria | 2919 |
| 19 | Ga0055525_1003944 | 3300003759 | Bacteria | 1292 |
| 20 | Ga0055531_10001939 | 3300003794 | Bacteria | 14453 |
| 21 | Ga0065165_1001641 | 3300005262 | Bacteria | 22770 |
| 22 | Ga0065165_1003060 | 3300005262 | Bacteria | 12519 |
| 23 | Ga0070658_10012558 | 3300005327 | Bacteria | 6793 |
| 24 | Ga0070658_10023514 | 3300005327 | Bacteria | 4944 |
| 25 | Ga0070658_10052859 | 3300005327 | Bacteria | 3296 |
| 26 | Ga0070658_10102491 | 3300005327 | Bacteria | 2367 |
| 27 | Ga0070658_10155121 | 3300005327 | Bacteria | 1919 |
| 28 | Ga0070676_10390013 | 3300005328 | Bacteria | 966 |
| 29 | Ga0070683_100014532 | 3300005329 | Bacteria | 6891 |
| 30 | Ga0070683_100130698 | 3300005329 | Bacteria | 2376 |
| 31 | Ga0070683_100175788 | 3300005329 | Bacteria | 2032 |
| 32 | Ga0070690_100355313 | 3300005330 | Bacteria | 1065 |
| 33 | Ga0070670_100407153 | 3300005331 | Bacteria | 1201 |
| 34 | Ga0068869_100458466 | 3300005334 | Bacteria | 1058 |
| 35 | Ga0070680_100299522 | 3300005336 | Bacteria | 1363 |
| 36 | Ga0070682_100036436 | 3300005337 | Bacteria | 3007 |
| 37 | Ga0070682_100117317 | 3300005337 | Bacteria | 1782 |
| 38 | Ga0070682_100461097 | 3300005337 | Bacteria | 975 |
| 39 | Ga0070682_100524723 | 3300005337 | Bacteria | 922 |
| 40 | Ga0068868_100060174 | 3300005338 | Bacteria | 3006 |
| 41 | Ga0068868_100208161 | 3300005338 | Bacteria | 1633 |
| 42 | Ga0070660_100006936 | 3300005339 | Bacteria | 7856 |
| 43 | Ga0070660_100046028 | 3300005339 | Bacteria | 3343 |
| 44 | Ga0070660_100078138 | 3300005339 | Bacteria | 2595 |
| 45 | Ga0070660_100659153 | 3300005339 | Bacteria | 877 |
| 46 | Ga0070689_100445054 | 3300005340 | Bacteria | 1101 |
| 47 | Ga0070691_10105336 | 3300005341 | Bacteria | 1405 |
| 48 | Ga0070687_100223122 | 3300005343 | Bacteria | 1155 |
| 49 | Ga0070661_100204512 | 3300005344 | Bacteria | 1510 |
| 50 | Ga0070661_100211872 | 3300005344 | Bacteria | 1483 |
| 51 | Ga0070668_100004090 | 3300005347 | Bacteria | 10802 |
| 52 | Ga0070668_100177813 | 3300005347 | Bacteria | 1736 |
| 53 | Ga0070668_100185693 | 3300005347 | Bacteria | 1700 |
| 54 | Ga0070668_100188933 | 3300005347 | Bacteria | 1686 |
| 55 | Ga0070668_100420314 | 3300005347 | Bacteria | 1144 |
| 56 | Ga0070668_100583118 | 3300005347 | Bacteria | 976 |
| 57 | Ga0070669_100077152 | 3300005353 | Bacteria | 2475 |
| 58 | Ga0070669_100235249 | 3300005353 | Bacteria | 1453 |
| 59 | Ga0070671_100028829 | 3300005355 | Bacteria | 4575 |
| 60 | Ga0070671_100227546 | 3300005355 | Bacteria | 1582 |
| 61 | Ga0070674_100399589 | 3300005356 | Bacteria | 1122 |
| 62 | Ga0070674_100460492 | 3300005356 | Bacteria | 1051 |
| 63 | Ga0070673_100223298 | 3300005364 | Bacteria | 1631 |
| 64 | Ga0070659_100028575 | 3300005366 | Bacteria | 4308 |
| 65 | Ga0070659_100120823 | 3300005366 | Bacteria | 2122 |
| 66 | Ga0070709_10001211 | 3300005434 | Bacteria | 14149 |
| 67 | Ga0070709_10001487 | 3300005434 | Bacteria | 12659 |
| 68 | Ga0070709_10012057 | 3300005434 | Bacteria | 4832 |
| 69 | Ga0070709_10203434 | 3300005434 | Bacteria | 1403 |
| 70 | Ga0070714_100021170 | 3300005435 | Bacteria | 5317 |
| 71 | Ga0070714_100036040 | 3300005435 | Bacteria | 4147 |
| 72 | Ga0070714_100065164 | 3300005435 | Bacteria | 3138 |
| 73 | Ga0070714_100074503 | 3300005435 | Bacteria | 2943 |
| 74 | Ga0070714_100109893 | 3300005435 | Bacteria | 2440 |
| 75 | Ga0070714_100228898 | 3300005435 | Bacteria | 1712 |
| 76 | Ga0070713_100005990 | 3300005436 | Bacteria | 8366 |
| 77 | Ga0070713_100077999 | 3300005436 | Bacteria | 2819 |
| 78 | Ga0070713_100096572 | 3300005436 | Bacteria | 2551 |
| 79 | Ga0070713_100335931 | 3300005436 | Bacteria | 1399 |
| 80 | Ga0070713_100449753 | 3300005436 | Bacteria | 1210 |
| 81 | Ga0070713_100471432 | 3300005436 | Bacteria | 1182 |
| 82 | Ga0070713_100479307 | 3300005436 | Bacteria | 1172 |
| 83 | Ga0070710_10001333 | 3300005437 | Bacteria | 11642 |
| 84 | Ga0070710_10004775 | 3300005437 | Bacteria | 6410 |
| 85 | Ga0070710_10047262 | 3300005437 | Bacteria | 2400 |
| 86 | Ga0070710_10238132 | 3300005437 | Bacteria | 1165 |
| 87 | Ga0070701_10190118 | 3300005438 | Bacteria | 1207 |
| 88 | Ga0070711_100004982 | 3300005439 | Bacteria | 7886 |
| 89 | Ga0070711_100008851 | 3300005439 | Bacteria | 6178 |
| 90 | Ga0070711_100009103 | 3300005439 | Bacteria | 6103 |
| 91 | Ga0070711_100015372 | 3300005439 | Bacteria | 4844 |
| 92 | Ga0070711_100042807 | 3300005439 | Bacteria | 3063 |
| 93 | Ga0070711_100587322 | 3300005439 | Bacteria | 928 |
| 94 | Ga0070700_100015418 | 3300005441 | Bacteria | 4332 |
| 95 | Ga0070700_100183938 | 3300005441 | Bacteria | 1456 |
| 96 | Ga0070663_100004680 | 3300005455 | Bacteria | 8069 |
| 97 | Ga0070663_100005639 | 3300005455 | Bacteria | 7455 |
| 98 | Ga0070663_100015169 | 3300005455 | Bacteria | 4964 |
| 99 | Ga0070663_100026089 | 3300005455 | Bacteria | 3953 |
| 100 | Ga0070663_100044624 | 3300005455 | Bacteria | 3127 |
| 101 | Ga0070663_100051115 | 3300005455 | Bacteria | 2942 |
| 102 | Ga0070663_100133416 | 3300005455 | Bacteria | 1888 |
| 103 | Ga0070663_100303096 | 3300005455 | Bacteria | 1279 |
| 104 | Ga0070678_100045978 | 3300005456 | Bacteria | 3127 |
| 105 | Ga0070678_100229640 | 3300005456 | Bacteria | 1546 |
| 106 | Ga0070662_100100370 | 3300005457 | Bacteria | 2189 |
| 107 | Ga0070662_100154805 | 3300005457 | Bacteria | 1788 |
| 108 | Ga0070662_100167487 | 3300005457 | Bacteria | 1723 |
| 109 | Ga0070662_100217927 | 3300005457 | Bacteria | 1521 |
| 110 | Ga0070662_100641525 | 3300005457 | Bacteria | 895 |
| 111 | Ga0070681_10012465 | 3300005458 | Bacteria | 8435 |
| 112 | Ga0070681_10017662 | 3300005458 | Bacteria | 7129 |
| 113 | Ga0070681_10024432 | 3300005458 | Bacteria | 6084 |
| 114 | Ga0070681_10057575 | 3300005458 | Bacteria | 3867 |
| 115 | Ga0068867_100203103 | 3300005459 | Bacteria | 1587 |
| 116 | Ga0070706_100712771 | 3300005467 | Bacteria | 930 |
| 117 | Ga0070707_100082832 | 3300005468 | Bacteria | 3099 |
| 118 | Ga0070698_100028998 | 3300005471 | Bacteria | 5744 |
| 119 | Ga0070698_100176063 | 3300005471 | Bacteria | 2078 |
| 120 | Ga0070698_100604931 | 3300005471 | Bacteria | 1036 |
| 121 | Ga0070699_100501560 | 3300005518 | Bacteria | 1103 |
| 122 | Ga0070679_100018130 | 3300005530 | Bacteria | 6824 |
| 123 | Ga0070679_100075893 | 3300005530 | Bacteria | 3351 |
| 124 | Ga0070679_100079972 | 3300005530 | Bacteria | 3258 |
| 125 | Ga0070679_100168713 | 3300005530 | Bacteria | 2161 |
| 126 | Ga0070679_100256152 | 3300005530 | Bacteria | 1705 |
| 127 | Ga0070684_100026884 | 3300005535 | Bacteria | 4850 |
| 128 | Ga0070697_100515432 | 3300005536 | Bacteria | 1046 |
| 129 | Ga0068853_100003590 | 3300005539 | Bacteria | 11880 |
| 130 | Ga0068853_100009325 | 3300005539 | Bacteria | 7913 |
| 131 | Ga0068853_100040891 | 3300005539 | Bacteria | 3958 |
| 132 | Ga0068853_100097167 | 3300005539 | Bacteria | 2599 |
| 133 | Ga0068853_100210598 | 3300005539 | Bacteria | 1771 |
| 134 | Ga0068853_100214448 | 3300005539 | Bacteria | 1756 |
| 135 | Ga0068853_100357112 | 3300005539 | Bacteria | 1360 |
| 136 | Ga0068853_100678605 | 3300005539 | Bacteria | 982 |
| 137 | Ga0070686_100061402 | 3300005544 | Bacteria | 2428 |
| 138 | Ga0070693_100104870 | 3300005547 | Bacteria | 1729 |
| 139 | Ga0070665_100013100 | 3300005548 | Bacteria | 8350 |
| 140 | Ga0070665_100030279 | 3300005548 | Bacteria | 5447 |
| 141 | Ga0070665_100128938 | 3300005548 | Bacteria | 2532 |
| 142 | Ga0070665_100154541 | 3300005548 | Bacteria | 2296 |
| 143 | Ga0070665_100263126 | 3300005548 | Bacteria | 1726 |
| 144 | Ga0070665_100662890 | 3300005548 | Bacteria | 1056 |
| 145 | Ga0070704_100191713 | 3300005549 | Bacteria | 1643 |
| 146 | Ga0068855_100007494 | 3300005563 | Bacteria | 13211 |
| 147 | Ga0068855_100051001 | 3300005563 | Bacteria | 4875 |
| 148 | Ga0068855_100074949 | 3300005563 | Bacteria | 3929 |
| 149 | Ga0068855_100100695 | 3300005563 | Bacteria | 3326 |
| 150 | Ga0068855_100157617 | 3300005563 | Bacteria | 2578 |
| 151 | Ga0068855_100173800 | 3300005563 | Bacteria | 2438 |
| 152 | Ga0068855_100179168 | 3300005563 | Bacteria | 2397 |
| 153 | Ga0068855_100286497 | 3300005563 | Bacteria | 1827 |
| 154 | Ga0068857_100010136 | 3300005577 | Bacteria | 8189 |
| 155 | Ga0068857_100028661 | 3300005577 | Bacteria | 4913 |
| 156 | Ga0068857_100046709 | 3300005577 | Bacteria | 3843 |
| 157 | Ga0068857_100090185 | 3300005577 | Bacteria | 2743 |
| 158 | Ga0068857_100152011 | 3300005577 | Bacteria | 2098 |
| 159 | Ga0068854_100004261 | 3300005578 | Bacteria | 9011 |
| 160 | Ga0068854_100014717 | 3300005578 | Bacteria | 5162 |
| 161 | Ga0068854_100167111 | 3300005578 | Bacteria | 1708 |
| 162 | Ga0068854_100498096 | 3300005578 | Bacteria | 1025 |
| 163 | Ga0068856_100000055 | 3300005614 | Bacteria | 104152 |
| 164 | Ga0068856_100002036 | 3300005614 | Bacteria | 20996 |
| 165 | Ga0068856_100035106 | 3300005614 | Bacteria | 4913 |
| 166 | Ga0068856_100813720 | 3300005614 | Bacteria | 954 |
| 167 | Ga0070702_100030788 | 3300005615 | Bacteria | 2929 |
| 168 | Ga0070702_100380126 | 3300005615 | Bacteria | 1004 |
| 169 | Ga0068852_100061105 | 3300005616 | Bacteria | 3273 |
| 170 | Ga0068852_100126999 | 3300005616 | Bacteria | 2343 |
| 171 | Ga0068852_100182452 | 3300005616 | Bacteria | 1974 |
| 172 | Ga0068852_100338700 | 3300005616 | Bacteria | 1465 |
| 173 | Ga0068852_100388317 | 3300005616 | Bacteria | 1371 |
| 174 | Ga0068852_100466010 | 3300005616 | Bacteria | 1253 |
| 175 | Ga0068852_100597224 | 3300005616 | Bacteria | 1108 |
| 176 | Ga0068859_100029233 | 3300005617 | Bacteria | 5530 |
| 177 | Ga0068859_100160455 | 3300005617 | Bacteria | 2327 |
| 178 | Ga0068859_100197202 | 3300005617 | Bacteria | 2098 |
| 179 | Ga0068859_100271344 | 3300005617 | Bacteria | 1788 |
| 180 | Ga0068859_100854619 | 3300005617 | Bacteria | 996 |
| 181 | Ga0068864_100155154 | 3300005618 | Bacteria | 2077 |
| 182 | Ga0068866_10121120 | 3300005718 | Bacteria | 1474 |
| 183 | Ga0068866_10150413 | 3300005718 | Bacteria | 1347 |
| 184 | Ga0068861_100222076 | 3300005719 | Bacteria | 1597 |
| 185 | Ga0068861_100380771 | 3300005719 | Bacteria | 1246 |
| 186 | Ga0068851_10018146 | 3300005834 | Bacteria | 3388 |
| 187 | Ga0068851_10199625 | 3300005834 | Bacteria | 1116 |
| 188 | Ga0068870_10162882 | 3300005840 | Bacteria | 1324 |
| 189 | Ga0068858_100060155 | 3300005842 | Bacteria | 3511 |
| 190 | Ga0068858_100084612 | 3300005842 | Bacteria | 2950 |
| 191 | Ga0068860_100004713 | 3300005843 | Bacteria | 13912 |
| 192 | Ga0068860_100218969 | 3300005843 | Bacteria | 1848 |
| 193 | Ga0068860_100438223 | 3300005843 | Bacteria | 1298 |
| 194 | Ga0068860_100511884 | 3300005843 | Bacteria | 1199 |
| 195 | Ga0068862_100565517 | 3300005844 | Bacteria | 1087 |
| 196 | Ga0081455_10005206 | 3300005937 | Bacteria | 14308 |
| 197 | Ga0081455_10014855 | 3300005937 | Bacteria | 7594 |
| 198 | Ga0081455_10029662 | 3300005937 | Bacteria | 4984 |
| 199 | Ga0081455_10109650 | 3300005937 | Bacteria | 2196 |
| 200 | Ga0081455_10121760 | 3300005937 | Bacteria | 2055 |
| 201 | Ga0081538_10014803 | 3300005981 | Bacteria | 6080 |
| 202 | Ga0081538_10052708 | 3300005981 | Bacteria | 2427 |
| 203 | Ga0081538_10121627 | 3300005981 | Bacteria | 1252 |
| 204 | Ga0081540_1001339 | 3300005983 | Bacteria | 21460 |
| 205 | Ga0081540_1002098 | 3300005983 | Bacteria | 16595 |
| 206 | Ga0081540_1005640 | 3300005983 | Bacteria | 9318 |
| 207 | Ga0081540_1007193 | 3300005983 | Bacteria | 7985 |
| 208 | Ga0081540_1007306 | 3300005983 | Bacteria | 7903 |
| 209 | Ga0081540_1007993 | 3300005983 | Bacteria | 7446 |
| 210 | Ga0081540_1014652 | 3300005983 | Bacteria | 5010 |
| 211 | Ga0081540_1075041 | 3300005983 | Bacteria | 1547 |
| 212 | Ga0081540_1098360 | 3300005983 | Bacteria | 1267 |
| 213 | Ga0081539_10000848 | 3300005985 | Bacteria | 58499 |
| 214 | Ga0081539_10000950 | 3300005985 | Bacteria | 54335 |
| 215 | Ga0081539_10023363 | 3300005985 | Bacteria | 4052 |
| 216 | Ga0081539_10090029 | 3300005985 | Bacteria | 1588 |
| 217 | Ga0081539_10096617 | 3300005985 | Bacteria | 1514 |
| 218 | Ga0070717_10000460 | 3300006028 | Bacteria | 25862 |
| 219 | Ga0070717_10004333 | 3300006028 | Bacteria | 10238 |
| 220 | Ga0070717_10061424 | 3300006028 | Bacteria | 3114 |
| 221 | Ga0070717_10333783 | 3300006028 | Bacteria | 1353 |
| 222 | Ga0070717_10362396 | 3300006028 | Bacteria | 1298 |
| 223 | Ga0075365_10002534 | 3300006038 | Bacteria | 9011 |
| 224 | Ga0075365_10016437 | 3300006038 | Bacteria | 4501 |
| 225 | Ga0075365_10032321 | 3300006038 | Bacteria | 3362 |
| 226 | Ga0075365_10041163 | 3300006038 | Bacteria | 3017 |
| 227 | Ga0075365_10046097 | 3300006038 | Bacteria | 2862 |
| 228 | Ga0075365_10082863 | 3300006038 | Bacteria | 2175 |
| 229 | Ga0075365_10230350 | 3300006038 | Bacteria | 1300 |
| 230 | Ga0075368_10005523 | 3300006042 | Bacteria | 4354 |
| 231 | Ga0075368_10042472 | 3300006042 | Bacteria | 1789 |
| 232 | Ga0075363_100002726 | 3300006048 | Bacteria | 7310 |
| 233 | Ga0075363_100040857 | 3300006048 | Bacteria | 2445 |
| 234 | Ga0075363_100054874 | 3300006048 | Bacteria | 2133 |
| 235 | Ga0070715_10128429 | 3300006163 | Bacteria | 1217 |
| 236 | Ga0070715_10216155 | 3300006163 | Bacteria | 983 |
| 237 | Ga0070716_100006222 | 3300006173 | Bacteria | 5827 |
| 238 | Ga0070716_100373734 | 3300006173 | Bacteria | 1016 |
| 239 | Ga0070716_100432710 | 3300006173 | Bacteria | 954 |
| 240 | Ga0070712_100098353 | 3300006175 | Bacteria | 2158 |
| 241 | Ga0075362_10085580 | 3300006177 | Bacteria | 1458 |
| 242 | Ga0075362_10193130 | 3300006177 | Bacteria | 989 |
| 243 | Ga0075367_10016328 | 3300006178 | Bacteria | 4054 |
| 244 | Ga0075367_10037477 | 3300006178 | Bacteria | 2818 |
| 245 | Ga0075367_10040157 | 3300006178 | Bacteria | 2731 |
| 246 | Ga0075367_10081082 | 3300006178 | Bacteria | 1963 |
| 247 | Ga0075367_10110845 | 3300006178 | Bacteria | 1684 |
| 248 | Ga0075367_10341270 | 3300006178 | Bacteria | 945 |
| 249 | Ga0075367_10388154 | 3300006178 | Bacteria | 882 |
| 250 | Ga0075369_10056155 | 3300006186 | Bacteria | 1711 |
| 251 | Ga0075369_10227191 | 3300006186 | Bacteria | 864 |
| 252 | Ga0075366_10024888 | 3300006195 | Bacteria | 3492 |
| 253 | Ga0075366_10050422 | 3300006195 | Bacteria | 2471 |
| 254 | Ga0075366_10107607 | 3300006195 | Bacteria | 1676 |
| 255 | Ga0097621_100512845 | 3300006237 | Bacteria | 1087 |
| 256 | Ga0075370_10005105 | 3300006353 | Bacteria | 6470 |
| 257 | Ga0075370_10043459 | 3300006353 | Bacteria | 2540 |
| 258 | Ga0075370_10232227 | 3300006353 | Bacteria | 1091 |
| 259 | Ga0075370_10323769 | 3300006353 | Bacteria | 918 |
| 260 | Ga0075434_100016328 | 3300006871 | Bacteria | 7137 |
| 261 | Ga0075434_100189929 | 3300006871 | Bacteria | 2074 |
| 262 | Ga0068865_100300036 | 3300006881 | Bacteria | 1285 |
| 263 | Ga0075436_100057729 | 3300006914 | Bacteria | 2680 |
| 264 | Ga0097620_100029232 | 3300006931 | Bacteria | 5530 |
| 265 | Ga0097620_100160457 | 3300006931 | Bacteria | 2327 |
| 266 | Ga0097620_100197214 | 3300006931 | Bacteria | 2098 |
| 267 | Ga0097620_100271350 | 3300006931 | Bacteria | 1788 |
| 268 | Ga0097620_100854749 | 3300006931 | Bacteria | 996 |
| 269 | Ga0099825_1026334 | 3300006941 | Bacteria | 3111 |
| 270 | Ga0099825_1033252 | 3300006941 | Bacteria | 2016 |
| 271 | Ga0099824_1008875 | 3300006942 | Bacteria | 12635 |
| 272 | Ga0099824_1012218 | 3300006942 | Bacteria | 9445 |
| 273 | Ga0099822_1020991 | 3300006943 | Bacteria | 6383 |
| 274 | Ga0099823_1051282 | 3300006944 | Bacteria | 2506 |
| 275 | Ga0075435_100520533 | 3300007076 | Bacteria | 1029 |
| 276 | Ga0099794_10197571 | 3300007265 | Bacteria | 1029 |
| 277 | Ga0099795_10094234 | 3300007788 | Bacteria | 1165 |
| 278 | Ga0099795_10107624 | 3300007788 | Bacteria | 1101 |
| 279 | Ga0105240_10004881 | 3300009093 | Bacteria | 20178 |
| 280 | Ga0105240_10004901 | 3300009093 | Bacteria | 20151 |
| 281 | Ga0105240_10016877 | 3300009093 | Bacteria | 9867 |
| 282 | Ga0105240_10097295 | 3300009093 | Bacteria | 3586 |
| 283 | Ga0105240_10150608 | 3300009093 | Bacteria | 2771 |
| 284 | Ga0105240_10188676 | 3300009093 | Bacteria | 2426 |
| 285 | Ga0105240_10309970 | 3300009093 | Bacteria | 1803 |
| 286 | Ga0105240_10375624 | 3300009093 | Bacteria | 1606 |
| 287 | Ga0105240_10438744 | 3300009093 | Bacteria | 1464 |
| 288 | Ga0111539_10071397 | 3300009094 | Bacteria | 4097 |
| 289 | Ga0105245_10060551 | 3300009098 | Bacteria | 3410 |
| 290 | Ga0105245_10288278 | 3300009098 | Bacteria | 1607 |
| 291 | Ga0105247_10060535 | 3300009101 | Bacteria | 2346 |
| 292 | Ga0105247_10080734 | 3300009101 | Bacteria | 2049 |
| 293 | Ga0105247_10541931 | 3300009101 | Bacteria | 854 |
| 294 | Ga0114129_10144511 | 3300009147 | Bacteria | 3259 |
| 295 | Ga0105243_10353713 | 3300009148 | Bacteria | 1350 |
| 296 | Ga0105241_10001823 | 3300009174 | Bacteria | 16163 |
| 297 | Ga0105241_10012915 | 3300009174 | Bacteria | 6127 |
| 298 | Ga0105241_10066635 | 3300009174 | Bacteria | 2785 |
| 299 | Ga0105241_10360165 | 3300009174 | Bacteria | 1265 |
| 300 | Ga0105248_10799823 | 3300009177 | Bacteria | 1064 |
| 301 | Ga0105248_10860676 | 3300009177 | Bacteria | 1023 |
| 302 | Ga0105248_10918589 | 3300009177 | Bacteria | 988 |
| 303 | Ga0105237_10003690 | 3300009545 | Bacteria | 18050 |
| 304 | Ga0105237_10018023 | 3300009545 | Bacteria | 7315 |
| 305 | Ga0105237_10026579 | 3300009545 | Bacteria | 5916 |
| 306 | Ga0105237_10084699 | 3300009545 | Bacteria | 3160 |
| 307 | Ga0105237_10208119 | 3300009545 | Bacteria | 1956 |
| 308 | Ga0105237_10412749 | 3300009545 | Bacteria | 1355 |
| 309 | Ga0105238_10001367 | 3300009551 | Bacteria | 24466 |
| 310 | Ga0105238_10001743 | 3300009551 | Bacteria | 21842 |
| 311 | Ga0105238_10004073 | 3300009551 | Bacteria | 14490 |
| 312 | Ga0105238_10105202 | 3300009551 | Bacteria | 2804 |
| 313 | Ga0105238_10108450 | 3300009551 | Bacteria | 2758 |
| 314 | Ga0105238_10126345 | 3300009551 | Bacteria | 2535 |
| 315 | Ga0105238_10216419 | 3300009551 | Bacteria | 1892 |
| 316 | Ga0105238_10348621 | 3300009551 | Bacteria | 1469 |
| 317 | Ga0105238_10627570 | 3300009551 | Bacteria | 1084 |
| 318 | Ga0105249_10025071 | 3300009553 | Bacteria | 5367 |
| 319 | Ga0105249_10696435 | 3300009553 | Bacteria | 1076 |
| 320 | Ga0105249_10975195 | 3300009553 | Bacteria | 916 |
| 321 | Ga0105239_10001966 | 3300010375 | Bacteria | 26740 |
| 322 | Ga0105239_10015287 | 3300010375 | Bacteria | 8506 |
| 323 | Ga0105239_10018873 | 3300010375 | Bacteria | 7619 |
| 324 | Ga0105239_10045918 | 3300010375 | Bacteria | 4787 |
| 325 | Ga0105239_10071995 | 3300010375 | Bacteria | 3798 |
| 326 | Ga0105239_10126508 | 3300010375 | Bacteria | 2840 |
| 327 | Ga0105239_10181902 | 3300010375 | Bacteria | 2352 |
| 328 | Ga0105246_10089670 | 3300011119 | Bacteria | 2213 |
| 329 | Ga0105246_10776433 | 3300011119 | Bacteria | 848 |
| 330 | Ga0157371_10328587 | 3300013102 | Bacteria | 1111 |
| 331 | Ga0157370_10026904 | 3300013104 | Bacteria | 5674 |
| 332 | Ga0157370_10041113 | 3300013104 | Bacteria | 4463 |
| 333 | Ga0157370_10101710 | 3300013104 | Bacteria | 2692 |
| 334 | Ga0157370_10648587 | 3300013104 | Bacteria | 965 |
| 335 | Ga0157369_10020019 | 3300013105 | Bacteria | 7484 |
| 336 | Ga0157369_10037771 | 3300013105 | Bacteria | 5286 |
| 337 | Ga0157369_10105183 | 3300013105 | Bacteria | 3005 |
| 338 | Ga0157369_10133284 | 3300013105 | Bacteria | 2632 |
| 339 | Ga0157369_10334466 | 3300013105 | Bacteria | 1573 |
| 340 | Ga0157369_10498472 | 3300013105 | Bacteria | 1260 |
| 341 | Ga0157369_10505552 | 3300013105 | Bacteria | 1250 |
| 342 | Ga0157374_10019278 | 3300013296 | Bacteria | 6036 |
| 343 | Ga0157374_10026832 | 3300013296 | Bacteria | 5187 |
| 344 | Ga0157374_10066182 | 3300013296 | Bacteria | 3396 |
| 345 | Ga0157374_10298195 | 3300013296 | Bacteria | 1594 |
| 346 | Ga0157378_10031236 | 3300013297 | Bacteria | 4704 |
| 347 | Ga0157378_10218287 | 3300013297 | Bacteria | 1812 |
| 348 | Ga0157378_10431301 | 3300013297 | Bacteria | 1304 |
| 349 | Ga0163162_10044547 | 3300013306 | Bacteria | 4444 |
| 350 | Ga0163162_10129391 | 3300013306 | Bacteria | 2633 |
| 351 | Ga0163162_10206375 | 3300013306 | Bacteria | 2094 |
| 352 | Ga0157372_10170357 | 3300013307 | Bacteria | 2519 |
| 353 | Ga0157375_10174025 | 3300013308 | Bacteria | 2301 |
| 354 | Ga0157375_10404171 | 3300013308 | Bacteria | 1532 |
| 355 | Ga0157375_10436627 | 3300013308 | Bacteria | 1475 |
| 356 | Ga0163163_10006414 | 3300014325 | Bacteria | 10278 |
| 357 | Ga0163163_10057665 | 3300014325 | Bacteria | 3840 |
| 358 | Ga0163163_10073225 | 3300014325 | Bacteria | 3416 |
| 359 | Ga0163163_10264222 | 3300014325 | Bacteria | 1772 |
| 360 | Ga0157380_10109465 | 3300014326 | Bacteria | 2318 |
| 361 | Ga0157380_10157219 | 3300014326 | Bacteria | 1971 |
| 362 | Ga0157377_10133299 | 3300014745 | Bacteria | 1520 |
| 363 | Ga0157379_10120147 | 3300014968 | Bacteria | 2363 |
| 364 | Ga0157379_10148040 | 3300014968 | Bacteria | 2118 |
| 365 | Ga0157379_10547290 | 3300014968 | Bacteria | 1077 |
| 366 | Ga0157376_10046724 | 3300014969 | Bacteria | 3572 |
| 367 | Ga0157376_10139890 | 3300014969 | Bacteria | 2170 |
| 368 | Ga0157376_10337041 | 3300014969 | Bacteria | 1439 |
| 369 | Ga0163161_10313078 | 3300017792 | Bacteria | 1239 |
| 370 | Ga0206356_10252712 | 3300020070 | Bacteria | 939 |
| 371 | Ga0206353_10542281 | 3300020082 | Bacteria | 975 |
| 372 | Ga0214544_1000005 | 3300021320 | Bacteria | 387675 |
| 373 | Ga0214542_1000004 | 3300021321 | Bacteria | 415597 |
| 374 | Ga0214545_1000005 | 3300021324 | Bacteria | 415590 |
| 375 | Ga0214543_1000111 | 3300021327 | Bacteria | 106517 |
| 376 | Ga0213872_10128081 | 3300021361 | Bacteria | 1119 |
| 377 | Ga0213874_10008955 | 3300021377 | Bacteria | 2459 |
| 378 | Ga0213876_10001491 | 3300021384 | Bacteria | 14550 |
| 379 | Ga0213876_10100607 | 3300021384 | Bacteria | 1532 |
| 380 | Ga0213875_10000011 | 3300021388 | Bacteria | 332447 |
| 381 | Ga0209563_102320 | 3300025230 | Bacteria | 4365 |
| 382 | Ga0207425_1011133 | 3300025245 | Bacteria | 2158 |
| 383 | Ga0209677_101639 | 3300025253 | Bacteria | 9408 |
| 384 | Ga0209677_102591 | 3300025253 | Bacteria | 6615 |
| 385 | Ga0209148_1000235 | 3300025254 | Bacteria | 90398 |
| 386 | Ga0209233_1000694 | 3300025261 | Bacteria | 15931 |
| 387 | Ga0209233_1004340 | 3300025261 | Bacteria | 4839 |
| 388 | Ga0209233_1015229 | 3300025261 | Bacteria | 2148 |
| 389 | Ga0209233_1017519 | 3300025261 | Bacteria | 1949 |
| 390 | Ga0209455_1000637 | 3300025272 | Bacteria | 21523 |
| 391 | Ga0209455_1001472 | 3300025272 | Bacteria | 10597 |
| 392 | Ga0209455_1001710 | 3300025272 | Bacteria | 9395 |
| 393 | Ga0209564_1006563 | 3300025295 | Bacteria | 6245 |
| 394 | Ga0209564_1029711 | 3300025295 | Bacteria | 1712 |
| 395 | Ga0209758_1000102 | 3300025297 | Bacteria | 224851 |
| 396 | Ga0209758_1000680 | 3300025297 | Bacteria | 50663 |
| 397 | Ga0209758_1001266 | 3300025297 | Bacteria | 31302 |
| 398 | Ga0209758_1002859 | 3300025297 | Bacteria | 16761 |
| 399 | Ga0209758_1003592 | 3300025297 | Bacteria | 13874 |
| 400 | Ga0209758_1003725 | 3300025297 | Bacteria | 13511 |
| 401 | Ga0209758_1005478 | 3300025297 | Bacteria | 9742 |
| 402 | Ga0209758_1008851 | 3300025297 | Bacteria | 6405 |
| 403 | Ga0209758_1033809 | 3300025297 | Bacteria | 2046 |
| 404 | Ga0209758_1062345 | 3300025297 | Bacteria | 1221 |
| 405 | Ga0209256_1004953 | 3300025299 | Bacteria | 7982 |
| 406 | Ga0209256_1022780 | 3300025299 | Bacteria | 1888 |
| 407 | Ga0207426_1000532 | 3300025302 | Bacteria | 54755 |
| 408 | Ga0207426_1001761 | 3300025302 | Bacteria | 16397 |
| 409 | Ga0207426_1024324 | 3300025302 | Bacteria | 2057 |
| 410 | Ga0207426_1027105 | 3300025302 | Bacteria | 1913 |
| 411 | Ga0209051_1081854 | 3300025303 | Bacteria | 928 |
| 412 | Ga0209257_1003378 | 3300025304 | Bacteria | 13780 |
| 413 | Ga0209257_1036799 | 3300025304 | Bacteria | 1499 |
| 414 | Ga0207656_10009313 | 3300025321 | Bacteria | 3644 |
| 415 | Ga0207656_10035763 | 3300025321 | Bacteria | 2081 |
| 416 | Ga0207656_10203137 | 3300025321 | Bacteria | 958 |
| 417 | Ga0207682_10055865 | 3300025893 | Bacteria | 1643 |
| 418 | Ga0207692_10004617 | 3300025898 | Bacteria | 5462 |
| 419 | Ga0207692_10008895 | 3300025898 | Bacteria | 4173 |
| 420 | Ga0207692_10044255 | 3300025898 | Bacteria | 2220 |
| 421 | Ga0207642_10020324 | 3300025899 | Bacteria | 2589 |
| 422 | Ga0207710_10010195 | 3300025900 | Bacteria | 3953 |
| 423 | Ga0207688_10019383 | 3300025901 | Bacteria | 3705 |
| 424 | Ga0207688_10094246 | 3300025901 | Bacteria | 1722 |
| 425 | Ga0207680_10169761 | 3300025903 | Bacteria | 1468 |
| 426 | Ga0207647_10001253 | 3300025904 | Bacteria | 19532 |
| 427 | Ga0207647_10011423 | 3300025904 | Bacteria | 6230 |
| 428 | Ga0207685_10049121 | 3300025905 | Bacteria | 1619 |
| 429 | Ga0207685_10109283 | 3300025905 | Bacteria | 1196 |
| 430 | Ga0207685_10120325 | 3300025905 | Bacteria | 1151 |
| 431 | Ga0207685_10312104 | 3300025905 | Bacteria | 781 |
| 432 | Ga0207699_10000886 | 3300025906 | Bacteria | 14295 |
| 433 | Ga0207699_10002476 | 3300025906 | Bacteria | 8714 |
| 434 | Ga0207699_10017538 | 3300025906 | Bacteria | 3772 |
| 435 | Ga0207699_10034416 | 3300025906 | Bacteria | 2874 |
| 436 | Ga0207699_10036391 | 3300025906 | Bacteria | 2806 |
| 437 | Ga0207645_10255310 | 3300025907 | Bacteria | 1161 |
| 438 | Ga0207643_10092234 | 3300025908 | Bacteria | 1767 |
| 439 | Ga0207705_10192989 | 3300025909 | Bacteria | 1541 |
| 440 | Ga0207705_10342863 | 3300025909 | Bacteria | 1150 |
| 441 | Ga0207654_10000446 | 3300025911 | Bacteria | 23584 |
| 442 | Ga0207654_10093238 | 3300025911 | Bacteria | 1841 |
| 443 | Ga0207654_10097462 | 3300025911 | Bacteria | 1805 |
| 444 | Ga0207654_10234412 | 3300025911 | Bacteria | 1224 |
| 445 | Ga0207707_10001016 | 3300025912 | Bacteria | 26912 |
| 446 | Ga0207707_10011000 | 3300025912 | Bacteria | 7874 |
| 447 | Ga0207707_10019818 | 3300025912 | Bacteria | 5872 |
| 448 | Ga0207695_10000006 | 3300025913 | Bacteria | 1135309 |
| 449 | Ga0207695_10001480 | 3300025913 | Bacteria | 39293 |
| 450 | Ga0207695_10007711 | 3300025913 | Bacteria | 13630 |
| 451 | Ga0207695_10109077 | 3300025913 | Bacteria | 2751 |
| 452 | Ga0207695_10234230 | 3300025913 | Bacteria | 1739 |
| 453 | Ga0207695_10278423 | 3300025913 | Bacteria | 1567 |
| 454 | Ga0207671_10023100 | 3300025914 | Bacteria | 4692 |
| 455 | Ga0207671_10026440 | 3300025914 | Bacteria | 4349 |
| 456 | Ga0207671_10119378 | 3300025914 | Bacteria | 2014 |
| 457 | Ga0207671_10124980 | 3300025914 | Bacteria | 1969 |
| 458 | Ga0207671_10388054 | 3300025914 | Bacteria | 1110 |
| 459 | Ga0207693_10009325 | 3300025915 | Bacteria | 8001 |
| 460 | Ga0207693_10017747 | 3300025915 | Bacteria | 5675 |
| 461 | Ga0207693_10089742 | 3300025915 | Bacteria | 2409 |
| 462 | Ga0207693_10114318 | 3300025915 | Bacteria | 2118 |
| 463 | Ga0207663_10000175 | 3300025916 | Bacteria | 28725 |
| 464 | Ga0207663_10006211 | 3300025916 | Bacteria | 6091 |
| 465 | Ga0207663_10025502 | 3300025916 | Bacteria | 3419 |
| 466 | Ga0207663_10066321 | 3300025916 | Bacteria | 2310 |
| 467 | Ga0207660_10000924 | 3300025917 | Bacteria | 19378 |
| 468 | Ga0207660_10030322 | 3300025917 | Bacteria | 3717 |
| 469 | Ga0207660_10047947 | 3300025917 | Bacteria | 3022 |
| 470 | Ga0207657_10001391 | 3300025919 | Bacteria | 25799 |
| 471 | Ga0207657_10005387 | 3300025919 | Bacteria | 13382 |
| 472 | Ga0207657_10093424 | 3300025919 | Bacteria | 2506 |
| 473 | Ga0207657_10299202 | 3300025919 | Bacteria | 1275 |
| 474 | Ga0207657_10513144 | 3300025919 | Bacteria | 938 |
| 475 | Ga0207649_10337619 | 3300025920 | Bacteria | 1112 |
| 476 | Ga0207652_10003893 | 3300025921 | Bacteria | 12209 |
| 477 | Ga0207652_10025815 | 3300025921 | Bacteria | 4888 |
| 478 | Ga0207652_10158337 | 3300025921 | Bacteria | 2029 |
| 479 | Ga0207646_10247409 | 3300025922 | Bacteria | 1610 |
| 480 | Ga0207646_10261644 | 3300025922 | Bacteria | 1563 |
| 481 | Ga0207694_10000136 | 3300025924 | Bacteria | 74908 |
| 482 | Ga0207694_10017893 | 3300025924 | Bacteria | 5357 |
| 483 | Ga0207694_10030192 | 3300025924 | Bacteria | 4139 |
| 484 | Ga0207694_10177989 | 3300025924 | Bacteria | 1724 |
| 485 | Ga0207694_10264468 | 3300025924 | Bacteria | 1410 |
| 486 | Ga0207650_10245228 | 3300025925 | Bacteria | 1449 |
| 487 | Ga0207659_10306420 | 3300025926 | Bacteria | 1306 |
| 488 | Ga0207659_10479667 | 3300025926 | Bacteria | 1051 |
| 489 | Ga0207687_10021012 | 3300025927 | Bacteria | 4335 |
| 490 | Ga0207687_10287346 | 3300025927 | Bacteria | 1320 |
| 491 | Ga0207700_10010911 | 3300025928 | Bacteria | 5768 |
| 492 | Ga0207700_10105626 | 3300025928 | Bacteria | 2256 |
| 493 | Ga0207700_10258635 | 3300025928 | Bacteria | 1490 |
| 494 | Ga0207700_10303157 | 3300025928 | Bacteria | 1380 |
| 495 | Ga0207700_10456751 | 3300025928 | Bacteria | 1126 |
| 496 | Ga0207700_10545000 | 3300025928 | Bacteria | 1029 |
| 497 | Ga0207700_10697227 | 3300025928 | Bacteria | 906 |
| 498 | Ga0207700_10874417 | 3300025928 | Bacteria | 804 |
| 499 | Ga0207664_10059318 | 3300025929 | Bacteria | 3046 |
| 500 | Ga0207664_10167671 | 3300025929 | Bacteria | 1877 |
| 501 | Ga0207664_10257075 | 3300025929 | Bacteria | 1526 |
| 502 | Ga0207644_10033155 | 3300025931 | Bacteria | 3607 |
| 503 | Ga0207644_10175774 | 3300025931 | Bacteria | 1675 |
| 504 | Ga0207644_10201610 | 3300025931 | Bacteria | 1570 |
| 505 | Ga0207644_10528968 | 3300025931 | Bacteria | 974 |
| 506 | Ga0207690_10249924 | 3300025932 | Bacteria | 1369 |
| 507 | Ga0207706_10020636 | 3300025933 | Bacteria | 5921 |
| 508 | Ga0207706_10284054 | 3300025933 | Bacteria | 1443 |
| 509 | Ga0207706_10467045 | 3300025933 | Bacteria | 1091 |
| 510 | Ga0207709_10041130 | 3300025935 | Bacteria | 2772 |
| 511 | Ga0207669_10007035 | 3300025937 | Bacteria | 5176 |
| 512 | Ga0207704_10069991 | 3300025938 | Bacteria | 2220 |
| 513 | Ga0207665_10000525 | 3300025939 | Bacteria | 25804 |
| 514 | Ga0207665_10004656 | 3300025939 | Bacteria | 9112 |
| 515 | Ga0207665_10091265 | 3300025939 | Bacteria | 2112 |
| 516 | Ga0207665_10159842 | 3300025939 | Bacteria | 1620 |
| 517 | Ga0207691_10388593 | 3300025940 | Bacteria | 1191 |
| 518 | Ga0207691_10486764 | 3300025940 | Bacteria | 1048 |
| 519 | Ga0207689_10166013 | 3300025942 | Bacteria | 1819 |
| 520 | Ga0207689_10177802 | 3300025942 | Bacteria | 1755 |
| 521 | Ga0207689_10184753 | 3300025942 | Bacteria | 1719 |
| 522 | Ga0207689_10510341 | 3300025942 | Bacteria | 1008 |
| 523 | Ga0207679_10266933 | 3300025945 | Bacteria | 1462 |
| 524 | Ga0207679_10619382 | 3300025945 | Bacteria | 977 |
| 525 | Ga0207667_10011614 | 3300025949 | Bacteria | 10225 |
| 526 | Ga0207667_10032595 | 3300025949 | Bacteria | 5612 |
| 527 | Ga0207667_10039623 | 3300025949 | Bacteria | 5021 |
| 528 | Ga0207667_10050380 | 3300025949 | Bacteria | 4394 |
| 529 | Ga0207667_10101111 | 3300025949 | Bacteria | 2974 |
| 530 | Ga0207667_10108706 | 3300025949 | Bacteria | 2860 |
| 531 | Ga0207667_10217185 | 3300025949 | Bacteria | 1959 |
| 532 | Ga0207667_10223458 | 3300025949 | Bacteria | 1929 |
| 533 | Ga0207667_10320854 | 3300025949 | Bacteria | 1582 |
| 534 | Ga0207667_10321844 | 3300025949 | Bacteria | 1579 |
| 535 | Ga0207667_10323219 | 3300025949 | Bacteria | 1576 |
| 536 | Ga0207667_10755816 | 3300025949 | Bacteria | 971 |
| 537 | Ga0207712_10433236 | 3300025961 | Bacteria | 1112 |
| 538 | Ga0207712_10616914 | 3300025961 | Bacteria | 940 |
| 539 | Ga0207668_10008217 | 3300025972 | Bacteria | 6216 |
| 540 | Ga0207668_10231719 | 3300025972 | Bacteria | 1489 |
| 541 | Ga0207668_10489503 | 3300025972 | Bacteria | 1056 |
| 542 | Ga0207668_10529886 | 3300025972 | Bacteria | 1017 |
| 543 | Ga0207640_10021128 | 3300025981 | Bacteria | 3874 |
| 544 | Ga0207640_10072615 | 3300025981 | Bacteria | 2322 |
| 545 | Ga0207640_10396898 | 3300025981 | Bacteria | 1122 |
| 546 | Ga0207640_10451005 | 3300025981 | Bacteria | 1060 |
| 547 | Ga0207677_10249345 | 3300026023 | Bacteria | 1441 |
| 548 | Ga0207703_10411871 | 3300026035 | Bacteria | 1256 |
| 549 | Ga0207703_10745373 | 3300026035 | Bacteria | 933 |
| 550 | Ga0207703_10976071 | 3300026035 | Bacteria | 812 |
| 551 | Ga0207639_10022760 | 3300026041 | Bacteria | 4517 |
| 552 | Ga0207639_10030927 | 3300026041 | Bacteria | 3931 |
| 553 | Ga0207639_10036177 | 3300026041 | Bacteria | 3657 |
| 554 | Ga0207639_10050493 | 3300026041 | Bacteria | 3159 |
| 555 | Ga0207639_10098940 | 3300026041 | Bacteria | 2352 |
| 556 | Ga0207639_10249569 | 3300026041 | Bacteria | 1547 |
| 557 | Ga0207639_10337264 | 3300026041 | Bacteria | 1343 |
| 558 | Ga0207678_10004216 | 3300026067 | Bacteria | 12904 |
| 559 | Ga0207678_10025952 | 3300026067 | Bacteria | 5112 |
| 560 | Ga0207678_10089469 | 3300026067 | Bacteria | 2631 |
| 561 | Ga0207678_10099974 | 3300026067 | Bacteria | 2478 |
| 562 | Ga0207678_10123758 | 3300026067 | Bacteria | 2207 |
| 563 | Ga0207678_10139654 | 3300026067 | Bacteria | 2068 |
| 564 | Ga0207678_10185063 | 3300026067 | Bacteria | 1779 |
| 565 | Ga0207678_10209000 | 3300026067 | Bacteria | 1669 |
| 566 | Ga0207678_10227790 | 3300026067 | Bacteria | 1596 |
| 567 | Ga0207678_10268443 | 3300026067 | Bacteria | 1463 |
| 568 | Ga0207678_10268919 | 3300026067 | Bacteria | 1461 |
| 569 | Ga0207708_10049842 | 3300026075 | Bacteria | 3189 |
| 570 | Ga0207702_10000006 | 3300026078 | Bacteria | 346370 |
| 571 | Ga0207702_10002502 | 3300026078 | Bacteria | 17348 |
| 572 | Ga0207702_10013602 | 3300026078 | Bacteria | 6756 |
| 573 | Ga0207702_10068824 | 3300026078 | Bacteria | 3042 |
| 574 | Ga0207702_10229418 | 3300026078 | Bacteria | 1734 |
| 575 | Ga0207702_10549620 | 3300026078 | Bacteria | 1129 |
| 576 | Ga0207641_10214620 | 3300026088 | Bacteria | 1781 |
| 577 | Ga0207648_10097170 | 3300026089 | Bacteria | 2578 |
| 578 | Ga0207648_10319147 | 3300026089 | Bacteria | 1396 |
| 579 | Ga0207648_10632539 | 3300026089 | Bacteria | 988 |
| 580 | Ga0207676_10096351 | 3300026095 | Bacteria | 2442 |
| 581 | Ga0207674_10012767 | 3300026116 | Bacteria | 9383 |
| 582 | Ga0207674_10016173 | 3300026116 | Bacteria | 8171 |
| 583 | Ga0207674_10037575 | 3300026116 | Bacteria | 5034 |
| 584 | Ga0207674_10091381 | 3300026116 | Bacteria | 3034 |
| 585 | Ga0207674_10204650 | 3300026116 | Bacteria | 1923 |
| 586 | Ga0207674_10408732 | 3300026116 | Bacteria | 1312 |
| 587 | Ga0207674_10419599 | 3300026116 | Bacteria | 1293 |
| 588 | Ga0207675_100049241 | 3300026118 | Bacteria | 3933 |
| 589 | Ga0207675_100251674 | 3300026118 | Bacteria | 1710 |
| 590 | Ga0207675_100354455 | 3300026118 | Bacteria | 1438 |
| 591 | Ga0207675_100687606 | 3300026118 | Bacteria | 1031 |
| 592 | Ga0207683_10029544 | 3300026121 | Bacteria | 4746 |
| 593 | Ga0207683_10827300 | 3300026121 | Bacteria | 859 |
| 594 | Ga0207698_10086637 | 3300026142 | Bacteria | 2548 |
| 595 | Ga0207698_10347583 | 3300026142 | Bacteria | 1399 |
| 596 | Ga0207698_10458031 | 3300026142 | Bacteria | 1233 |
| 597 | Ga0207698_10520704 | 3300026142 | Bacteria | 1160 |
| 598 | Ga0207698_10559721 | 3300026142 | Bacteria | 1122 |
| 599 | Ga0209389_1000021 | 3300027296 | Bacteria | 169506 |
| 600 | Ga0209389_1000120 | 3300027296 | Bacteria | 70535 |
| 601 | Ga0209589_1000005 | 3300027357 | Bacteria | 530958 |
| 602 | Ga0209589_1000027 | 3300027357 | Bacteria | 155295 |
| 603 | Ga0209489_100005 | 3300027361 | Bacteria | 530958 |
| 604 | Ga0209489_100023 | 3300027361 | Bacteria | 198829 |
| 605 | Ga0209489_100742 | 3300027361 | Bacteria | 64218 |
| 606 | Ga0209700_100006 | 3300027363 | Bacteria | 530958 |
| 607 | Ga0209700_100134 | 3300027363 | Bacteria | 112846 |
| 608 | Ga0209813_10050531 | 3300027866 | Bacteria | 1298 |
| 609 | Ga0268266_10001136 | 3300028379 | Bacteria | 33101 |
| 610 | Ga0268266_10003686 | 3300028379 | Bacteria | 15118 |
| 611 | Ga0268266_10031172 | 3300028379 | Bacteria | 4526 |
| 612 | Ga0268266_10094515 | 3300028379 | Bacteria | 2624 |
| 613 | Ga0268266_10212623 | 3300028379 | Bacteria | 1774 |
| 614 | Ga0268266_10367028 | 3300028379 | Bacteria | 1355 |
| 615 | Ga0268266_10535896 | 3300028379 | Bacteria | 1120 |
| 616 | Ga0268265_10124640 | 3300028380 | Bacteria | 2129 |
| 617 | Ga0268265_10271215 | 3300028380 | Bacteria | 1513 |
| 618 | Ga0268264_10000185 | 3300028381 | Bacteria | 131374 |
| 619 | Ga0268264_10233636 | 3300028381 | Bacteria | 1699 |
| 620 | Ga0268264_10270804 | 3300028381 | Bacteria | 1586 |
| 621 | Ga0268264_10557854 | 3300028381 | Bacteria | 1124 |
| 622 | Ga0265323_10047489 | 3300028653 | Bacteria | 1535 |
| 623 | Ga0265336_10000415 | 3300028666 | Bacteria | 26412 |
| 624 | Ga0307517_10000098 | 3300028786 | Bacteria | 126044 |
| 625 | Ga0307515_10104075 | 3300028794 | Bacteria | 3396 |
| 626 | Ga0307515_10378216 | 3300028794 | Bacteria | 1050 |
| 627 | Ga0307511_10050282 | 3300030521 | Bacteria | 3359 |
| 628 | Ga0307511_10112612 | 3300030521 | Bacteria | 1724 |
| 629 | Ga0265763_1002394 | 3300030763 | Bacteria | 1436 |
| 630 | Ga0265330_10022841 | 3300031235 | Bacteria | 2844 |
| 631 | Ga0265330_10070540 | 3300031235 | Bacteria | 1512 |
| 632 | Ga0265330_10102798 | 3300031235 | Bacteria | 1222 |
| 633 | Ga0265332_10115012 | 3300031238 | Bacteria | 1132 |
| 634 | Ga0265325_10030068 | 3300031241 | Bacteria | 2915 |
| 635 | Ga0265329_10087994 | 3300031242 | Bacteria | 985 |
| 636 | Ga0265340_10006734 | 3300031247 | Bacteria | 6293 |
| 637 | Ga0265339_10000906 | 3300031249 | Bacteria | 22779 |
| 638 | Ga0265316_10167245 | 3300031344 | Bacteria | 1642 |
| 639 | Ga0307513_10014560 | 3300031456 | Bacteria | 9577 |
| 640 | Ga0307513_10379211 | 3300031456 | Bacteria | 1154 |
| 641 | Ga0307509_10043196 | 3300031507 | Bacteria | 4879 |
| 642 | Ga0307509_10123960 | 3300031507 | Bacteria | 2554 |
| 643 | Ga0307509_10128015 | 3300031507 | Bacteria | 2501 |
| 644 | Ga0307509_10180048 | 3300031507 | Bacteria | 1980 |
| 645 | Ga0307509_10232256 | 3300031507 | Bacteria | 1646 |
| 646 | Ga0307509_10295143 | 3300031507 | Bacteria | 1372 |
| 647 | Ga0307408_100678065 | 3300031548 | Bacteria | 924 |
| 648 | Ga0307508_10000012 | 3300031616 | Bacteria | 243167 |
| 649 | Ga0307508_10205567 | 3300031616 | Bacteria | 1569 |
| 650 | Ga0307508_10331970 | 3300031616 | Bacteria | 1112 |
| 651 | Ga0265314_10014193 | 3300031711 | Bacteria | 6390 |
| 652 | Ga0265314_10028062 | 3300031711 | Bacteria | 4203 |
| 653 | Ga0265314_10149051 | 3300031711 | Bacteria | 1437 |
| 654 | Ga0265314_10278961 | 3300031711 | Bacteria | 946 |
| 655 | Ga0265342_10003016 | 3300031712 | Bacteria | 14114 |
| 656 | Ga0307516_10008865 | 3300031730 | Bacteria | 11295 |
| 657 | Ga0307516_10277261 | 3300031730 | Bacteria | 1360 |
| 658 | Ga0307516_10355841 | 3300031730 | Bacteria | 1129 |
| 659 | Ga0307405_10059833 | 3300031731 | Bacteria | 2402 |
| 660 | Ga0307410_10251268 | 3300031852 | Bacteria | 1375 |
| 661 | Ga0307410_10422215 | 3300031852 | Bacteria | 1082 |
| 662 | Ga0307406_10302548 | 3300031901 | Bacteria | 1229 |
| 663 | Ga0307406_10600384 | 3300031901 | Bacteria | 907 |
| 664 | Ga0307412_10076186 | 3300031911 | Bacteria | 2304 |
| 665 | Ga0307412_10176842 | 3300031911 | Bacteria | 1601 |
| 666 | Ga0307409_100168169 | 3300031995 | Bacteria | 1926 |
| 667 | Ga0307414_10445796 | 3300032004 | Bacteria | 1134 |
| 668 | Ga0307414_10921453 | 3300032004 | Bacteria | 802 |
| 669 | Ga0307411_10076739 | 3300032005 | Bacteria | 2285 |
| 670 | Ga0307411_10167068 | 3300032005 | Bacteria | 1655 |
| 671 | Ga0307411_10695831 | 3300032005 | Bacteria | 885 |
| 672 | Ga0307415_100042705 | 3300032126 | Bacteria | 3019 |
| 673 | Ga0307507_10160269 | 3300033179 | Bacteria | 1664 |
| 674 | Ga0307510_10007562 | 3300033180 | Bacteria | 12946 |
| 675 | Ga0307510_10066813 | 3300033180 | Bacteria | 3627 |
| 676 | Ga0307510_10101326 | 3300033180 | Bacteria | 2668 |
| 677 | Ga0307510_10194593 | 3300033180 | Bacteria | 1571 |
| 678 | Ga0315911_1000005 | 3300033442 | Bacteria | 426255 |
| 679 | Ga0316215_1001897 | 3300033544 | Bacteria | 1980 |
| 680 | Ga0373958_0013101 | 3300034819 | Bacteria | 1430 |
| 681 | Ga0373926_0125648 | 3300035083 | Bacteria | 969 |
| 682 | Ga0373929_0044211 | 3300035085 | Bacteria | 999 |
| 683 | Ga0373944_0090449 | 3300035089 | Bacteria | 1022 |
| 684 | Ga0373944_0105147 | 3300035089 | Bacteria | 958 |
| 685 | Ga0373951_0044318 | 3300035091 | Bacteria | 1080 |
| 686 | Ga0373952_0052584 | 3300035092 | Bacteria | 975 |
| 687 | Ga0373923_0001382 | 3300035111 | Bacteria | 6917 |
| 688 | Ga0373923_0002101 | 3300035111 | Bacteria | 6035 |
| 689 | Ga0373923_0148183 | 3300035111 | Bacteria | 1064 |
| 690 | Ga0373936_0043384 | 3300035113 | Bacteria | 1807 |
| 691 | Ga0373936_0052240 | 3300035113 | Bacteria | 1655 |
| 692 | Ga0373936_0138144 | 3300035113 | Bacteria | 1051 |
| 693 | Ga0373941_0041926 | 3300035115 | Bacteria | 1419 |
| 694 | Ga0373953_0000985 | 3300035117 | Bacteria | 8003 |
| 695 | Ga0373953_0004518 | 3300035117 | Bacteria | 4445 |
| 696 | Ga0373953_0250028 | 3300035117 | Bacteria | 770 |
| 697 | Ga0373954_0001160 | 3300035118 | Bacteria | 10599 |
| 698 | Ga0373954_0003164 | 3300035118 | Bacteria | 6955 |
| 699 | Ga0373954_0004646 | 3300035118 | Bacteria | 5922 |
| 700 | Ga0373954_0271664 | 3300035118 | Bacteria | 835 |
| 701 | Ga0373956_0001463 | 3300035119 | Bacteria | 9760 |
| 702 | Ga0373956_0032250 | 3300035119 | Bacteria | 2298 |
| 703 | Ga0373956_0058883 | 3300035119 | Bacteria | 1737 |
| 704 | Ga0373957_0010109 | 3300035120 | Bacteria | 3108 |
| 705 | Ga0373957_0015715 | 3300035120 | Bacteria | 2610 |
| 706 | Ga0373957_0166333 | 3300035120 | Bacteria | 910 |
| 707 | Ga0373960_0006254 | 3300035121 | Bacteria | 2789 |
| 708 | Ga0373943_0020170 | 3300035170 | Bacteria | 3071 |
| 709 | Ga0373943_0121755 | 3300035170 | Bacteria | 1387 |
| 710 | Ga0373943_0261882 | 3300035170 | Bacteria | 974 |
| 711 | Ga0373946_0013105 | 3300035171 | Bacteria | 3111 |
| 712 | Ga0373946_0159688 | 3300035171 | Bacteria | 1057 |
| 713 | Ga0373955_0001372 | 3300035172 | Bacteria | 10349 |
| 714 | Ga0373955_0012729 | 3300035172 | Bacteria | 4051 |
| 715 | Ga0373955_0022165 | 3300035172 | Bacteria | 3218 |
| 716 | Ga0373942_0014531 | 3300035207 | Bacteria | 1908 |
| 717 | Ga0373942_0054265 | 3300035207 | Bacteria | 1132 |
| 718 | Ga0373961_0026944 | 3300035241 | Bacteria | 1574 |
| 719 | Ga0373962_0044737 | 3300035242 | Bacteria | 1258 |
| 720 | Ga0373924_0018660 | 3300035410 | Bacteria | 2676 |
| 721 | Ga0373924_0027315 | 3300035410 | Bacteria | 2268 |
| 722 | Ga0373924_0076217 | 3300035410 | Bacteria | 1420 |
| 723 | Ga0373931_0001100 | 3300035691 | Bacteria | 11473 |
| 724 | Ga0373931_0003428 | 3300035691 | Bacteria | 7118 |
| 725 | Ga0373931_0211512 | 3300035691 | Bacteria | 1163 |
| 726 | Ga0373935_0000520 | 3300035692 | Bacteria | 20054 |
| 727 | Ga0373935_0097809 | 3300035692 | Bacteria | 1931 |
| 728 | Ga0373935_0127371 | 3300035692 | Bacteria | 1707 |
| 729 | Ga0373935_0247709 | 3300035692 | Bacteria | 1246 |
| 730 | Ga0373935_0312586 | 3300035692 | Bacteria | 1113 |
| 731 | Ga0373935_0340452 | 3300035692 | Bacteria | 1068 |
| 732 | Ga0373927_0000046 | 3300035695 | Bacteria | 88401 |
| 733 | Ga0373927_0005938 | 3300035695 | Bacteria | 8359 |
| 734 | Ga0373927_0009305 | 3300035695 | Bacteria | 6590 |
| 735 | Ga0373927_0015109 | 3300035695 | Bacteria | 5104 |
| 736 | Ga0373927_0039246 | 3300035695 | Bacteria | 3073 |
| 737 | Ga0373927_0155395 | 3300035695 | Bacteria | 1498 |
| 738 | Ga0373933_0000026 | 3300035724 | Bacteria | 90309 |
| 739 | Ga0373933_0006390 | 3300035724 | Bacteria | 6414 |
| 740 | Ga0373933_0017205 | 3300035724 | Bacteria | 4053 |
| 741 | Ga0373933_0028682 | 3300035724 | Bacteria | 3212 |
| 742 | Ga0373933_0073161 | 3300035724 | Bacteria | 2088 |
| 743 | Ga0373947_0001392 | 3300035725 | Bacteria | 14902 |
| 744 | Ga0373947_0002439 | 3300035725 | Bacteria | 11211 |
| 745 | Ga0373947_0052793 | 3300035725 | Bacteria | 2449 |
| 746 | Ga0373947_0303254 | 3300035725 | Bacteria | 1065 |
| 747 | Ga0373937_0016441 | 3300036401 | Bacteria | 6572 |
| 748 | Ga0373937_0048844 | 3300036401 | Bacteria | 3874 |
| 749 | Ga0373937_0112764 | 3300036401 | Bacteria | 2530 |
| 750 | Ga0373937_0168370 | 3300036401 | Bacteria | 2055 |
| 751 | Ga0373937_0376743 | 3300036401 | Bacteria | 1346 |
| 752 | Ga0372808_008862 | 3300036459 | Bacteria | 1399 |
| 753 | Ga0373925_0009905 | 3300037068 | Bacteria | 6924 |
| 754 | Ga0373925_0013452 | 3300037068 | Bacteria | 5923 |
| 755 | Ga0373925_0062764 | 3300037068 | Bacteria | 2794 |
| 756 | Ga0373925_0134813 | 3300037068 | Bacteria | 1929 |
| 757 | Ga0395900_0016187 | 3300037418 | Bacteria | 7597 |
| 758 | Ga0395900_0020667 | 3300037418 | Bacteria | 6728 |
| 759 | Ga0395900_0032079 | 3300037418 | Bacteria | 5401 |
| 760 | Ga0395900_0174183 | 3300037418 | Bacteria | 2189 |
| 761 | Ga0395900_0179879 | 3300037418 | Bacteria | 2150 |
| 762 | Ga0395898_0035872 | 3300037466 | Bacteria | 4928 |
| 763 | Ga0395898_0270372 | 3300037466 | Bacteria | 1621 |
| 764 | Ga0395898_0409137 | 3300037466 | Bacteria | 1293 |
| 765 | Ga0395905_0025920 | 3300037471 | Bacteria | 5526 |
| 766 | Ga0395905_0081275 | 3300037471 | Bacteria | 3037 |
| 767 | Ga0395905_0081461 | 3300037471 | Bacteria | 3033 |
| 768 | Ga0436364_0224834 | 3300037853 | Bacteria | 2511 |
| 769 | Ga0436364_0328296 | 3300037853 | Bacteria | 143298 |
| 770 | Ga0436364_0796332 | 3300037853 | Bacteria | 1367 |
| 771 | Ga0436364_1001125 | 3300037853 | Bacteria | 847 |
| 772 | Ga0436364_1109971 | 3300037853 | Bacteria | 20298 |
| 773 | Ga0395901_0050817 | 3300038443 | Bacteria | 4307 |
| 774 | Ga0395901_0178216 | 3300038443 | Bacteria | 2229 |
| 775 | Ga0436365_0221110 | 3300039437 | Bacteria | 888 |
| 776 | Ga0436365_0600630 | 3300039437 | Bacteria | 1699 |
| 777 | Ga0436365_0709391 | 3300039437 | Bacteria | 2814 |
| 778 | Ga0436365_0921625 | 3300039437 | Bacteria | 24575 |
| 779 | Ga0436365_0939476 | 3300039437 | Bacteria | 1745 |
| 780 | Ga0436365_1231387 | 3300039437 | Bacteria | 2949 |
| 781 | Ga0436365_1846147 | 3300039437 | Bacteria | 1309 |
| 782 | Ga0436360_0159371 | 3300039438 | Bacteria | 1756 |
| 783 | Ga0436361_0298970 | 3300039447 | Bacteria | 1128 |
| 784 | Ga0436361_0873949 | 3300039447 | Bacteria | 1284 |
| 785 | Ga0436361_1011559 | 3300039447 | Bacteria | 1721 |
| 786 | Ga0436363_0355443 | 3300039450 | Bacteria | 1824 |
| 787 | Ga0436363_0468710 | 3300039450 | Bacteria | 3616 |
| 788 | Ga0436363_0615662 | 3300039450 | Bacteria | 1170 |
| 789 | Ga0436363_0726412 | 3300039450 | Bacteria | 11305 |
| 790 | Ga0436363_1594013 | 3300039450 | Bacteria | 913 |
| 791 | Ga0436362_0496995 | 3300039453 | Bacteria | 1817 |
| 792 | Ga0436362_0763354 | 3300039453 | Bacteria | 1643 |
| 793 | Ga0436362_0804184 | 3300039453 | Bacteria | 773 |
| 794 | Ga0439465_0039024 | 3300041413 | Bacteria | 1532 |
| 795 | Ga0451802_0319345 | 3300041460 | Bacteria | 1051 |
| 796 | Ga0451851_0100858 | 3300041507 | Bacteria | 1568 |
| 797 | Ga0451853_2272543 | 3300041512 | Bacteria | 1216 |
| 798 | Ga0439463_029581 | 3300042016 | Bacteria | 1380 |
| 799 | Ga0439464_0074624 | 3300042439 | Bacteria | 1007 |
| 800 | Ga0466969_0037230 | 3300044656 | Bacteria | 2455 |
| 801 | Ga0466972_0000126 | 3300044658 | Bacteria | 64766 |
| 802 | Ga0466972_0013988 | 3300044658 | Bacteria | 4024 |
| 803 | Ga0466966_0001157 | 3300044684 | Bacteria | 16957 |
| 804 | Ga0466966_0339054 | 3300044684 | Bacteria | 903 |
| 805 | Ga0466961_0000025 | 3300044693 | Bacteria | 96344 |
| 806 | Ga0466963_0031093 | 3300044694 | Bacteria | 3449 |
| 807 | Ga0466963_0138053 | 3300044694 | Bacteria | 1688 |
| 808 | Ga0466964_0024242 | 3300044706 | Bacteria | 2363 |
| 809 | Ga0466964_0054150 | 3300044706 | Bacteria | 1653 |
| 810 | Ga0466964_0245229 | 3300044706 | Bacteria | 881 |
| 811 | Ga0466968_0003372 | 3300044735 | Bacteria | 5903 |
| 812 | Ga0466968_0157046 | 3300044735 | Bacteria | 1048 |
| 813 | Ga0466957_0057047 | 3300044842 | Bacteria | 2389 |
| 814 | Ga0466960_0008649 | 3300044901 | Bacteria | 4174 |
| 815 | Ga0466959_0000873 | 3300045049 | Bacteria | 17751 |
| 816 | Ga0466967_0130167 | 3300045976 | Bacteria | 2335 |
| 817 | Ga0466967_0192733 | 3300045976 | Bacteria | 1927 |
| 818 | Ga0466967_0497597 | 3300045976 | Bacteria | 1196 |
| 819 | Ga0466967_0783637 | 3300045976 | Bacteria | 946 |
| 820 | Ga0495617_007122 | 3300046452 | Bacteria | 3898 |
| 821 | Ga0495617_033379 | 3300046452 | Bacteria | 1727 |
| 822 | Ga0495592_0001238 | 3300046454 | Bacteria | 17695 |
| 823 | Ga0495592_0071092 | 3300046454 | Bacteria | 2534 |
| 824 | Ga0495592_0136576 | 3300046454 | Bacteria | 1709 |
| 825 | Ga0495592_0171163 | 3300046454 | Bacteria | 1487 |
| 826 | Ga0495592_0293095 | 3300046454 | Bacteria | 1060 |
| 827 | Ga0495592_0296046 | 3300046454 | Bacteria | 1053 |
| 828 | Ga0495603_0000051 | 3300046455 | Bacteria | 50402 |
| 829 | Ga0495603_0043229 | 3300046455 | Bacteria | 2691 |
| 830 | Ga0495603_0074766 | 3300046455 | Bacteria | 1989 |
| 831 | Ga0495603_0203339 | 3300046455 | Bacteria | 1145 |
| 832 | Ga0495603_0236613 | 3300046455 | Bacteria | 1052 |
| 833 | Ga0495629_0000182 | 3300046459 | Bacteria | 56655 |
| 834 | Ga0495629_0000750 | 3300046459 | Bacteria | 26239 |
| 835 | Ga0495629_0006753 | 3300046459 | Bacteria | 8483 |
| 836 | Ga0495638_0003938 | 3300046460 | Bacteria | 11448 |
| 837 | Ga0495638_0021430 | 3300046460 | Bacteria | 4259 |
| 838 | Ga0495638_0311579 | 3300046460 | Bacteria | 844 |
| 839 | Ga0495641_0006374 | 3300046461 | Bacteria | 7658 |
| 840 | Ga0495651_0015643 | 3300046462 | Bacteria | 5873 |
| 841 | Ga0495651_0019393 | 3300046462 | Bacteria | 5271 |
| 842 | Ga0495651_0047283 | 3300046462 | Bacteria | 3328 |
| 843 | Ga0495653_0014575 | 3300046463 | Bacteria | 6416 |
| 844 | Ga0495653_0065346 | 3300046463 | Bacteria | 2738 |
| 845 | Ga0495653_0193226 | 3300046463 | Bacteria | 1387 |
| 846 | Ga0495653_0241395 | 3300046463 | Bacteria | 1204 |
| 847 | Ga0495580_0004021 | 3300046472 | Bacteria | 12411 |
| 848 | Ga0495580_0012063 | 3300046472 | Bacteria | 6652 |
| 849 | Ga0495580_0214672 | 3300046472 | Bacteria | 1323 |
| 850 | Ga0495582_0000137 | 3300046473 | Bacteria | 39425 |
| 851 | Ga0495582_0157604 | 3300046473 | Bacteria | 1290 |
| 852 | Ga0495582_0172306 | 3300046473 | Bacteria | 1232 |
| 853 | Ga0495582_0269021 | 3300046473 | Bacteria | 978 |
| 854 | Ga0495605_0073209 | 3300046474 | Bacteria | 1614 |
| 855 | Ga0495605_0207331 | 3300046474 | Bacteria | 852 |
| 856 | Ga0495639_0002873 | 3300046475 | Bacteria | 7493 |
| 857 | Ga0495639_0050090 | 3300046475 | Bacteria | 1897 |
| 858 | Ga0495639_0072703 | 3300046475 | Bacteria | 1590 |
| 859 | Ga0495639_0308456 | 3300046475 | Bacteria | 790 |
| 860 | Ga0495662_0000583 | 3300046476 | Bacteria | 16810 |
| 861 | Ga0495662_0121487 | 3300046476 | Bacteria | 1282 |
| 862 | Ga0495662_0160899 | 3300046476 | Bacteria | 1106 |
| 863 | Ga0495662_0244340 | 3300046476 | Bacteria | 884 |
| 864 | Ga0495664_0009075 | 3300046477 | Bacteria | 5560 |
| 865 | Ga0495664_0028765 | 3300046477 | Bacteria | 3246 |
| 866 | Ga0495664_0055529 | 3300046477 | Bacteria | 2356 |
| 867 | Ga0495664_0095702 | 3300046477 | Bacteria | 1787 |
| 868 | Ga0495664_0098986 | 3300046477 | Bacteria | 1756 |
| 869 | Ga0495664_0338305 | 3300046477 | Bacteria | 907 |
| 870 | Ga0495664_0378697 | 3300046477 | Bacteria | 851 |
| 871 | Ga0495584_0024795 | 3300046491 | Bacteria | 3041 |
| 872 | Ga0495584_0047078 | 3300046491 | Bacteria | 2175 |
| 873 | Ga0495584_0197946 | 3300046491 | Bacteria | 1021 |
| 874 | Ga0495585_0029073 | 3300046492 | Bacteria | 3148 |
| 875 | Ga0495585_0202481 | 3300046492 | Bacteria | 1010 |
| 876 | Ga0495594_0001833 | 3300046499 | Bacteria | 11057 |
| 877 | Ga0495594_0042613 | 3300046499 | Bacteria | 2486 |
| 878 | Ga0495594_0049922 | 3300046499 | Bacteria | 2300 |
| 879 | Ga0495594_0176874 | 3300046499 | Bacteria | 1214 |
| 880 | Ga0495594_0332935 | 3300046499 | Bacteria | 865 |
| 881 | Ga0495596_0059130 | 3300046500 | Bacteria | 1494 |
| 882 | Ga0495583_0025223 | 3300046506 | Bacteria | 2974 |
| 883 | Ga0495606_0001505 | 3300046507 | Bacteria | 30975 |
| 884 | Ga0495606_0012177 | 3300046507 | Bacteria | 6932 |
| 885 | Ga0495606_0064028 | 3300046507 | Bacteria | 2342 |
| 886 | Ga0495606_0176508 | 3300046507 | Bacteria | 1235 |
| 887 | Ga0495606_0281926 | 3300046507 | Bacteria | 908 |
| 888 | Ga0495608_0000738 | 3300046511 | Bacteria | 22828 |
| 889 | Ga0495608_0060188 | 3300046511 | Bacteria | 2499 |
| 890 | Ga0495608_0066723 | 3300046511 | Bacteria | 2355 |
| 891 | Ga0495610_0089149 | 3300046512 | Bacteria | 1401 |
| 892 | Ga0495616_0104198 | 3300046513 | Bacteria | 1326 |
| 893 | Ga0495616_0116693 | 3300046513 | Bacteria | 1235 |
| 894 | Ga0495616_0179280 | 3300046513 | Bacteria | 942 |
| 895 | Ga0495618_0012424 | 3300046514 | Bacteria | 5172 |
| 896 | Ga0495618_0075980 | 3300046514 | Bacteria | 2140 |
| 897 | Ga0495618_0240434 | 3300046514 | Bacteria | 1138 |
| 898 | Ga0495620_0084717 | 3300046515 | Bacteria | 1278 |
| 899 | Ga0495620_0121754 | 3300046515 | Bacteria | 1028 |
| 900 | Ga0495628_0021321 | 3300046516 | Bacteria | 5332 |
| 901 | Ga0495628_0033413 | 3300046516 | Bacteria | 4147 |
| 902 | Ga0495628_0034008 | 3300046516 | Bacteria | 4103 |
| 903 | Ga0495628_0259219 | 3300046516 | Bacteria | 1296 |
| 904 | Ga0495630_0002625 | 3300046517 | Bacteria | 12446 |
| 905 | Ga0495630_0062540 | 3300046517 | Bacteria | 2796 |
| 906 | Ga0495631_0015803 | 3300046518 | Bacteria | 3609 |
| 907 | Ga0495632_0094535 | 3300046519 | Bacteria | 1413 |
| 908 | Ga0495632_0127013 | 3300046519 | Bacteria | 1188 |
| 909 | Ga0495637_0165966 | 3300046520 | Bacteria | 826 |
| 910 | Ga0495643_0012291 | 3300046522 | Bacteria | 5170 |
| 911 | Ga0495643_0049687 | 3300046522 | Bacteria | 2261 |
| 912 | Ga0495644_0052273 | 3300046523 | Bacteria | 1534 |
| 913 | Ga0495648_0001119 | 3300046524 | Bacteria | 27174 |
| 914 | Ga0495648_0093465 | 3300046524 | Bacteria | 1677 |
| 915 | Ga0495648_0138167 | 3300046524 | Bacteria | 1286 |
| 916 | Ga0495648_0143187 | 3300046524 | Bacteria | 1256 |
| 917 | Ga0495648_0204372 | 3300046524 | Bacteria | 986 |
| 918 | Ga0495666_0035675 | 3300046526 | Bacteria | 2423 |
| 919 | Ga0495642_0132019 | 3300046528 | Bacteria | 1075 |
| 920 | Ga0495652_0004125 | 3300046529 | Bacteria | 14021 |
| 921 | Ga0495652_0035614 | 3300046529 | Bacteria | 4331 |
| 922 | Ga0495652_0037670 | 3300046529 | Bacteria | 4194 |
| 923 | Ga0495652_0041725 | 3300046529 | Bacteria | 3959 |
| 924 | Ga0495652_0119701 | 3300046529 | Bacteria | 2102 |
| 925 | Ga0495652_0187308 | 3300046529 | Bacteria | 1582 |
| 926 | Ga0495652_0384571 | 3300046529 | Bacteria | 997 |
| 927 | Ga0495665_0001239 | 3300046531 | Bacteria | 13612 |
| 928 | Ga0495665_0020494 | 3300046531 | Bacteria | 3551 |
| 929 | Ga0495640_0011216 | 3300046533 | Bacteria | 6899 |
| 930 | Ga0495640_0041782 | 3300046533 | Bacteria | 3202 |
| 931 | Ga0495640_0055752 | 3300046533 | Bacteria | 2703 |
| 932 | Ga0495640_0071490 | 3300046533 | Bacteria | 2328 |
| 933 | Ga0495640_0132243 | 3300046533 | Bacteria | 1614 |
| 934 | Ga0495586_0037182 | 3300046535 | Bacteria | 2613 |
| 935 | Ga0495587_0012212 | 3300046536 | Bacteria | 5423 |
| 936 | Ga0495587_0070475 | 3300046536 | Bacteria | 2034 |
| 937 | Ga0495587_0115572 | 3300046536 | Bacteria | 1539 |
| 938 | Ga0495598_0079149 | 3300046537 | Bacteria | 1051 |
| 939 | Ga0495609_0028259 | 3300046538 | Bacteria | 2560 |
| 940 | Ga0495621_0018971 | 3300046539 | Bacteria | 2240 |
| 941 | Ga0495597_0033416 | 3300046542 | Bacteria | 2329 |
| 942 | Ga0495645_0025912 | 3300046543 | Bacteria | 4256 |
| 943 | Ga0495645_0066982 | 3300046543 | Bacteria | 2593 |
| 944 | Ga0495622_0005490 | 3300046557 | Bacteria | 5879 |
| 945 | Ga0495622_0016785 | 3300046557 | Bacteria | 3410 |
| 946 | Ga0495633_0053651 | 3300046558 | Bacteria | 1897 |
| 947 | Ga0495633_0179924 | 3300046558 | Bacteria | 973 |
| 948 | Ga0495667_0067100 | 3300046559 | Bacteria | 2345 |
| 949 | Ga0495667_0112302 | 3300046559 | Bacteria | 1761 |
| 950 | Ga0495667_0187630 | 3300046559 | Bacteria | 1326 |
| 951 | Ga0495667_0428145 | 3300046559 | Bacteria | 832 |
| 952 | Ga0495656_0084365 | 3300046615 | Bacteria | 1440 |
| 953 | Ga0495668_0026683 | 3300046616 | Bacteria | 3276 |
| 954 | Ga0495668_0029734 | 3300046616 | Bacteria | 3086 |
| 955 | Ga0495668_0082172 | 3300046616 | Bacteria | 1767 |
| 956 | Ga0495634_0002221 | 3300046642 | Bacteria | 16276 |
| 957 | Ga0495634_0018650 | 3300046642 | Bacteria | 4935 |
| 958 | Ga0495634_0025310 | 3300046642 | Bacteria | 4155 |
| 959 | Ga0495634_0037628 | 3300046642 | Bacteria | 3305 |
| 960 | Ga0495634_0109829 | 3300046642 | Bacteria | 1774 |
| 961 | Ga0495611_0043715 | 3300046648 | Bacteria | 2003 |
| 962 | Ga0495625_0058534 | 3300046660 | Bacteria | 2738 |
| 963 | Ga0495625_0380108 | 3300046660 | Bacteria | 886 |
| 964 | Ga0495635_0000166 | 3300046663 | Bacteria | 40939 |
| 965 | Ga0495635_0001455 | 3300046663 | Bacteria | 15846 |
| 966 | Ga0495635_0001614 | 3300046663 | Bacteria | 15168 |
| 967 | Ga0495635_0021252 | 3300046663 | Bacteria | 4524 |
| 968 | Ga0495635_0116182 | 3300046663 | Bacteria | 1826 |
| 969 | Ga0495659_0095246 | 3300046664 | Bacteria | 1147 |
| 970 | Ga0495659_0121847 | 3300046664 | Bacteria | 1027 |
| 971 | Ga0495661_0258832 | 3300046665 | Bacteria | 885 |
| 972 | Ga0495588_0007336 | 3300046674 | Bacteria | 5012 |
| 973 | Ga0495588_0046469 | 3300046674 | Bacteria | 2227 |
| 974 | Ga0495588_0110523 | 3300046674 | Bacteria | 1448 |
| 975 | Ga0495657_0004131 | 3300046675 | Bacteria | 11623 |
| 976 | Ga0495657_0007196 | 3300046675 | Bacteria | 8628 |
| 977 | Ga0495657_0018249 | 3300046675 | Bacteria | 5083 |
| 978 | Ga0495657_0147798 | 3300046675 | Bacteria | 1461 |
| 979 | Ga0495657_0203447 | 3300046675 | Bacteria | 1206 |
| 980 | Ga0495599_0004838 | 3300046678 | Bacteria | 8011 |
| 981 | Ga0495599_0005025 | 3300046678 | Bacteria | 7865 |
| 982 | Ga0495599_0012226 | 3300046678 | Bacteria | 5288 |
| 983 | Ga0495599_0188922 | 3300046678 | Bacteria | 1268 |
| 984 | Ga0495599_0205758 | 3300046678 | Bacteria | 1208 |
| 985 | Ga0495599_0362565 | 3300046678 | Bacteria | 868 |
| 986 | Ga0495623_0002267 | 3300046679 | Bacteria | 12801 |
| 987 | Ga0495623_0188426 | 3300046679 | Bacteria | 1194 |
| 988 | Ga0495646_0019980 | 3300046680 | Bacteria | 4235 |
| 989 | Ga0495646_0020107 | 3300046680 | Bacteria | 4221 |
| 990 | Ga0495646_0060132 | 3300046680 | Bacteria | 2267 |
| 991 | Ga0495646_0067140 | 3300046680 | Bacteria | 2120 |
| 992 | Ga0495646_0148533 | 3300046680 | Bacteria | 1305 |
| 993 | Ga0495647_0032438 | 3300046681 | Bacteria | 1946 |
| 994 | Ga0495647_0071742 | 3300046681 | Bacteria | 1388 |
| 995 | Ga0495658_0008017 | 3300046683 | Bacteria | 5231 |
| 996 | Ga0495658_0074828 | 3300046683 | Bacteria | 1974 |
| 997 | Ga0495658_0112303 | 3300046683 | Bacteria | 1640 |
| 998 | Ga0495658_0396400 | 3300046683 | Bacteria | 880 |
| 999 | Ga0495669_0061491 | 3300046684 | Bacteria | 1699 |
| 1000 | Ga0495669_0108830 | 3300046684 | Bacteria | 1292 |
| 1001 | Ga0495669_0136339 | 3300046684 | Bacteria | 1157 |
| 1002 | Ga0495613_0047965 | 3300046689 | Bacteria | 3154 |
| 1003 | Ga0495613_0114323 | 3300046689 | Bacteria | 1943 |
| 1004 | Ga0495613_0132297 | 3300046689 | Bacteria | 1786 |
| 1005 | Ga0495613_0196387 | 3300046689 | Bacteria | 1424 |
| 1006 | Ga0495613_0273679 | 3300046689 | Bacteria | 1174 |
| 1007 | Ga0495624_0000898 | 3300046690 | Bacteria | 23624 |
| 1008 | Ga0495624_0018283 | 3300046690 | Bacteria | 4689 |
| 1009 | Ga0495624_0048677 | 3300046690 | Bacteria | 2689 |
| 1010 | Ga0495624_0085390 | 3300046690 | Bacteria | 1950 |
| 1011 | Ga0495671_0161490 | 3300046692 | Bacteria | 1090 |
| 1012 | Ga0495649_0011337 | 3300046694 | Bacteria | 5233 |
| 1013 | Ga0495649_0146140 | 3300046694 | Bacteria | 1243 |
| 1014 | Ga0495589_0117431 | 3300046794 | Bacteria | 1282 |
| 1015 | Ga0495600_0008000 | 3300046809 | Bacteria | 6479 |
| 1016 | Ga0495600_0011474 | 3300046809 | Bacteria | 5522 |
| 1017 | Ga0495600_0035461 | 3300046809 | Bacteria | 3240 |
| 1018 | Ga0495600_0035500 | 3300046809 | Bacteria | 3238 |
| 1019 | Ga0495600_0067086 | 3300046809 | Bacteria | 2345 |
| 1020 | Ga0495581_0007805 | 3300047315 | Bacteria | 6197 |
| 1021 | Ga0495581_0035924 | 3300047315 | Bacteria | 2866 |
| 1022 | Ga0495581_0070797 | 3300047315 | Bacteria | 2018 |
| 1023 | Ga0495581_0081158 | 3300047315 | Bacteria | 1878 |
| 1024 | Ga0495581_0099714 | 3300047315 | Bacteria | 1687 |
| 1025 | Ga0495604_0025793 | 3300047317 | Bacteria | 4681 |
| 1026 | Ga0495604_0047644 | 3300047317 | Bacteria | 3337 |
| 1027 | Ga0495604_0225347 | 3300047317 | Bacteria | 1288 |
| 1028 | Ga0495604_0435960 | 3300047317 | Bacteria | 858 |
| 1029 | Ga0495674_0010092 | 3300047319 | Bacteria | 8948 |
| 1030 | Ga0495674_0011184 | 3300047319 | Bacteria | 8474 |
| 1031 | Ga0495674_0046482 | 3300047319 | Bacteria | 3852 |
| 1032 | Ga0495674_0597790 | 3300047319 | Bacteria | 874 |
| 1033 | Ga0495672_0024126 | 3300047320 | Bacteria | 3924 |
| 1034 | Ga0495672_0092467 | 3300047320 | Bacteria | 1658 |
| 1035 | Ga0495672_0178904 | 3300047320 | Bacteria | 1076 |
| 1036 | Ga0495676_0031814 | 3300047321 | Bacteria | 4458 |
| 1037 | Ga0495676_0203301 | 3300047321 | Bacteria | 1375 |
| 1038 | Ga0495676_0240363 | 3300047321 | Bacteria | 1240 |
| 1039 | Ga0495680_0003456 | 3300047322 | Bacteria | 15551 |
| 1040 | Ga0495680_0016657 | 3300047322 | Bacteria | 6307 |
| 1041 | Ga0495683_0185020 | 3300047323 | Bacteria | 949 |
| 1042 | Ga0495687_040167 | 3300047443 | Bacteria | 2063 |
| 1043 | Ga0495675_0062655 | 3300047444 | Bacteria | 2354 |
| 1044 | Ga0495677_0052671 | 3300047445 | Bacteria | 1500 |
| 1045 | Ga0495685_059934 | 3300047447 | Bacteria | 1284 |
| 1046 | Ga0495673_0022298 | 3300047469 | Bacteria | 3107 |
| 1047 | Ga0495681_0102971 | 3300047470 | Bacteria | 1246 |
| 1048 | Ga0495684_0007715 | 3300047471 | Bacteria | 8330 |
| 1049 | Ga0495684_0064967 | 3300047471 | Bacteria | 2773 |
| 1050 | Ga0495684_0074579 | 3300047471 | Bacteria | 2578 |
| 1051 | Ga0495684_0083133 | 3300047471 | Bacteria | 2428 |
| 1052 | Ga0495686_0033518 | 3300047472 | Bacteria | 3315 |
| 1053 | Ga0495686_0127118 | 3300047472 | Bacteria | 1514 |
| 1054 | Ga0495593_0000469 | 3300047673 | Bacteria | 22695 |
| 1055 | Ga0495593_0006819 | 3300047673 | Bacteria | 6685 |
| 1056 | Ga0495593_0023148 | 3300047673 | Bacteria | 3455 |
| 1057 | Ga0495593_0041675 | 3300047673 | Bacteria | 2468 |
| 1058 | Ga0495593_0130701 | 3300047673 | Bacteria | 1275 |
| 1059 | Ga0495602_0009739 | 3300048088 | Bacteria | 9983 |
| 1060 | Ga0495615_0063028 | 3300048090 | Bacteria | 983 |
| 1061 | Ga0496100_0001098 | 3300048903 | Bacteria | 13078 |
| 1062 | Ga0496100_0126913 | 3300048903 | Bacteria | 1791 |
| 1063 | Ga0496100_0220574 | 3300048903 | Bacteria | 1391 |
| 1064 | Ga0496100_0342189 | 3300048903 | Bacteria | 1128 |
| 1065 | Ga0496101_0011608 | 3300048904 | Bacteria | 5851 |
| 1066 | Ga0496101_0205467 | 3300048904 | Bacteria | 1524 |
| 1067 | Ga0496102_0008520 | 3300048905 | Bacteria | 8791 |
| 1068 | Ga0496102_0092154 | 3300048905 | Bacteria | 2806 |
| 1069 | Ga0496102_0195455 | 3300048905 | Bacteria | 1906 |
| 1070 | Ga0496102_0240520 | 3300048905 | Bacteria | 1707 |
| 1071 | Ga0496102_0649090 | 3300048905 | Bacteria | 978 |
| 1072 | Ga0496103_0037555 | 3300048906 | Bacteria | 2968 |
| 1073 | Ga0496103_0280311 | 3300048906 | Bacteria | 1072 |
| 1074 | Ga0496104_0015075 | 3300048907 | Bacteria | 6995 |
| 1075 | Ga0496104_0026734 | 3300048907 | Bacteria | 5332 |
| 1076 | Ga0496104_0036163 | 3300048907 | Bacteria | 4615 |
| 1077 | Ga0496104_0037264 | 3300048907 | Bacteria | 4548 |
| 1078 | Ga0496104_0097220 | 3300048907 | Bacteria | 2818 |
| 1079 | Ga0496104_0208151 | 3300048907 | Bacteria | 1868 |
| 1080 | Ga0496104_0356829 | 3300048907 | Bacteria | 1374 |
| 1081 | Ga0496104_0396442 | 3300048907 | Bacteria | 1292 |
| 1082 | Ga0496104_0592513 | 3300048907 | Bacteria | 1019 |
| 1083 | Ga0496105_0000208 | 3300048908 | Bacteria | 39305 |
| 1084 | Ga0496105_0030338 | 3300048908 | Bacteria | 4430 |
| 1085 | Ga0496105_0066489 | 3300048908 | Bacteria | 2976 |
| 1086 | Ga0496105_0120936 | 3300048908 | Bacteria | 2159 |
| 1087 | Ga0496105_0375439 | 3300048908 | Bacteria | 1132 |
| 1088 | Ga0496106_0002121 | 3300048909 | Bacteria | 14838 |
| 1089 | Ga0496106_0031033 | 3300048909 | Bacteria | 3983 |
| 1090 | Ga0496106_0123661 | 3300048909 | Bacteria | 2024 |
| 1091 | Ga0496106_0228788 | 3300048909 | Bacteria | 1484 |
| 1092 | Ga0496106_0329249 | 3300048909 | Bacteria | 1226 |
| 1093 | Ga0496106_0419870 | 3300048909 | Bacteria | 1075 |
| 1094 | Ga0496107_0046162 | 3300048910 | Bacteria | 3135 |
| 1095 | Ga0496107_0174158 | 3300048910 | Bacteria | 1597 |
| 1096 | Ga0496107_0307918 | 3300048910 | Bacteria | 1179 |
| 1097 | Ga0496108_0000681 | 3300048911 | Bacteria | 26279 |
| 1098 | Ga0496108_0042075 | 3300048911 | Bacteria | 3813 |
| 1099 | Ga0496108_0122333 | 3300048911 | Bacteria | 2233 |
| 1100 | Ga0496108_0232274 | 3300048911 | Bacteria | 1604 |
| 1101 | Ga0496108_0538366 | 3300048911 | Bacteria | 1019 |
| 1102 | Ga0496109_0000450 | 3300048912 | Bacteria | 35265 |
| 1103 | Ga0496109_0027672 | 3300048912 | Bacteria | 5066 |
| 1104 | Ga0496109_0053052 | 3300048912 | Bacteria | 3697 |
| 1105 | Ga0496109_0167884 | 3300048912 | Bacteria | 2058 |
| 1106 | Ga0496110_0013956 | 3300048913 | Bacteria | 6657 |
| 1107 | Ga0496110_0031106 | 3300048913 | Bacteria | 4604 |
| 1108 | Ga0496110_0037630 | 3300048913 | Bacteria | 4206 |
| 1109 | Ga0496110_0091129 | 3300048913 | Bacteria | 2727 |
| 1110 | Ga0496110_0145854 | 3300048913 | Bacteria | 2141 |
| 1111 | Ga0496110_0369813 | 3300048913 | Bacteria | 1306 |
| 1112 | Ga0496110_0371924 | 3300048913 | Bacteria | 1302 |
| 1113 | Ga0496111_0040302 | 3300048914 | Bacteria | 3350 |
| 1114 | Ga0496111_0184327 | 3300048914 | Bacteria | 1552 |
| 1115 | Ga0496112_0000040 | 3300048915 | Bacteria | 89057 |
| 1116 | Ga0496112_0003971 | 3300048915 | Bacteria | 12388 |
| 1117 | Ga0496112_0005466 | 3300048915 | Bacteria | 10997 |
| 1118 | Ga0496112_0012229 | 3300048915 | Bacteria | 7879 |
| 1119 | Ga0496112_0023844 | 3300048915 | Bacteria | 5852 |
| 1120 | Ga0496112_0025634 | 3300048915 | Bacteria | 5663 |
| 1121 | Ga0496112_0319638 | 3300048915 | Bacteria | 1496 |
| 1122 | Ga0496112_0407027 | 3300048915 | Bacteria | 1300 |
| 1123 | Ga0496112_0816038 | 3300048915 | Bacteria | 857 |
| 1124 | Ga0496113_0015425 | 3300048916 | Bacteria | 5250 |
| 1125 | Ga0496113_0151391 | 3300048916 | Bacteria | 1830 |
| 1126 | Ga0496113_0358608 | 3300048916 | Bacteria | 1170 |
| 1127 | Ga0496113_0453572 | 3300048916 | Bacteria | 1030 |
| 1128 | Ga0496113_0559723 | 3300048916 | Bacteria | 917 |
| 1129 | Ga0496114_0033230 | 3300048917 | Bacteria | 4249 |
| 1130 | Ga0496114_0043995 | 3300048917 | Bacteria | 3703 |
| 1131 | Ga0496114_0108243 | 3300048917 | Bacteria | 2379 |
| 1132 | Ga0496114_0113023 | 3300048917 | Bacteria | 2328 |
| 1133 | Ga0496114_0213364 | 3300048917 | Bacteria | 1693 |
| 1134 | Ga0496114_0236676 | 3300048917 | Bacteria | 1605 |
| 1135 | Ga0496114_0499662 | 3300048917 | Bacteria | 1076 |
| 1136 | Ga0496114_0547196 | 3300048917 | Bacteria | 1023 |
| 1137 | Ga0496114_0757644 | 3300048917 | Bacteria | 848 |
| 1138 | Ga0496115_0017046 | 3300048918 | Bacteria | 5541 |
| 1139 | Ga0496115_0046053 | 3300048918 | Bacteria | 3484 |
| 1140 | Ga0496115_0259875 | 3300048918 | Bacteria | 1428 |
| 1141 | Ga0496115_0318080 | 3300048918 | Bacteria | 1273 |
| 1142 | Ga0496115_0359774 | 3300048918 | Bacteria | 1186 |
| 1143 | Ga0496115_0414887 | 3300048918 | Bacteria | 1091 |
| 1144 | Ga0496116_0164240 | 3300048919 | Bacteria | 1213 |
| 1145 | Ga0496117_0008070 | 3300048920 | Bacteria | 10087 |
| 1146 | Ga0496117_0079878 | 3300048920 | Bacteria | 2153 |
| 1147 | Ga0496117_0125246 | 3300048920 | Bacteria | 1570 |
| 1148 | Ga0496118_0002570 | 3300048921 | Bacteria | 24239 |
| 1149 | Ga0496118_0087129 | 3300048921 | Bacteria | 2167 |
| 1150 | Ga0496118_0142539 | 3300048921 | Bacteria | 1516 |
| 1151 | Ga0496118_0189448 | 3300048921 | Bacteria | 1232 |
| 1152 | Ga0496118_0243919 | 3300048921 | Bacteria | 1026 |
| 1153 | Ga0496119_0043743 | 3300048922 | Bacteria | 2827 |
| 1154 | Ga0496119_0098757 | 3300048922 | Bacteria | 1644 |
| 1155 | Ga0496121_0000265 | 3300048924 | Bacteria | 109251 |
| 1156 | Ga0496121_0001125 | 3300048924 | Bacteria | 47001 |
| 1157 | Ga0496121_0011280 | 3300048924 | Bacteria | 9954 |
| 1158 | Ga0496121_0011669 | 3300048924 | Bacteria | 9712 |
| 1159 | Ga0496121_0028222 | 3300048924 | Bacteria | 5229 |
| 1160 | Ga0496121_0044559 | 3300048924 | Bacteria | 3824 |
| 1161 | Ga0496121_0054026 | 3300048924 | Bacteria | 3360 |
| 1162 | Ga0496121_0112182 | 3300048924 | Bacteria | 2077 |
| 1163 | Ga0496121_0138490 | 3300048924 | Bacteria | 1809 |
| 1164 | Ga0496121_0287384 | 3300048924 | Bacteria | 1122 |
| 1165 | Ga0496121_0440548 | 3300048924 | Bacteria | 842 |
| 1166 | Ga0496122_0259050 | 3300048925 | Bacteria | 967 |
| 1167 | Ga0496122_0295814 | 3300048925 | Bacteria | 876 |
| 1168 | Ga0496124_0001146 | 3300048927 | Bacteria | 41561 |
| 1169 | Ga0496124_0038040 | 3300048927 | Bacteria | 4179 |
| 1170 | Ga0496124_0155785 | 3300048927 | Bacteria | 1787 |
| 1171 | Ga0496124_0215642 | 3300048927 | Bacteria | 1448 |
| 1172 | Ga0496125_0000176 | 3300048928 | Bacteria | 140746 |
| 1173 | Ga0496125_0034884 | 3300048928 | Bacteria | 4426 |
| 1174 | Ga0496125_0065382 | 3300048928 | Bacteria | 2882 |
| 1175 | Ga0496125_0123900 | 3300048928 | Bacteria | 1836 |
| 1176 | Ga0496125_0154485 | 3300048928 | Bacteria | 1570 |
| 1177 | Ga0496125_0195405 | 3300048928 | Bacteria | 1331 |
| 1178 | Ga0496126_0005831 | 3300048929 | Bacteria | 13924 |
| 1179 | Ga0496126_0011852 | 3300048929 | Bacteria | 8969 |
| 1180 | Ga0496126_0015449 | 3300048929 | Bacteria | 7677 |
| 1181 | Ga0496126_0020296 | 3300048929 | Bacteria | 6520 |
| 1182 | Ga0496126_0024497 | 3300048929 | Bacteria | 5826 |
| 1183 | Ga0496126_0032606 | 3300048929 | Bacteria | 4906 |
| 1184 | Ga0496126_0042857 | 3300048929 | Bacteria | 4178 |
| 1185 | Ga0496126_0057447 | 3300048929 | Bacteria | 3513 |
| 1186 | Ga0496126_0070795 | 3300048929 | Bacteria | 3106 |
| 1187 | Ga0496126_0072217 | 3300048929 | Bacteria | 3070 |
| 1188 | Ga0496126_0120816 | 3300048929 | Bacteria | 2272 |
| 1189 | Ga0496126_0121358 | 3300048929 | Bacteria | 2266 |
| 1190 | Ga0496126_0229919 | 3300048929 | Bacteria | 1554 |
| 1191 | Ga0496126_0612167 | 3300048929 | Bacteria | 857 |
| 1192 | Ga0495678_084520 | 3300049459 | Bacteria | 1132 |
| 1193 | Ga0495682_0018288 | 3300049460 | Bacteria | 2641 |
| 1194 | Ga0501031_0001415 | 3300049568 | Bacteria | 14850 |
| 1195 | Ga0501032_0003300 | 3300049569 | Bacteria | 12404 |
| 1196 | Ga0501032_0034880 | 3300049569 | Bacteria | 3441 |
| 1197 | Ga0501032_0047787 | 3300049569 | Bacteria | 2889 |
| 1198 | Ga0501032_0067767 | 3300049569 | Bacteria | 2383 |
| 1199 | Ga0501032_0128686 | 3300049569 | Bacteria | 1671 |
| 1200 | Ga0501033_0000175 | 3300049570 | Bacteria | 60845 |
| 1201 | Ga0501033_0000207 | 3300049570 | Bacteria | 56200 |
| 1202 | Ga0501033_0023002 | 3300049570 | Bacteria | 4698 |
| 1203 | Ga0501033_0060484 | 3300049570 | Bacteria | 2794 |
| 1204 | Ga0501033_0219426 | 3300049570 | Bacteria | 1354 |
| 1205 | Ga0501033_0407430 | 3300049570 | Bacteria | 948 |
| 1206 | Ga0501034_0000202 | 3300049571 | Bacteria | 112985 |
| 1207 | Ga0501034_0052329 | 3300049571 | Bacteria | 4114 |
| 1208 | Ga0501034_0079493 | 3300049571 | Bacteria | 3283 |
| 1209 | Ga0501034_0129594 | 3300049571 | Bacteria | 2506 |
| 1210 | Ga0501034_0178709 | 3300049571 | Bacteria | 2087 |
| 1211 | Ga0501034_0594583 | 3300049571 | Bacteria | 1012 |
| 1212 | Ga0501034_0595299 | 3300049571 | Bacteria | 1012 |
| 1213 | Ga0501034_0723716 | 3300049571 | Bacteria | 892 |
| 1214 | Ga0501036_0000042 | 3300049572 | Bacteria | 79876 |
| 1215 | Ga0501036_0106719 | 3300049572 | Bacteria | 2368 |
| 1216 | Ga0501036_0117764 | 3300049572 | Bacteria | 2243 |
| 1217 | Ga0501036_0503889 | 3300049572 | Bacteria | 1007 |
| 1218 | Ga0501037_0000100 | 3300049573 | Bacteria | 81013 |
| 1219 | Ga0501037_0000334 | 3300049573 | Bacteria | 39895 |
| 1220 | Ga0501037_0212015 | 3300049573 | Bacteria | 1365 |
| 1221 | Ga0501037_0273387 | 3300049573 | Bacteria | 1178 |
| 1222 | Ga0501038_0000157 | 3300049574 | Bacteria | 58169 |
| 1223 | Ga0501038_0043349 | 3300049574 | Bacteria | 3912 |
| 1224 | Ga0501038_0085789 | 3300049574 | Bacteria | 2646 |
| 1225 | Ga0501038_0205940 | 3300049574 | Bacteria | 1576 |
| 1226 | Ga0501039_0000216 | 3300049575 | Bacteria | 42349 |
| 1227 | Ga0501039_0007971 | 3300049575 | Bacteria | 8068 |
| 1228 | Ga0501039_0011255 | 3300049575 | Bacteria | 6814 |
| 1229 | Ga0501039_0298952 | 3300049575 | Bacteria | 1265 |
| 1230 | Ga0501040_0083811 | 3300049576 | Bacteria | 2211 |
| 1231 | Ga0501042_0044070 | 3300049578 | Bacteria | 3178 |
| 1232 | Ga0501042_0053023 | 3300049578 | Bacteria | 2893 |
| 1233 | Ga0501042_0083958 | 3300049578 | Bacteria | 2283 |
| 1234 | Ga0501043_0001316 | 3300049579 | Bacteria | 21701 |
| 1235 | Ga0501043_0040872 | 3300049579 | Bacteria | 3644 |
| 1236 | Ga0501043_0050219 | 3300049579 | Bacteria | 3279 |
| 1237 | Ga0501043_0387968 | 3300049579 | Bacteria | 1056 |
| 1238 | Ga0501046_0000387 | 3300049580 | Bacteria | 44269 |
| 1239 | Ga0501046_0101168 | 3300049580 | Bacteria | 2211 |
| 1240 | Ga0501046_0137214 | 3300049580 | Bacteria | 1852 |
| 1241 | Ga0501047_0000159 | 3300049581 | Bacteria | 82106 |
| 1242 | Ga0501047_0006707 | 3300049581 | Bacteria | 10824 |
| 1243 | Ga0501047_0154680 | 3300049581 | Bacteria | 2167 |
| 1244 | Ga0501047_0389810 | 3300049581 | Bacteria | 1226 |
| 1245 | Ga0501047_0432753 | 3300049581 | Bacteria | 1146 |
| 1246 | Ga0501048_0000655 | 3300049582 | Bacteria | 24936 |
| 1247 | Ga0501048_0197317 | 3300049582 | Bacteria | 1426 |
| 1248 | Ga0501067_0011823 | 3300049583 | Bacteria | 4836 |
| 1249 | Ga0501067_0022683 | 3300049583 | Bacteria | 3473 |
| 1250 | Ga0501068_0000168 | 3300049584 | Bacteria | 30562 |
| 1251 | Ga0501068_0004245 | 3300049584 | Bacteria | 7778 |
| 1252 | Ga0501068_0103177 | 3300049584 | Bacteria | 1768 |
| 1253 | Ga0501069_0002689 | 3300049585 | Bacteria | 9073 |
| 1254 | Ga0501069_0025378 | 3300049585 | Bacteria | 3239 |
| 1255 | Ga0501069_0100739 | 3300049585 | Bacteria | 1640 |
| 1256 | Ga0501070_0002236 | 3300049586 | Bacteria | 17009 |
| 1257 | Ga0501070_0004540 | 3300049586 | Bacteria | 11913 |
| 1258 | Ga0501070_0024309 | 3300049586 | Bacteria | 5081 |
| 1259 | Ga0501070_0070516 | 3300049586 | Bacteria | 2894 |
| 1260 | Ga0501070_0357855 | 3300049586 | Bacteria | 1184 |
| 1261 | Ga0501071_0072452 | 3300049587 | Bacteria | 2513 |
| 1262 | Ga0501071_0203185 | 3300049587 | Bacteria | 1489 |
| 1263 | Ga0501072_0000475 | 3300049588 | Bacteria | 28798 |
| 1264 | Ga0501072_0307036 | 3300049588 | Bacteria | 1261 |
| 1265 | Ga0501073_0000678 | 3300049589 | Bacteria | 23931 |
| 1266 | Ga0501073_0021963 | 3300049589 | Bacteria | 4597 |
| 1267 | Ga0501073_0046988 | 3300049589 | Bacteria | 3035 |
| 1268 | Ga0501073_0232206 | 3300049589 | Bacteria | 1274 |
| 1269 | Ga0501073_0510202 | 3300049589 | Bacteria | 831 |
| 1270 | Ga0501074_0001904 | 3300049590 | Bacteria | 14331 |
| 1271 | Ga0501074_0004788 | 3300049590 | Bacteria | 9702 |
| 1272 | Ga0501075_0380494 | 3300049591 | Bacteria | 1076 |
| 1273 | Ga0501076_0399186 | 3300049592 | Bacteria | 1130 |
| 1274 | Ga0501076_0517097 | 3300049592 | Bacteria | 984 |
| 1275 | Ga0501079_0006064 | 3300049741 | Bacteria | 9059 |
| 1276 | Ga0501079_0013419 | 3300049741 | Bacteria | 6248 |
| 1277 | Ga0501080_0004449 | 3300049742 | Bacteria | 12471 |
| 1278 | Ga0501080_0005538 | 3300049742 | Bacteria | 11274 |
| 1279 | Ga0501080_0108484 | 3300049742 | Bacteria | 2573 |
| 1280 | Ga0501080_0649821 | 3300049742 | Bacteria | 933 |
| 1281 | Ga0501081_0135027 | 3300049743 | Bacteria | 1766 |
| 1282 | Ga0501083_0001555 | 3300049744 | Bacteria | 15682 |
| 1283 | Ga0501083_0227962 | 3300049744 | Bacteria | 1213 |
| 1284 | Ga0501035_0000172 | 3300049822 | Bacteria | 79203 |
| 1285 | Ga0501035_0089560 | 3300049822 | Bacteria | 2710 |
| 1286 | Ga0501035_0211197 | 3300049822 | Bacteria | 1660 |
| 1287 | Ga0501035_0254251 | 3300049822 | Bacteria | 1491 |
| 1288 | Ga0501035_0425185 | 3300049822 | Bacteria | 1102 |
| 1289 | Ga0501035_0511269 | 3300049822 | Bacteria | 988 |
| 1290 | Ga0501044_0000282 | 3300049823 | Bacteria | 64640 |
| 1291 | Ga0501044_0017300 | 3300049823 | Bacteria | 7732 |
| 1292 | Ga0501044_0027827 | 3300049823 | Bacteria | 5968 |
| 1293 | Ga0501044_0046842 | 3300049823 | Bacteria | 4475 |
| 1294 | Ga0501044_0052100 | 3300049823 | Bacteria | 4219 |
| 1295 | Ga0501044_0136440 | 3300049823 | Bacteria | 2444 |
| 1296 | Ga0501045_0019340 | 3300049824 | Bacteria | 4854 |
| 1297 | Ga0501045_0056911 | 3300049824 | Bacteria | 2860 |
| 1298 | nmdc:mga03n38_1607_c1 | 3300050490 | Bacteria | 6595 |
| 1299 | nmdc:mga03n38_294452_c1 | 3300050490 | Bacteria | 870 |
| 1300 | nmdc:mga03n38_37646_c1 | 3300050490 | Bacteria | 2088 |
| 1301 | nmdc:mga03n38_62564_c1 | 3300050490 | Bacteria | 1698 |
| 1302 | nmdc:mga00v17_266012_c1 | 3300050491 | Bacteria | 1113 |
| 1303 | nmdc:mga0yw44_125590_c1 | 3300050492 | Bacteria | 1657 |
| 1304 | nmdc:mga0yw44_2044_c1 | 3300050492 | Bacteria | 8411 |
| 1305 | nmdc:mga0yw44_56048_c1 | 3300050492 | Bacteria | 2400 |
| 1306 | nmdc:mga0yw44_91277_c1 | 3300050492 | Bacteria | 1925 |
| 1307 | nmdc:mga0yw44_95497_c1 | 3300050492 | Bacteria | 1886 |
| 1308 | nmdc:mga0k408_109312_c1 | 3300050493 | Bacteria | 1634 |
| 1309 | nmdc:mga0k408_30290_c1 | 3300050493 | Bacteria | 3085 |
| 1310 | nmdc:mga0k408_345967_c1 | 3300050493 | Bacteria | 886 |
| 1311 | nmdc:mga06z11_64327_c1 | 3300050494 | Bacteria | 1922 |
| 1312 | nmdc:mga06z11_8466_c1 | 3300050494 | Bacteria | 4291 |
| 1313 | nmdc:mga06z11_8851_c1 | 3300050494 | Bacteria | 3862 |
| 1314 | nmdc:mga04h51_197101_c1 | 3300050495 | Bacteria | 790 |
| 1315 | nmdc:mga04h51_38767_c1 | 3300050495 | Bacteria | 1545 |
| 1316 | nmdc:mga04h51_51084_c1 | 3300050495 | Bacteria | 1388 |
| 1317 | nmdc:mga04h51_55291_c1 | 3300050495 | Bacteria | 1344 |
| 1318 | nmdc:mga07m45_47170_c1 | 3300050496 | Bacteria | 2421 |
| 1319 | nmdc:mga07m45_59524_c1 | 3300050496 | Bacteria | 2161 |
| 1320 | nmdc:mga07m45_82080_c1 | 3300050496 | Bacteria | 1841 |
| 1321 | nmdc:mga05p37_196622_c1 | 3300050507 | Bacteria | 2445 |
| 1322 | nmdc:mga0qj67_579749_c1 | 3300050509 | Bacteria | 898 |
| 1323 | nmdc:mga08y16_351549_c1 | 3300050511 | Bacteria | 1514 |
| 1324 | nmdc:mga08y16_40252_c1 | 3300050511 | Bacteria | 4899 |
| 1325 | nmdc:mga08y16_841950_c1 | 3300050511 | Bacteria | 907 |
| 1326 | nmdc:mga0n895_131877_c1 | 3300050512 | Bacteria | 2524 |
| 1327 | nmdc:mga0n895_13760_c1 | 3300050512 | Bacteria | 7317 |
| 1328 | nmdc:mga0n895_499664_c1 | 3300050512 | Bacteria | 1225 |
| 1329 | nmdc:mga0rr50_144231_c1 | 3300050513 | Bacteria | 1918 |
| 1330 | nmdc:mga08x19_50119_c1 | 3300050514 | Bacteria | 2678 |
| 1331 | nmdc:mga0a205_315262_c1 | 3300050515 | Bacteria | 1435 |
| 1332 | nmdc:mga0sz30_60389_c1 | 3300050516 | Bacteria | 1619 |
| 1333 | nmdc:mga0sz30_73278_c1 | 3300050516 | Bacteria | 1476 |
| 1334 | nmdc:mga0sz30_96610_c1 | 3300050516 | Bacteria | 1289 |
| 1335 | Ga0495601_0037678 | 3300053077 | Bacteria | 3023 |
| 1336 | Ga0495601_0096036 | 3300053077 | Bacteria | 1911 |
| 1337 | Ga0495601_0106010 | 3300053077 | Bacteria | 1817 |
| 1338 | Ga0495612_0007550 | 3300053078 | Bacteria | 4445 |
| 1339 | Ga0495612_0022244 | 3300053078 | Bacteria | 2542 |
| 1340 | Ga0495612_0078734 | 3300053078 | Bacteria | 1383 |
| 1341 | Ga0495612_0094368 | 3300053078 | Bacteria | 1270 |
| 1342 | Ga0500610_0032128 | 3300053079 | Bacteria | 2671 |
| 1343 | Ga0500610_0082336 | 3300053079 | Bacteria | 1677 |
| 1344 | Ga0500635_0039043 | 3300053080 | Bacteria | 1577 |
| 1345 | Ga0500635_0096668 | 3300053080 | Bacteria | 1081 |
| 1346 | Ga0495595_0000332 | 3300053084 | Bacteria | 18218 |
| 1347 | Ga0495595_0107394 | 3300053084 | Bacteria | 1351 |
| 1348 | Ga0495619_0000633 | 3300053085 | Bacteria | 23194 |
| 1349 | Ga0495619_0183969 | 3300053085 | Bacteria | 1446 |
| 1350 | Ga0500578_0078699 | 3300053086 | Bacteria | 2098 |
| 1351 | Ga0500578_0270688 | 3300053086 | Bacteria | 1016 |
| 1352 | Ga0500643_000016 | 3300053087 | Bacteria | 309502 |
| 1353 | Ga0500644_0040572 | 3300053088 | Bacteria | 1541 |
| 1354 | Ga0500646_0026612 | 3300053090 | Bacteria | 1569 |
| 1355 | Ga0500651_0004739 | 3300053093 | Bacteria | 7670 |
| 1356 | Ga0500651_0034823 | 3300053093 | Bacteria | 3174 |
| 1357 | Ga0500566_0000078 | 3300053094 | Bacteria | 47558 |
| 1358 | Ga0500566_0000290 | 3300053094 | Bacteria | 26984 |
| 1359 | Ga0500566_0075616 | 3300053094 | Bacteria | 1884 |
| 1360 | Ga0500566_0095532 | 3300053094 | Bacteria | 1637 |
| 1361 | Ga0500566_0177840 | 3300053094 | Bacteria | 1094 |
| 1362 | Ga0500640_000121 | 3300053095 | Bacteria | 14580 |
| 1363 | Ga0500641_0000385 | 3300053096 | Bacteria | 16362 |
| 1364 | Ga0500641_0146332 | 3300053096 | Bacteria | 1020 |
| 1365 | Ga0500648_148817 | 3300053097 | Bacteria | 1248 |
| 1366 | Ga0500650_0053851 | 3300053098 | Bacteria | 1872 |
| 1367 | Ga0500554_023672 | 3300053102 | Bacteria | 1730 |
| 1368 | Ga0500555_023736 | 3300053103 | Bacteria | 1758 |
| 1369 | Ga0500556_0030267 | 3300053104 | Bacteria | 1833 |
| 1370 | Ga0500557_000011 | 3300053105 | Bacteria | 117471 |
| 1371 | Ga0500572_000170 | 3300053111 | Bacteria | 22863 |
| 1372 | Ga0500572_034970 | 3300053111 | Bacteria | 1426 |
| 1373 | Ga0500592_010304 | 3300053116 | Bacteria | 1488 |
| 1374 | Ga0500594_0017047 | 3300053118 | Bacteria | 1773 |
| 1375 | Ga0500595_001686 | 3300053119 | Bacteria | 11604 |
| 1376 | Ga0500595_002442 | 3300053119 | Bacteria | 9222 |
| 1377 | Ga0500595_002477 | 3300053119 | Bacteria | 9136 |
| 1378 | Ga0500595_004672 | 3300053119 | Bacteria | 6088 |
| 1379 | Ga0500595_024639 | 3300053119 | Bacteria | 2097 |
| 1380 | Ga0500595_026908 | 3300053119 | Bacteria | 1976 |
| 1381 | Ga0500595_055910 | 3300053119 | Bacteria | 1207 |
| 1382 | Ga0500607_104330 | 3300053121 | Bacteria | 1401 |
| 1383 | Ga0500614_004910 | 3300053123 | Bacteria | 2813 |
| 1384 | Ga0500614_085275 | 3300053123 | Bacteria | 890 |
| 1385 | Ga0500642_0000090 | 3300053130 | Bacteria | 46849 |
| 1386 | Ga0500642_0121991 | 3300053130 | Bacteria | 1219 |
| 1387 | Ga0500642_0123555 | 3300053130 | Bacteria | 1211 |
| 1388 | Ga0500655_009005 | 3300053133 | Bacteria | 1796 |
| 1389 | Ga0500658_0051360 | 3300053134 | Bacteria | 1685 |
| 1390 | Ga0500559_0009508 | 3300053136 | Bacteria | 4201 |
| 1391 | Ga0500561_0007905 | 3300053137 | Bacteria | 2095 |
| 1392 | Ga0500568_0011274 | 3300053139 | Bacteria | 4161 |
| 1393 | Ga0500568_0018416 | 3300053139 | Bacteria | 3058 |
| 1394 | Ga0500568_0035763 | 3300053139 | Bacteria | 2025 |
| 1395 | Ga0500573_0056514 | 3300053140 | Bacteria | 2252 |
| 1396 | Ga0500577_0000619 | 3300053142 | Bacteria | 9125 |
| 1397 | Ga0500577_0080646 | 3300053142 | Bacteria | 1297 |
| 1398 | Ga0500588_0046427 | 3300053146 | Bacteria | 1335 |
| 1399 | Ga0500589_060298 | 3300053147 | Bacteria | 1740 |
| 1400 | Ga0500590_073986 | 3300053148 | Bacteria | 1688 |
| 1401 | Ga0500590_128847 | 3300053148 | Bacteria | 1173 |
| 1402 | Ga0500603_000081 | 3300053150 | Bacteria | 22182 |
| 1403 | Ga0500603_012969 | 3300053150 | Bacteria | 1924 |
| 1404 | Ga0500604_0011079 | 3300053151 | Bacteria | 2419 |
| 1405 | Ga0500616_0047459 | 3300053153 | Bacteria | 2280 |
| 1406 | Ga0500620_074910 | 3300053155 | Bacteria | 1168 |
| 1407 | Ga0500627_0015439 | 3300053158 | Bacteria | 2953 |
| 1408 | Ga0500630_004509 | 3300053159 | Bacteria | 6772 |
| 1409 | Ga0500638_018006 | 3300053162 | Bacteria | 3289 |
| 1410 | Ga0500638_021427 | 3300053162 | Bacteria | 3054 |
| 1411 | Ga0500638_097678 | 3300053162 | Bacteria | 1374 |
| 1412 | Ga0500638_150816 | 3300053162 | Bacteria | 1034 |
| 1413 | Ga0500639_000028 | 3300053163 | Bacteria | 77951 |
| 1414 | Ga0500639_112012 | 3300053163 | Bacteria | 1326 |
| 1415 | Ga0500639_177365 | 3300053163 | Bacteria | 947 |
| 1416 | Ga0500636_0001766 | 3300053177 | Bacteria | 11841 |
| 1417 | Ga0500636_0065953 | 3300053177 | Bacteria | 2106 |
| 1418 | Ga0500636_0127461 | 3300053177 | Bacteria | 1421 |
| 1419 | Ga0500637_0039902 | 3300053178 | Bacteria | 2649 |
| 1420 | Ga0500637_0052431 | 3300053178 | Bacteria | 2326 |
| 1421 | Ga0500611_094937 | 3300053727 | Bacteria | 765 |
| 1422 | Ga0500625_002925 | 3300053729 | Bacteria | 6585 |
| 1423 | Ga0500645_029720 | 3300053730 | Bacteria | 1648 |
| 1424 | Ga0500609_001414 | 3300053731 | Bacteria | 3516 |
| 1425 | Ga0500609_017433 | 3300053731 | Bacteria | 976 |
| 1426 | Ga0500596_000324 | 3300053735 | Bacteria | 8556 |
| 1427 | Ga0500596_000655 | 3300053735 | Bacteria | 6696 |
| 1428 | Ga0500596_012941 | 3300053735 | Bacteria | 1262 |
| 1429 | Ga0501084_0023457 | 3300054114 | Bacteria | 5148 |
| 1430 | Ga0501084_0180813 | 3300054114 | Bacteria | 1780 |
| 1431 | Ga0501084_0299323 | 3300054114 | Bacteria | 1359 |
| 1432 | Ga0500661_000381 | 3300055283 | Bacteria | 8160 |
| 1433 | Ga0500661_002428 | 3300055283 | Bacteria | 3509 |
| 1434 | Ga0501082_0005465 | 3300060353 | Bacteria | 11036 |
| 1435 | Ga0501082_0182571 | 3300060353 | Bacteria | 1825 |
| 1436 | Ga0501082_0383448 | 3300060353 | Bacteria | 1226 |
| 1437 | Ga0530510_0173880 | 3300061734 | Bacteria | 1596 |
| 1438 | 2507511468 | 2507262055 | Bacteria | 8048963 |
| 1439 | 2508545275 | 2508501009 | Bacteria | 7784016 |
| 1440 | 2509147818 | 2508501128 | Bacteria | 8613869 |
| 1441 | 2511397251 | 2511231028 | Bacteria | 8046582 |
| 1442 | 2513624041 | 2513237092 | Bacteria | 8341956 |
| 1443 | 2513641004 | 2513237094 | Bacteria | 8789602 |
| 1444 | 2513648417 | 2513237095 | Bacteria | 8976980 |
| 1445 | 2513655374 | 2513237096 | Bacteria | 8722461 |
| 1446 | 2513696102 | 2513237101 | Bacteria | 7952346 |
| 1447 | 2513703640 | 2513237102 | Bacteria | 7703324 |
| 1448 | 2513716371 | 2513237104 | Bacteria | 10034502 |
| 1449 | 2513860061 | 2513237137 | Bacteria | 9558895 |
| 1450 | 2513875072 | 2513237139 | Bacteria | 8737671 |
| 1451 | 2513893102 | 2513237141 | Bacteria | 8496279 |
| 1452 | 2513916548 | 2513237145 | Bacteria | 8979722 |
| 1453 | 2514013854 | 2513237161 | Bacteria | 8871253 |
| 1454 | 2515624958 | 2515154112 | Bacteria | 8294334 |
| 1455 | 2517101232 | 2517093001 | Bacteria | 9002274 |
| 1456 | 2517889862 | 2517572143 | Bacteria | 9484767 |
| 1457 | 2524439825 | 2524023205 | Bacteria | 8918781 |
| 1458 | 2524532952 | 2524023228 | Bacteria | 10118060 |
| 1459 | 2528855422 | 2528768022 | Bacteria | 10457665 |
| 1460 | 2617348363 | 2617270735 | Bacteria | 9163226 |
| 1461 | 2617374904 | 2617270741 | Bacteria | 8201522 |
| 1462 | 2671121116 | 2667528175 | Bacteria | 7532676 |
| 1463 | 2723848834 | 2721755755 | Bacteria | 8322773 |
| 1464 | 2728751744 | 2728368998 | Bacteria | 8720350 |
| 1465 | 2745075895 | 2744054633 | Bacteria | 8678936 |
| 1466 | 2793061365 | 2791355196 | Bacteria | 7323613 |
| 1467 | 2793073410 | 2791355197 | Bacteria | 8420563 |
| 1468 | 2793078832 | |||
| 1469 | 2805916338 | 2802429603 | Bacteria | 8777136 |
| 1470 | 2818239999 | 2816332527 | Bacteria | 8933356 |
| 1471 | 2824607022 | 2824600985 | Bacteria | 8488197 |
| 1472 | 2824614307 | 2824609381 | Bacteria | 8672835 |
| 1473 | 2824622306 | 2824617872 | Bacteria | 8814715 |
| 1474 | 2824631481 | 2824626560 | Bacteria | 8813858 |
| 1475 | 2824638001 | 2824635225 | Bacteria | 8785348 |
| 1476 | 2824664140 | 2824661429 | Bacteria | 9877870 |
| 1477 | 2824674569 | 2824671348 | Bacteria | 8369588 |
| 1478 | 2824685737 | 2824679649 | Bacteria | 8248951 |
| 1479 | 2824690532 | 2824687955 | Bacteria | 8360029 |
| 1480 | 2824697888 | 2824696289 | Bacteria | 8335049 |
| 1481 | 2824726683 | 2824723954 | Bacteria | 8758240 |
| 1482 | 2824736398 | 2824732956 | Bacteria | 7810675 |
| 1483 | 2824752063 | 2824746037 | Bacteria | 7911610 |
| 1484 | 2824770293 | 2824763712 | Bacteria | 9792355 |
| 1485 | 2824776233 | 2824773399 | Bacteria | 8360218 |
| 1486 | 2838129999 | 2838122688 | Bacteria | 8803140 |
| 1487 | 2841947038 | 2841941048 | Bacteria | 8688029 |
| 1488 | 2841955031 | 2841949485 | Bacteria | 8680857 |
| 1489 | 2841969988 | 2841966195 | Bacteria | 8673214 |
| 1490 | 2841977370 | 2841974524 | Bacteria | 8931498 |
| 1491 | 2841990216 | 2841983080 | Bacteria | 8395090 |
| 1492 | 2842042218 | 2842038055 | Bacteria | 8002051 |
| 1493 | 2842050261 | 2842045827 | Bacteria | 8006841 |
| 1494 | 2844316440 | 2844315083 | Bacteria | 8138177 |
| 1495 | 2847939261 | 2847930680 | Bacteria | 9342022 |
| 1496 | 2847943776 | 2847939898 | Bacteria | 8606328 |
| 1497 | 2849081990 | 2849076700 | Bacteria | 7039503 |
| 1498 | 2857513529 | 2857509624 | Bacteria | 7472071 |
| 1499 | 2874594683 | 2874590934 | Bacteria | 8299676 |
| 1500 | 2874606033 | 2874604998 | Bacteria | 7834745 |
| 1501 | 2874615253 | 2874612657 | Bacteria | 8252029 |
| 1502 | 2874622660 | 2874620515 | Bacteria | 8290088 |
| 1503 | 2874633589 | 2874628541 | Bacteria | 8630250 |
| 1504 | 2874647260 | 2874645413 | Bacteria | 8214782 |
| 1505 | 2876765421 | 2876761206 | Bacteria | 10111113 |
| 1506 | 2876773815 | 2876771140 | Bacteria | 8287509 |
| 1507 | 2876817821 | 2876808645 | Bacteria | 8824342 |
| 1508 | 2876819947 | 2876818435 | Bacteria | 8274608 |
| 1509 | 2879076066 | 2879074833 | Bacteria | 8279565 |
| 1510 | 2879086933 | 2879083081 | Bacteria | 8587928 |
| 1511 | 2879104325 | 2879099564 | Bacteria | 10442239 |
| 1512 | 2879116803 | 2879110137 | Bacteria | 8907982 |
| 1513 | 2879129328 | 2879127579 | Bacteria | 8294491 |
| 1514 | 2879144098 | 2879142872 | Bacteria | 8267021 |
| 1515 | 2881369416 | 2881364244 | Bacteria | 7710352 |
| 1516 | 2881668267 | 2881665667 | Bacteria | 8175609 |
| 1517 | 2885373655 | 2885366525 | Bacteria | 8326213 |
| 1518 | 2885378564 | 2885374607 | Bacteria | 8927485 |
| 1519 | 2888387049 | 2888378607 | Bacteria | 9652610 |
| 1520 | 2888389729 | 2888388044 | Bacteria | 7304136 |
| 1521 | 2888421358 | 2888419890 | Bacteria | 7857137 |
| 1522 | 2889034457 | 2889033259 | Bacteria | 9099371 |
| 1523 | 2903732321 | 2903727486 | Bacteria | 8281579 |
| 1524 | 2903749002 | 2903748898 | Bacteria | 9972761 |
| 1525 | 2904671333 | 2904666416 | Bacteria | 8226587 |
| 1526 | 2904692699 | 2904690495 | Bacteria | 9412302 |
| 1527 | 2904711224 | |||
| 1528 | 2904719632 | 2904711408 | Bacteria | 9771557 |
| 1529 | 2906606366 | 2906602504 | Bacteria | 8295279 |
| 1530 | 2906612403 | |||
| 1531 | 2906626835 | 2906626472 | Bacteria | 8826946 |
| 1532 | 2906636751 | 2906635258 | Bacteria | 8601019 |
| 1533 | 2906649081 | 2906643746 | Bacteria | 8722424 |
| 1534 | 2906663446 | 2906660503 | Bacteria | 8595048 |
| 1535 | 2908745671 | 2908739725 | Bacteria | 8628932 |
| 1536 | 2908757661 | 2908756301 | Bacteria | 8864324 |
| 1537 | 2908777388 | 2908775508 | Bacteria | 8092255 |
| 1538 | 2922366553 | 2922361189 | Bacteria | 7436256 |
| 1539 | 2922377183 | |||
| 1540 | 2922389537 | 2922386360 | Bacteria | 7017218 |
| 1541 | 2922398331 | 2922393267 | Bacteria | 8285685 |
| 1542 | 2922426889 | |||
| 1543 | 2929623584 | 2929615660 | Bacteria | 9193770 |
| 1544 | 2929632714 | 2929624759 | Bacteria | 9339455 |
| 1545 | 2932793026 | 2932784394 | Bacteria | 9704911 |
| 1546 | 2932795838 | 2932794094 | Bacteria | 7915132 |
| 1547 | 2932802076 | 2932801729 | Bacteria | 7987968 |
| 1548 | 2932814703 | 2932809354 | Bacteria | 9135765 |
| 1549 | 2932823560 | 2932818245 | Bacteria | 9955613 |
| 1550 | 2932832997 | 2932828146 | Bacteria | 9745859 |
| 1551 | 2933585487 | 2933577622 | Bacteria | 9116884 |
| 1552 | 2935616342 | 2935608549 | Bacteria | 8203142 |
| 1553 | 2935623728 | 2935616580 | Bacteria | 9032984 |
| 1554 | 2935633050 | 2935630451 | Bacteria | 8169952 |
| 1555 | 2935639499 | 2935638405 | Bacteria | 10015038 |
| 1556 | 2935650736 | 2935648319 | Bacteria | 8801166 |
| 1557 | 2935662116 | 2935656913 | Bacteria | 8965014 |
| 1558 | 2935670444 | 2935665750 | Bacteria | 9571747 |
| 1559 | 2935679873 | 2935675223 | Bacteria | 9928132 |
| 1560 | 2935687443 | 2935684952 | Bacteria | 9590419 |
| 1561 | 2935696585 | 2935694250 | Bacteria | 9291695 |
| 1562 | 2935705403 | 2935703347 | Bacteria | 10242284 |
| 1563 | 2935718902 | 2935713505 | Bacteria | 9608509 |
| 1564 | 2935728554 | 2935722832 | Bacteria | 9608746 |
| 1565 | 2935736849 | 2935732158 | Bacteria | 9706831 |
| 1566 | 2935746148 | 2935741537 | Bacteria | 9707219 |
| 1567 | 2935753409 | 2935750917 | Bacteria | 9590372 |
| 1568 | 2935766198 | 2935760218 | Bacteria | 9817913 |
| 1569 | 2935770395 | 2935769743 | Bacteria | 7878163 |
| 1570 | 2935777574 | 2935777560 | Bacteria | 8077691 |
| 1571 | 2935786552 | 2935785616 | Bacteria | 7962367 |
| 1572 | 2935794607 | 2935793552 | Bacteria | 8012592 |
| 1573 | 2935807146 | 2935801545 | Bacteria | 9301974 |
| 1574 | 2935813940 | 2935810662 | Bacteria | 9401221 |
| 1575 | 2935827139 | 2935819856 | Bacteria | 8261050 |
| 1576 | 2935828982 | 2935827899 | Bacteria | 10038562 |
| 1577 | 2935844154 | 2935837841 | Bacteria | 9454360 |
| 1578 | 2935854320 | 2935847175 | Bacteria | 8228321 |
| 1579 | 2935862047 | 2935855204 | Bacteria | 9035059 |
| 1580 | 2935871611 | 2935864058 | Bacteria | 9784707 |
| 1581 | 2935880278 | 2935873716 | Bacteria | 9632195 |
| 1582 | 2935886264 | 2935883170 | Bacteria | 7964738 |
| 1583 | 2935913586 | 2935908558 | Bacteria | 8568796 |
| 1584 | 2935923484 | 2935916978 | Bacteria | 9113783 |
| 1585 | 2935931097 | 2935926038 | Bacteria | 8601059 |
| 1586 | 2935935379 | 2935934488 | Bacteria | 8602579 |
| 1587 | 2935946945 | 2935942939 | Bacteria | 8599779 |
| 1588 | 2935953960 | 2935951376 | Bacteria | 8602333 |
| 1589 | 2935961407 | 2935959822 | Bacteria | 7869783 |
| 1590 | 2935968986 | 2935967501 | Bacteria | 8603075 |
| 1591 | 2935982365 | 2935975950 | Bacteria | 8347125 |
| 1592 | 2935985822 | 2935984226 | Bacteria | 8302647 |
| 1593 | 2935996944 | 2935992306 | Bacteria | 9802711 |
| 1594 | 2936005979 | 2936002035 | Bacteria | 9362176 |
| 1595 | 2936016302 | 2936011229 | Bacteria | 8801034 |
| 1596 | 2936025050 | 2936019824 | Bacteria | 8804134 |
| 1597 | 2936033607 | 2936028420 | Bacteria | 8965941 |
| 1598 | 2936039496 | 2936037263 | Bacteria | 9446081 |
| 1599 | 2936050961 | 2936046547 | Bacteria | 8903709 |
| 1600 | 2936057710 | 2936055302 | Bacteria | 8785755 |
| 1601 | 2940559322 | 2940556831 | Bacteria | 9590747 |
| 1602 | 2941509648 | 2941507105 | Bacteria | 8166816 |
| 1603 | 2941517477 | 2941515067 | Bacteria | 8166720 |
| 1604 | 2941526570 | 2941523033 | Bacteria | 8169134 |
| 1605 | 2941536917 | 2941531003 | Bacteria | 7653939 |
| 1606 | 2941542017 | 2941538514 | Bacteria | 9402094 |
| 1607 | 3005476076 | 3005474847 | Bacteria | 9259049 |
| 1608 | 3005491240 | 3005483717 | Bacteria | 7877331 |
| 1609 | 3005511086 | 3005506211 | Bacteria | 6943378 |
| 1610 | 3005591933 | 3005587118 | Bacteria | 7794411 |
| 1611 | 3005596058 | 3005594810 | Bacteria | 8716512 |
| 1612 | 3005712013 | 3005710791 | Bacteria | 7622528 |
| 1613 | 3005719249 | 3005718088 | Bacteria | 8283608 |
| 1614 | 8006932931 | 8006926726 | Bacteria | 6749210 |
| 1615 | 8006937386 | 8006933436 | Bacteria | 10410654 |
| 1616 | 8006971082 | 8006964411 | Bacteria | 8966052 |
| 1617 | 8006977416 | 8006973647 | Bacteria | 10679141 |
| 1618 | 8006992949 | 8006984368 | Bacteria | 9651211 |
| 1619 | 8006996796 | 8006994254 | Bacteria | 8309700 |
| 1620 | 8016517053 | 8016511872 | Bacteria | 9921665 |
| 1621 | 8016524596 | 8016522445 | Bacteria | 8156687 |
| 1622 | 8016538158 | 8016530956 | Bacteria | 8155261 |
| 1623 | 8016542438 | 8016539877 | Bacteria | 8155419 |
| 1624 | 8016559250 | 8016557553 | Bacteria | 8154380 |
| 1625 | 8016567827 | 8016566248 | Bacteria | 8158151 |
| 1626 | 8016580514 | 8016575299 | Bacteria | 8154085 |
| 1627 | 8016588514 | 8016583857 | Bacteria | 10421953 |
| 1628 | 8016597200 | 8016595262 | Bacteria | 8149947 |
| 1629 | 8016605073 | 8016603502 | Bacteria | 8731218 |
| 1630 | 8016619944 | 8016613128 | Bacteria | 8794220 |
| 1631 | 8016624165 | 8016622563 | Bacteria | 7999408 |
| 1632 | 8016637558 | 8016630954 | Bacteria | 9217207 |
| 1633 | 8017059528 | 8017057580 | Bacteria | 10023680 |
| 1634 | 8019537829 | 8019530166 | Bacteria | 8155624 |
| 1635 | 8019551185 | 8019547302 | Bacteria | 7996444 |
| 1636 | 8019571329 | 8019565922 | Bacteria | 9639779 |
| 1637 | 8019597037 | 8019586578 | Bacteria | 10212056 |
| 1638 | 8019604646 | 8019597564 | Bacteria | 10041141 |
| 1639 | 8019624460 | 8019619141 | Bacteria | 9218857 |
| 1640 | 8019637582 | 8019629233 | Bacteria | 8687553 |
| 1641 | 8019642034 | 8019638758 | Bacteria | 9062356 |
| 1642 | 8019650516 | 8019648815 | Bacteria | 10014479 |
| 1643 | 8019665511 | 8019659431 | Bacteria | 8577854 |
| 1644 | 8019675055 | 8019668869 | Bacteria | 8791617 |
| 1645 | 8019681043 | 8019678201 | Bacteria | 8863603 |
| 1646 | 8019694678 | 8019687851 | Bacteria | 8712826 |
| 1647 | 8055749744 | 8055742211 | Bacteria | 9226248 |
| 1648 | 8056675378 | 8056673599 | Bacteria | 7871253 |
| 1649 | 8056692027 | 8056689827 | Bacteria | 6712655 |
| 1650 | 8056973957 | 8056967851 | Bacteria | 9038162 |
| 1651 | Ga0070671_100643588 | |||
| 1652 | JGI24740J21852_10001580 | |||
| 1653 | JGI24737J22298_10002347 | |||
| 1654 | JGI24735J21928_10028622 | |||
| 1655 | JGI25406J46586_10005617 | |||
| 1656 | JGI25406J46586_10007816 | |||
| 1657 | JGI25406J46586_10008897 | |||
| 1658 | JGI25165J46597_1004728 | |||
| 1659 | JGI25165J46597_1005035 | |||
| 1660 | JGI25153J46596_10002507 | |||
| 1661 | JGI25153J46596_10002543 | |||
| 1662 | JGI25153J46596_10010032 | |||
| 1663 | JGI25153J46596_10026515 | |||
| 1664 | JGI25153J46596_10037403 | |||
| 1665 | rootH2_10168323 | |||
| 1666 | JGI25160J50197_1003540 | |||
| 1667 | JGI25160J50197_1009667 | |||
| 1668 | JGI25404J52841_10004139 | |||
| 1669 | Ga0055525_1003944 | |||
| 1670 | Ga0055531_10001939 | |||
| 1671 | Ga0065165_1001641 | |||
| 1672 | Ga0065165_1003060 | |||
| 1673 | Ga0070658_10012558 | |||
| 1674 | Ga0070658_10023514 | |||
| 1675 | Ga0070658_10052859 | |||
| 1676 | Ga0070658_10102491 | |||
| 1677 | Ga0070658_10155121 | |||
| 1678 | Ga0070676_10390013 | |||
| 1679 | Ga0070683_100014532 | |||
| 1680 | Ga0070683_100130698 | |||
| 1681 | Ga0070683_100175788 | |||
| 1682 | Ga0070690_100355313 | |||
| 1683 | Ga0070670_100407153 | |||
| 1684 | Ga0068869_100458466 | |||
| 1685 | Ga0070680_100299522 | |||
| 1686 | Ga0070682_100036436 | |||
| 1687 | Ga0070682_100117317 | |||
| 1688 | Ga0070682_100461097 | |||
| 1689 | Ga0070682_100524723 | |||
| 1690 | Ga0068868_100060174 | |||
| 1691 | Ga0068868_100208161 | |||
| 1692 | Ga0070660_100006936 | |||
| 1693 | Ga0070660_100046028 | |||
| 1694 | Ga0070660_100078138 | |||
| 1695 | Ga0070660_100659153 | |||
| 1696 | Ga0070689_100445054 | |||
| 1697 | Ga0070691_10105336 | |||
| 1698 | Ga0070687_100223122 | |||
| 1699 | Ga0070661_100204512 | |||
| 1700 | Ga0070661_100211872 | |||
| 1701 | Ga0070668_100004090 | |||
| 1702 | Ga0070668_100177813 | |||
| 1703 | Ga0070668_100185693 | |||
| 1704 | Ga0070668_100188933 | |||
| 1705 | Ga0070668_100420314 | |||
| 1706 | Ga0070668_100583118 | |||
| 1707 | Ga0070669_100077152 | |||
| 1708 | Ga0070669_100235249 | |||
| 1709 | Ga0070671_100028829 | |||
| 1710 | Ga0070671_100227546 | |||
| 1711 | Ga0070674_100399589 | |||
| 1712 | Ga0070674_100460492 | |||
| 1713 | Ga0070673_100223298 | |||
| 1714 | Ga0070659_100028575 | |||
| 1715 | Ga0070659_100120823 | |||
| 1716 | Ga0070709_10001211 | |||
| 1717 | Ga0070709_10001487 | |||
| 1718 | Ga0070709_10012057 | |||
| 1719 | Ga0070709_10203434 | |||
| 1720 | Ga0070714_100021170 | |||
| 1721 | Ga0070714_100036040 | |||
| 1722 | Ga0070714_100065164 | |||
| 1723 | Ga0070714_100074503 | |||
| 1724 | Ga0070714_100109893 | |||
| 1725 | Ga0070714_100228898 | |||
| 1726 | Ga0070713_100005990 | |||
| 1727 | Ga0070713_100077999 | |||
| 1728 | Ga0070713_100096572 | |||
| 1729 | Ga0070713_100335931 | |||
| 1730 | Ga0070713_100449753 | |||
| 1731 | Ga0070713_100471432 | |||
| 1732 | Ga0070713_100479307 | |||
| 1733 | Ga0070710_10001333 | |||
| 1734 | Ga0070710_10004775 | |||
| 1735 | Ga0070710_10047262 | |||
| 1736 | Ga0070710_10238132 | |||
| 1737 | Ga0070701_10190118 | |||
| 1738 | Ga0070711_100004982 | |||
| 1739 | Ga0070711_100008851 | |||
| 1740 | Ga0070711_100009103 | |||
| 1741 | Ga0070711_100015372 | |||
| 1742 | Ga0070711_100042807 | |||
| 1743 | Ga0070711_100587322 | |||
| 1744 | Ga0070700_100015418 | |||
| 1745 | Ga0070700_100183938 | |||
| 1746 | Ga0070663_100004680 | |||
| 1747 | Ga0070663_100005639 | |||
| 1748 | Ga0070663_100015169 | |||
| 1749 | Ga0070663_100026089 | |||
| 1750 | Ga0070663_100044624 | |||
| 1751 | Ga0070663_100051115 | |||
| 1752 | Ga0070663_100133416 | |||
| 1753 | Ga0070663_100303096 | |||
| 1754 | Ga0070678_100045978 | |||
| 1755 | Ga0070678_100229640 | |||
| 1756 | Ga0070662_100100370 | |||
| 1757 | Ga0070662_100154805 | |||
| 1758 | Ga0070662_100167487 | |||
| 1759 | Ga0070662_100217927 | |||
| 1760 | Ga0070662_100641525 | |||
| 1761 | Ga0070681_10012465 | |||
| 1762 | Ga0070681_10017662 | |||
| 1763 | Ga0070681_10024432 | |||
| 1764 | Ga0070681_10057575 | |||
| 1765 | Ga0068867_100203103 | |||
| 1766 | Ga0070706_100712771 | |||
| 1767 | Ga0070707_100082832 | |||
| 1768 | Ga0070698_100028998 | |||
| 1769 | Ga0070698_100176063 | |||
| 1770 | Ga0070698_100604931 | |||
| 1771 | Ga0070699_100501560 | |||
| 1772 | Ga0070679_100018130 | |||
| 1773 | Ga0070679_100075893 | |||
| 1774 | Ga0070679_100079972 | |||
| 1775 | Ga0070679_100168713 | |||
| 1776 | Ga0070679_100256152 | |||
| 1777 | Ga0070684_100026884 | |||
| 1778 | Ga0070697_100515432 | |||
| 1779 | Ga0068853_100003590 | |||
| 1780 | Ga0068853_100009325 | |||
| 1781 | Ga0068853_100040891 | |||
| 1782 | Ga0068853_100097167 | |||
| 1783 | Ga0068853_100210598 | |||
| 1784 | Ga0068853_100214448 | |||
| 1785 | Ga0068853_100357112 | |||
| 1786 | Ga0068853_100678605 | |||
| 1787 | Ga0070686_100061402 | |||
| 1788 | Ga0070693_100104870 | |||
| 1789 | Ga0070665_100013100 | |||
| 1790 | Ga0070665_100030279 | |||
| 1791 | Ga0070665_100128938 | |||
| 1792 | Ga0070665_100154541 | |||
| 1793 | Ga0070665_100263126 | |||
| 1794 | Ga0070665_100662890 | |||
| 1795 | Ga0070704_100191713 | |||
| 1796 | Ga0068855_100007494 | |||
| 1797 | Ga0068855_100051001 | |||
| 1798 | Ga0068855_100074949 | |||
| 1799 | Ga0068855_100100695 | |||
| 1800 | Ga0068855_100157617 | |||
| 1801 | Ga0068855_100173800 | |||
| 1802 | Ga0068855_100179168 | |||
| 1803 | Ga0068855_100286497 | |||
| 1804 | Ga0068857_100010136 | |||
| 1805 | Ga0068857_100028661 | |||
| 1806 | Ga0068857_100046709 | |||
| 1807 | Ga0068857_100090185 | |||
| 1808 | Ga0068857_100152011 | |||
| 1809 | Ga0068854_100004261 | |||
| 1810 | Ga0068854_100014717 | |||
| 1811 | Ga0068854_100167111 | |||
| 1812 | Ga0068854_100498096 | |||
| 1813 | Ga0068856_100000055 | |||
| 1814 | Ga0068856_100002036 | |||
| 1815 | Ga0068856_100035106 | |||
| 1816 | Ga0068856_100813720 | |||
| 1817 | Ga0070702_100030788 | |||
| 1818 | Ga0070702_100380126 | |||
| 1819 | Ga0068852_100061105 | |||
| 1820 | Ga0068852_100126999 | |||
| 1821 | Ga0068852_100182452 | |||
| 1822 | Ga0068852_100338700 | |||
| 1823 | Ga0068852_100388317 | |||
| 1824 | Ga0068852_100466010 | |||
| 1825 | Ga0068852_100597224 | |||
| 1826 | Ga0068859_100029233 | |||
| 1827 | Ga0068859_100160455 | |||
| 1828 | Ga0068859_100197202 | |||
| 1829 | Ga0068859_100271344 | |||
| 1830 | Ga0068859_100854619 | |||
| 1831 | Ga0068864_100155154 | |||
| 1832 | Ga0068866_10121120 | |||
| 1833 | Ga0068866_10150413 | |||
| 1834 | Ga0068861_100222076 | |||
| 1835 | Ga0068861_100380771 | |||
| 1836 | Ga0068851_10018146 | |||
| 1837 | Ga0068851_10199625 | |||
| 1838 | Ga0068870_10162882 | |||
| 1839 | Ga0068858_100060155 | |||
| 1840 | Ga0068858_100084612 | |||
| 1841 | Ga0068860_100004713 | |||
| 1842 | Ga0068860_100218969 | |||
| 1843 | Ga0068860_100438223 | |||
| 1844 | Ga0068860_100511884 | |||
| 1845 | Ga0068862_100565517 | |||
| 1846 | Ga0081455_10005206 | |||
| 1847 | Ga0081455_10014855 | |||
| 1848 | Ga0081455_10029662 | |||
| 1849 | Ga0081455_10109650 | |||
| 1850 | Ga0081455_10121760 | |||
| 1851 | Ga0081538_10014803 | |||
| 1852 | Ga0081538_10052708 | |||
| 1853 | Ga0081538_10121627 | |||
| 1854 | Ga0081540_1001339 | |||
| 1855 | Ga0081540_1002098 | |||
| 1856 | Ga0081540_1005640 | |||
| 1857 | Ga0081540_1007193 | |||
| 1858 | Ga0081540_1007306 | |||
| 1859 | Ga0081540_1007993 | |||
| 1860 | Ga0081540_1014652 | |||
| 1861 | Ga0081540_1075041 | |||
| 1862 | Ga0081540_1098360 | |||
| 1863 | Ga0081539_10000848 | |||
| 1864 | Ga0081539_10000950 | |||
| 1865 | Ga0081539_10023363 | |||
| 1866 | Ga0081539_10090029 | |||
| 1867 | Ga0081539_10096617 | |||
| 1868 | Ga0070717_10000460 | |||
| 1869 | Ga0070717_10004333 | |||
| 1870 | Ga0070717_10061424 | |||
| 1871 | Ga0070717_10333783 | |||
| 1872 | Ga0070717_10362396 | |||
| 1873 | Ga0075365_10002534 | |||
| 1874 | Ga0075365_10016437 | |||
| 1875 | Ga0075365_10032321 | |||
| 1876 | Ga0075365_10041163 | |||
| 1877 | Ga0075365_10046097 | |||
| 1878 | Ga0075365_10082863 | |||
| 1879 | Ga0075365_10230350 | |||
| 1880 | Ga0075368_10005523 | |||
| 1881 | Ga0075368_10042472 | |||
| 1882 | Ga0075363_100002726 | |||
| 1883 | Ga0075363_100040857 | |||
| 1884 | Ga0075363_100054874 | |||
| 1885 | Ga0070715_10128429 | |||
| 1886 | Ga0070715_10216155 | |||
| 1887 | Ga0070716_100006222 | |||
| 1888 | Ga0070716_100373734 | |||
| 1889 | Ga0070716_100432710 | |||
| 1890 | Ga0070712_100098353 | |||
| 1891 | Ga0075362_10085580 | |||
| 1892 | Ga0075362_10193130 | |||
| 1893 | Ga0075367_10016328 | |||
| 1894 | Ga0075367_10037477 | |||
| 1895 | Ga0075367_10040157 | |||
| 1896 | Ga0075367_10081082 | |||
| 1897 | Ga0075367_10110845 | |||
| 1898 | Ga0075367_10341270 | |||
| 1899 | Ga0075367_10388154 | |||
| 1900 | Ga0075369_10056155 | |||
| 1901 | Ga0075369_10227191 | |||
| 1902 | Ga0075366_10024888 | |||
| 1903 | Ga0075366_10050422 | |||
| 1904 | Ga0075366_10107607 | |||
| 1905 | Ga0097621_100512845 | |||
| 1906 | Ga0075370_10005105 | |||
| 1907 | Ga0075370_10043459 | |||
| 1908 | Ga0075370_10232227 | |||
| 1909 | Ga0075370_10323769 | |||
| 1910 | Ga0075434_100016328 | |||
| 1911 | Ga0075434_100189929 | |||
| 1912 | Ga0068865_100300036 | |||
| 1913 | Ga0075436_100057729 | |||
| 1914 | Ga0097620_100029232 | |||
| 1915 | Ga0097620_100160457 | |||
| 1916 | Ga0097620_100197214 | |||
| 1917 | Ga0097620_100271350 | |||
| 1918 | Ga0097620_100854749 | |||
| 1919 | Ga0099825_1026334 | |||
| 1920 | Ga0099825_1033252 | |||
| 1921 | Ga0099824_1008875 | |||
| 1922 | Ga0099824_1012218 | |||
| 1923 | Ga0099822_1020991 | |||
| 1924 | Ga0099823_1051282 | |||
| 1925 | Ga0075435_100520533 | |||
| 1926 | Ga0099794_10197571 | |||
| 1927 | Ga0099795_10094234 | |||
| 1928 | Ga0099795_10107624 | |||
| 1929 | Ga0105240_10004881 | |||
| 1930 | Ga0105240_10004901 | |||
| 1931 | Ga0105240_10016877 | |||
| 1932 | Ga0105240_10097295 | |||
| 1933 | Ga0105240_10150608 | |||
| 1934 | Ga0105240_10188676 | |||
| 1935 | Ga0105240_10309970 | |||
| 1936 | Ga0105240_10375624 | |||
| 1937 | Ga0105240_10438744 | |||
| 1938 | Ga0111539_10071397 | |||
| 1939 | Ga0105245_10060551 | |||
| 1940 | Ga0105245_10288278 | |||
| 1941 | Ga0105247_10060535 | |||
| 1942 | Ga0105247_10080734 | |||
| 1943 | Ga0105247_10541931 | |||
| 1944 | Ga0114129_10144511 | |||
| 1945 | Ga0105243_10353713 | |||
| 1946 | Ga0105241_10001823 | |||
| 1947 | Ga0105241_10012915 | |||
| 1948 | Ga0105241_10066635 | |||
| 1949 | Ga0105241_10360165 | |||
| 1950 | Ga0105248_10799823 | |||
| 1951 | Ga0105248_10860676 | |||
| 1952 | Ga0105248_10918589 | |||
| 1953 | Ga0105237_10003690 | |||
| 1954 | Ga0105237_10018023 | |||
| 1955 | Ga0105237_10026579 | |||
| 1956 | Ga0105237_10084699 | |||
| 1957 | Ga0105237_10208119 | |||
| 1958 | Ga0105237_10412749 | |||
| 1959 | Ga0105238_10001367 | |||
| 1960 | Ga0105238_10001743 | |||
| 1961 | Ga0105238_10004073 | |||
| 1962 | Ga0105238_10105202 | |||
| 1963 | Ga0105238_10108450 | |||
| 1964 | Ga0105238_10126345 | |||
| 1965 | Ga0105238_10216419 | |||
| 1966 | Ga0105238_10348621 | |||
| 1967 | Ga0105238_10627570 | |||
| 1968 | Ga0105249_10025071 | |||
| 1969 | Ga0105249_10696435 | |||
| 1970 | Ga0105249_10975195 | |||
| 1971 | Ga0105239_10001966 | |||
| 1972 | Ga0105239_10015287 | |||
| 1973 | Ga0105239_10018873 | |||
| 1974 | Ga0105239_10045918 | |||
| 1975 | Ga0105239_10071995 | |||
| 1976 | Ga0105239_10126508 | |||
| 1977 | Ga0105239_10181902 | |||
| 1978 | Ga0105246_10089670 | |||
| 1979 | Ga0105246_10776433 | |||
| 1980 | Ga0157371_10328587 | |||
| 1981 | Ga0157370_10026904 | |||
| 1982 | Ga0157370_10041113 | |||
| 1983 | Ga0157370_10101710 | |||
| 1984 | Ga0157370_10648587 | |||
| 1985 | Ga0157369_10020019 | |||
| 1986 | Ga0157369_10037771 | |||
| 1987 | Ga0157369_10105183 | |||
| 1988 | Ga0157369_10133284 | |||
| 1989 | Ga0157369_10334466 | |||
| 1990 | Ga0157369_10498472 | |||
| 1991 | Ga0157369_10505552 | |||
| 1992 | Ga0157374_10019278 | |||
| 1993 | Ga0157374_10026832 | |||
| 1994 | Ga0157374_10066182 | |||
| 1995 | Ga0157374_10298195 | |||
| 1996 | Ga0157378_10031236 | |||
| 1997 | Ga0157378_10218287 | |||
| 1998 | Ga0157378_10431301 | |||
| 1999 | Ga0163162_10044547 | |||
| 2000 | Ga0163162_10129391 | |||
| 2001 | Ga0163162_10206375 | |||
| 2002 | Ga0157372_10170357 | |||
| 2003 | Ga0157375_10174025 | |||
| 2004 | Ga0157375_10404171 | |||
| 2005 | Ga0157375_10436627 | |||
| 2006 | Ga0163163_10006414 | |||
| 2007 | Ga0163163_10057665 | |||
| 2008 | Ga0163163_10073225 | |||
| 2009 | Ga0163163_10264222 | |||
| 2010 | Ga0157380_10109465 | |||
| 2011 | Ga0157380_10157219 | |||
| 2012 | Ga0157377_10133299 | |||
| 2013 | Ga0157379_10120147 | |||
| 2014 | Ga0157379_10148040 | |||
| 2015 | Ga0157379_10547290 | |||
| 2016 | Ga0157376_10046724 | |||
| 2017 | Ga0157376_10139890 | |||
| 2018 | Ga0157376_10337041 | |||
| 2019 | Ga0163161_10313078 | |||
| 2020 | Ga0206356_10252712 | |||
| 2021 | Ga0206353_10542281 | |||
| 2022 | Ga0214544_1000005 | |||
| 2023 | Ga0214542_1000004 | |||
| 2024 | Ga0214545_1000005 | |||
| 2025 | Ga0214543_1000111 | |||
| 2026 | Ga0213872_10128081 | |||
| 2027 | Ga0213874_10008955 | |||
| 2028 | Ga0213876_10001491 | |||
| 2029 | Ga0213876_10100607 | |||
| 2030 | Ga0213875_10000011 | |||
| 2031 | Ga0209563_102320 | |||
| 2032 | Ga0207425_1011133 | |||
| 2033 | Ga0209677_101639 | |||
| 2034 | Ga0209677_102591 | |||
| 2035 | Ga0209148_1000235 | |||
| 2036 | Ga0209233_1000694 | |||
| 2037 | Ga0209233_1004340 | |||
| 2038 | Ga0209233_1015229 | |||
| 2039 | Ga0209233_1017519 | |||
| 2040 | Ga0209455_1000637 | |||
| 2041 | Ga0209455_1001472 | |||
| 2042 | Ga0209455_1001710 | |||
| 2043 | Ga0209564_1006563 | |||
| 2044 | Ga0209564_1029711 | |||
| 2045 | Ga0209758_1000102 | |||
| 2046 | Ga0209758_1000680 | |||
| 2047 | Ga0209758_1001266 | |||
| 2048 | Ga0209758_1002859 | |||
| 2049 | Ga0209758_1003592 | |||
| 2050 | Ga0209758_1003725 | |||
| 2051 | Ga0209758_1005478 | |||
| 2052 | Ga0209758_1008851 | |||
| 2053 | Ga0209758_1033809 | |||
| 2054 | Ga0209758_1062345 | |||
| 2055 | Ga0209256_1004953 | |||
| 2056 | Ga0209256_1022780 | |||
| 2057 | Ga0207426_1000532 | |||
| 2058 | Ga0207426_1001761 | |||
| 2059 | Ga0207426_1024324 | |||
| 2060 | Ga0207426_1027105 | |||
| 2061 | Ga0209051_1081854 | |||
| 2062 | Ga0209257_1003378 | |||
| 2063 | Ga0209257_1036799 | |||
| 2064 | Ga0207656_10009313 | |||
| 2065 | Ga0207656_10035763 | |||
| 2066 | Ga0207656_10203137 | |||
| 2067 | Ga0207682_10055865 | |||
| 2068 | Ga0207692_10004617 | |||
| 2069 | Ga0207692_10008895 | |||
| 2070 | Ga0207692_10044255 | |||
| 2071 | Ga0207642_10020324 | |||
| 2072 | Ga0207710_10010195 | |||
| 2073 | Ga0207688_10019383 | |||
| 2074 | Ga0207688_10094246 | |||
| 2075 | Ga0207680_10169761 | |||
| 2076 | Ga0207647_10001253 | |||
| 2077 | Ga0207647_10011423 | |||
| 2078 | Ga0207685_10049121 | |||
| 2079 | Ga0207685_10109283 | |||
| 2080 | Ga0207685_10120325 | |||
| 2081 | Ga0207685_10312104 | |||
| 2082 | Ga0207699_10000886 | |||
| 2083 | Ga0207699_10002476 | |||
| 2084 | Ga0207699_10017538 | |||
| 2085 | Ga0207699_10034416 | |||
| 2086 | Ga0207699_10036391 | |||
| 2087 | Ga0207645_10255310 | |||
| 2088 | Ga0207643_10092234 | |||
| 2089 | Ga0207705_10192989 | |||
| 2090 | Ga0207705_10342863 | |||
| 2091 | Ga0207654_10000446 | |||
| 2092 | Ga0207654_10093238 | |||
| 2093 | Ga0207654_10097462 | |||
| 2094 | Ga0207654_10234412 | |||
| 2095 | Ga0207707_10001016 | |||
| 2096 | Ga0207707_10011000 | |||
| 2097 | Ga0207707_10019818 | |||
| 2098 | Ga0207695_10000006 | |||
| 2099 | Ga0207695_10001480 | |||
| 2100 | Ga0207695_10007711 | |||
| 2101 | Ga0207695_10109077 | |||
| 2102 | Ga0207695_10234230 | |||
| 2103 | Ga0207695_10278423 | |||
| 2104 | Ga0207671_10023100 | |||
| 2105 | Ga0207671_10026440 | |||
| 2106 | Ga0207671_10119378 | |||
| 2107 | Ga0207671_10124980 | |||
| 2108 | Ga0207671_10388054 | |||
| 2109 | Ga0207693_10009325 | |||
| 2110 | Ga0207693_10017747 | |||
| 2111 | Ga0207693_10089742 | |||
| 2112 | Ga0207693_10114318 | |||
| 2113 | Ga0207663_10000175 | |||
| 2114 | Ga0207663_10006211 | |||
| 2115 | Ga0207663_10025502 | |||
| 2116 | Ga0207663_10066321 | |||
| 2117 | Ga0207660_10000924 | |||
| 2118 | Ga0207660_10030322 | |||
| 2119 | Ga0207660_10047947 | |||
| 2120 | Ga0207657_10001391 | |||
| 2121 | Ga0207657_10005387 | |||
| 2122 | Ga0207657_10093424 | |||
| 2123 | Ga0207657_10299202 | |||
| 2124 | Ga0207657_10513144 | |||
| 2125 | Ga0207649_10337619 | |||
| 2126 | Ga0207652_10003893 | |||
| 2127 | Ga0207652_10025815 | |||
| 2128 | Ga0207652_10158337 | |||
| 2129 | Ga0207646_10247409 | |||
| 2130 | Ga0207646_10261644 | |||
| 2131 | Ga0207694_10000136 | |||
| 2132 | Ga0207694_10017893 | |||
| 2133 | Ga0207694_10030192 | |||
| 2134 | Ga0207694_10177989 | |||
| 2135 | Ga0207694_10264468 | |||
| 2136 | Ga0207650_10245228 | |||
| 2137 | Ga0207659_10306420 | |||
| 2138 | Ga0207659_10479667 | |||
| 2139 | Ga0207687_10021012 | |||
| 2140 | Ga0207687_10287346 | |||
| 2141 | Ga0207700_10010911 | |||
| 2142 | Ga0207700_10105626 | |||
| 2143 | Ga0207700_10258635 | |||
| 2144 | Ga0207700_10303157 | |||
| 2145 | Ga0207700_10456751 | |||
| 2146 | Ga0207700_10545000 | |||
| 2147 | Ga0207700_10697227 | |||
| 2148 | Ga0207700_10874417 | |||
| 2149 | Ga0207664_10059318 | |||
| 2150 | Ga0207664_10167671 | |||
| 2151 | Ga0207664_10257075 | |||
| 2152 | Ga0207644_10033155 | |||
| 2153 | Ga0207644_10175774 | |||
| 2154 | Ga0207644_10201610 | |||
| 2155 | Ga0207644_10528968 | |||
| 2156 | Ga0207690_10249924 | |||
| 2157 | Ga0207706_10020636 | |||
| 2158 | Ga0207706_10284054 | |||
| 2159 | Ga0207706_10467045 | |||
| 2160 | Ga0207709_10041130 | |||
| 2161 | Ga0207669_10007035 | |||
| 2162 | Ga0207704_10069991 | |||
| 2163 | Ga0207665_10000525 | |||
| 2164 | Ga0207665_10004656 | |||
| 2165 | Ga0207665_10091265 | |||
| 2166 | Ga0207665_10159842 | |||
| 2167 | Ga0207691_10388593 | |||
| 2168 | Ga0207691_10486764 | |||
| 2169 | Ga0207689_10166013 | |||
| 2170 | Ga0207689_10177802 | |||
| 2171 | Ga0207689_10184753 | |||
| 2172 | Ga0207689_10510341 | |||
| 2173 | Ga0207679_10266933 | |||
| 2174 | Ga0207679_10619382 | |||
| 2175 | Ga0207667_10011614 | |||
| 2176 | Ga0207667_10032595 | |||
| 2177 | Ga0207667_10039623 | |||
| 2178 | Ga0207667_10050380 | |||
| 2179 | Ga0207667_10101111 | |||
| 2180 | Ga0207667_10108706 | |||
| 2181 | Ga0207667_10217185 | |||
| 2182 | Ga0207667_10223458 | |||
| 2183 | Ga0207667_10320854 | |||
| 2184 | Ga0207667_10321844 | |||
| 2185 | Ga0207667_10323219 | |||
| 2186 | Ga0207667_10755816 | |||
| 2187 | Ga0207712_10433236 | |||
| 2188 | Ga0207712_10616914 | |||
| 2189 | Ga0207668_10008217 | |||
| 2190 | Ga0207668_10231719 | |||
| 2191 | Ga0207668_10489503 | |||
| 2192 | Ga0207668_10529886 | |||
| 2193 | Ga0207640_10021128 | |||
| 2194 | Ga0207640_10072615 | |||
| 2195 | Ga0207640_10396898 | |||
| 2196 | Ga0207640_10451005 | |||
| 2197 | Ga0207677_10249345 | |||
| 2198 | Ga0207703_10411871 | |||
| 2199 | Ga0207703_10745373 | |||
| 2200 | Ga0207703_10976071 | |||
| 2201 | Ga0207639_10022760 | |||
| 2202 | Ga0207639_10030927 | |||
| 2203 | Ga0207639_10036177 | |||
| 2204 | Ga0207639_10050493 | |||
| 2205 | Ga0207639_10098940 | |||
| 2206 | Ga0207639_10249569 | |||
| 2207 | Ga0207639_10337264 | |||
| 2208 | Ga0207678_10004216 | |||
| 2209 | Ga0207678_10025952 | |||
| 2210 | Ga0207678_10089469 | |||
| 2211 | Ga0207678_10099974 | |||
| 2212 | Ga0207678_10123758 | |||
| 2213 | Ga0207678_10139654 | |||
| 2214 | Ga0207678_10185063 | |||
| 2215 | Ga0207678_10209000 | |||
| 2216 | Ga0207678_10227790 | |||
| 2217 | Ga0207678_10268443 | |||
| 2218 | Ga0207678_10268919 | |||
| 2219 | Ga0207708_10049842 | |||
| 2220 | Ga0207702_10000006 | |||
| 2221 | Ga0207702_10002502 | |||
| 2222 | Ga0207702_10013602 | |||
| 2223 | Ga0207702_10068824 | |||
| 2224 | Ga0207702_10229418 | |||
| 2225 | Ga0207702_10549620 | |||
| 2226 | Ga0207641_10214620 | |||
| 2227 | Ga0207648_10097170 | |||
| 2228 | Ga0207648_10319147 | |||
| 2229 | Ga0207648_10632539 | |||
| 2230 | Ga0207676_10096351 | |||
| 2231 | Ga0207674_10012767 | |||
| 2232 | Ga0207674_10016173 | |||
| 2233 | Ga0207674_10037575 | |||
| 2234 | Ga0207674_10091381 | |||
| 2235 | Ga0207674_10204650 | |||
| 2236 | Ga0207674_10408732 | |||
| 2237 | Ga0207674_10419599 | |||
| 2238 | Ga0207675_100049241 | |||
| 2239 | Ga0207675_100251674 | |||
| 2240 | Ga0207675_100354455 | |||
| 2241 | Ga0207675_100687606 | |||
| 2242 | Ga0207683_10029544 | |||
| 2243 | Ga0207683_10827300 | |||
| 2244 | Ga0207698_10086637 | |||
| 2245 | Ga0207698_10347583 | |||
| 2246 | Ga0207698_10458031 | |||
| 2247 | Ga0207698_10520704 | |||
| 2248 | Ga0207698_10559721 | |||
| 2249 | Ga0209389_1000021 | |||
| 2250 | Ga0209389_1000120 | |||
| 2251 | Ga0209589_1000005 | |||
| 2252 | Ga0209589_1000027 | |||
| 2253 | Ga0209489_100005 | |||
| 2254 | Ga0209489_100023 | |||
| 2255 | Ga0209489_100742 | |||
| 2256 | Ga0209700_100006 | |||
| 2257 | Ga0209700_100134 | |||
| 2258 | Ga0209813_10050531 | |||
| 2259 | Ga0268266_10001136 | |||
| 2260 | Ga0268266_10003686 | |||
| 2261 | Ga0268266_10031172 | |||
| 2262 | Ga0268266_10094515 | |||
| 2263 | Ga0268266_10212623 | |||
| 2264 | Ga0268266_10367028 | |||
| 2265 | Ga0268266_10535896 | |||
| 2266 | Ga0268265_10124640 | |||
| 2267 | Ga0268265_10271215 | |||
| 2268 | Ga0268264_10000185 | |||
| 2269 | Ga0268264_10233636 | |||
| 2270 | Ga0268264_10270804 | |||
| 2271 | Ga0268264_10557854 | |||
| 2272 | Ga0265323_10047489 | |||
| 2273 | Ga0265336_10000415 | |||
| 2274 | Ga0307517_10000098 | |||
| 2275 | Ga0307515_10104075 | |||
| 2276 | Ga0307515_10378216 | |||
| 2277 | Ga0307511_10050282 | |||
| 2278 | Ga0307511_10112612 | |||
| 2279 | Ga0265763_1002394 | |||
| 2280 | Ga0265330_10022841 | |||
| 2281 | Ga0265330_10070540 | |||
| 2282 | Ga0265330_10102798 | |||
| 2283 | Ga0265332_10115012 | |||
| 2284 | Ga0265325_10030068 | |||
| 2285 | Ga0265329_10087994 | |||
| 2286 | Ga0265340_10006734 | |||
| 2287 | Ga0265339_10000906 | |||
| 2288 | Ga0265316_10167245 | |||
| 2289 | Ga0307513_10014560 | |||
| 2290 | Ga0307513_10379211 | |||
| 2291 | Ga0307509_10043196 | |||
| 2292 | Ga0307509_10123960 | |||
| 2293 | Ga0307509_10128015 | |||
| 2294 | Ga0307509_10180048 | |||
| 2295 | Ga0307509_10232256 | |||
| 2296 | Ga0307509_10295143 | |||
| 2297 | Ga0307408_100678065 | |||
| 2298 | Ga0307508_10000012 | |||
| 2299 | Ga0307508_10205567 | |||
| 2300 | Ga0307508_10331970 | |||
| 2301 | Ga0265314_10014193 | |||
| 2302 | Ga0265314_10028062 | |||
| 2303 | Ga0265314_10149051 | |||
| 2304 | Ga0265314_10278961 | |||
| 2305 | Ga0265342_10003016 | |||
| 2306 | Ga0307516_10008865 | |||
| 2307 | Ga0307516_10277261 | |||
| 2308 | Ga0307516_10355841 | |||
| 2309 | Ga0307405_10059833 | |||
| 2310 | Ga0307410_10251268 | |||
| 2311 | Ga0307410_10422215 | |||
| 2312 | Ga0307406_10302548 | |||
| 2313 | Ga0307406_10600384 | |||
| 2314 | Ga0307412_10076186 | |||
| 2315 | Ga0307412_10176842 | |||
| 2316 | Ga0307409_100168169 | |||
| 2317 | Ga0307414_10445796 | |||
| 2318 | Ga0307414_10921453 | |||
| 2319 | Ga0307411_10076739 | |||
| 2320 | Ga0307411_10167068 | |||
| 2321 | Ga0307411_10695831 | |||
| 2322 | Ga0307415_100042705 | |||
| 2323 | Ga0307507_10160269 | |||
| 2324 | Ga0307510_10007562 | |||
| 2325 | Ga0307510_10066813 | |||
| 2326 | Ga0307510_10101326 | |||
| 2327 | Ga0307510_10194593 | |||
| 2328 | Ga0315911_1000005 | |||
| 2329 | Ga0316215_1001897 | |||
| 2330 | Ga0373958_0013101 | |||
| 2331 | Ga0373926_0125648 | |||
| 2332 | Ga0373929_0044211 | |||
| 2333 | Ga0373944_0090449 | |||
| 2334 | Ga0373944_0105147 | |||
| 2335 | Ga0373951_0044318 | |||
| 2336 | Ga0373952_0052584 | |||
| 2337 | Ga0373923_0001382 | |||
| 2338 | Ga0373923_0002101 | |||
| 2339 | Ga0373923_0148183 | |||
| 2340 | Ga0373936_0043384 | |||
| 2341 | Ga0373936_0052240 | |||
| 2342 | Ga0373936_0138144 | |||
| 2343 | Ga0373941_0041926 | |||
| 2344 | Ga0373953_0000985 | |||
| 2345 | Ga0373953_0004518 | |||
| 2346 | Ga0373953_0250028 | |||
| 2347 | Ga0373954_0001160 | |||
| 2348 | Ga0373954_0003164 | |||
| 2349 | Ga0373954_0004646 | |||
| 2350 | Ga0373954_0271664 | |||
| 2351 | Ga0373956_0001463 | |||
| 2352 | Ga0373956_0032250 | |||
| 2353 | Ga0373956_0058883 | |||
| 2354 | Ga0373957_0010109 | |||
| 2355 | Ga0373957_0015715 | |||
| 2356 | Ga0373957_0166333 | |||
| 2357 | Ga0373960_0006254 | |||
| 2358 | Ga0373943_0020170 | |||
| 2359 | Ga0373943_0121755 | |||
| 2360 | Ga0373943_0261882 | |||
| 2361 | Ga0373946_0013105 | |||
| 2362 | Ga0373946_0159688 | |||
| 2363 | Ga0373955_0001372 | |||
| 2364 | Ga0373955_0012729 | |||
| 2365 | Ga0373955_0022165 | |||
| 2366 | Ga0373942_0014531 | |||
| 2367 | Ga0373942_0054265 | |||
| 2368 | Ga0373961_0026944 | |||
| 2369 | Ga0373962_0044737 | |||
| 2370 | Ga0373924_0018660 | |||
| 2371 | Ga0373924_0027315 | |||
| 2372 | Ga0373924_0076217 | |||
| 2373 | Ga0373931_0001100 | |||
| 2374 | Ga0373931_0003428 | |||
| 2375 | Ga0373931_0211512 | |||
| 2376 | Ga0373935_0000520 | |||
| 2377 | Ga0373935_0097809 | |||
| 2378 | Ga0373935_0127371 | |||
| 2379 | Ga0373935_0247709 | |||
| 2380 | Ga0373935_0312586 | |||
| 2381 | Ga0373935_0340452 | |||
| 2382 | Ga0373927_0000046 | |||
| 2383 | Ga0373927_0005938 | |||
| 2384 | Ga0373927_0009305 | |||
| 2385 | Ga0373927_0015109 | |||
| 2386 | Ga0373927_0039246 | |||
| 2387 | Ga0373927_0155395 | |||
| 2388 | Ga0373933_0000026 | |||
| 2389 | Ga0373933_0006390 | |||
| 2390 | Ga0373933_0017205 | |||
| 2391 | Ga0373933_0028682 | |||
| 2392 | Ga0373933_0073161 | |||
| 2393 | Ga0373947_0001392 | |||
| 2394 | Ga0373947_0002439 | |||
| 2395 | Ga0373947_0052793 | |||
| 2396 | Ga0373947_0303254 | |||
| 2397 | Ga0373937_0016441 | |||
| 2398 | Ga0373937_0048844 | |||
| 2399 | Ga0373937_0112764 | |||
| 2400 | Ga0373937_0168370 | |||
| 2401 | Ga0373937_0376743 | |||
| 2402 | Ga0372808_008862 | |||
| 2403 | Ga0373925_0009905 | |||
| 2404 | Ga0373925_0013452 | |||
| 2405 | Ga0373925_0062764 | |||
| 2406 | Ga0373925_0134813 | |||
| 2407 | Ga0395900_0016187 | |||
| 2408 | Ga0395900_0020667 | |||
| 2409 | Ga0395900_0032079 | |||
| 2410 | Ga0395900_0174183 | |||
| 2411 | Ga0395900_0179879 | |||
| 2412 | Ga0395898_0035872 | |||
| 2413 | Ga0395898_0270372 | |||
| 2414 | Ga0395898_0409137 | |||
| 2415 | Ga0395905_0025920 | |||
| 2416 | Ga0395905_0081275 | |||
| 2417 | Ga0395905_0081461 | |||
| 2418 | Ga0436364_0224834 | |||
| 2419 | Ga0436364_0328296 | |||
| 2420 | Ga0436364_0796332 | |||
| 2421 | Ga0436364_1001125 | |||
| 2422 | Ga0436364_1109971 | |||
| 2423 | Ga0395901_0050817 | |||
| 2424 | Ga0395901_0178216 | |||
| 2425 | Ga0436365_0221110 | |||
| 2426 | Ga0436365_0600630 | |||
| 2427 | Ga0436365_0709391 | |||
| 2428 | Ga0436365_0921625 | |||
| 2429 | Ga0436365_0939476 | |||
| 2430 | Ga0436365_1231387 | |||
| 2431 | Ga0436365_1846147 | |||
| 2432 | Ga0436360_0159371 | |||
| 2433 | Ga0436361_0298970 | |||
| 2434 | Ga0436361_0873949 | |||
| 2435 | Ga0436361_1011559 | |||
| 2436 | Ga0436363_0355443 | |||
| 2437 | Ga0436363_0468710 | |||
| 2438 | Ga0436363_0615662 | |||
| 2439 | Ga0436363_0726412 | |||
| 2440 | Ga0436363_1594013 | |||
| 2441 | Ga0436362_0496995 | |||
| 2442 | Ga0436362_0763354 | |||
| 2443 | Ga0436362_0804184 | |||
| 2444 | Ga0439465_0039024 | |||
| 2445 | Ga0451802_0319345 | |||
| 2446 | Ga0451851_0100858 | |||
| 2447 | Ga0451853_2272543 | |||
| 2448 | Ga0439463_029581 | |||
| 2449 | Ga0439464_0074624 | |||
| 2450 | Ga0466969_0037230 | |||
| 2451 | Ga0466972_0000126 | |||
| 2452 | Ga0466972_0013988 | |||
| 2453 | Ga0466966_0001157 | |||
| 2454 | Ga0466966_0339054 | |||
| 2455 | Ga0466961_0000025 | |||
| 2456 | Ga0466963_0031093 | |||
| 2457 | Ga0466963_0138053 | |||
| 2458 | Ga0466964_0024242 | |||
| 2459 | Ga0466964_0054150 | |||
| 2460 | Ga0466964_0245229 | |||
| 2461 | Ga0466968_0003372 | |||
| 2462 | Ga0466968_0157046 | |||
| 2463 | Ga0466957_0057047 | |||
| 2464 | Ga0466960_0008649 | |||
| 2465 | Ga0466959_0000873 | |||
| 2466 | Ga0466967_0130167 | |||
| 2467 | Ga0466967_0192733 | |||
| 2468 | Ga0466967_0497597 | |||
| 2469 | Ga0466967_0783637 | |||
| 2470 | Ga0495617_007122 | |||
| 2471 | Ga0495617_033379 | |||
| 2472 | Ga0495592_0001238 | |||
| 2473 | Ga0495592_0071092 | |||
| 2474 | Ga0495592_0136576 | |||
| 2475 | Ga0495592_0171163 | |||
| 2476 | Ga0495592_0293095 | |||
| 2477 | Ga0495592_0296046 | |||
| 2478 | Ga0495603_0000051 | |||
| 2479 | Ga0495603_0043229 | |||
| 2480 | Ga0495603_0074766 | |||
| 2481 | Ga0495603_0203339 | |||
| 2482 | Ga0495603_0236613 | |||
| 2483 | Ga0495629_0000182 | |||
| 2484 | Ga0495629_0000750 | |||
| 2485 | Ga0495629_0006753 | |||
| 2486 | Ga0495638_0003938 | |||
| 2487 | Ga0495638_0021430 | |||
| 2488 | Ga0495638_0311579 | |||
| 2489 | Ga0495641_0006374 | |||
| 2490 | Ga0495651_0015643 | |||
| 2491 | Ga0495651_0019393 | |||
| 2492 | Ga0495651_0047283 | |||
| 2493 | Ga0495653_0014575 | |||
| 2494 | Ga0495653_0065346 | |||
| 2495 | Ga0495653_0193226 | |||
| 2496 | Ga0495653_0241395 | |||
| 2497 | Ga0495580_0004021 | |||
| 2498 | Ga0495580_0012063 | |||
| 2499 | Ga0495580_0214672 | |||
| 2500 | Ga0495582_0000137 | |||
| 2501 | Ga0495582_0157604 | |||
| 2502 | Ga0495582_0172306 | |||
| 2503 | Ga0495582_0269021 | |||
| 2504 | Ga0495605_0073209 | |||
| 2505 | Ga0495605_0207331 | |||
| 2506 | Ga0495639_0002873 | |||
| 2507 | Ga0495639_0050090 | |||
| 2508 | Ga0495639_0072703 | |||
| 2509 | Ga0495639_0308456 | |||
| 2510 | Ga0495662_0000583 | |||
| 2511 | Ga0495662_0121487 | |||
| 2512 | Ga0495662_0160899 | |||
| 2513 | Ga0495662_0244340 | |||
| 2514 | Ga0495664_0009075 | |||
| 2515 | Ga0495664_0028765 | |||
| 2516 | Ga0495664_0055529 | |||
| 2517 | Ga0495664_0095702 | |||
| 2518 | Ga0495664_0098986 | |||
| 2519 | Ga0495664_0338305 | |||
| 2520 | Ga0495664_0378697 | |||
| 2521 | Ga0495584_0024795 | |||
| 2522 | Ga0495584_0047078 | |||
| 2523 | Ga0495584_0197946 | |||
| 2524 | Ga0495585_0029073 | |||
| 2525 | Ga0495585_0202481 | |||
| 2526 | Ga0495594_0001833 | |||
| 2527 | Ga0495594_0042613 | |||
| 2528 | Ga0495594_0049922 | |||
| 2529 | Ga0495594_0176874 | |||
| 2530 | Ga0495594_0332935 | |||
| 2531 | Ga0495596_0059130 | |||
| 2532 | Ga0495583_0025223 | |||
| 2533 | Ga0495606_0001505 | |||
| 2534 | Ga0495606_0012177 | |||
| 2535 | Ga0495606_0064028 | |||
| 2536 | Ga0495606_0176508 | |||
| 2537 | Ga0495606_0281926 | |||
| 2538 | Ga0495608_0000738 | |||
| 2539 | Ga0495608_0060188 | |||
| 2540 | Ga0495608_0066723 | |||
| 2541 | Ga0495610_0089149 | |||
| 2542 | Ga0495616_0104198 | |||
| 2543 | Ga0495616_0116693 | |||
| 2544 | Ga0495616_0179280 | |||
| 2545 | Ga0495618_0012424 | |||
| 2546 | Ga0495618_0075980 | |||
| 2547 | Ga0495618_0240434 | |||
| 2548 | Ga0495620_0084717 | |||
| 2549 | Ga0495620_0121754 | |||
| 2550 | Ga0495628_0021321 | |||
| 2551 | Ga0495628_0033413 | |||
| 2552 | Ga0495628_0034008 | |||
| 2553 | Ga0495628_0259219 | |||
| 2554 | Ga0495630_0002625 | |||
| 2555 | Ga0495630_0062540 | |||
| 2556 | Ga0495631_0015803 | |||
| 2557 | Ga0495632_0094535 | |||
| 2558 | Ga0495632_0127013 | |||
| 2559 | Ga0495637_0165966 | |||
| 2560 | Ga0495643_0012291 | |||
| 2561 | Ga0495643_0049687 | |||
| 2562 | Ga0495644_0052273 | |||
| 2563 | Ga0495648_0001119 | |||
| 2564 | Ga0495648_0093465 | |||
| 2565 | Ga0495648_0138167 | |||
| 2566 | Ga0495648_0143187 | |||
| 2567 | Ga0495648_0204372 | |||
| 2568 | Ga0495666_0035675 | |||
| 2569 | Ga0495642_0132019 | |||
| 2570 | Ga0495652_0004125 | |||
| 2571 | Ga0495652_0035614 | |||
| 2572 | Ga0495652_0037670 | |||
| 2573 | Ga0495652_0041725 | |||
| 2574 | Ga0495652_0119701 | |||
| 2575 | Ga0495652_0187308 | |||
| 2576 | Ga0495652_0384571 | |||
| 2577 | Ga0495665_0001239 | |||
| 2578 | Ga0495665_0020494 | |||
| 2579 | Ga0495640_0011216 | |||
| 2580 | Ga0495640_0041782 | |||
| 2581 | Ga0495640_0055752 | |||
| 2582 | Ga0495640_0071490 | |||
| 2583 | Ga0495640_0132243 | |||
| 2584 | Ga0495586_0037182 | |||
| 2585 | Ga0495587_0012212 | |||
| 2586 | Ga0495587_0070475 | |||
| 2587 | Ga0495587_0115572 | |||
| 2588 | Ga0495598_0079149 | |||
| 2589 | Ga0495609_0028259 | |||
| 2590 | Ga0495621_0018971 | |||
| 2591 | Ga0495597_0033416 | |||
| 2592 | Ga0495645_0025912 | |||
| 2593 | Ga0495645_0066982 | |||
| 2594 | Ga0495622_0005490 | |||
| 2595 | Ga0495622_0016785 | |||
| 2596 | Ga0495633_0053651 | |||
| 2597 | Ga0495633_0179924 | |||
| 2598 | Ga0495667_0067100 | |||
| 2599 | Ga0495667_0112302 | |||
| 2600 | Ga0495667_0187630 | |||
| 2601 | Ga0495667_0428145 | |||
| 2602 | Ga0495656_0084365 | |||
| 2603 | Ga0495668_0026683 | |||
| 2604 | Ga0495668_0029734 | |||
| 2605 | Ga0495668_0082172 | |||
| 2606 | Ga0495634_0002221 | |||
| 2607 | Ga0495634_0018650 | |||
| 2608 | Ga0495634_0025310 | |||
| 2609 | Ga0495634_0037628 | |||
| 2610 | Ga0495634_0109829 | |||
| 2611 | Ga0495611_0043715 | |||
| 2612 | Ga0495625_0058534 | |||
| 2613 | Ga0495625_0380108 | |||
| 2614 | Ga0495635_0000166 | |||
| 2615 | Ga0495635_0001455 | |||
| 2616 | Ga0495635_0001614 | |||
| 2617 | Ga0495635_0021252 | |||
| 2618 | Ga0495635_0116182 | |||
| 2619 | Ga0495659_0095246 | |||
| 2620 | Ga0495659_0121847 | |||
| 2621 | Ga0495661_0258832 | |||
| 2622 | Ga0495588_0007336 | |||
| 2623 | Ga0495588_0046469 | |||
| 2624 | Ga0495588_0110523 | |||
| 2625 | Ga0495657_0004131 | |||
| 2626 | Ga0495657_0007196 | |||
| 2627 | Ga0495657_0018249 | |||
| 2628 | Ga0495657_0147798 | |||
| 2629 | Ga0495657_0203447 | |||
| 2630 | Ga0495599_0004838 | |||
| 2631 | Ga0495599_0005025 | |||
| 2632 | Ga0495599_0012226 | |||
| 2633 | Ga0495599_0188922 | |||
| 2634 | Ga0495599_0205758 | |||
| 2635 | Ga0495599_0362565 | |||
| 2636 | Ga0495623_0002267 | |||
| 2637 | Ga0495623_0188426 | |||
| 2638 | Ga0495646_0019980 | |||
| 2639 | Ga0495646_0020107 | |||
| 2640 | Ga0495646_0060132 | |||
| 2641 | Ga0495646_0067140 | |||
| 2642 | Ga0495646_0148533 | |||
| 2643 | Ga0495647_0032438 | |||
| 2644 | Ga0495647_0071742 | |||
| 2645 | Ga0495658_0008017 | |||
| 2646 | Ga0495658_0074828 | |||
| 2647 | Ga0495658_0112303 | |||
| 2648 | Ga0495658_0396400 | |||
| 2649 | Ga0495669_0061491 | |||
| 2650 | Ga0495669_0108830 | |||
| 2651 | Ga0495669_0136339 | |||
| 2652 | Ga0495613_0047965 | |||
| 2653 | Ga0495613_0114323 | |||
| 2654 | Ga0495613_0132297 | |||
| 2655 | Ga0495613_0196387 | |||
| 2656 | Ga0495613_0273679 | |||
| 2657 | Ga0495624_0000898 | |||
| 2658 | Ga0495624_0018283 | |||
| 2659 | Ga0495624_0048677 | |||
| 2660 | Ga0495624_0085390 | |||
| 2661 | Ga0495671_0161490 | |||
| 2662 | Ga0495649_0011337 | |||
| 2663 | Ga0495649_0146140 | |||
| 2664 | Ga0495589_0117431 | |||
| 2665 | Ga0495600_0008000 | |||
| 2666 | Ga0495600_0011474 | |||
| 2667 | Ga0495600_0035461 | |||
| 2668 | Ga0495600_0035500 | |||
| 2669 | Ga0495600_0067086 | |||
| 2670 | Ga0495581_0007805 | |||
| 2671 | Ga0495581_0035924 | |||
| 2672 | Ga0495581_0070797 | |||
| 2673 | Ga0495581_0081158 | |||
| 2674 | Ga0495581_0099714 | |||
| 2675 | Ga0495604_0025793 | |||
| 2676 | Ga0495604_0047644 | |||
| 2677 | Ga0495604_0225347 | |||
| 2678 | Ga0495604_0435960 | |||
| 2679 | Ga0495674_0010092 | |||
| 2680 | Ga0495674_0011184 | |||
| 2681 | Ga0495674_0046482 | |||
| 2682 | Ga0495674_0597790 | |||
| 2683 | Ga0495672_0024126 | |||
| 2684 | Ga0495672_0092467 | |||
| 2685 | Ga0495672_0178904 | |||
| 2686 | Ga0495676_0031814 | |||
| 2687 | Ga0495676_0203301 | |||
| 2688 | Ga0495676_0240363 | |||
| 2689 | Ga0495680_0003456 | |||
| 2690 | Ga0495680_0016657 | |||
| 2691 | Ga0495683_0185020 | |||
| 2692 | Ga0495687_040167 | |||
| 2693 | Ga0495675_0062655 | |||
| 2694 | Ga0495677_0052671 | |||
| 2695 | Ga0495685_059934 | |||
| 2696 | Ga0495673_0022298 | |||
| 2697 | Ga0495681_0102971 | |||
| 2698 | Ga0495684_0007715 | |||
| 2699 | Ga0495684_0064967 | |||
| 2700 | Ga0495684_0074579 | |||
| 2701 | Ga0495684_0083133 | |||
| 2702 | Ga0495686_0033518 | |||
| 2703 | Ga0495686_0127118 | |||
| 2704 | Ga0495593_0000469 | |||
| 2705 | Ga0495593_0006819 | |||
| 2706 | Ga0495593_0023148 | |||
| 2707 | Ga0495593_0041675 | |||
| 2708 | Ga0495593_0130701 | |||
| 2709 | Ga0495602_0009739 | |||
| 2710 | Ga0495615_0063028 | |||
| 2711 | Ga0496100_0001098 | |||
| 2712 | Ga0496100_0126913 | |||
| 2713 | Ga0496100_0220574 | |||
| 2714 | Ga0496100_0342189 | |||
| 2715 | Ga0496101_0011608 | |||
| 2716 | Ga0496101_0205467 | |||
| 2717 | Ga0496102_0008520 | |||
| 2718 | Ga0496102_0092154 | |||
| 2719 | Ga0496102_0195455 | |||
| 2720 | Ga0496102_0240520 | |||
| 2721 | Ga0496102_0649090 | |||
| 2722 | Ga0496103_0037555 | |||
| 2723 | Ga0496103_0280311 | |||
| 2724 | Ga0496104_0015075 | |||
| 2725 | Ga0496104_0026734 | |||
| 2726 | Ga0496104_0036163 | |||
| 2727 | Ga0496104_0037264 | |||
| 2728 | Ga0496104_0097220 | |||
| 2729 | Ga0496104_0208151 | |||
| 2730 | Ga0496104_0356829 | |||
| 2731 | Ga0496104_0396442 | |||
| 2732 | Ga0496104_0592513 | |||
| 2733 | Ga0496105_0000208 | |||
| 2734 | Ga0496105_0030338 | |||
| 2735 | Ga0496105_0066489 | |||
| 2736 | Ga0496105_0120936 | |||
| 2737 | Ga0496105_0375439 | |||
| 2738 | Ga0496106_0002121 | |||
| 2739 | Ga0496106_0031033 | |||
| 2740 | Ga0496106_0123661 | |||
| 2741 | Ga0496106_0228788 | |||
| 2742 | Ga0496106_0329249 | |||
| 2743 | Ga0496106_0419870 | |||
| 2744 | Ga0496107_0046162 | |||
| 2745 | Ga0496107_0174158 | |||
| 2746 | Ga0496107_0307918 | |||
| 2747 | Ga0496108_0000681 | |||
| 2748 | Ga0496108_0042075 | |||
| 2749 | Ga0496108_0122333 | |||
| 2750 | Ga0496108_0232274 | |||
| 2751 | Ga0496108_0538366 | |||
| 2752 | Ga0496109_0000450 | |||
| 2753 | Ga0496109_0027672 | |||
| 2754 | Ga0496109_0053052 | |||
| 2755 | Ga0496109_0167884 | |||
| 2756 | Ga0496110_0013956 | |||
| 2757 | Ga0496110_0031106 | |||
| 2758 | Ga0496110_0037630 | |||
| 2759 | Ga0496110_0091129 | |||
| 2760 | Ga0496110_0145854 | |||
| 2761 | Ga0496110_0369813 | |||
| 2762 | Ga0496110_0371924 | |||
| 2763 | Ga0496111_0040302 | |||
| 2764 | Ga0496111_0184327 | |||
| 2765 | Ga0496112_0000040 | |||
| 2766 | Ga0496112_0003971 | |||
| 2767 | Ga0496112_0005466 | |||
| 2768 | Ga0496112_0012229 | |||
| 2769 | Ga0496112_0023844 | |||
| 2770 | Ga0496112_0025634 | |||
| 2771 | Ga0496112_0319638 | |||
| 2772 | Ga0496112_0407027 | |||
| 2773 | Ga0496112_0816038 | |||
| 2774 | Ga0496113_0015425 | |||
| 2775 | Ga0496113_0151391 | |||
| 2776 | Ga0496113_0358608 | |||
| 2777 | Ga0496113_0453572 | |||
| 2778 | Ga0496113_0559723 | |||
| 2779 | Ga0496114_0033230 | |||
| 2780 | Ga0496114_0043995 | |||
| 2781 | Ga0496114_0108243 | |||
| 2782 | Ga0496114_0113023 | |||
| 2783 | Ga0496114_0213364 | |||
| 2784 | Ga0496114_0236676 | |||
| 2785 | Ga0496114_0499662 | |||
| 2786 | Ga0496114_0547196 | |||
| 2787 | Ga0496114_0757644 | |||
| 2788 | Ga0496115_0017046 | |||
| 2789 | Ga0496115_0046053 | |||
| 2790 | Ga0496115_0259875 | |||
| 2791 | Ga0496115_0318080 | |||
| 2792 | Ga0496115_0359774 | |||
| 2793 | Ga0496115_0414887 | |||
| 2794 | Ga0496116_0164240 | |||
| 2795 | Ga0496117_0008070 | |||
| 2796 | Ga0496117_0079878 | |||
| 2797 | Ga0496117_0125246 | |||
| 2798 | Ga0496118_0002570 | |||
| 2799 | Ga0496118_0087129 | |||
| 2800 | Ga0496118_0142539 | |||
| 2801 | Ga0496118_0189448 | |||
| 2802 | Ga0496118_0243919 | |||
| 2803 | Ga0496119_0043743 | |||
| 2804 | Ga0496119_0098757 | |||
| 2805 | Ga0496121_0000265 | |||
| 2806 | Ga0496121_0001125 | |||
| 2807 | Ga0496121_0011280 | |||
| 2808 | Ga0496121_0011669 | |||
| 2809 | Ga0496121_0028222 | |||
| 2810 | Ga0496121_0044559 | |||
| 2811 | Ga0496121_0054026 | |||
| 2812 | Ga0496121_0112182 | |||
| 2813 | Ga0496121_0138490 | |||
| 2814 | Ga0496121_0287384 | |||
| 2815 | Ga0496121_0440548 | |||
| 2816 | Ga0496122_0259050 | |||
| 2817 | Ga0496122_0295814 | |||
| 2818 | Ga0496124_0001146 | |||
| 2819 | Ga0496124_0038040 | |||
| 2820 | Ga0496124_0155785 | |||
| 2821 | Ga0496124_0215642 | |||
| 2822 | Ga0496125_0000176 | |||
| 2823 | Ga0496125_0034884 | |||
| 2824 | Ga0496125_0065382 | |||
| 2825 | Ga0496125_0123900 | |||
| 2826 | Ga0496125_0154485 | |||
| 2827 | Ga0496125_0195405 | |||
| 2828 | Ga0496126_0005831 | |||
| 2829 | Ga0496126_0011852 | |||
| 2830 | Ga0496126_0015449 | |||
| 2831 | Ga0496126_0020296 | |||
| 2832 | Ga0496126_0024497 | |||
| 2833 | Ga0496126_0032606 | |||
| 2834 | Ga0496126_0042857 | |||
| 2835 | Ga0496126_0057447 | |||
| 2836 | Ga0496126_0070795 | |||
| 2837 | Ga0496126_0072217 | |||
| 2838 | Ga0496126_0120816 | |||
| 2839 | Ga0496126_0121358 | |||
| 2840 | Ga0496126_0229919 | |||
| 2841 | Ga0496126_0612167 | |||
| 2842 | Ga0495678_084520 | |||
| 2843 | Ga0495682_0018288 | |||
| 2844 | Ga0501031_0001415 | |||
| 2845 | Ga0501032_0003300 | |||
| 2846 | Ga0501032_0034880 | |||
| 2847 | Ga0501032_0047787 | |||
| 2848 | Ga0501032_0067767 | |||
| 2849 | Ga0501032_0128686 | |||
| 2850 | Ga0501033_0000175 | |||
| 2851 | Ga0501033_0000207 | |||
| 2852 | Ga0501033_0023002 | |||
| 2853 | Ga0501033_0060484 | |||
| 2854 | Ga0501033_0219426 | |||
| 2855 | Ga0501033_0407430 | |||
| 2856 | Ga0501034_0000202 | |||
| 2857 | Ga0501034_0052329 | |||
| 2858 | Ga0501034_0079493 | |||
| 2859 | Ga0501034_0129594 | |||
| 2860 | Ga0501034_0178709 | |||
| 2861 | Ga0501034_0594583 | |||
| 2862 | Ga0501034_0595299 | |||
| 2863 | Ga0501034_0723716 | |||
| 2864 | Ga0501036_0000042 | |||
| 2865 | Ga0501036_0106719 | |||
| 2866 | Ga0501036_0117764 | |||
| 2867 | Ga0501036_0503889 | |||
| 2868 | Ga0501037_0000100 | |||
| 2869 | Ga0501037_0000334 | |||
| 2870 | Ga0501037_0212015 | |||
| 2871 | Ga0501037_0273387 | |||
| 2872 | Ga0501038_0000157 | |||
| 2873 | Ga0501038_0043349 | |||
| 2874 | Ga0501038_0085789 | |||
| 2875 | Ga0501038_0205940 | |||
| 2876 | Ga0501039_0000216 | |||
| 2877 | Ga0501039_0007971 | |||
| 2878 | Ga0501039_0011255 | |||
| 2879 | Ga0501039_0298952 | |||
| 2880 | Ga0501040_0083811 | |||
| 2881 | Ga0501042_0044070 | |||
| 2882 | Ga0501042_0053023 | |||
| 2883 | Ga0501042_0083958 | |||
| 2884 | Ga0501043_0001316 | |||
| 2885 | Ga0501043_0040872 | |||
| 2886 | Ga0501043_0050219 | |||
| 2887 | Ga0501043_0387968 | |||
| 2888 | Ga0501046_0000387 | |||
| 2889 | Ga0501046_0101168 | |||
| 2890 | Ga0501046_0137214 | |||
| 2891 | Ga0501047_0000159 | |||
| 2892 | Ga0501047_0006707 | |||
| 2893 | Ga0501047_0154680 | |||
| 2894 | Ga0501047_0389810 | |||
| 2895 | Ga0501047_0432753 | |||
| 2896 | Ga0501048_0000655 | |||
| 2897 | Ga0501048_0197317 | |||
| 2898 | Ga0501067_0011823 | |||
| 2899 | Ga0501067_0022683 | |||
| 2900 | Ga0501068_0000168 | |||
| 2901 | Ga0501068_0004245 | |||
| 2902 | Ga0501068_0103177 | |||
| 2903 | Ga0501069_0002689 | |||
| 2904 | Ga0501069_0025378 | |||
| 2905 | Ga0501069_0100739 | |||
| 2906 | Ga0501070_0002236 | |||
| 2907 | Ga0501070_0004540 | |||
| 2908 | Ga0501070_0024309 | |||
| 2909 | Ga0501070_0070516 | |||
| 2910 | Ga0501070_0357855 | |||
| 2911 | Ga0501071_0072452 | |||
| 2912 | Ga0501071_0203185 | |||
| 2913 | Ga0501072_0000475 | |||
| 2914 | Ga0501072_0307036 | |||
| 2915 | Ga0501073_0000678 | |||
| 2916 | Ga0501073_0021963 | |||
| 2917 | Ga0501073_0046988 | |||
| 2918 | Ga0501073_0232206 | |||
| 2919 | Ga0501073_0510202 | |||
| 2920 | Ga0501074_0001904 | |||
| 2921 | Ga0501074_0004788 | |||
| 2922 | Ga0501075_0380494 | |||
| 2923 | Ga0501076_0399186 | |||
| 2924 | Ga0501076_0517097 | |||
| 2925 | Ga0501079_0006064 | |||
| 2926 | Ga0501079_0013419 | |||
| 2927 | Ga0501080_0004449 | |||
| 2928 | Ga0501080_0005538 | |||
| 2929 | Ga0501080_0108484 | |||
| 2930 | Ga0501080_0649821 | |||
| 2931 | Ga0501081_0135027 | |||
| 2932 | Ga0501083_0001555 | |||
| 2933 | Ga0501083_0227962 | |||
| 2934 | Ga0501035_0000172 | |||
| 2935 | Ga0501035_0089560 | |||
| 2936 | Ga0501035_0211197 | |||
| 2937 | Ga0501035_0254251 | |||
| 2938 | Ga0501035_0425185 | |||
| 2939 | Ga0501035_0511269 | |||
| 2940 | Ga0501044_0000282 | |||
| 2941 | Ga0501044_0017300 | |||
| 2942 | Ga0501044_0027827 | |||
| 2943 | Ga0501044_0046842 | |||
| 2944 | Ga0501044_0052100 | |||
| 2945 | Ga0501044_0136440 | |||
| 2946 | Ga0501045_0019340 | |||
| 2947 | Ga0501045_0056911 | |||
| 2948 | nmdc:mga03n38_1607_c1 | |||
| 2949 | nmdc:mga03n38_294452_c1 | |||
| 2950 | nmdc:mga03n38_37646_c1 | |||
| 2951 | nmdc:mga03n38_62564_c1 | |||
| 2952 | nmdc:mga00v17_266012_c1 | |||
| 2953 | nmdc:mga0yw44_125590_c1 | |||
| 2954 | nmdc:mga0yw44_2044_c1 | |||
| 2955 | nmdc:mga0yw44_56048_c1 | |||
| 2956 | nmdc:mga0yw44_91277_c1 | |||
| 2957 | nmdc:mga0yw44_95497_c1 | |||
| 2958 | nmdc:mga0k408_109312_c1 | |||
| 2959 | nmdc:mga0k408_30290_c1 | |||
| 2960 | nmdc:mga0k408_345967_c1 | |||
| 2961 | nmdc:mga06z11_64327_c1 | |||
| 2962 | nmdc:mga06z11_8466_c1 | |||
| 2963 | nmdc:mga06z11_8851_c1 | |||
| 2964 | nmdc:mga04h51_197101_c1 | |||
| 2965 | nmdc:mga04h51_38767_c1 | |||
| 2966 | nmdc:mga04h51_51084_c1 | |||
| 2967 | nmdc:mga04h51_55291_c1 | |||
| 2968 | nmdc:mga07m45_47170_c1 | |||
| 2969 | nmdc:mga07m45_59524_c1 | |||
| 2970 | nmdc:mga07m45_82080_c1 | |||
| 2971 | nmdc:mga05p37_196622_c1 | |||
| 2972 | nmdc:mga0qj67_579749_c1 | |||
| 2973 | nmdc:mga08y16_351549_c1 | |||
| 2974 | nmdc:mga08y16_40252_c1 | |||
| 2975 | nmdc:mga08y16_841950_c1 | |||
| 2976 | nmdc:mga0n895_131877_c1 | |||
| 2977 | nmdc:mga0n895_13760_c1 | |||
| 2978 | nmdc:mga0n895_499664_c1 | |||
| 2979 | nmdc:mga0rr50_144231_c1 | |||
| 2980 | nmdc:mga08x19_50119_c1 | |||
| 2981 | nmdc:mga0a205_315262_c1 | |||
| 2982 | nmdc:mga0sz30_60389_c1 | |||
| 2983 | nmdc:mga0sz30_73278_c1 | |||
| 2984 | nmdc:mga0sz30_96610_c1 | |||
| 2985 | Ga0495601_0037678 | |||
| 2986 | Ga0495601_0096036 | |||
| 2987 | Ga0495601_0106010 | |||
| 2988 | Ga0495612_0007550 | |||
| 2989 | Ga0495612_0022244 | |||
| 2990 | Ga0495612_0078734 | |||
| 2991 | Ga0495612_0094368 | |||
| 2992 | Ga0500610_0032128 | |||
| 2993 | Ga0500610_0082336 | |||
| 2994 | Ga0500635_0039043 | |||
| 2995 | Ga0500635_0096668 | |||
| 2996 | Ga0495595_0000332 | |||
| 2997 | Ga0495595_0107394 | |||
| 2998 | Ga0495619_0000633 | |||
| 2999 | Ga0495619_0183969 | |||
| 3000 | Ga0500578_0078699 | |||
| 3001 | Ga0500578_0270688 | |||
| 3002 | Ga0500643_000016 | |||
| 3003 | Ga0500644_0040572 | |||
| 3004 | Ga0500646_0026612 | |||
| 3005 | Ga0500651_0004739 | |||
| 3006 | Ga0500651_0034823 | |||
| 3007 | Ga0500566_0000078 | |||
| 3008 | Ga0500566_0000290 | |||
| 3009 | Ga0500566_0075616 | |||
| 3010 | Ga0500566_0095532 | |||
| 3011 | Ga0500566_0177840 | |||
| 3012 | Ga0500640_000121 | |||
| 3013 | Ga0500641_0000385 | |||
| 3014 | Ga0500641_0146332 | |||
| 3015 | Ga0500648_148817 | |||
| 3016 | Ga0500650_0053851 | |||
| 3017 | Ga0500554_023672 | |||
| 3018 | Ga0500555_023736 | |||
| 3019 | Ga0500556_0030267 | |||
| 3020 | Ga0500557_000011 | |||
| 3021 | Ga0500572_000170 | |||
| 3022 | Ga0500572_034970 | |||
| 3023 | Ga0500592_010304 | |||
| 3024 | Ga0500594_0017047 | |||
| 3025 | Ga0500595_001686 | |||
| 3026 | Ga0500595_002442 | |||
| 3027 | Ga0500595_002477 | |||
| 3028 | Ga0500595_004672 | |||
| 3029 | Ga0500595_024639 | |||
| 3030 | Ga0500595_026908 | |||
| 3031 | Ga0500595_055910 | |||
| 3032 | Ga0500607_104330 | |||
| 3033 | Ga0500614_004910 | |||
| 3034 | Ga0500614_085275 | |||
| 3035 | Ga0500642_0000090 | |||
| 3036 | Ga0500642_0121991 | |||
| 3037 | Ga0500642_0123555 | |||
| 3038 | Ga0500655_009005 | |||
| 3039 | Ga0500658_0051360 | |||
| 3040 | Ga0500559_0009508 | |||
| 3041 | Ga0500561_0007905 | |||
| 3042 | Ga0500568_0011274 | |||
| 3043 | Ga0500568_0018416 | |||
| 3044 | Ga0500568_0035763 | |||
| 3045 | Ga0500573_0056514 | |||
| 3046 | Ga0500577_0000619 | |||
| 3047 | Ga0500577_0080646 | |||
| 3048 | Ga0500588_0046427 | |||
| 3049 | Ga0500589_060298 | |||
| 3050 | Ga0500590_073986 | |||
| 3051 | Ga0500590_128847 | |||
| 3052 | Ga0500603_000081 | |||
| 3053 | Ga0500603_012969 | |||
| 3054 | Ga0500604_0011079 | |||
| 3055 | Ga0500616_0047459 | |||
| 3056 | Ga0500620_074910 | |||
| 3057 | Ga0500627_0015439 | |||
| 3058 | Ga0500630_004509 | |||
| 3059 | Ga0500638_018006 | |||
| 3060 | Ga0500638_021427 | |||
| 3061 | Ga0500638_097678 | |||
| 3062 | Ga0500638_150816 | |||
| 3063 | Ga0500639_000028 | |||
| 3064 | Ga0500639_112012 | |||
| 3065 | Ga0500639_177365 | |||
| 3066 | Ga0500636_0001766 | |||
| 3067 | Ga0500636_0065953 | |||
| 3068 | Ga0500636_0127461 | |||
| 3069 | Ga0500637_0039902 | |||
| 3070 | Ga0500637_0052431 | |||
| 3071 | Ga0500611_094937 | |||
| 3072 | Ga0500625_002925 | |||
| 3073 | Ga0500645_029720 | |||
| 3074 | Ga0500609_001414 | |||
| 3075 | Ga0500609_017433 | |||
| 3076 | Ga0500596_000324 | |||
| 3077 | Ga0500596_000655 | |||
| 3078 | Ga0500596_012941 | |||
| 3079 | Ga0501084_0023457 | |||
| 3080 | Ga0501084_0180813 | |||
| 3081 | Ga0501084_0299323 | |||
| 3082 | Ga0500661_000381 | |||
| 3083 | Ga0500661_002428 | |||
| 3084 | Ga0501082_0005465 | |||
| 3085 | Ga0501082_0182571 | |||
| 3086 | Ga0501082_0383448 | |||
| 3087 | Ga0530510_0173880 | |||
| 3088 | 2507511468 | |||
| 3089 | 2508545275 | |||
| 3090 | 2509147818 | |||
| 3091 | 2511397251 | |||
| 3092 | 2513624041 | |||
| 3093 | 2513641004 | |||
| 3094 | 2513648417 | |||
| 3095 | 2513655374 | |||
| 3096 | 2513696102 | |||
| 3097 | 2513703640 | |||
| 3098 | 2513716371 | |||
| 3099 | 2513860061 | |||
| 3100 | 2513875072 | |||
| 3101 | 2513893102 | |||
| 3102 | 2513916548 | |||
| 3103 | 2514013854 | |||
| 3104 | 2515624958 | |||
| 3105 | 2517101232 | |||
| 3106 | 2517889862 | |||
| 3107 | 2524439825 | |||
| 3108 | 2524532952 | |||
| 3109 | 2528855422 | |||
| 3110 | 2617348363 | |||
| 3111 | 2617374904 | |||
| 3112 | 2671121116 | |||
| 3113 | 2723848834 | |||
| 3114 | 2728751744 | |||
| 3115 | 2745075895 | |||
| 3116 | 2793061365 | |||
| 3117 | 2793073410 | |||
| 3118 | 2793078832 | |||
| 3119 | 2805916338 | |||
| 3120 | 2818239999 | |||
| 3121 | 2824607022 | |||
| 3122 | 2824614307 | |||
| 3123 | 2824622306 | |||
| 3124 | 2824631481 | |||
| 3125 | 2824638001 | |||
| 3126 | 2824664140 | |||
| 3127 | 2824674569 | |||
| 3128 | 2824685737 | |||
| 3129 | 2824690532 | |||
| 3130 | 2824697888 | |||
| 3131 | 2824726683 | |||
| 3132 | 2824736398 | |||
| 3133 | 2824752063 | |||
| 3134 | 2824770293 | |||
| 3135 | 2824776233 | |||
| 3136 | 2838129999 | |||
| 3137 | 2841947038 | |||
| 3138 | 2841955031 | |||
| 3139 | 2841969988 | |||
| 3140 | 2841977370 | |||
| 3141 | 2841990216 | |||
| 3142 | 2842042218 | |||
| 3143 | 2842050261 | |||
| 3144 | 2844316440 | |||
| 3145 | 2847939261 | |||
| 3146 | 2847943776 | |||
| 3147 | 2849081990 | |||
| 3148 | 2857513529 | |||
| 3149 | 2874594683 | |||
| 3150 | 2874606033 | |||
| 3151 | 2874615253 | |||
| 3152 | 2874622660 | |||
| 3153 | 2874633589 | |||
| 3154 | 2874647260 | |||
| 3155 | 2876765421 | |||
| 3156 | 2876773815 | |||
| 3157 | 2876817821 | |||
| 3158 | 2876819947 | |||
| 3159 | 2879076066 | |||
| 3160 | 2879086933 | |||
| 3161 | 2879104325 | |||
| 3162 | 2879116803 | |||
| 3163 | 2879129328 | |||
| 3164 | 2879144098 | |||
| 3165 | 2881369416 | |||
| 3166 | 2881668267 | |||
| 3167 | 2885373655 | |||
| 3168 | 2885378564 | |||
| 3169 | 2888387049 | |||
| 3170 | 2888389729 | |||
| 3171 | 2888421358 | |||
| 3172 | 2889034457 | |||
| 3173 | 2903732321 | |||
| 3174 | 2903749002 | |||
| 3175 | 2904671333 | |||
| 3176 | 2904692699 | |||
| 3177 | 2904711224 | |||
| 3178 | 2904719632 | |||
| 3179 | 2906606366 | |||
| 3180 | 2906612403 | |||
| 3181 | 2906626835 | |||
| 3182 | 2906636751 | |||
| 3183 | 2906649081 | |||
| 3184 | 2906663446 | |||
| 3185 | 2908745671 | |||
| 3186 | 2908757661 | |||
| 3187 | 2908777388 | |||
| 3188 | 2922366553 | |||
| 3189 | 2922377183 | |||
| 3190 | 2922389537 | |||
| 3191 | 2922398331 | |||
| 3192 | 2922426889 | |||
| 3193 | 2929623584 | |||
| 3194 | 2929632714 | |||
| 3195 | 2932793026 | |||
| 3196 | 2932795838 | |||
| 3197 | 2932802076 | |||
| 3198 | 2932814703 | |||
| 3199 | 2932823560 | |||
| 3200 | 2932832997 | |||
| 3201 | 2933585487 | |||
| 3202 | 2935616342 | |||
| 3203 | 2935623728 | |||
| 3204 | 2935633050 | |||
| 3205 | 2935639499 | |||
| 3206 | 2935650736 | |||
| 3207 | 2935662116 | |||
| 3208 | 2935670444 | |||
| 3209 | 2935679873 | |||
| 3210 | 2935687443 | |||
| 3211 | 2935696585 | |||
| 3212 | 2935705403 | |||
| 3213 | 2935718902 | |||
| 3214 | 2935728554 | |||
| 3215 | 2935736849 | |||
| 3216 | 2935746148 | |||
| 3217 | 2935753409 | |||
| 3218 | 2935766198 | |||
| 3219 | 2935770395 | |||
| 3220 | 2935777574 | |||
| 3221 | 2935786552 | |||
| 3222 | 2935794607 | |||
| 3223 | 2935807146 | |||
| 3224 | 2935813940 | |||
| 3225 | 2935827139 | |||
| 3226 | 2935828982 | |||
| 3227 | 2935844154 | |||
| 3228 | 2935854320 | |||
| 3229 | 2935862047 | |||
| 3230 | 2935871611 | |||
| 3231 | 2935880278 | |||
| 3232 | 2935886264 | |||
| 3233 | 2935913586 | |||
| 3234 | 2935923484 | |||
| 3235 | 2935931097 | |||
| 3236 | 2935935379 | |||
| 3237 | 2935946945 | |||
| 3238 | 2935953960 | |||
| 3239 | 2935961407 | |||
| 3240 | 2935968986 | |||
| 3241 | 2935982365 | |||
| 3242 | 2935985822 | |||
| 3243 | 2935996944 | |||
| 3244 | 2936005979 | |||
| 3245 | 2936016302 | |||
| 3246 | 2936025050 | |||
| 3247 | 2936033607 | |||
| 3248 | 2936039496 | |||
| 3249 | 2936050961 | |||
| 3250 | 2936057710 | |||
| 3251 | 2940559322 | |||
| 3252 | 2941509648 | |||
| 3253 | 2941517477 | |||
| 3254 | 2941526570 | |||
| 3255 | 2941536917 | |||
| 3256 | 2941542017 | |||
| 3257 | 3005476076 | |||
| 3258 | 3005491240 | |||
| 3259 | 3005511086 | |||
| 3260 | 3005591933 | |||
| 3261 | 3005596058 | |||
| 3262 | 3005712013 | |||
| 3263 | 3005719249 | |||
| 3264 | 8006932931 | |||
| 3265 | 8006937386 | |||
| 3266 | 8006971082 | |||
| 3267 | 8006977416 | |||
| 3268 | 8006992949 | |||
| 3269 | 8006996796 | |||
| 3270 | 8016517053 | |||
| 3271 | 8016524596 | |||
| 3272 | 8016538158 | |||
| 3273 | 8016542438 | |||
| 3274 | 8016559250 | |||
| 3275 | 8016567827 | |||
| 3276 | 8016580514 | |||
| 3277 | 8016588514 | |||
| 3278 | 8016597200 | |||
| 3279 | 8016605073 | |||
| 3280 | 8016619944 | |||
| 3281 | 8016624165 | |||
| 3282 | 8016637558 | |||
| 3283 | 8017059528 | |||
| 3284 | 8019537829 | |||
| 3285 | 8019551185 | |||
| 3286 | 8019571329 | |||
| 3287 | 8019597037 | |||
| 3288 | 8019604646 | |||
| 3289 | 8019624460 | |||
| 3290 | 8019637582 | |||
| 3291 | 8019642034 | |||
| 3292 | 8019650516 | |||
| 3293 | 8019665511 | |||
| 3294 | 8019675055 | |||
| 3295 | 8019681043 | |||
| 3296 | 8019694678 | |||
| 3297 | 8055749744 | |||
| 3298 | 8056675378 | |||
| 3299 | 8056692027 | |||
| 3300 | 8056973957 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3on2-assembly1.cif.gz_A | structure of a protein with unknown function from rhodococcus sp. rha1 | 0.8151 | 10 | 207 |
| 3on2-assembly3.cif.gz_C | structure of a protein with unknown function from rhodococcus sp. rha1 | 0.8052 | 11 | 210 |
| 5gpa-assembly1.cif.gz_A | structural analysis of fatty acid degradation regulator fadr from bacillus halodurans | 0.8027 | 17 | 199 |
| 3on2-assembly3.cif.gz_C | structure of a protein with unknown function from rhodococcus sp. rha1 | 0.8015 | 11 | 210 |
| 3on2-assembly1.cif.gz_A | structure of a protein with unknown function from rhodococcus sp. rha1 | 0.7999 | 10 | 207 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4xk4D01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.8606 | 19 | 68 | 1.10.10.60 |
| 4xk4A01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.8601 | 19 | 68 | 1.10.10.60 |
| 4xk4B01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.8587 | 19 | 68 | 1.10.10.60 |
| 6azhA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.8518 | 20 | 65 | 1.10.10.60 |
| 6azhB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.8501 | 22 | 65 | 1.10.10.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y2UQR5-F1-model_v4 | TetR/AcrR family transcriptional regulator | 0.911 | 11 | 160 |
GO:0000976
GO:0003700 |
| AF-A0A7Y2UQR5-F1-model_v4 | TetR/AcrR family transcriptional regulator | 0.8941 | 11 | 160 |
GO:0000976
GO:0003700 |
| AF-A0A643FAU4-F1-model_v4 | TetR/AcrR family transcriptional regulator | 0.8539 | 20 | 207 |
GO:0000976
GO:0003700 |
| AF-A0A356QJZ8-F1-model_v4 | TetR family transcriptional regulator | 0.8533 | 19 | 148 |
GO:0000976
GO:0003700 |
| AF-A0A6N4W4B7-F1-model_v4 | TetR family transcriptional regulator | 0.8362 | 19 | 207 |
GO:0000976
GO:0003700 |