F495204

General Info

Members Datasets Scaffolds Average Seq Length
1650 731 3300 231

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100643588|Ga0070671_1006435881
Length 259
Sequence MLRKPIAGLPAMVTLLPLHVKALHMSWRKDDRRAERGYHHGNLKEALLQAALDLIAQKGAAGFTFADAARMAGVSPAAPYRHFRDREELLSSIAQRGFEQFEAALTQAWDDGRPDTVTAFERVGKAYLAFARNEPAFYSAMFESGLPADANPALMAASERAFGVLRAAAERLAALAPPGTPRPPALMMALHIWSMSHGVASLFARGDAARRKLPMSAEDLLEAEVLIYLRGLGFPTERRTQPPPLPEDEKPAGPWGRAK

Samples

Sample ID Description Type Environment
1 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
11 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
78 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
79 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
94 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
95 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
96 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
97 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
98 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
99 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
130 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
131 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
132 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
133 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
134 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
135 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
136 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
137 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
139 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
142 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
145 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
147 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
207 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
208 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
209 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
210 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
211 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
215 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
216 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
217 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
218 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
219 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
221 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
222 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
223 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
224 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
225 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
226 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
227 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
228 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
229 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
230 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
231 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
232 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
233 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
234 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
235 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
236 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
237 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
238 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
239 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
240 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
241 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
242 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
243 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
244 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
245 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
246 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
247 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
248 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
249 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
250 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
251 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
252 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
253 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
254 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
255 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
256 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
257 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
258 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
259 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
260 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
261 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
262 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
263 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
264 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
265 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
266 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
267 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
268 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
269 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
270 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
271 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
272 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
273 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
274 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
275 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
276 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
277 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
278 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
279 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
280 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
281 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
282 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
283 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
284 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
285 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
286 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
287 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
288 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
289 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
290 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
291 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
292 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
293 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
294 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
295 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
296 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
297 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
298 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
299 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
300 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
301 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
302 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
303 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
304 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
305 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
306 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
307 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
308 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
309 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
310 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
311 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
312 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
313 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
314 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
315 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
316 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
317 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
318 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
319 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
320 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
321 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
322 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
323 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
324 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
325 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
326 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
327 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
328 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
329 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
330 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
331 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
332 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
333 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
334 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
335 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
336 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
337 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
338 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
339 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
340 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
341 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
342 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
343 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
344 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
345 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
346 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
347 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
348 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
349 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
350 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
351 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
352 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
353 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
354 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
355 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
356 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
357 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
358 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
359 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
360 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
361 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
362 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
363 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
364 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
365 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
366 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
367 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
368 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
369 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
370 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
371 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
372 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
373 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
374 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
375 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
376 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
377 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
378 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
379 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
380 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
381 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
382 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
383 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
384 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
385 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
386 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
387 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
388 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
389 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
390 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
391 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
392 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
393 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
394 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
395 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
396 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
397 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
398 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
399 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
400 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
401 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
402 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
403 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
404 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
405 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
406 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
407 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
408 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
409 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
410 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
411 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
412 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
413 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
414 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
415 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
416 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
417 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
418 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
419 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
420 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
421 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
422 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
423 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
424 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
425 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
426 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
427 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
428 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
429 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
430 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
431 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
432 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
433 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
434 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
435 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
436 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
437 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
438 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
439 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
440 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
441 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
442 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
443 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
444 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
445 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
446 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
447 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
448 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
449 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
450 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
451 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
452 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
453 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
454 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
455 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
456 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
457 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
458 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
459 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
460 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
461 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
462 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
463 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
464 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
465 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
466 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
467 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
468 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
469 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
470 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
471 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
472 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
473 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
474 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
475 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
476 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
477 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
478 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
479 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
480 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
481 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
482 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
483 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
484 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
485 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
486 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
487 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
488 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
489 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
490 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
491 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
492 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
493 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
494 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
495 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
496 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
497 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
498 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
499 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
500 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
501 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
502 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
503 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
504 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
505 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
506 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
507 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
508 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
509 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
510 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
511 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
512 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
513 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
514 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
515 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
516 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
517 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
518 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
519 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
520 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
521 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
522 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
523 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
524 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
525 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
526 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
527 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
528 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
529 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
530 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
531 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
532 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
533 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
534 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
535 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
536 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
537 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
538 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
539 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
540 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
541 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
542 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
543 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
544 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
545 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
546 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
547 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
548 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
549 2791355199
550 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
551 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
552 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
553 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
554 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
555 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
556 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
557 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
558 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
559 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
560 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
561 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
562 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
563 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
564 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
565 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
566 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
567 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
568 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
569 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
570 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
571 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
572 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
573 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
574 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
575 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
576 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
577 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
578 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
579 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
580 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
581 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
582 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
583 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
584 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
585 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
586 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
587 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
588 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
589 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
590 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
591 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
592 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
593 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
594 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
595 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
596 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
597 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
598 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
599 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
600 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
601 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
602 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
603 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
604 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
605 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
606 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
607 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
608 2904699407
609 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
610 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
611 2906610324
612 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
613 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
614 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
615 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
616 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
617 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
618 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
619 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
620 2922368715
621 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
622 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
623 2922425934
624 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
625 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
626 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
627 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
628 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
629 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
630 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
631 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
632 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
633 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
634 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
635 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
636 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
637 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
638 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
639 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
640 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
641 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
642 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
643 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
644 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
645 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
646 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
647 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
648 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
649 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
650 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
651 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
652 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
653 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
654 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
655 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
656 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
657 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
658 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
659 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
660 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
661 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
662 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
663 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
664 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
665 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
666 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
667 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
668 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
669 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
670 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
671 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
672 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
673 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
674 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
675 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
676 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
677 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
678 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
679 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
680 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
681 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
682 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
683 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
684 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
685 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
686 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
687 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
688 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
689 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
690 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
691 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
692 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
693 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
694 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
695 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
696 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
697 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
698 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
699 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
700 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
701 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
702 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
703 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
704 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
705 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
706 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
707 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
708 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
709 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
710 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
711 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
712 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
713 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
714 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
715 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
716 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
717 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
718 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
719 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
720 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
721 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
722 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
723 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
724 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
725 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
726 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
727 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
728 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
729 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
730 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
731 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.11
Metatranscriptomes 0.24
Isolates 12.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.39
Nodule 10.79
Rhizoplane 5.15
Rhizosphere 63.52
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070671_100643588 3300005355 Bacteria 918
2 JGI24740J21852_10001580 3300001979 Bacteria 10465
3 JGI24737J22298_10002347 3300001990 Bacteria 6747
4 JGI24735J21928_10028622 3300002067 Bacteria 1663
5 JGI25406J46586_10005617 3300003203 Bacteria 5805
6 JGI25406J46586_10007816 3300003203 Bacteria 4864
7 JGI25406J46586_10008897 3300003203 Bacteria 4519
8 JGI25165J46597_1004728 3300003214 Bacteria 2822
9 JGI25165J46597_1005035 3300003214 Bacteria 2644
10 JGI25153J46596_10002507 3300003215 Bacteria 10538
11 JGI25153J46596_10002543 3300003215 Bacteria 10454
12 JGI25153J46596_10010032 3300003215 Bacteria 4323
13 JGI25153J46596_10026515 3300003215 Bacteria 2049
14 JGI25153J46596_10037403 3300003215 Bacteria 1543
15 rootH2_10168323 3300003320 Bacteria 1172
16 JGI25160J50197_1003540 3300003354 Bacteria 6958
17 JGI25160J50197_1009667 3300003354 Bacteria 3554
18 JGI25404J52841_10004139 3300003659 Bacteria 2919
19 Ga0055525_1003944 3300003759 Bacteria 1292
20 Ga0055531_10001939 3300003794 Bacteria 14453
21 Ga0065165_1001641 3300005262 Bacteria 22770
22 Ga0065165_1003060 3300005262 Bacteria 12519
23 Ga0070658_10012558 3300005327 Bacteria 6793
24 Ga0070658_10023514 3300005327 Bacteria 4944
25 Ga0070658_10052859 3300005327 Bacteria 3296
26 Ga0070658_10102491 3300005327 Bacteria 2367
27 Ga0070658_10155121 3300005327 Bacteria 1919
28 Ga0070676_10390013 3300005328 Bacteria 966
29 Ga0070683_100014532 3300005329 Bacteria 6891
30 Ga0070683_100130698 3300005329 Bacteria 2376
31 Ga0070683_100175788 3300005329 Bacteria 2032
32 Ga0070690_100355313 3300005330 Bacteria 1065
33 Ga0070670_100407153 3300005331 Bacteria 1201
34 Ga0068869_100458466 3300005334 Bacteria 1058
35 Ga0070680_100299522 3300005336 Bacteria 1363
36 Ga0070682_100036436 3300005337 Bacteria 3007
37 Ga0070682_100117317 3300005337 Bacteria 1782
38 Ga0070682_100461097 3300005337 Bacteria 975
39 Ga0070682_100524723 3300005337 Bacteria 922
40 Ga0068868_100060174 3300005338 Bacteria 3006
41 Ga0068868_100208161 3300005338 Bacteria 1633
42 Ga0070660_100006936 3300005339 Bacteria 7856
43 Ga0070660_100046028 3300005339 Bacteria 3343
44 Ga0070660_100078138 3300005339 Bacteria 2595
45 Ga0070660_100659153 3300005339 Bacteria 877
46 Ga0070689_100445054 3300005340 Bacteria 1101
47 Ga0070691_10105336 3300005341 Bacteria 1405
48 Ga0070687_100223122 3300005343 Bacteria 1155
49 Ga0070661_100204512 3300005344 Bacteria 1510
50 Ga0070661_100211872 3300005344 Bacteria 1483
51 Ga0070668_100004090 3300005347 Bacteria 10802
52 Ga0070668_100177813 3300005347 Bacteria 1736
53 Ga0070668_100185693 3300005347 Bacteria 1700
54 Ga0070668_100188933 3300005347 Bacteria 1686
55 Ga0070668_100420314 3300005347 Bacteria 1144
56 Ga0070668_100583118 3300005347 Bacteria 976
57 Ga0070669_100077152 3300005353 Bacteria 2475
58 Ga0070669_100235249 3300005353 Bacteria 1453
59 Ga0070671_100028829 3300005355 Bacteria 4575
60 Ga0070671_100227546 3300005355 Bacteria 1582
61 Ga0070674_100399589 3300005356 Bacteria 1122
62 Ga0070674_100460492 3300005356 Bacteria 1051
63 Ga0070673_100223298 3300005364 Bacteria 1631
64 Ga0070659_100028575 3300005366 Bacteria 4308
65 Ga0070659_100120823 3300005366 Bacteria 2122
66 Ga0070709_10001211 3300005434 Bacteria 14149
67 Ga0070709_10001487 3300005434 Bacteria 12659
68 Ga0070709_10012057 3300005434 Bacteria 4832
69 Ga0070709_10203434 3300005434 Bacteria 1403
70 Ga0070714_100021170 3300005435 Bacteria 5317
71 Ga0070714_100036040 3300005435 Bacteria 4147
72 Ga0070714_100065164 3300005435 Bacteria 3138
73 Ga0070714_100074503 3300005435 Bacteria 2943
74 Ga0070714_100109893 3300005435 Bacteria 2440
75 Ga0070714_100228898 3300005435 Bacteria 1712
76 Ga0070713_100005990 3300005436 Bacteria 8366
77 Ga0070713_100077999 3300005436 Bacteria 2819
78 Ga0070713_100096572 3300005436 Bacteria 2551
79 Ga0070713_100335931 3300005436 Bacteria 1399
80 Ga0070713_100449753 3300005436 Bacteria 1210
81 Ga0070713_100471432 3300005436 Bacteria 1182
82 Ga0070713_100479307 3300005436 Bacteria 1172
83 Ga0070710_10001333 3300005437 Bacteria 11642
84 Ga0070710_10004775 3300005437 Bacteria 6410
85 Ga0070710_10047262 3300005437 Bacteria 2400
86 Ga0070710_10238132 3300005437 Bacteria 1165
87 Ga0070701_10190118 3300005438 Bacteria 1207
88 Ga0070711_100004982 3300005439 Bacteria 7886
89 Ga0070711_100008851 3300005439 Bacteria 6178
90 Ga0070711_100009103 3300005439 Bacteria 6103
91 Ga0070711_100015372 3300005439 Bacteria 4844
92 Ga0070711_100042807 3300005439 Bacteria 3063
93 Ga0070711_100587322 3300005439 Bacteria 928
94 Ga0070700_100015418 3300005441 Bacteria 4332
95 Ga0070700_100183938 3300005441 Bacteria 1456
96 Ga0070663_100004680 3300005455 Bacteria 8069
97 Ga0070663_100005639 3300005455 Bacteria 7455
98 Ga0070663_100015169 3300005455 Bacteria 4964
99 Ga0070663_100026089 3300005455 Bacteria 3953
100 Ga0070663_100044624 3300005455 Bacteria 3127
101 Ga0070663_100051115 3300005455 Bacteria 2942
102 Ga0070663_100133416 3300005455 Bacteria 1888
103 Ga0070663_100303096 3300005455 Bacteria 1279
104 Ga0070678_100045978 3300005456 Bacteria 3127
105 Ga0070678_100229640 3300005456 Bacteria 1546
106 Ga0070662_100100370 3300005457 Bacteria 2189
107 Ga0070662_100154805 3300005457 Bacteria 1788
108 Ga0070662_100167487 3300005457 Bacteria 1723
109 Ga0070662_100217927 3300005457 Bacteria 1521
110 Ga0070662_100641525 3300005457 Bacteria 895
111 Ga0070681_10012465 3300005458 Bacteria 8435
112 Ga0070681_10017662 3300005458 Bacteria 7129
113 Ga0070681_10024432 3300005458 Bacteria 6084
114 Ga0070681_10057575 3300005458 Bacteria 3867
115 Ga0068867_100203103 3300005459 Bacteria 1587
116 Ga0070706_100712771 3300005467 Bacteria 930
117 Ga0070707_100082832 3300005468 Bacteria 3099
118 Ga0070698_100028998 3300005471 Bacteria 5744
119 Ga0070698_100176063 3300005471 Bacteria 2078
120 Ga0070698_100604931 3300005471 Bacteria 1036
121 Ga0070699_100501560 3300005518 Bacteria 1103
122 Ga0070679_100018130 3300005530 Bacteria 6824
123 Ga0070679_100075893 3300005530 Bacteria 3351
124 Ga0070679_100079972 3300005530 Bacteria 3258
125 Ga0070679_100168713 3300005530 Bacteria 2161
126 Ga0070679_100256152 3300005530 Bacteria 1705
127 Ga0070684_100026884 3300005535 Bacteria 4850
128 Ga0070697_100515432 3300005536 Bacteria 1046
129 Ga0068853_100003590 3300005539 Bacteria 11880
130 Ga0068853_100009325 3300005539 Bacteria 7913
131 Ga0068853_100040891 3300005539 Bacteria 3958
132 Ga0068853_100097167 3300005539 Bacteria 2599
133 Ga0068853_100210598 3300005539 Bacteria 1771
134 Ga0068853_100214448 3300005539 Bacteria 1756
135 Ga0068853_100357112 3300005539 Bacteria 1360
136 Ga0068853_100678605 3300005539 Bacteria 982
137 Ga0070686_100061402 3300005544 Bacteria 2428
138 Ga0070693_100104870 3300005547 Bacteria 1729
139 Ga0070665_100013100 3300005548 Bacteria 8350
140 Ga0070665_100030279 3300005548 Bacteria 5447
141 Ga0070665_100128938 3300005548 Bacteria 2532
142 Ga0070665_100154541 3300005548 Bacteria 2296
143 Ga0070665_100263126 3300005548 Bacteria 1726
144 Ga0070665_100662890 3300005548 Bacteria 1056
145 Ga0070704_100191713 3300005549 Bacteria 1643
146 Ga0068855_100007494 3300005563 Bacteria 13211
147 Ga0068855_100051001 3300005563 Bacteria 4875
148 Ga0068855_100074949 3300005563 Bacteria 3929
149 Ga0068855_100100695 3300005563 Bacteria 3326
150 Ga0068855_100157617 3300005563 Bacteria 2578
151 Ga0068855_100173800 3300005563 Bacteria 2438
152 Ga0068855_100179168 3300005563 Bacteria 2397
153 Ga0068855_100286497 3300005563 Bacteria 1827
154 Ga0068857_100010136 3300005577 Bacteria 8189
155 Ga0068857_100028661 3300005577 Bacteria 4913
156 Ga0068857_100046709 3300005577 Bacteria 3843
157 Ga0068857_100090185 3300005577 Bacteria 2743
158 Ga0068857_100152011 3300005577 Bacteria 2098
159 Ga0068854_100004261 3300005578 Bacteria 9011
160 Ga0068854_100014717 3300005578 Bacteria 5162
161 Ga0068854_100167111 3300005578 Bacteria 1708
162 Ga0068854_100498096 3300005578 Bacteria 1025
163 Ga0068856_100000055 3300005614 Bacteria 104152
164 Ga0068856_100002036 3300005614 Bacteria 20996
165 Ga0068856_100035106 3300005614 Bacteria 4913
166 Ga0068856_100813720 3300005614 Bacteria 954
167 Ga0070702_100030788 3300005615 Bacteria 2929
168 Ga0070702_100380126 3300005615 Bacteria 1004
169 Ga0068852_100061105 3300005616 Bacteria 3273
170 Ga0068852_100126999 3300005616 Bacteria 2343
171 Ga0068852_100182452 3300005616 Bacteria 1974
172 Ga0068852_100338700 3300005616 Bacteria 1465
173 Ga0068852_100388317 3300005616 Bacteria 1371
174 Ga0068852_100466010 3300005616 Bacteria 1253
175 Ga0068852_100597224 3300005616 Bacteria 1108
176 Ga0068859_100029233 3300005617 Bacteria 5530
177 Ga0068859_100160455 3300005617 Bacteria 2327
178 Ga0068859_100197202 3300005617 Bacteria 2098
179 Ga0068859_100271344 3300005617 Bacteria 1788
180 Ga0068859_100854619 3300005617 Bacteria 996
181 Ga0068864_100155154 3300005618 Bacteria 2077
182 Ga0068866_10121120 3300005718 Bacteria 1474
183 Ga0068866_10150413 3300005718 Bacteria 1347
184 Ga0068861_100222076 3300005719 Bacteria 1597
185 Ga0068861_100380771 3300005719 Bacteria 1246
186 Ga0068851_10018146 3300005834 Bacteria 3388
187 Ga0068851_10199625 3300005834 Bacteria 1116
188 Ga0068870_10162882 3300005840 Bacteria 1324
189 Ga0068858_100060155 3300005842 Bacteria 3511
190 Ga0068858_100084612 3300005842 Bacteria 2950
191 Ga0068860_100004713 3300005843 Bacteria 13912
192 Ga0068860_100218969 3300005843 Bacteria 1848
193 Ga0068860_100438223 3300005843 Bacteria 1298
194 Ga0068860_100511884 3300005843 Bacteria 1199
195 Ga0068862_100565517 3300005844 Bacteria 1087
196 Ga0081455_10005206 3300005937 Bacteria 14308
197 Ga0081455_10014855 3300005937 Bacteria 7594
198 Ga0081455_10029662 3300005937 Bacteria 4984
199 Ga0081455_10109650 3300005937 Bacteria 2196
200 Ga0081455_10121760 3300005937 Bacteria 2055
201 Ga0081538_10014803 3300005981 Bacteria 6080
202 Ga0081538_10052708 3300005981 Bacteria 2427
203 Ga0081538_10121627 3300005981 Bacteria 1252
204 Ga0081540_1001339 3300005983 Bacteria 21460
205 Ga0081540_1002098 3300005983 Bacteria 16595
206 Ga0081540_1005640 3300005983 Bacteria 9318
207 Ga0081540_1007193 3300005983 Bacteria 7985
208 Ga0081540_1007306 3300005983 Bacteria 7903
209 Ga0081540_1007993 3300005983 Bacteria 7446
210 Ga0081540_1014652 3300005983 Bacteria 5010
211 Ga0081540_1075041 3300005983 Bacteria 1547
212 Ga0081540_1098360 3300005983 Bacteria 1267
213 Ga0081539_10000848 3300005985 Bacteria 58499
214 Ga0081539_10000950 3300005985 Bacteria 54335
215 Ga0081539_10023363 3300005985 Bacteria 4052
216 Ga0081539_10090029 3300005985 Bacteria 1588
217 Ga0081539_10096617 3300005985 Bacteria 1514
218 Ga0070717_10000460 3300006028 Bacteria 25862
219 Ga0070717_10004333 3300006028 Bacteria 10238
220 Ga0070717_10061424 3300006028 Bacteria 3114
221 Ga0070717_10333783 3300006028 Bacteria 1353
222 Ga0070717_10362396 3300006028 Bacteria 1298
223 Ga0075365_10002534 3300006038 Bacteria 9011
224 Ga0075365_10016437 3300006038 Bacteria 4501
225 Ga0075365_10032321 3300006038 Bacteria 3362
226 Ga0075365_10041163 3300006038 Bacteria 3017
227 Ga0075365_10046097 3300006038 Bacteria 2862
228 Ga0075365_10082863 3300006038 Bacteria 2175
229 Ga0075365_10230350 3300006038 Bacteria 1300
230 Ga0075368_10005523 3300006042 Bacteria 4354
231 Ga0075368_10042472 3300006042 Bacteria 1789
232 Ga0075363_100002726 3300006048 Bacteria 7310
233 Ga0075363_100040857 3300006048 Bacteria 2445
234 Ga0075363_100054874 3300006048 Bacteria 2133
235 Ga0070715_10128429 3300006163 Bacteria 1217
236 Ga0070715_10216155 3300006163 Bacteria 983
237 Ga0070716_100006222 3300006173 Bacteria 5827
238 Ga0070716_100373734 3300006173 Bacteria 1016
239 Ga0070716_100432710 3300006173 Bacteria 954
240 Ga0070712_100098353 3300006175 Bacteria 2158
241 Ga0075362_10085580 3300006177 Bacteria 1458
242 Ga0075362_10193130 3300006177 Bacteria 989
243 Ga0075367_10016328 3300006178 Bacteria 4054
244 Ga0075367_10037477 3300006178 Bacteria 2818
245 Ga0075367_10040157 3300006178 Bacteria 2731
246 Ga0075367_10081082 3300006178 Bacteria 1963
247 Ga0075367_10110845 3300006178 Bacteria 1684
248 Ga0075367_10341270 3300006178 Bacteria 945
249 Ga0075367_10388154 3300006178 Bacteria 882
250 Ga0075369_10056155 3300006186 Bacteria 1711
251 Ga0075369_10227191 3300006186 Bacteria 864
252 Ga0075366_10024888 3300006195 Bacteria 3492
253 Ga0075366_10050422 3300006195 Bacteria 2471
254 Ga0075366_10107607 3300006195 Bacteria 1676
255 Ga0097621_100512845 3300006237 Bacteria 1087
256 Ga0075370_10005105 3300006353 Bacteria 6470
257 Ga0075370_10043459 3300006353 Bacteria 2540
258 Ga0075370_10232227 3300006353 Bacteria 1091
259 Ga0075370_10323769 3300006353 Bacteria 918
260 Ga0075434_100016328 3300006871 Bacteria 7137
261 Ga0075434_100189929 3300006871 Bacteria 2074
262 Ga0068865_100300036 3300006881 Bacteria 1285
263 Ga0075436_100057729 3300006914 Bacteria 2680
264 Ga0097620_100029232 3300006931 Bacteria 5530
265 Ga0097620_100160457 3300006931 Bacteria 2327
266 Ga0097620_100197214 3300006931 Bacteria 2098
267 Ga0097620_100271350 3300006931 Bacteria 1788
268 Ga0097620_100854749 3300006931 Bacteria 996
269 Ga0099825_1026334 3300006941 Bacteria 3111
270 Ga0099825_1033252 3300006941 Bacteria 2016
271 Ga0099824_1008875 3300006942 Bacteria 12635
272 Ga0099824_1012218 3300006942 Bacteria 9445
273 Ga0099822_1020991 3300006943 Bacteria 6383
274 Ga0099823_1051282 3300006944 Bacteria 2506
275 Ga0075435_100520533 3300007076 Bacteria 1029
276 Ga0099794_10197571 3300007265 Bacteria 1029
277 Ga0099795_10094234 3300007788 Bacteria 1165
278 Ga0099795_10107624 3300007788 Bacteria 1101
279 Ga0105240_10004881 3300009093 Bacteria 20178
280 Ga0105240_10004901 3300009093 Bacteria 20151
281 Ga0105240_10016877 3300009093 Bacteria 9867
282 Ga0105240_10097295 3300009093 Bacteria 3586
283 Ga0105240_10150608 3300009093 Bacteria 2771
284 Ga0105240_10188676 3300009093 Bacteria 2426
285 Ga0105240_10309970 3300009093 Bacteria 1803
286 Ga0105240_10375624 3300009093 Bacteria 1606
287 Ga0105240_10438744 3300009093 Bacteria 1464
288 Ga0111539_10071397 3300009094 Bacteria 4097
289 Ga0105245_10060551 3300009098 Bacteria 3410
290 Ga0105245_10288278 3300009098 Bacteria 1607
291 Ga0105247_10060535 3300009101 Bacteria 2346
292 Ga0105247_10080734 3300009101 Bacteria 2049
293 Ga0105247_10541931 3300009101 Bacteria 854
294 Ga0114129_10144511 3300009147 Bacteria 3259
295 Ga0105243_10353713 3300009148 Bacteria 1350
296 Ga0105241_10001823 3300009174 Bacteria 16163
297 Ga0105241_10012915 3300009174 Bacteria 6127
298 Ga0105241_10066635 3300009174 Bacteria 2785
299 Ga0105241_10360165 3300009174 Bacteria 1265
300 Ga0105248_10799823 3300009177 Bacteria 1064
301 Ga0105248_10860676 3300009177 Bacteria 1023
302 Ga0105248_10918589 3300009177 Bacteria 988
303 Ga0105237_10003690 3300009545 Bacteria 18050
304 Ga0105237_10018023 3300009545 Bacteria 7315
305 Ga0105237_10026579 3300009545 Bacteria 5916
306 Ga0105237_10084699 3300009545 Bacteria 3160
307 Ga0105237_10208119 3300009545 Bacteria 1956
308 Ga0105237_10412749 3300009545 Bacteria 1355
309 Ga0105238_10001367 3300009551 Bacteria 24466
310 Ga0105238_10001743 3300009551 Bacteria 21842
311 Ga0105238_10004073 3300009551 Bacteria 14490
312 Ga0105238_10105202 3300009551 Bacteria 2804
313 Ga0105238_10108450 3300009551 Bacteria 2758
314 Ga0105238_10126345 3300009551 Bacteria 2535
315 Ga0105238_10216419 3300009551 Bacteria 1892
316 Ga0105238_10348621 3300009551 Bacteria 1469
317 Ga0105238_10627570 3300009551 Bacteria 1084
318 Ga0105249_10025071 3300009553 Bacteria 5367
319 Ga0105249_10696435 3300009553 Bacteria 1076
320 Ga0105249_10975195 3300009553 Bacteria 916
321 Ga0105239_10001966 3300010375 Bacteria 26740
322 Ga0105239_10015287 3300010375 Bacteria 8506
323 Ga0105239_10018873 3300010375 Bacteria 7619
324 Ga0105239_10045918 3300010375 Bacteria 4787
325 Ga0105239_10071995 3300010375 Bacteria 3798
326 Ga0105239_10126508 3300010375 Bacteria 2840
327 Ga0105239_10181902 3300010375 Bacteria 2352
328 Ga0105246_10089670 3300011119 Bacteria 2213
329 Ga0105246_10776433 3300011119 Bacteria 848
330 Ga0157371_10328587 3300013102 Bacteria 1111
331 Ga0157370_10026904 3300013104 Bacteria 5674
332 Ga0157370_10041113 3300013104 Bacteria 4463
333 Ga0157370_10101710 3300013104 Bacteria 2692
334 Ga0157370_10648587 3300013104 Bacteria 965
335 Ga0157369_10020019 3300013105 Bacteria 7484
336 Ga0157369_10037771 3300013105 Bacteria 5286
337 Ga0157369_10105183 3300013105 Bacteria 3005
338 Ga0157369_10133284 3300013105 Bacteria 2632
339 Ga0157369_10334466 3300013105 Bacteria 1573
340 Ga0157369_10498472 3300013105 Bacteria 1260
341 Ga0157369_10505552 3300013105 Bacteria 1250
342 Ga0157374_10019278 3300013296 Bacteria 6036
343 Ga0157374_10026832 3300013296 Bacteria 5187
344 Ga0157374_10066182 3300013296 Bacteria 3396
345 Ga0157374_10298195 3300013296 Bacteria 1594
346 Ga0157378_10031236 3300013297 Bacteria 4704
347 Ga0157378_10218287 3300013297 Bacteria 1812
348 Ga0157378_10431301 3300013297 Bacteria 1304
349 Ga0163162_10044547 3300013306 Bacteria 4444
350 Ga0163162_10129391 3300013306 Bacteria 2633
351 Ga0163162_10206375 3300013306 Bacteria 2094
352 Ga0157372_10170357 3300013307 Bacteria 2519
353 Ga0157375_10174025 3300013308 Bacteria 2301
354 Ga0157375_10404171 3300013308 Bacteria 1532
355 Ga0157375_10436627 3300013308 Bacteria 1475
356 Ga0163163_10006414 3300014325 Bacteria 10278
357 Ga0163163_10057665 3300014325 Bacteria 3840
358 Ga0163163_10073225 3300014325 Bacteria 3416
359 Ga0163163_10264222 3300014325 Bacteria 1772
360 Ga0157380_10109465 3300014326 Bacteria 2318
361 Ga0157380_10157219 3300014326 Bacteria 1971
362 Ga0157377_10133299 3300014745 Bacteria 1520
363 Ga0157379_10120147 3300014968 Bacteria 2363
364 Ga0157379_10148040 3300014968 Bacteria 2118
365 Ga0157379_10547290 3300014968 Bacteria 1077
366 Ga0157376_10046724 3300014969 Bacteria 3572
367 Ga0157376_10139890 3300014969 Bacteria 2170
368 Ga0157376_10337041 3300014969 Bacteria 1439
369 Ga0163161_10313078 3300017792 Bacteria 1239
370 Ga0206356_10252712 3300020070 Bacteria 939
371 Ga0206353_10542281 3300020082 Bacteria 975
372 Ga0214544_1000005 3300021320 Bacteria 387675
373 Ga0214542_1000004 3300021321 Bacteria 415597
374 Ga0214545_1000005 3300021324 Bacteria 415590
375 Ga0214543_1000111 3300021327 Bacteria 106517
376 Ga0213872_10128081 3300021361 Bacteria 1119
377 Ga0213874_10008955 3300021377 Bacteria 2459
378 Ga0213876_10001491 3300021384 Bacteria 14550
379 Ga0213876_10100607 3300021384 Bacteria 1532
380 Ga0213875_10000011 3300021388 Bacteria 332447
381 Ga0209563_102320 3300025230 Bacteria 4365
382 Ga0207425_1011133 3300025245 Bacteria 2158
383 Ga0209677_101639 3300025253 Bacteria 9408
384 Ga0209677_102591 3300025253 Bacteria 6615
385 Ga0209148_1000235 3300025254 Bacteria 90398
386 Ga0209233_1000694 3300025261 Bacteria 15931
387 Ga0209233_1004340 3300025261 Bacteria 4839
388 Ga0209233_1015229 3300025261 Bacteria 2148
389 Ga0209233_1017519 3300025261 Bacteria 1949
390 Ga0209455_1000637 3300025272 Bacteria 21523
391 Ga0209455_1001472 3300025272 Bacteria 10597
392 Ga0209455_1001710 3300025272 Bacteria 9395
393 Ga0209564_1006563 3300025295 Bacteria 6245
394 Ga0209564_1029711 3300025295 Bacteria 1712
395 Ga0209758_1000102 3300025297 Bacteria 224851
396 Ga0209758_1000680 3300025297 Bacteria 50663
397 Ga0209758_1001266 3300025297 Bacteria 31302
398 Ga0209758_1002859 3300025297 Bacteria 16761
399 Ga0209758_1003592 3300025297 Bacteria 13874
400 Ga0209758_1003725 3300025297 Bacteria 13511
401 Ga0209758_1005478 3300025297 Bacteria 9742
402 Ga0209758_1008851 3300025297 Bacteria 6405
403 Ga0209758_1033809 3300025297 Bacteria 2046
404 Ga0209758_1062345 3300025297 Bacteria 1221
405 Ga0209256_1004953 3300025299 Bacteria 7982
406 Ga0209256_1022780 3300025299 Bacteria 1888
407 Ga0207426_1000532 3300025302 Bacteria 54755
408 Ga0207426_1001761 3300025302 Bacteria 16397
409 Ga0207426_1024324 3300025302 Bacteria 2057
410 Ga0207426_1027105 3300025302 Bacteria 1913
411 Ga0209051_1081854 3300025303 Bacteria 928
412 Ga0209257_1003378 3300025304 Bacteria 13780
413 Ga0209257_1036799 3300025304 Bacteria 1499
414 Ga0207656_10009313 3300025321 Bacteria 3644
415 Ga0207656_10035763 3300025321 Bacteria 2081
416 Ga0207656_10203137 3300025321 Bacteria 958
417 Ga0207682_10055865 3300025893 Bacteria 1643
418 Ga0207692_10004617 3300025898 Bacteria 5462
419 Ga0207692_10008895 3300025898 Bacteria 4173
420 Ga0207692_10044255 3300025898 Bacteria 2220
421 Ga0207642_10020324 3300025899 Bacteria 2589
422 Ga0207710_10010195 3300025900 Bacteria 3953
423 Ga0207688_10019383 3300025901 Bacteria 3705
424 Ga0207688_10094246 3300025901 Bacteria 1722
425 Ga0207680_10169761 3300025903 Bacteria 1468
426 Ga0207647_10001253 3300025904 Bacteria 19532
427 Ga0207647_10011423 3300025904 Bacteria 6230
428 Ga0207685_10049121 3300025905 Bacteria 1619
429 Ga0207685_10109283 3300025905 Bacteria 1196
430 Ga0207685_10120325 3300025905 Bacteria 1151
431 Ga0207685_10312104 3300025905 Bacteria 781
432 Ga0207699_10000886 3300025906 Bacteria 14295
433 Ga0207699_10002476 3300025906 Bacteria 8714
434 Ga0207699_10017538 3300025906 Bacteria 3772
435 Ga0207699_10034416 3300025906 Bacteria 2874
436 Ga0207699_10036391 3300025906 Bacteria 2806
437 Ga0207645_10255310 3300025907 Bacteria 1161
438 Ga0207643_10092234 3300025908 Bacteria 1767
439 Ga0207705_10192989 3300025909 Bacteria 1541
440 Ga0207705_10342863 3300025909 Bacteria 1150
441 Ga0207654_10000446 3300025911 Bacteria 23584
442 Ga0207654_10093238 3300025911 Bacteria 1841
443 Ga0207654_10097462 3300025911 Bacteria 1805
444 Ga0207654_10234412 3300025911 Bacteria 1224
445 Ga0207707_10001016 3300025912 Bacteria 26912
446 Ga0207707_10011000 3300025912 Bacteria 7874
447 Ga0207707_10019818 3300025912 Bacteria 5872
448 Ga0207695_10000006 3300025913 Bacteria 1135309
449 Ga0207695_10001480 3300025913 Bacteria 39293
450 Ga0207695_10007711 3300025913 Bacteria 13630
451 Ga0207695_10109077 3300025913 Bacteria 2751
452 Ga0207695_10234230 3300025913 Bacteria 1739
453 Ga0207695_10278423 3300025913 Bacteria 1567
454 Ga0207671_10023100 3300025914 Bacteria 4692
455 Ga0207671_10026440 3300025914 Bacteria 4349
456 Ga0207671_10119378 3300025914 Bacteria 2014
457 Ga0207671_10124980 3300025914 Bacteria 1969
458 Ga0207671_10388054 3300025914 Bacteria 1110
459 Ga0207693_10009325 3300025915 Bacteria 8001
460 Ga0207693_10017747 3300025915 Bacteria 5675
461 Ga0207693_10089742 3300025915 Bacteria 2409
462 Ga0207693_10114318 3300025915 Bacteria 2118
463 Ga0207663_10000175 3300025916 Bacteria 28725
464 Ga0207663_10006211 3300025916 Bacteria 6091
465 Ga0207663_10025502 3300025916 Bacteria 3419
466 Ga0207663_10066321 3300025916 Bacteria 2310
467 Ga0207660_10000924 3300025917 Bacteria 19378
468 Ga0207660_10030322 3300025917 Bacteria 3717
469 Ga0207660_10047947 3300025917 Bacteria 3022
470 Ga0207657_10001391 3300025919 Bacteria 25799
471 Ga0207657_10005387 3300025919 Bacteria 13382
472 Ga0207657_10093424 3300025919 Bacteria 2506
473 Ga0207657_10299202 3300025919 Bacteria 1275
474 Ga0207657_10513144 3300025919 Bacteria 938
475 Ga0207649_10337619 3300025920 Bacteria 1112
476 Ga0207652_10003893 3300025921 Bacteria 12209
477 Ga0207652_10025815 3300025921 Bacteria 4888
478 Ga0207652_10158337 3300025921 Bacteria 2029
479 Ga0207646_10247409 3300025922 Bacteria 1610
480 Ga0207646_10261644 3300025922 Bacteria 1563
481 Ga0207694_10000136 3300025924 Bacteria 74908
482 Ga0207694_10017893 3300025924 Bacteria 5357
483 Ga0207694_10030192 3300025924 Bacteria 4139
484 Ga0207694_10177989 3300025924 Bacteria 1724
485 Ga0207694_10264468 3300025924 Bacteria 1410
486 Ga0207650_10245228 3300025925 Bacteria 1449
487 Ga0207659_10306420 3300025926 Bacteria 1306
488 Ga0207659_10479667 3300025926 Bacteria 1051
489 Ga0207687_10021012 3300025927 Bacteria 4335
490 Ga0207687_10287346 3300025927 Bacteria 1320
491 Ga0207700_10010911 3300025928 Bacteria 5768
492 Ga0207700_10105626 3300025928 Bacteria 2256
493 Ga0207700_10258635 3300025928 Bacteria 1490
494 Ga0207700_10303157 3300025928 Bacteria 1380
495 Ga0207700_10456751 3300025928 Bacteria 1126
496 Ga0207700_10545000 3300025928 Bacteria 1029
497 Ga0207700_10697227 3300025928 Bacteria 906
498 Ga0207700_10874417 3300025928 Bacteria 804
499 Ga0207664_10059318 3300025929 Bacteria 3046
500 Ga0207664_10167671 3300025929 Bacteria 1877
501 Ga0207664_10257075 3300025929 Bacteria 1526
502 Ga0207644_10033155 3300025931 Bacteria 3607
503 Ga0207644_10175774 3300025931 Bacteria 1675
504 Ga0207644_10201610 3300025931 Bacteria 1570
505 Ga0207644_10528968 3300025931 Bacteria 974
506 Ga0207690_10249924 3300025932 Bacteria 1369
507 Ga0207706_10020636 3300025933 Bacteria 5921
508 Ga0207706_10284054 3300025933 Bacteria 1443
509 Ga0207706_10467045 3300025933 Bacteria 1091
510 Ga0207709_10041130 3300025935 Bacteria 2772
511 Ga0207669_10007035 3300025937 Bacteria 5176
512 Ga0207704_10069991 3300025938 Bacteria 2220
513 Ga0207665_10000525 3300025939 Bacteria 25804
514 Ga0207665_10004656 3300025939 Bacteria 9112
515 Ga0207665_10091265 3300025939 Bacteria 2112
516 Ga0207665_10159842 3300025939 Bacteria 1620
517 Ga0207691_10388593 3300025940 Bacteria 1191
518 Ga0207691_10486764 3300025940 Bacteria 1048
519 Ga0207689_10166013 3300025942 Bacteria 1819
520 Ga0207689_10177802 3300025942 Bacteria 1755
521 Ga0207689_10184753 3300025942 Bacteria 1719
522 Ga0207689_10510341 3300025942 Bacteria 1008
523 Ga0207679_10266933 3300025945 Bacteria 1462
524 Ga0207679_10619382 3300025945 Bacteria 977
525 Ga0207667_10011614 3300025949 Bacteria 10225
526 Ga0207667_10032595 3300025949 Bacteria 5612
527 Ga0207667_10039623 3300025949 Bacteria 5021
528 Ga0207667_10050380 3300025949 Bacteria 4394
529 Ga0207667_10101111 3300025949 Bacteria 2974
530 Ga0207667_10108706 3300025949 Bacteria 2860
531 Ga0207667_10217185 3300025949 Bacteria 1959
532 Ga0207667_10223458 3300025949 Bacteria 1929
533 Ga0207667_10320854 3300025949 Bacteria 1582
534 Ga0207667_10321844 3300025949 Bacteria 1579
535 Ga0207667_10323219 3300025949 Bacteria 1576
536 Ga0207667_10755816 3300025949 Bacteria 971
537 Ga0207712_10433236 3300025961 Bacteria 1112
538 Ga0207712_10616914 3300025961 Bacteria 940
539 Ga0207668_10008217 3300025972 Bacteria 6216
540 Ga0207668_10231719 3300025972 Bacteria 1489
541 Ga0207668_10489503 3300025972 Bacteria 1056
542 Ga0207668_10529886 3300025972 Bacteria 1017
543 Ga0207640_10021128 3300025981 Bacteria 3874
544 Ga0207640_10072615 3300025981 Bacteria 2322
545 Ga0207640_10396898 3300025981 Bacteria 1122
546 Ga0207640_10451005 3300025981 Bacteria 1060
547 Ga0207677_10249345 3300026023 Bacteria 1441
548 Ga0207703_10411871 3300026035 Bacteria 1256
549 Ga0207703_10745373 3300026035 Bacteria 933
550 Ga0207703_10976071 3300026035 Bacteria 812
551 Ga0207639_10022760 3300026041 Bacteria 4517
552 Ga0207639_10030927 3300026041 Bacteria 3931
553 Ga0207639_10036177 3300026041 Bacteria 3657
554 Ga0207639_10050493 3300026041 Bacteria 3159
555 Ga0207639_10098940 3300026041 Bacteria 2352
556 Ga0207639_10249569 3300026041 Bacteria 1547
557 Ga0207639_10337264 3300026041 Bacteria 1343
558 Ga0207678_10004216 3300026067 Bacteria 12904
559 Ga0207678_10025952 3300026067 Bacteria 5112
560 Ga0207678_10089469 3300026067 Bacteria 2631
561 Ga0207678_10099974 3300026067 Bacteria 2478
562 Ga0207678_10123758 3300026067 Bacteria 2207
563 Ga0207678_10139654 3300026067 Bacteria 2068
564 Ga0207678_10185063 3300026067 Bacteria 1779
565 Ga0207678_10209000 3300026067 Bacteria 1669
566 Ga0207678_10227790 3300026067 Bacteria 1596
567 Ga0207678_10268443 3300026067 Bacteria 1463
568 Ga0207678_10268919 3300026067 Bacteria 1461
569 Ga0207708_10049842 3300026075 Bacteria 3189
570 Ga0207702_10000006 3300026078 Bacteria 346370
571 Ga0207702_10002502 3300026078 Bacteria 17348
572 Ga0207702_10013602 3300026078 Bacteria 6756
573 Ga0207702_10068824 3300026078 Bacteria 3042
574 Ga0207702_10229418 3300026078 Bacteria 1734
575 Ga0207702_10549620 3300026078 Bacteria 1129
576 Ga0207641_10214620 3300026088 Bacteria 1781
577 Ga0207648_10097170 3300026089 Bacteria 2578
578 Ga0207648_10319147 3300026089 Bacteria 1396
579 Ga0207648_10632539 3300026089 Bacteria 988
580 Ga0207676_10096351 3300026095 Bacteria 2442
581 Ga0207674_10012767 3300026116 Bacteria 9383
582 Ga0207674_10016173 3300026116 Bacteria 8171
583 Ga0207674_10037575 3300026116 Bacteria 5034
584 Ga0207674_10091381 3300026116 Bacteria 3034
585 Ga0207674_10204650 3300026116 Bacteria 1923
586 Ga0207674_10408732 3300026116 Bacteria 1312
587 Ga0207674_10419599 3300026116 Bacteria 1293
588 Ga0207675_100049241 3300026118 Bacteria 3933
589 Ga0207675_100251674 3300026118 Bacteria 1710
590 Ga0207675_100354455 3300026118 Bacteria 1438
591 Ga0207675_100687606 3300026118 Bacteria 1031
592 Ga0207683_10029544 3300026121 Bacteria 4746
593 Ga0207683_10827300 3300026121 Bacteria 859
594 Ga0207698_10086637 3300026142 Bacteria 2548
595 Ga0207698_10347583 3300026142 Bacteria 1399
596 Ga0207698_10458031 3300026142 Bacteria 1233
597 Ga0207698_10520704 3300026142 Bacteria 1160
598 Ga0207698_10559721 3300026142 Bacteria 1122
599 Ga0209389_1000021 3300027296 Bacteria 169506
600 Ga0209389_1000120 3300027296 Bacteria 70535
601 Ga0209589_1000005 3300027357 Bacteria 530958
602 Ga0209589_1000027 3300027357 Bacteria 155295
603 Ga0209489_100005 3300027361 Bacteria 530958
604 Ga0209489_100023 3300027361 Bacteria 198829
605 Ga0209489_100742 3300027361 Bacteria 64218
606 Ga0209700_100006 3300027363 Bacteria 530958
607 Ga0209700_100134 3300027363 Bacteria 112846
608 Ga0209813_10050531 3300027866 Bacteria 1298
609 Ga0268266_10001136 3300028379 Bacteria 33101
610 Ga0268266_10003686 3300028379 Bacteria 15118
611 Ga0268266_10031172 3300028379 Bacteria 4526
612 Ga0268266_10094515 3300028379 Bacteria 2624
613 Ga0268266_10212623 3300028379 Bacteria 1774
614 Ga0268266_10367028 3300028379 Bacteria 1355
615 Ga0268266_10535896 3300028379 Bacteria 1120
616 Ga0268265_10124640 3300028380 Bacteria 2129
617 Ga0268265_10271215 3300028380 Bacteria 1513
618 Ga0268264_10000185 3300028381 Bacteria 131374
619 Ga0268264_10233636 3300028381 Bacteria 1699
620 Ga0268264_10270804 3300028381 Bacteria 1586
621 Ga0268264_10557854 3300028381 Bacteria 1124
622 Ga0265323_10047489 3300028653 Bacteria 1535
623 Ga0265336_10000415 3300028666 Bacteria 26412
624 Ga0307517_10000098 3300028786 Bacteria 126044
625 Ga0307515_10104075 3300028794 Bacteria 3396
626 Ga0307515_10378216 3300028794 Bacteria 1050
627 Ga0307511_10050282 3300030521 Bacteria 3359
628 Ga0307511_10112612 3300030521 Bacteria 1724
629 Ga0265763_1002394 3300030763 Bacteria 1436
630 Ga0265330_10022841 3300031235 Bacteria 2844
631 Ga0265330_10070540 3300031235 Bacteria 1512
632 Ga0265330_10102798 3300031235 Bacteria 1222
633 Ga0265332_10115012 3300031238 Bacteria 1132
634 Ga0265325_10030068 3300031241 Bacteria 2915
635 Ga0265329_10087994 3300031242 Bacteria 985
636 Ga0265340_10006734 3300031247 Bacteria 6293
637 Ga0265339_10000906 3300031249 Bacteria 22779
638 Ga0265316_10167245 3300031344 Bacteria 1642
639 Ga0307513_10014560 3300031456 Bacteria 9577
640 Ga0307513_10379211 3300031456 Bacteria 1154
641 Ga0307509_10043196 3300031507 Bacteria 4879
642 Ga0307509_10123960 3300031507 Bacteria 2554
643 Ga0307509_10128015 3300031507 Bacteria 2501
644 Ga0307509_10180048 3300031507 Bacteria 1980
645 Ga0307509_10232256 3300031507 Bacteria 1646
646 Ga0307509_10295143 3300031507 Bacteria 1372
647 Ga0307408_100678065 3300031548 Bacteria 924
648 Ga0307508_10000012 3300031616 Bacteria 243167
649 Ga0307508_10205567 3300031616 Bacteria 1569
650 Ga0307508_10331970 3300031616 Bacteria 1112
651 Ga0265314_10014193 3300031711 Bacteria 6390
652 Ga0265314_10028062 3300031711 Bacteria 4203
653 Ga0265314_10149051 3300031711 Bacteria 1437
654 Ga0265314_10278961 3300031711 Bacteria 946
655 Ga0265342_10003016 3300031712 Bacteria 14114
656 Ga0307516_10008865 3300031730 Bacteria 11295
657 Ga0307516_10277261 3300031730 Bacteria 1360
658 Ga0307516_10355841 3300031730 Bacteria 1129
659 Ga0307405_10059833 3300031731 Bacteria 2402
660 Ga0307410_10251268 3300031852 Bacteria 1375
661 Ga0307410_10422215 3300031852 Bacteria 1082
662 Ga0307406_10302548 3300031901 Bacteria 1229
663 Ga0307406_10600384 3300031901 Bacteria 907
664 Ga0307412_10076186 3300031911 Bacteria 2304
665 Ga0307412_10176842 3300031911 Bacteria 1601
666 Ga0307409_100168169 3300031995 Bacteria 1926
667 Ga0307414_10445796 3300032004 Bacteria 1134
668 Ga0307414_10921453 3300032004 Bacteria 802
669 Ga0307411_10076739 3300032005 Bacteria 2285
670 Ga0307411_10167068 3300032005 Bacteria 1655
671 Ga0307411_10695831 3300032005 Bacteria 885
672 Ga0307415_100042705 3300032126 Bacteria 3019
673 Ga0307507_10160269 3300033179 Bacteria 1664
674 Ga0307510_10007562 3300033180 Bacteria 12946
675 Ga0307510_10066813 3300033180 Bacteria 3627
676 Ga0307510_10101326 3300033180 Bacteria 2668
677 Ga0307510_10194593 3300033180 Bacteria 1571
678 Ga0315911_1000005 3300033442 Bacteria 426255
679 Ga0316215_1001897 3300033544 Bacteria 1980
680 Ga0373958_0013101 3300034819 Bacteria 1430
681 Ga0373926_0125648 3300035083 Bacteria 969
682 Ga0373929_0044211 3300035085 Bacteria 999
683 Ga0373944_0090449 3300035089 Bacteria 1022
684 Ga0373944_0105147 3300035089 Bacteria 958
685 Ga0373951_0044318 3300035091 Bacteria 1080
686 Ga0373952_0052584 3300035092 Bacteria 975
687 Ga0373923_0001382 3300035111 Bacteria 6917
688 Ga0373923_0002101 3300035111 Bacteria 6035
689 Ga0373923_0148183 3300035111 Bacteria 1064
690 Ga0373936_0043384 3300035113 Bacteria 1807
691 Ga0373936_0052240 3300035113 Bacteria 1655
692 Ga0373936_0138144 3300035113 Bacteria 1051
693 Ga0373941_0041926 3300035115 Bacteria 1419
694 Ga0373953_0000985 3300035117 Bacteria 8003
695 Ga0373953_0004518 3300035117 Bacteria 4445
696 Ga0373953_0250028 3300035117 Bacteria 770
697 Ga0373954_0001160 3300035118 Bacteria 10599
698 Ga0373954_0003164 3300035118 Bacteria 6955
699 Ga0373954_0004646 3300035118 Bacteria 5922
700 Ga0373954_0271664 3300035118 Bacteria 835
701 Ga0373956_0001463 3300035119 Bacteria 9760
702 Ga0373956_0032250 3300035119 Bacteria 2298
703 Ga0373956_0058883 3300035119 Bacteria 1737
704 Ga0373957_0010109 3300035120 Bacteria 3108
705 Ga0373957_0015715 3300035120 Bacteria 2610
706 Ga0373957_0166333 3300035120 Bacteria 910
707 Ga0373960_0006254 3300035121 Bacteria 2789
708 Ga0373943_0020170 3300035170 Bacteria 3071
709 Ga0373943_0121755 3300035170 Bacteria 1387
710 Ga0373943_0261882 3300035170 Bacteria 974
711 Ga0373946_0013105 3300035171 Bacteria 3111
712 Ga0373946_0159688 3300035171 Bacteria 1057
713 Ga0373955_0001372 3300035172 Bacteria 10349
714 Ga0373955_0012729 3300035172 Bacteria 4051
715 Ga0373955_0022165 3300035172 Bacteria 3218
716 Ga0373942_0014531 3300035207 Bacteria 1908
717 Ga0373942_0054265 3300035207 Bacteria 1132
718 Ga0373961_0026944 3300035241 Bacteria 1574
719 Ga0373962_0044737 3300035242 Bacteria 1258
720 Ga0373924_0018660 3300035410 Bacteria 2676
721 Ga0373924_0027315 3300035410 Bacteria 2268
722 Ga0373924_0076217 3300035410 Bacteria 1420
723 Ga0373931_0001100 3300035691 Bacteria 11473
724 Ga0373931_0003428 3300035691 Bacteria 7118
725 Ga0373931_0211512 3300035691 Bacteria 1163
726 Ga0373935_0000520 3300035692 Bacteria 20054
727 Ga0373935_0097809 3300035692 Bacteria 1931
728 Ga0373935_0127371 3300035692 Bacteria 1707
729 Ga0373935_0247709 3300035692 Bacteria 1246
730 Ga0373935_0312586 3300035692 Bacteria 1113
731 Ga0373935_0340452 3300035692 Bacteria 1068
732 Ga0373927_0000046 3300035695 Bacteria 88401
733 Ga0373927_0005938 3300035695 Bacteria 8359
734 Ga0373927_0009305 3300035695 Bacteria 6590
735 Ga0373927_0015109 3300035695 Bacteria 5104
736 Ga0373927_0039246 3300035695 Bacteria 3073
737 Ga0373927_0155395 3300035695 Bacteria 1498
738 Ga0373933_0000026 3300035724 Bacteria 90309
739 Ga0373933_0006390 3300035724 Bacteria 6414
740 Ga0373933_0017205 3300035724 Bacteria 4053
741 Ga0373933_0028682 3300035724 Bacteria 3212
742 Ga0373933_0073161 3300035724 Bacteria 2088
743 Ga0373947_0001392 3300035725 Bacteria 14902
744 Ga0373947_0002439 3300035725 Bacteria 11211
745 Ga0373947_0052793 3300035725 Bacteria 2449
746 Ga0373947_0303254 3300035725 Bacteria 1065
747 Ga0373937_0016441 3300036401 Bacteria 6572
748 Ga0373937_0048844 3300036401 Bacteria 3874
749 Ga0373937_0112764 3300036401 Bacteria 2530
750 Ga0373937_0168370 3300036401 Bacteria 2055
751 Ga0373937_0376743 3300036401 Bacteria 1346
752 Ga0372808_008862 3300036459 Bacteria 1399
753 Ga0373925_0009905 3300037068 Bacteria 6924
754 Ga0373925_0013452 3300037068 Bacteria 5923
755 Ga0373925_0062764 3300037068 Bacteria 2794
756 Ga0373925_0134813 3300037068 Bacteria 1929
757 Ga0395900_0016187 3300037418 Bacteria 7597
758 Ga0395900_0020667 3300037418 Bacteria 6728
759 Ga0395900_0032079 3300037418 Bacteria 5401
760 Ga0395900_0174183 3300037418 Bacteria 2189
761 Ga0395900_0179879 3300037418 Bacteria 2150
762 Ga0395898_0035872 3300037466 Bacteria 4928
763 Ga0395898_0270372 3300037466 Bacteria 1621
764 Ga0395898_0409137 3300037466 Bacteria 1293
765 Ga0395905_0025920 3300037471 Bacteria 5526
766 Ga0395905_0081275 3300037471 Bacteria 3037
767 Ga0395905_0081461 3300037471 Bacteria 3033
768 Ga0436364_0224834 3300037853 Bacteria 2511
769 Ga0436364_0328296 3300037853 Bacteria 143298
770 Ga0436364_0796332 3300037853 Bacteria 1367
771 Ga0436364_1001125 3300037853 Bacteria 847
772 Ga0436364_1109971 3300037853 Bacteria 20298
773 Ga0395901_0050817 3300038443 Bacteria 4307
774 Ga0395901_0178216 3300038443 Bacteria 2229
775 Ga0436365_0221110 3300039437 Bacteria 888
776 Ga0436365_0600630 3300039437 Bacteria 1699
777 Ga0436365_0709391 3300039437 Bacteria 2814
778 Ga0436365_0921625 3300039437 Bacteria 24575
779 Ga0436365_0939476 3300039437 Bacteria 1745
780 Ga0436365_1231387 3300039437 Bacteria 2949
781 Ga0436365_1846147 3300039437 Bacteria 1309
782 Ga0436360_0159371 3300039438 Bacteria 1756
783 Ga0436361_0298970 3300039447 Bacteria 1128
784 Ga0436361_0873949 3300039447 Bacteria 1284
785 Ga0436361_1011559 3300039447 Bacteria 1721
786 Ga0436363_0355443 3300039450 Bacteria 1824
787 Ga0436363_0468710 3300039450 Bacteria 3616
788 Ga0436363_0615662 3300039450 Bacteria 1170
789 Ga0436363_0726412 3300039450 Bacteria 11305
790 Ga0436363_1594013 3300039450 Bacteria 913
791 Ga0436362_0496995 3300039453 Bacteria 1817
792 Ga0436362_0763354 3300039453 Bacteria 1643
793 Ga0436362_0804184 3300039453 Bacteria 773
794 Ga0439465_0039024 3300041413 Bacteria 1532
795 Ga0451802_0319345 3300041460 Bacteria 1051
796 Ga0451851_0100858 3300041507 Bacteria 1568
797 Ga0451853_2272543 3300041512 Bacteria 1216
798 Ga0439463_029581 3300042016 Bacteria 1380
799 Ga0439464_0074624 3300042439 Bacteria 1007
800 Ga0466969_0037230 3300044656 Bacteria 2455
801 Ga0466972_0000126 3300044658 Bacteria 64766
802 Ga0466972_0013988 3300044658 Bacteria 4024
803 Ga0466966_0001157 3300044684 Bacteria 16957
804 Ga0466966_0339054 3300044684 Bacteria 903
805 Ga0466961_0000025 3300044693 Bacteria 96344
806 Ga0466963_0031093 3300044694 Bacteria 3449
807 Ga0466963_0138053 3300044694 Bacteria 1688
808 Ga0466964_0024242 3300044706 Bacteria 2363
809 Ga0466964_0054150 3300044706 Bacteria 1653
810 Ga0466964_0245229 3300044706 Bacteria 881
811 Ga0466968_0003372 3300044735 Bacteria 5903
812 Ga0466968_0157046 3300044735 Bacteria 1048
813 Ga0466957_0057047 3300044842 Bacteria 2389
814 Ga0466960_0008649 3300044901 Bacteria 4174
815 Ga0466959_0000873 3300045049 Bacteria 17751
816 Ga0466967_0130167 3300045976 Bacteria 2335
817 Ga0466967_0192733 3300045976 Bacteria 1927
818 Ga0466967_0497597 3300045976 Bacteria 1196
819 Ga0466967_0783637 3300045976 Bacteria 946
820 Ga0495617_007122 3300046452 Bacteria 3898
821 Ga0495617_033379 3300046452 Bacteria 1727
822 Ga0495592_0001238 3300046454 Bacteria 17695
823 Ga0495592_0071092 3300046454 Bacteria 2534
824 Ga0495592_0136576 3300046454 Bacteria 1709
825 Ga0495592_0171163 3300046454 Bacteria 1487
826 Ga0495592_0293095 3300046454 Bacteria 1060
827 Ga0495592_0296046 3300046454 Bacteria 1053
828 Ga0495603_0000051 3300046455 Bacteria 50402
829 Ga0495603_0043229 3300046455 Bacteria 2691
830 Ga0495603_0074766 3300046455 Bacteria 1989
831 Ga0495603_0203339 3300046455 Bacteria 1145
832 Ga0495603_0236613 3300046455 Bacteria 1052
833 Ga0495629_0000182 3300046459 Bacteria 56655
834 Ga0495629_0000750 3300046459 Bacteria 26239
835 Ga0495629_0006753 3300046459 Bacteria 8483
836 Ga0495638_0003938 3300046460 Bacteria 11448
837 Ga0495638_0021430 3300046460 Bacteria 4259
838 Ga0495638_0311579 3300046460 Bacteria 844
839 Ga0495641_0006374 3300046461 Bacteria 7658
840 Ga0495651_0015643 3300046462 Bacteria 5873
841 Ga0495651_0019393 3300046462 Bacteria 5271
842 Ga0495651_0047283 3300046462 Bacteria 3328
843 Ga0495653_0014575 3300046463 Bacteria 6416
844 Ga0495653_0065346 3300046463 Bacteria 2738
845 Ga0495653_0193226 3300046463 Bacteria 1387
846 Ga0495653_0241395 3300046463 Bacteria 1204
847 Ga0495580_0004021 3300046472 Bacteria 12411
848 Ga0495580_0012063 3300046472 Bacteria 6652
849 Ga0495580_0214672 3300046472 Bacteria 1323
850 Ga0495582_0000137 3300046473 Bacteria 39425
851 Ga0495582_0157604 3300046473 Bacteria 1290
852 Ga0495582_0172306 3300046473 Bacteria 1232
853 Ga0495582_0269021 3300046473 Bacteria 978
854 Ga0495605_0073209 3300046474 Bacteria 1614
855 Ga0495605_0207331 3300046474 Bacteria 852
856 Ga0495639_0002873 3300046475 Bacteria 7493
857 Ga0495639_0050090 3300046475 Bacteria 1897
858 Ga0495639_0072703 3300046475 Bacteria 1590
859 Ga0495639_0308456 3300046475 Bacteria 790
860 Ga0495662_0000583 3300046476 Bacteria 16810
861 Ga0495662_0121487 3300046476 Bacteria 1282
862 Ga0495662_0160899 3300046476 Bacteria 1106
863 Ga0495662_0244340 3300046476 Bacteria 884
864 Ga0495664_0009075 3300046477 Bacteria 5560
865 Ga0495664_0028765 3300046477 Bacteria 3246
866 Ga0495664_0055529 3300046477 Bacteria 2356
867 Ga0495664_0095702 3300046477 Bacteria 1787
868 Ga0495664_0098986 3300046477 Bacteria 1756
869 Ga0495664_0338305 3300046477 Bacteria 907
870 Ga0495664_0378697 3300046477 Bacteria 851
871 Ga0495584_0024795 3300046491 Bacteria 3041
872 Ga0495584_0047078 3300046491 Bacteria 2175
873 Ga0495584_0197946 3300046491 Bacteria 1021
874 Ga0495585_0029073 3300046492 Bacteria 3148
875 Ga0495585_0202481 3300046492 Bacteria 1010
876 Ga0495594_0001833 3300046499 Bacteria 11057
877 Ga0495594_0042613 3300046499 Bacteria 2486
878 Ga0495594_0049922 3300046499 Bacteria 2300
879 Ga0495594_0176874 3300046499 Bacteria 1214
880 Ga0495594_0332935 3300046499 Bacteria 865
881 Ga0495596_0059130 3300046500 Bacteria 1494
882 Ga0495583_0025223 3300046506 Bacteria 2974
883 Ga0495606_0001505 3300046507 Bacteria 30975
884 Ga0495606_0012177 3300046507 Bacteria 6932
885 Ga0495606_0064028 3300046507 Bacteria 2342
886 Ga0495606_0176508 3300046507 Bacteria 1235
887 Ga0495606_0281926 3300046507 Bacteria 908
888 Ga0495608_0000738 3300046511 Bacteria 22828
889 Ga0495608_0060188 3300046511 Bacteria 2499
890 Ga0495608_0066723 3300046511 Bacteria 2355
891 Ga0495610_0089149 3300046512 Bacteria 1401
892 Ga0495616_0104198 3300046513 Bacteria 1326
893 Ga0495616_0116693 3300046513 Bacteria 1235
894 Ga0495616_0179280 3300046513 Bacteria 942
895 Ga0495618_0012424 3300046514 Bacteria 5172
896 Ga0495618_0075980 3300046514 Bacteria 2140
897 Ga0495618_0240434 3300046514 Bacteria 1138
898 Ga0495620_0084717 3300046515 Bacteria 1278
899 Ga0495620_0121754 3300046515 Bacteria 1028
900 Ga0495628_0021321 3300046516 Bacteria 5332
901 Ga0495628_0033413 3300046516 Bacteria 4147
902 Ga0495628_0034008 3300046516 Bacteria 4103
903 Ga0495628_0259219 3300046516 Bacteria 1296
904 Ga0495630_0002625 3300046517 Bacteria 12446
905 Ga0495630_0062540 3300046517 Bacteria 2796
906 Ga0495631_0015803 3300046518 Bacteria 3609
907 Ga0495632_0094535 3300046519 Bacteria 1413
908 Ga0495632_0127013 3300046519 Bacteria 1188
909 Ga0495637_0165966 3300046520 Bacteria 826
910 Ga0495643_0012291 3300046522 Bacteria 5170
911 Ga0495643_0049687 3300046522 Bacteria 2261
912 Ga0495644_0052273 3300046523 Bacteria 1534
913 Ga0495648_0001119 3300046524 Bacteria 27174
914 Ga0495648_0093465 3300046524 Bacteria 1677
915 Ga0495648_0138167 3300046524 Bacteria 1286
916 Ga0495648_0143187 3300046524 Bacteria 1256
917 Ga0495648_0204372 3300046524 Bacteria 986
918 Ga0495666_0035675 3300046526 Bacteria 2423
919 Ga0495642_0132019 3300046528 Bacteria 1075
920 Ga0495652_0004125 3300046529 Bacteria 14021
921 Ga0495652_0035614 3300046529 Bacteria 4331
922 Ga0495652_0037670 3300046529 Bacteria 4194
923 Ga0495652_0041725 3300046529 Bacteria 3959
924 Ga0495652_0119701 3300046529 Bacteria 2102
925 Ga0495652_0187308 3300046529 Bacteria 1582
926 Ga0495652_0384571 3300046529 Bacteria 997
927 Ga0495665_0001239 3300046531 Bacteria 13612
928 Ga0495665_0020494 3300046531 Bacteria 3551
929 Ga0495640_0011216 3300046533 Bacteria 6899
930 Ga0495640_0041782 3300046533 Bacteria 3202
931 Ga0495640_0055752 3300046533 Bacteria 2703
932 Ga0495640_0071490 3300046533 Bacteria 2328
933 Ga0495640_0132243 3300046533 Bacteria 1614
934 Ga0495586_0037182 3300046535 Bacteria 2613
935 Ga0495587_0012212 3300046536 Bacteria 5423
936 Ga0495587_0070475 3300046536 Bacteria 2034
937 Ga0495587_0115572 3300046536 Bacteria 1539
938 Ga0495598_0079149 3300046537 Bacteria 1051
939 Ga0495609_0028259 3300046538 Bacteria 2560
940 Ga0495621_0018971 3300046539 Bacteria 2240
941 Ga0495597_0033416 3300046542 Bacteria 2329
942 Ga0495645_0025912 3300046543 Bacteria 4256
943 Ga0495645_0066982 3300046543 Bacteria 2593
944 Ga0495622_0005490 3300046557 Bacteria 5879
945 Ga0495622_0016785 3300046557 Bacteria 3410
946 Ga0495633_0053651 3300046558 Bacteria 1897
947 Ga0495633_0179924 3300046558 Bacteria 973
948 Ga0495667_0067100 3300046559 Bacteria 2345
949 Ga0495667_0112302 3300046559 Bacteria 1761
950 Ga0495667_0187630 3300046559 Bacteria 1326
951 Ga0495667_0428145 3300046559 Bacteria 832
952 Ga0495656_0084365 3300046615 Bacteria 1440
953 Ga0495668_0026683 3300046616 Bacteria 3276
954 Ga0495668_0029734 3300046616 Bacteria 3086
955 Ga0495668_0082172 3300046616 Bacteria 1767
956 Ga0495634_0002221 3300046642 Bacteria 16276
957 Ga0495634_0018650 3300046642 Bacteria 4935
958 Ga0495634_0025310 3300046642 Bacteria 4155
959 Ga0495634_0037628 3300046642 Bacteria 3305
960 Ga0495634_0109829 3300046642 Bacteria 1774
961 Ga0495611_0043715 3300046648 Bacteria 2003
962 Ga0495625_0058534 3300046660 Bacteria 2738
963 Ga0495625_0380108 3300046660 Bacteria 886
964 Ga0495635_0000166 3300046663 Bacteria 40939
965 Ga0495635_0001455 3300046663 Bacteria 15846
966 Ga0495635_0001614 3300046663 Bacteria 15168
967 Ga0495635_0021252 3300046663 Bacteria 4524
968 Ga0495635_0116182 3300046663 Bacteria 1826
969 Ga0495659_0095246 3300046664 Bacteria 1147
970 Ga0495659_0121847 3300046664 Bacteria 1027
971 Ga0495661_0258832 3300046665 Bacteria 885
972 Ga0495588_0007336 3300046674 Bacteria 5012
973 Ga0495588_0046469 3300046674 Bacteria 2227
974 Ga0495588_0110523 3300046674 Bacteria 1448
975 Ga0495657_0004131 3300046675 Bacteria 11623
976 Ga0495657_0007196 3300046675 Bacteria 8628
977 Ga0495657_0018249 3300046675 Bacteria 5083
978 Ga0495657_0147798 3300046675 Bacteria 1461
979 Ga0495657_0203447 3300046675 Bacteria 1206
980 Ga0495599_0004838 3300046678 Bacteria 8011
981 Ga0495599_0005025 3300046678 Bacteria 7865
982 Ga0495599_0012226 3300046678 Bacteria 5288
983 Ga0495599_0188922 3300046678 Bacteria 1268
984 Ga0495599_0205758 3300046678 Bacteria 1208
985 Ga0495599_0362565 3300046678 Bacteria 868
986 Ga0495623_0002267 3300046679 Bacteria 12801
987 Ga0495623_0188426 3300046679 Bacteria 1194
988 Ga0495646_0019980 3300046680 Bacteria 4235
989 Ga0495646_0020107 3300046680 Bacteria 4221
990 Ga0495646_0060132 3300046680 Bacteria 2267
991 Ga0495646_0067140 3300046680 Bacteria 2120
992 Ga0495646_0148533 3300046680 Bacteria 1305
993 Ga0495647_0032438 3300046681 Bacteria 1946
994 Ga0495647_0071742 3300046681 Bacteria 1388
995 Ga0495658_0008017 3300046683 Bacteria 5231
996 Ga0495658_0074828 3300046683 Bacteria 1974
997 Ga0495658_0112303 3300046683 Bacteria 1640
998 Ga0495658_0396400 3300046683 Bacteria 880
999 Ga0495669_0061491 3300046684 Bacteria 1699
1000 Ga0495669_0108830 3300046684 Bacteria 1292
1001 Ga0495669_0136339 3300046684 Bacteria 1157
1002 Ga0495613_0047965 3300046689 Bacteria 3154
1003 Ga0495613_0114323 3300046689 Bacteria 1943
1004 Ga0495613_0132297 3300046689 Bacteria 1786
1005 Ga0495613_0196387 3300046689 Bacteria 1424
1006 Ga0495613_0273679 3300046689 Bacteria 1174
1007 Ga0495624_0000898 3300046690 Bacteria 23624
1008 Ga0495624_0018283 3300046690 Bacteria 4689
1009 Ga0495624_0048677 3300046690 Bacteria 2689
1010 Ga0495624_0085390 3300046690 Bacteria 1950
1011 Ga0495671_0161490 3300046692 Bacteria 1090
1012 Ga0495649_0011337 3300046694 Bacteria 5233
1013 Ga0495649_0146140 3300046694 Bacteria 1243
1014 Ga0495589_0117431 3300046794 Bacteria 1282
1015 Ga0495600_0008000 3300046809 Bacteria 6479
1016 Ga0495600_0011474 3300046809 Bacteria 5522
1017 Ga0495600_0035461 3300046809 Bacteria 3240
1018 Ga0495600_0035500 3300046809 Bacteria 3238
1019 Ga0495600_0067086 3300046809 Bacteria 2345
1020 Ga0495581_0007805 3300047315 Bacteria 6197
1021 Ga0495581_0035924 3300047315 Bacteria 2866
1022 Ga0495581_0070797 3300047315 Bacteria 2018
1023 Ga0495581_0081158 3300047315 Bacteria 1878
1024 Ga0495581_0099714 3300047315 Bacteria 1687
1025 Ga0495604_0025793 3300047317 Bacteria 4681
1026 Ga0495604_0047644 3300047317 Bacteria 3337
1027 Ga0495604_0225347 3300047317 Bacteria 1288
1028 Ga0495604_0435960 3300047317 Bacteria 858
1029 Ga0495674_0010092 3300047319 Bacteria 8948
1030 Ga0495674_0011184 3300047319 Bacteria 8474
1031 Ga0495674_0046482 3300047319 Bacteria 3852
1032 Ga0495674_0597790 3300047319 Bacteria 874
1033 Ga0495672_0024126 3300047320 Bacteria 3924
1034 Ga0495672_0092467 3300047320 Bacteria 1658
1035 Ga0495672_0178904 3300047320 Bacteria 1076
1036 Ga0495676_0031814 3300047321 Bacteria 4458
1037 Ga0495676_0203301 3300047321 Bacteria 1375
1038 Ga0495676_0240363 3300047321 Bacteria 1240
1039 Ga0495680_0003456 3300047322 Bacteria 15551
1040 Ga0495680_0016657 3300047322 Bacteria 6307
1041 Ga0495683_0185020 3300047323 Bacteria 949
1042 Ga0495687_040167 3300047443 Bacteria 2063
1043 Ga0495675_0062655 3300047444 Bacteria 2354
1044 Ga0495677_0052671 3300047445 Bacteria 1500
1045 Ga0495685_059934 3300047447 Bacteria 1284
1046 Ga0495673_0022298 3300047469 Bacteria 3107
1047 Ga0495681_0102971 3300047470 Bacteria 1246
1048 Ga0495684_0007715 3300047471 Bacteria 8330
1049 Ga0495684_0064967 3300047471 Bacteria 2773
1050 Ga0495684_0074579 3300047471 Bacteria 2578
1051 Ga0495684_0083133 3300047471 Bacteria 2428
1052 Ga0495686_0033518 3300047472 Bacteria 3315
1053 Ga0495686_0127118 3300047472 Bacteria 1514
1054 Ga0495593_0000469 3300047673 Bacteria 22695
1055 Ga0495593_0006819 3300047673 Bacteria 6685
1056 Ga0495593_0023148 3300047673 Bacteria 3455
1057 Ga0495593_0041675 3300047673 Bacteria 2468
1058 Ga0495593_0130701 3300047673 Bacteria 1275
1059 Ga0495602_0009739 3300048088 Bacteria 9983
1060 Ga0495615_0063028 3300048090 Bacteria 983
1061 Ga0496100_0001098 3300048903 Bacteria 13078
1062 Ga0496100_0126913 3300048903 Bacteria 1791
1063 Ga0496100_0220574 3300048903 Bacteria 1391
1064 Ga0496100_0342189 3300048903 Bacteria 1128
1065 Ga0496101_0011608 3300048904 Bacteria 5851
1066 Ga0496101_0205467 3300048904 Bacteria 1524
1067 Ga0496102_0008520 3300048905 Bacteria 8791
1068 Ga0496102_0092154 3300048905 Bacteria 2806
1069 Ga0496102_0195455 3300048905 Bacteria 1906
1070 Ga0496102_0240520 3300048905 Bacteria 1707
1071 Ga0496102_0649090 3300048905 Bacteria 978
1072 Ga0496103_0037555 3300048906 Bacteria 2968
1073 Ga0496103_0280311 3300048906 Bacteria 1072
1074 Ga0496104_0015075 3300048907 Bacteria 6995
1075 Ga0496104_0026734 3300048907 Bacteria 5332
1076 Ga0496104_0036163 3300048907 Bacteria 4615
1077 Ga0496104_0037264 3300048907 Bacteria 4548
1078 Ga0496104_0097220 3300048907 Bacteria 2818
1079 Ga0496104_0208151 3300048907 Bacteria 1868
1080 Ga0496104_0356829 3300048907 Bacteria 1374
1081 Ga0496104_0396442 3300048907 Bacteria 1292
1082 Ga0496104_0592513 3300048907 Bacteria 1019
1083 Ga0496105_0000208 3300048908 Bacteria 39305
1084 Ga0496105_0030338 3300048908 Bacteria 4430
1085 Ga0496105_0066489 3300048908 Bacteria 2976
1086 Ga0496105_0120936 3300048908 Bacteria 2159
1087 Ga0496105_0375439 3300048908 Bacteria 1132
1088 Ga0496106_0002121 3300048909 Bacteria 14838
1089 Ga0496106_0031033 3300048909 Bacteria 3983
1090 Ga0496106_0123661 3300048909 Bacteria 2024
1091 Ga0496106_0228788 3300048909 Bacteria 1484
1092 Ga0496106_0329249 3300048909 Bacteria 1226
1093 Ga0496106_0419870 3300048909 Bacteria 1075
1094 Ga0496107_0046162 3300048910 Bacteria 3135
1095 Ga0496107_0174158 3300048910 Bacteria 1597
1096 Ga0496107_0307918 3300048910 Bacteria 1179
1097 Ga0496108_0000681 3300048911 Bacteria 26279
1098 Ga0496108_0042075 3300048911 Bacteria 3813
1099 Ga0496108_0122333 3300048911 Bacteria 2233
1100 Ga0496108_0232274 3300048911 Bacteria 1604
1101 Ga0496108_0538366 3300048911 Bacteria 1019
1102 Ga0496109_0000450 3300048912 Bacteria 35265
1103 Ga0496109_0027672 3300048912 Bacteria 5066
1104 Ga0496109_0053052 3300048912 Bacteria 3697
1105 Ga0496109_0167884 3300048912 Bacteria 2058
1106 Ga0496110_0013956 3300048913 Bacteria 6657
1107 Ga0496110_0031106 3300048913 Bacteria 4604
1108 Ga0496110_0037630 3300048913 Bacteria 4206
1109 Ga0496110_0091129 3300048913 Bacteria 2727
1110 Ga0496110_0145854 3300048913 Bacteria 2141
1111 Ga0496110_0369813 3300048913 Bacteria 1306
1112 Ga0496110_0371924 3300048913 Bacteria 1302
1113 Ga0496111_0040302 3300048914 Bacteria 3350
1114 Ga0496111_0184327 3300048914 Bacteria 1552
1115 Ga0496112_0000040 3300048915 Bacteria 89057
1116 Ga0496112_0003971 3300048915 Bacteria 12388
1117 Ga0496112_0005466 3300048915 Bacteria 10997
1118 Ga0496112_0012229 3300048915 Bacteria 7879
1119 Ga0496112_0023844 3300048915 Bacteria 5852
1120 Ga0496112_0025634 3300048915 Bacteria 5663
1121 Ga0496112_0319638 3300048915 Bacteria 1496
1122 Ga0496112_0407027 3300048915 Bacteria 1300
1123 Ga0496112_0816038 3300048915 Bacteria 857
1124 Ga0496113_0015425 3300048916 Bacteria 5250
1125 Ga0496113_0151391 3300048916 Bacteria 1830
1126 Ga0496113_0358608 3300048916 Bacteria 1170
1127 Ga0496113_0453572 3300048916 Bacteria 1030
1128 Ga0496113_0559723 3300048916 Bacteria 917
1129 Ga0496114_0033230 3300048917 Bacteria 4249
1130 Ga0496114_0043995 3300048917 Bacteria 3703
1131 Ga0496114_0108243 3300048917 Bacteria 2379
1132 Ga0496114_0113023 3300048917 Bacteria 2328
1133 Ga0496114_0213364 3300048917 Bacteria 1693
1134 Ga0496114_0236676 3300048917 Bacteria 1605
1135 Ga0496114_0499662 3300048917 Bacteria 1076
1136 Ga0496114_0547196 3300048917 Bacteria 1023
1137 Ga0496114_0757644 3300048917 Bacteria 848
1138 Ga0496115_0017046 3300048918 Bacteria 5541
1139 Ga0496115_0046053 3300048918 Bacteria 3484
1140 Ga0496115_0259875 3300048918 Bacteria 1428
1141 Ga0496115_0318080 3300048918 Bacteria 1273
1142 Ga0496115_0359774 3300048918 Bacteria 1186
1143 Ga0496115_0414887 3300048918 Bacteria 1091
1144 Ga0496116_0164240 3300048919 Bacteria 1213
1145 Ga0496117_0008070 3300048920 Bacteria 10087
1146 Ga0496117_0079878 3300048920 Bacteria 2153
1147 Ga0496117_0125246 3300048920 Bacteria 1570
1148 Ga0496118_0002570 3300048921 Bacteria 24239
1149 Ga0496118_0087129 3300048921 Bacteria 2167
1150 Ga0496118_0142539 3300048921 Bacteria 1516
1151 Ga0496118_0189448 3300048921 Bacteria 1232
1152 Ga0496118_0243919 3300048921 Bacteria 1026
1153 Ga0496119_0043743 3300048922 Bacteria 2827
1154 Ga0496119_0098757 3300048922 Bacteria 1644
1155 Ga0496121_0000265 3300048924 Bacteria 109251
1156 Ga0496121_0001125 3300048924 Bacteria 47001
1157 Ga0496121_0011280 3300048924 Bacteria 9954
1158 Ga0496121_0011669 3300048924 Bacteria 9712
1159 Ga0496121_0028222 3300048924 Bacteria 5229
1160 Ga0496121_0044559 3300048924 Bacteria 3824
1161 Ga0496121_0054026 3300048924 Bacteria 3360
1162 Ga0496121_0112182 3300048924 Bacteria 2077
1163 Ga0496121_0138490 3300048924 Bacteria 1809
1164 Ga0496121_0287384 3300048924 Bacteria 1122
1165 Ga0496121_0440548 3300048924 Bacteria 842
1166 Ga0496122_0259050 3300048925 Bacteria 967
1167 Ga0496122_0295814 3300048925 Bacteria 876
1168 Ga0496124_0001146 3300048927 Bacteria 41561
1169 Ga0496124_0038040 3300048927 Bacteria 4179
1170 Ga0496124_0155785 3300048927 Bacteria 1787
1171 Ga0496124_0215642 3300048927 Bacteria 1448
1172 Ga0496125_0000176 3300048928 Bacteria 140746
1173 Ga0496125_0034884 3300048928 Bacteria 4426
1174 Ga0496125_0065382 3300048928 Bacteria 2882
1175 Ga0496125_0123900 3300048928 Bacteria 1836
1176 Ga0496125_0154485 3300048928 Bacteria 1570
1177 Ga0496125_0195405 3300048928 Bacteria 1331
1178 Ga0496126_0005831 3300048929 Bacteria 13924
1179 Ga0496126_0011852 3300048929 Bacteria 8969
1180 Ga0496126_0015449 3300048929 Bacteria 7677
1181 Ga0496126_0020296 3300048929 Bacteria 6520
1182 Ga0496126_0024497 3300048929 Bacteria 5826
1183 Ga0496126_0032606 3300048929 Bacteria 4906
1184 Ga0496126_0042857 3300048929 Bacteria 4178
1185 Ga0496126_0057447 3300048929 Bacteria 3513
1186 Ga0496126_0070795 3300048929 Bacteria 3106
1187 Ga0496126_0072217 3300048929 Bacteria 3070
1188 Ga0496126_0120816 3300048929 Bacteria 2272
1189 Ga0496126_0121358 3300048929 Bacteria 2266
1190 Ga0496126_0229919 3300048929 Bacteria 1554
1191 Ga0496126_0612167 3300048929 Bacteria 857
1192 Ga0495678_084520 3300049459 Bacteria 1132
1193 Ga0495682_0018288 3300049460 Bacteria 2641
1194 Ga0501031_0001415 3300049568 Bacteria 14850
1195 Ga0501032_0003300 3300049569 Bacteria 12404
1196 Ga0501032_0034880 3300049569 Bacteria 3441
1197 Ga0501032_0047787 3300049569 Bacteria 2889
1198 Ga0501032_0067767 3300049569 Bacteria 2383
1199 Ga0501032_0128686 3300049569 Bacteria 1671
1200 Ga0501033_0000175 3300049570 Bacteria 60845
1201 Ga0501033_0000207 3300049570 Bacteria 56200
1202 Ga0501033_0023002 3300049570 Bacteria 4698
1203 Ga0501033_0060484 3300049570 Bacteria 2794
1204 Ga0501033_0219426 3300049570 Bacteria 1354
1205 Ga0501033_0407430 3300049570 Bacteria 948
1206 Ga0501034_0000202 3300049571 Bacteria 112985
1207 Ga0501034_0052329 3300049571 Bacteria 4114
1208 Ga0501034_0079493 3300049571 Bacteria 3283
1209 Ga0501034_0129594 3300049571 Bacteria 2506
1210 Ga0501034_0178709 3300049571 Bacteria 2087
1211 Ga0501034_0594583 3300049571 Bacteria 1012
1212 Ga0501034_0595299 3300049571 Bacteria 1012
1213 Ga0501034_0723716 3300049571 Bacteria 892
1214 Ga0501036_0000042 3300049572 Bacteria 79876
1215 Ga0501036_0106719 3300049572 Bacteria 2368
1216 Ga0501036_0117764 3300049572 Bacteria 2243
1217 Ga0501036_0503889 3300049572 Bacteria 1007
1218 Ga0501037_0000100 3300049573 Bacteria 81013
1219 Ga0501037_0000334 3300049573 Bacteria 39895
1220 Ga0501037_0212015 3300049573 Bacteria 1365
1221 Ga0501037_0273387 3300049573 Bacteria 1178
1222 Ga0501038_0000157 3300049574 Bacteria 58169
1223 Ga0501038_0043349 3300049574 Bacteria 3912
1224 Ga0501038_0085789 3300049574 Bacteria 2646
1225 Ga0501038_0205940 3300049574 Bacteria 1576
1226 Ga0501039_0000216 3300049575 Bacteria 42349
1227 Ga0501039_0007971 3300049575 Bacteria 8068
1228 Ga0501039_0011255 3300049575 Bacteria 6814
1229 Ga0501039_0298952 3300049575 Bacteria 1265
1230 Ga0501040_0083811 3300049576 Bacteria 2211
1231 Ga0501042_0044070 3300049578 Bacteria 3178
1232 Ga0501042_0053023 3300049578 Bacteria 2893
1233 Ga0501042_0083958 3300049578 Bacteria 2283
1234 Ga0501043_0001316 3300049579 Bacteria 21701
1235 Ga0501043_0040872 3300049579 Bacteria 3644
1236 Ga0501043_0050219 3300049579 Bacteria 3279
1237 Ga0501043_0387968 3300049579 Bacteria 1056
1238 Ga0501046_0000387 3300049580 Bacteria 44269
1239 Ga0501046_0101168 3300049580 Bacteria 2211
1240 Ga0501046_0137214 3300049580 Bacteria 1852
1241 Ga0501047_0000159 3300049581 Bacteria 82106
1242 Ga0501047_0006707 3300049581 Bacteria 10824
1243 Ga0501047_0154680 3300049581 Bacteria 2167
1244 Ga0501047_0389810 3300049581 Bacteria 1226
1245 Ga0501047_0432753 3300049581 Bacteria 1146
1246 Ga0501048_0000655 3300049582 Bacteria 24936
1247 Ga0501048_0197317 3300049582 Bacteria 1426
1248 Ga0501067_0011823 3300049583 Bacteria 4836
1249 Ga0501067_0022683 3300049583 Bacteria 3473
1250 Ga0501068_0000168 3300049584 Bacteria 30562
1251 Ga0501068_0004245 3300049584 Bacteria 7778
1252 Ga0501068_0103177 3300049584 Bacteria 1768
1253 Ga0501069_0002689 3300049585 Bacteria 9073
1254 Ga0501069_0025378 3300049585 Bacteria 3239
1255 Ga0501069_0100739 3300049585 Bacteria 1640
1256 Ga0501070_0002236 3300049586 Bacteria 17009
1257 Ga0501070_0004540 3300049586 Bacteria 11913
1258 Ga0501070_0024309 3300049586 Bacteria 5081
1259 Ga0501070_0070516 3300049586 Bacteria 2894
1260 Ga0501070_0357855 3300049586 Bacteria 1184
1261 Ga0501071_0072452 3300049587 Bacteria 2513
1262 Ga0501071_0203185 3300049587 Bacteria 1489
1263 Ga0501072_0000475 3300049588 Bacteria 28798
1264 Ga0501072_0307036 3300049588 Bacteria 1261
1265 Ga0501073_0000678 3300049589 Bacteria 23931
1266 Ga0501073_0021963 3300049589 Bacteria 4597
1267 Ga0501073_0046988 3300049589 Bacteria 3035
1268 Ga0501073_0232206 3300049589 Bacteria 1274
1269 Ga0501073_0510202 3300049589 Bacteria 831
1270 Ga0501074_0001904 3300049590 Bacteria 14331
1271 Ga0501074_0004788 3300049590 Bacteria 9702
1272 Ga0501075_0380494 3300049591 Bacteria 1076
1273 Ga0501076_0399186 3300049592 Bacteria 1130
1274 Ga0501076_0517097 3300049592 Bacteria 984
1275 Ga0501079_0006064 3300049741 Bacteria 9059
1276 Ga0501079_0013419 3300049741 Bacteria 6248
1277 Ga0501080_0004449 3300049742 Bacteria 12471
1278 Ga0501080_0005538 3300049742 Bacteria 11274
1279 Ga0501080_0108484 3300049742 Bacteria 2573
1280 Ga0501080_0649821 3300049742 Bacteria 933
1281 Ga0501081_0135027 3300049743 Bacteria 1766
1282 Ga0501083_0001555 3300049744 Bacteria 15682
1283 Ga0501083_0227962 3300049744 Bacteria 1213
1284 Ga0501035_0000172 3300049822 Bacteria 79203
1285 Ga0501035_0089560 3300049822 Bacteria 2710
1286 Ga0501035_0211197 3300049822 Bacteria 1660
1287 Ga0501035_0254251 3300049822 Bacteria 1491
1288 Ga0501035_0425185 3300049822 Bacteria 1102
1289 Ga0501035_0511269 3300049822 Bacteria 988
1290 Ga0501044_0000282 3300049823 Bacteria 64640
1291 Ga0501044_0017300 3300049823 Bacteria 7732
1292 Ga0501044_0027827 3300049823 Bacteria 5968
1293 Ga0501044_0046842 3300049823 Bacteria 4475
1294 Ga0501044_0052100 3300049823 Bacteria 4219
1295 Ga0501044_0136440 3300049823 Bacteria 2444
1296 Ga0501045_0019340 3300049824 Bacteria 4854
1297 Ga0501045_0056911 3300049824 Bacteria 2860
1298 nmdc:mga03n38_1607_c1 3300050490 Bacteria 6595
1299 nmdc:mga03n38_294452_c1 3300050490 Bacteria 870
1300 nmdc:mga03n38_37646_c1 3300050490 Bacteria 2088
1301 nmdc:mga03n38_62564_c1 3300050490 Bacteria 1698
1302 nmdc:mga00v17_266012_c1 3300050491 Bacteria 1113
1303 nmdc:mga0yw44_125590_c1 3300050492 Bacteria 1657
1304 nmdc:mga0yw44_2044_c1 3300050492 Bacteria 8411
1305 nmdc:mga0yw44_56048_c1 3300050492 Bacteria 2400
1306 nmdc:mga0yw44_91277_c1 3300050492 Bacteria 1925
1307 nmdc:mga0yw44_95497_c1 3300050492 Bacteria 1886
1308 nmdc:mga0k408_109312_c1 3300050493 Bacteria 1634
1309 nmdc:mga0k408_30290_c1 3300050493 Bacteria 3085
1310 nmdc:mga0k408_345967_c1 3300050493 Bacteria 886
1311 nmdc:mga06z11_64327_c1 3300050494 Bacteria 1922
1312 nmdc:mga06z11_8466_c1 3300050494 Bacteria 4291
1313 nmdc:mga06z11_8851_c1 3300050494 Bacteria 3862
1314 nmdc:mga04h51_197101_c1 3300050495 Bacteria 790
1315 nmdc:mga04h51_38767_c1 3300050495 Bacteria 1545
1316 nmdc:mga04h51_51084_c1 3300050495 Bacteria 1388
1317 nmdc:mga04h51_55291_c1 3300050495 Bacteria 1344
1318 nmdc:mga07m45_47170_c1 3300050496 Bacteria 2421
1319 nmdc:mga07m45_59524_c1 3300050496 Bacteria 2161
1320 nmdc:mga07m45_82080_c1 3300050496 Bacteria 1841
1321 nmdc:mga05p37_196622_c1 3300050507 Bacteria 2445
1322 nmdc:mga0qj67_579749_c1 3300050509 Bacteria 898
1323 nmdc:mga08y16_351549_c1 3300050511 Bacteria 1514
1324 nmdc:mga08y16_40252_c1 3300050511 Bacteria 4899
1325 nmdc:mga08y16_841950_c1 3300050511 Bacteria 907
1326 nmdc:mga0n895_131877_c1 3300050512 Bacteria 2524
1327 nmdc:mga0n895_13760_c1 3300050512 Bacteria 7317
1328 nmdc:mga0n895_499664_c1 3300050512 Bacteria 1225
1329 nmdc:mga0rr50_144231_c1 3300050513 Bacteria 1918
1330 nmdc:mga08x19_50119_c1 3300050514 Bacteria 2678
1331 nmdc:mga0a205_315262_c1 3300050515 Bacteria 1435
1332 nmdc:mga0sz30_60389_c1 3300050516 Bacteria 1619
1333 nmdc:mga0sz30_73278_c1 3300050516 Bacteria 1476
1334 nmdc:mga0sz30_96610_c1 3300050516 Bacteria 1289
1335 Ga0495601_0037678 3300053077 Bacteria 3023
1336 Ga0495601_0096036 3300053077 Bacteria 1911
1337 Ga0495601_0106010 3300053077 Bacteria 1817
1338 Ga0495612_0007550 3300053078 Bacteria 4445
1339 Ga0495612_0022244 3300053078 Bacteria 2542
1340 Ga0495612_0078734 3300053078 Bacteria 1383
1341 Ga0495612_0094368 3300053078 Bacteria 1270
1342 Ga0500610_0032128 3300053079 Bacteria 2671
1343 Ga0500610_0082336 3300053079 Bacteria 1677
1344 Ga0500635_0039043 3300053080 Bacteria 1577
1345 Ga0500635_0096668 3300053080 Bacteria 1081
1346 Ga0495595_0000332 3300053084 Bacteria 18218
1347 Ga0495595_0107394 3300053084 Bacteria 1351
1348 Ga0495619_0000633 3300053085 Bacteria 23194
1349 Ga0495619_0183969 3300053085 Bacteria 1446
1350 Ga0500578_0078699 3300053086 Bacteria 2098
1351 Ga0500578_0270688 3300053086 Bacteria 1016
1352 Ga0500643_000016 3300053087 Bacteria 309502
1353 Ga0500644_0040572 3300053088 Bacteria 1541
1354 Ga0500646_0026612 3300053090 Bacteria 1569
1355 Ga0500651_0004739 3300053093 Bacteria 7670
1356 Ga0500651_0034823 3300053093 Bacteria 3174
1357 Ga0500566_0000078 3300053094 Bacteria 47558
1358 Ga0500566_0000290 3300053094 Bacteria 26984
1359 Ga0500566_0075616 3300053094 Bacteria 1884
1360 Ga0500566_0095532 3300053094 Bacteria 1637
1361 Ga0500566_0177840 3300053094 Bacteria 1094
1362 Ga0500640_000121 3300053095 Bacteria 14580
1363 Ga0500641_0000385 3300053096 Bacteria 16362
1364 Ga0500641_0146332 3300053096 Bacteria 1020
1365 Ga0500648_148817 3300053097 Bacteria 1248
1366 Ga0500650_0053851 3300053098 Bacteria 1872
1367 Ga0500554_023672 3300053102 Bacteria 1730
1368 Ga0500555_023736 3300053103 Bacteria 1758
1369 Ga0500556_0030267 3300053104 Bacteria 1833
1370 Ga0500557_000011 3300053105 Bacteria 117471
1371 Ga0500572_000170 3300053111 Bacteria 22863
1372 Ga0500572_034970 3300053111 Bacteria 1426
1373 Ga0500592_010304 3300053116 Bacteria 1488
1374 Ga0500594_0017047 3300053118 Bacteria 1773
1375 Ga0500595_001686 3300053119 Bacteria 11604
1376 Ga0500595_002442 3300053119 Bacteria 9222
1377 Ga0500595_002477 3300053119 Bacteria 9136
1378 Ga0500595_004672 3300053119 Bacteria 6088
1379 Ga0500595_024639 3300053119 Bacteria 2097
1380 Ga0500595_026908 3300053119 Bacteria 1976
1381 Ga0500595_055910 3300053119 Bacteria 1207
1382 Ga0500607_104330 3300053121 Bacteria 1401
1383 Ga0500614_004910 3300053123 Bacteria 2813
1384 Ga0500614_085275 3300053123 Bacteria 890
1385 Ga0500642_0000090 3300053130 Bacteria 46849
1386 Ga0500642_0121991 3300053130 Bacteria 1219
1387 Ga0500642_0123555 3300053130 Bacteria 1211
1388 Ga0500655_009005 3300053133 Bacteria 1796
1389 Ga0500658_0051360 3300053134 Bacteria 1685
1390 Ga0500559_0009508 3300053136 Bacteria 4201
1391 Ga0500561_0007905 3300053137 Bacteria 2095
1392 Ga0500568_0011274 3300053139 Bacteria 4161
1393 Ga0500568_0018416 3300053139 Bacteria 3058
1394 Ga0500568_0035763 3300053139 Bacteria 2025
1395 Ga0500573_0056514 3300053140 Bacteria 2252
1396 Ga0500577_0000619 3300053142 Bacteria 9125
1397 Ga0500577_0080646 3300053142 Bacteria 1297
1398 Ga0500588_0046427 3300053146 Bacteria 1335
1399 Ga0500589_060298 3300053147 Bacteria 1740
1400 Ga0500590_073986 3300053148 Bacteria 1688
1401 Ga0500590_128847 3300053148 Bacteria 1173
1402 Ga0500603_000081 3300053150 Bacteria 22182
1403 Ga0500603_012969 3300053150 Bacteria 1924
1404 Ga0500604_0011079 3300053151 Bacteria 2419
1405 Ga0500616_0047459 3300053153 Bacteria 2280
1406 Ga0500620_074910 3300053155 Bacteria 1168
1407 Ga0500627_0015439 3300053158 Bacteria 2953
1408 Ga0500630_004509 3300053159 Bacteria 6772
1409 Ga0500638_018006 3300053162 Bacteria 3289
1410 Ga0500638_021427 3300053162 Bacteria 3054
1411 Ga0500638_097678 3300053162 Bacteria 1374
1412 Ga0500638_150816 3300053162 Bacteria 1034
1413 Ga0500639_000028 3300053163 Bacteria 77951
1414 Ga0500639_112012 3300053163 Bacteria 1326
1415 Ga0500639_177365 3300053163 Bacteria 947
1416 Ga0500636_0001766 3300053177 Bacteria 11841
1417 Ga0500636_0065953 3300053177 Bacteria 2106
1418 Ga0500636_0127461 3300053177 Bacteria 1421
1419 Ga0500637_0039902 3300053178 Bacteria 2649
1420 Ga0500637_0052431 3300053178 Bacteria 2326
1421 Ga0500611_094937 3300053727 Bacteria 765
1422 Ga0500625_002925 3300053729 Bacteria 6585
1423 Ga0500645_029720 3300053730 Bacteria 1648
1424 Ga0500609_001414 3300053731 Bacteria 3516
1425 Ga0500609_017433 3300053731 Bacteria 976
1426 Ga0500596_000324 3300053735 Bacteria 8556
1427 Ga0500596_000655 3300053735 Bacteria 6696
1428 Ga0500596_012941 3300053735 Bacteria 1262
1429 Ga0501084_0023457 3300054114 Bacteria 5148
1430 Ga0501084_0180813 3300054114 Bacteria 1780
1431 Ga0501084_0299323 3300054114 Bacteria 1359
1432 Ga0500661_000381 3300055283 Bacteria 8160
1433 Ga0500661_002428 3300055283 Bacteria 3509
1434 Ga0501082_0005465 3300060353 Bacteria 11036
1435 Ga0501082_0182571 3300060353 Bacteria 1825
1436 Ga0501082_0383448 3300060353 Bacteria 1226
1437 Ga0530510_0173880 3300061734 Bacteria 1596
1438 2507511468 2507262055 Bacteria 8048963
1439 2508545275 2508501009 Bacteria 7784016
1440 2509147818 2508501128 Bacteria 8613869
1441 2511397251 2511231028 Bacteria 8046582
1442 2513624041 2513237092 Bacteria 8341956
1443 2513641004 2513237094 Bacteria 8789602
1444 2513648417 2513237095 Bacteria 8976980
1445 2513655374 2513237096 Bacteria 8722461
1446 2513696102 2513237101 Bacteria 7952346
1447 2513703640 2513237102 Bacteria 7703324
1448 2513716371 2513237104 Bacteria 10034502
1449 2513860061 2513237137 Bacteria 9558895
1450 2513875072 2513237139 Bacteria 8737671
1451 2513893102 2513237141 Bacteria 8496279
1452 2513916548 2513237145 Bacteria 8979722
1453 2514013854 2513237161 Bacteria 8871253
1454 2515624958 2515154112 Bacteria 8294334
1455 2517101232 2517093001 Bacteria 9002274
1456 2517889862 2517572143 Bacteria 9484767
1457 2524439825 2524023205 Bacteria 8918781
1458 2524532952 2524023228 Bacteria 10118060
1459 2528855422 2528768022 Bacteria 10457665
1460 2617348363 2617270735 Bacteria 9163226
1461 2617374904 2617270741 Bacteria 8201522
1462 2671121116 2667528175 Bacteria 7532676
1463 2723848834 2721755755 Bacteria 8322773
1464 2728751744 2728368998 Bacteria 8720350
1465 2745075895 2744054633 Bacteria 8678936
1466 2793061365 2791355196 Bacteria 7323613
1467 2793073410 2791355197 Bacteria 8420563
1468 2793078832
1469 2805916338 2802429603 Bacteria 8777136
1470 2818239999 2816332527 Bacteria 8933356
1471 2824607022 2824600985 Bacteria 8488197
1472 2824614307 2824609381 Bacteria 8672835
1473 2824622306 2824617872 Bacteria 8814715
1474 2824631481 2824626560 Bacteria 8813858
1475 2824638001 2824635225 Bacteria 8785348
1476 2824664140 2824661429 Bacteria 9877870
1477 2824674569 2824671348 Bacteria 8369588
1478 2824685737 2824679649 Bacteria 8248951
1479 2824690532 2824687955 Bacteria 8360029
1480 2824697888 2824696289 Bacteria 8335049
1481 2824726683 2824723954 Bacteria 8758240
1482 2824736398 2824732956 Bacteria 7810675
1483 2824752063 2824746037 Bacteria 7911610
1484 2824770293 2824763712 Bacteria 9792355
1485 2824776233 2824773399 Bacteria 8360218
1486 2838129999 2838122688 Bacteria 8803140
1487 2841947038 2841941048 Bacteria 8688029
1488 2841955031 2841949485 Bacteria 8680857
1489 2841969988 2841966195 Bacteria 8673214
1490 2841977370 2841974524 Bacteria 8931498
1491 2841990216 2841983080 Bacteria 8395090
1492 2842042218 2842038055 Bacteria 8002051
1493 2842050261 2842045827 Bacteria 8006841
1494 2844316440 2844315083 Bacteria 8138177
1495 2847939261 2847930680 Bacteria 9342022
1496 2847943776 2847939898 Bacteria 8606328
1497 2849081990 2849076700 Bacteria 7039503
1498 2857513529 2857509624 Bacteria 7472071
1499 2874594683 2874590934 Bacteria 8299676
1500 2874606033 2874604998 Bacteria 7834745
1501 2874615253 2874612657 Bacteria 8252029
1502 2874622660 2874620515 Bacteria 8290088
1503 2874633589 2874628541 Bacteria 8630250
1504 2874647260 2874645413 Bacteria 8214782
1505 2876765421 2876761206 Bacteria 10111113
1506 2876773815 2876771140 Bacteria 8287509
1507 2876817821 2876808645 Bacteria 8824342
1508 2876819947 2876818435 Bacteria 8274608
1509 2879076066 2879074833 Bacteria 8279565
1510 2879086933 2879083081 Bacteria 8587928
1511 2879104325 2879099564 Bacteria 10442239
1512 2879116803 2879110137 Bacteria 8907982
1513 2879129328 2879127579 Bacteria 8294491
1514 2879144098 2879142872 Bacteria 8267021
1515 2881369416 2881364244 Bacteria 7710352
1516 2881668267 2881665667 Bacteria 8175609
1517 2885373655 2885366525 Bacteria 8326213
1518 2885378564 2885374607 Bacteria 8927485
1519 2888387049 2888378607 Bacteria 9652610
1520 2888389729 2888388044 Bacteria 7304136
1521 2888421358 2888419890 Bacteria 7857137
1522 2889034457 2889033259 Bacteria 9099371
1523 2903732321 2903727486 Bacteria 8281579
1524 2903749002 2903748898 Bacteria 9972761
1525 2904671333 2904666416 Bacteria 8226587
1526 2904692699 2904690495 Bacteria 9412302
1527 2904711224
1528 2904719632 2904711408 Bacteria 9771557
1529 2906606366 2906602504 Bacteria 8295279
1530 2906612403
1531 2906626835 2906626472 Bacteria 8826946
1532 2906636751 2906635258 Bacteria 8601019
1533 2906649081 2906643746 Bacteria 8722424
1534 2906663446 2906660503 Bacteria 8595048
1535 2908745671 2908739725 Bacteria 8628932
1536 2908757661 2908756301 Bacteria 8864324
1537 2908777388 2908775508 Bacteria 8092255
1538 2922366553 2922361189 Bacteria 7436256
1539 2922377183
1540 2922389537 2922386360 Bacteria 7017218
1541 2922398331 2922393267 Bacteria 8285685
1542 2922426889
1543 2929623584 2929615660 Bacteria 9193770
1544 2929632714 2929624759 Bacteria 9339455
1545 2932793026 2932784394 Bacteria 9704911
1546 2932795838 2932794094 Bacteria 7915132
1547 2932802076 2932801729 Bacteria 7987968
1548 2932814703 2932809354 Bacteria 9135765
1549 2932823560 2932818245 Bacteria 9955613
1550 2932832997 2932828146 Bacteria 9745859
1551 2933585487 2933577622 Bacteria 9116884
1552 2935616342 2935608549 Bacteria 8203142
1553 2935623728 2935616580 Bacteria 9032984
1554 2935633050 2935630451 Bacteria 8169952
1555 2935639499 2935638405 Bacteria 10015038
1556 2935650736 2935648319 Bacteria 8801166
1557 2935662116 2935656913 Bacteria 8965014
1558 2935670444 2935665750 Bacteria 9571747
1559 2935679873 2935675223 Bacteria 9928132
1560 2935687443 2935684952 Bacteria 9590419
1561 2935696585 2935694250 Bacteria 9291695
1562 2935705403 2935703347 Bacteria 10242284
1563 2935718902 2935713505 Bacteria 9608509
1564 2935728554 2935722832 Bacteria 9608746
1565 2935736849 2935732158 Bacteria 9706831
1566 2935746148 2935741537 Bacteria 9707219
1567 2935753409 2935750917 Bacteria 9590372
1568 2935766198 2935760218 Bacteria 9817913
1569 2935770395 2935769743 Bacteria 7878163
1570 2935777574 2935777560 Bacteria 8077691
1571 2935786552 2935785616 Bacteria 7962367
1572 2935794607 2935793552 Bacteria 8012592
1573 2935807146 2935801545 Bacteria 9301974
1574 2935813940 2935810662 Bacteria 9401221
1575 2935827139 2935819856 Bacteria 8261050
1576 2935828982 2935827899 Bacteria 10038562
1577 2935844154 2935837841 Bacteria 9454360
1578 2935854320 2935847175 Bacteria 8228321
1579 2935862047 2935855204 Bacteria 9035059
1580 2935871611 2935864058 Bacteria 9784707
1581 2935880278 2935873716 Bacteria 9632195
1582 2935886264 2935883170 Bacteria 7964738
1583 2935913586 2935908558 Bacteria 8568796
1584 2935923484 2935916978 Bacteria 9113783
1585 2935931097 2935926038 Bacteria 8601059
1586 2935935379 2935934488 Bacteria 8602579
1587 2935946945 2935942939 Bacteria 8599779
1588 2935953960 2935951376 Bacteria 8602333
1589 2935961407 2935959822 Bacteria 7869783
1590 2935968986 2935967501 Bacteria 8603075
1591 2935982365 2935975950 Bacteria 8347125
1592 2935985822 2935984226 Bacteria 8302647
1593 2935996944 2935992306 Bacteria 9802711
1594 2936005979 2936002035 Bacteria 9362176
1595 2936016302 2936011229 Bacteria 8801034
1596 2936025050 2936019824 Bacteria 8804134
1597 2936033607 2936028420 Bacteria 8965941
1598 2936039496 2936037263 Bacteria 9446081
1599 2936050961 2936046547 Bacteria 8903709
1600 2936057710 2936055302 Bacteria 8785755
1601 2940559322 2940556831 Bacteria 9590747
1602 2941509648 2941507105 Bacteria 8166816
1603 2941517477 2941515067 Bacteria 8166720
1604 2941526570 2941523033 Bacteria 8169134
1605 2941536917 2941531003 Bacteria 7653939
1606 2941542017 2941538514 Bacteria 9402094
1607 3005476076 3005474847 Bacteria 9259049
1608 3005491240 3005483717 Bacteria 7877331
1609 3005511086 3005506211 Bacteria 6943378
1610 3005591933 3005587118 Bacteria 7794411
1611 3005596058 3005594810 Bacteria 8716512
1612 3005712013 3005710791 Bacteria 7622528
1613 3005719249 3005718088 Bacteria 8283608
1614 8006932931 8006926726 Bacteria 6749210
1615 8006937386 8006933436 Bacteria 10410654
1616 8006971082 8006964411 Bacteria 8966052
1617 8006977416 8006973647 Bacteria 10679141
1618 8006992949 8006984368 Bacteria 9651211
1619 8006996796 8006994254 Bacteria 8309700
1620 8016517053 8016511872 Bacteria 9921665
1621 8016524596 8016522445 Bacteria 8156687
1622 8016538158 8016530956 Bacteria 8155261
1623 8016542438 8016539877 Bacteria 8155419
1624 8016559250 8016557553 Bacteria 8154380
1625 8016567827 8016566248 Bacteria 8158151
1626 8016580514 8016575299 Bacteria 8154085
1627 8016588514 8016583857 Bacteria 10421953
1628 8016597200 8016595262 Bacteria 8149947
1629 8016605073 8016603502 Bacteria 8731218
1630 8016619944 8016613128 Bacteria 8794220
1631 8016624165 8016622563 Bacteria 7999408
1632 8016637558 8016630954 Bacteria 9217207
1633 8017059528 8017057580 Bacteria 10023680
1634 8019537829 8019530166 Bacteria 8155624
1635 8019551185 8019547302 Bacteria 7996444
1636 8019571329 8019565922 Bacteria 9639779
1637 8019597037 8019586578 Bacteria 10212056
1638 8019604646 8019597564 Bacteria 10041141
1639 8019624460 8019619141 Bacteria 9218857
1640 8019637582 8019629233 Bacteria 8687553
1641 8019642034 8019638758 Bacteria 9062356
1642 8019650516 8019648815 Bacteria 10014479
1643 8019665511 8019659431 Bacteria 8577854
1644 8019675055 8019668869 Bacteria 8791617
1645 8019681043 8019678201 Bacteria 8863603
1646 8019694678 8019687851 Bacteria 8712826
1647 8055749744 8055742211 Bacteria 9226248
1648 8056675378 8056673599 Bacteria 7871253
1649 8056692027 8056689827 Bacteria 6712655
1650 8056973957 8056967851 Bacteria 9038162
1651 Ga0070671_100643588
1652 JGI24740J21852_10001580
1653 JGI24737J22298_10002347
1654 JGI24735J21928_10028622
1655 JGI25406J46586_10005617
1656 JGI25406J46586_10007816
1657 JGI25406J46586_10008897
1658 JGI25165J46597_1004728
1659 JGI25165J46597_1005035
1660 JGI25153J46596_10002507
1661 JGI25153J46596_10002543
1662 JGI25153J46596_10010032
1663 JGI25153J46596_10026515
1664 JGI25153J46596_10037403
1665 rootH2_10168323
1666 JGI25160J50197_1003540
1667 JGI25160J50197_1009667
1668 JGI25404J52841_10004139
1669 Ga0055525_1003944
1670 Ga0055531_10001939
1671 Ga0065165_1001641
1672 Ga0065165_1003060
1673 Ga0070658_10012558
1674 Ga0070658_10023514
1675 Ga0070658_10052859
1676 Ga0070658_10102491
1677 Ga0070658_10155121
1678 Ga0070676_10390013
1679 Ga0070683_100014532
1680 Ga0070683_100130698
1681 Ga0070683_100175788
1682 Ga0070690_100355313
1683 Ga0070670_100407153
1684 Ga0068869_100458466
1685 Ga0070680_100299522
1686 Ga0070682_100036436
1687 Ga0070682_100117317
1688 Ga0070682_100461097
1689 Ga0070682_100524723
1690 Ga0068868_100060174
1691 Ga0068868_100208161
1692 Ga0070660_100006936
1693 Ga0070660_100046028
1694 Ga0070660_100078138
1695 Ga0070660_100659153
1696 Ga0070689_100445054
1697 Ga0070691_10105336
1698 Ga0070687_100223122
1699 Ga0070661_100204512
1700 Ga0070661_100211872
1701 Ga0070668_100004090
1702 Ga0070668_100177813
1703 Ga0070668_100185693
1704 Ga0070668_100188933
1705 Ga0070668_100420314
1706 Ga0070668_100583118
1707 Ga0070669_100077152
1708 Ga0070669_100235249
1709 Ga0070671_100028829
1710 Ga0070671_100227546
1711 Ga0070674_100399589
1712 Ga0070674_100460492
1713 Ga0070673_100223298
1714 Ga0070659_100028575
1715 Ga0070659_100120823
1716 Ga0070709_10001211
1717 Ga0070709_10001487
1718 Ga0070709_10012057
1719 Ga0070709_10203434
1720 Ga0070714_100021170
1721 Ga0070714_100036040
1722 Ga0070714_100065164
1723 Ga0070714_100074503
1724 Ga0070714_100109893
1725 Ga0070714_100228898
1726 Ga0070713_100005990
1727 Ga0070713_100077999
1728 Ga0070713_100096572
1729 Ga0070713_100335931
1730 Ga0070713_100449753
1731 Ga0070713_100471432
1732 Ga0070713_100479307
1733 Ga0070710_10001333
1734 Ga0070710_10004775
1735 Ga0070710_10047262
1736 Ga0070710_10238132
1737 Ga0070701_10190118
1738 Ga0070711_100004982
1739 Ga0070711_100008851
1740 Ga0070711_100009103
1741 Ga0070711_100015372
1742 Ga0070711_100042807
1743 Ga0070711_100587322
1744 Ga0070700_100015418
1745 Ga0070700_100183938
1746 Ga0070663_100004680
1747 Ga0070663_100005639
1748 Ga0070663_100015169
1749 Ga0070663_100026089
1750 Ga0070663_100044624
1751 Ga0070663_100051115
1752 Ga0070663_100133416
1753 Ga0070663_100303096
1754 Ga0070678_100045978
1755 Ga0070678_100229640
1756 Ga0070662_100100370
1757 Ga0070662_100154805
1758 Ga0070662_100167487
1759 Ga0070662_100217927
1760 Ga0070662_100641525
1761 Ga0070681_10012465
1762 Ga0070681_10017662
1763 Ga0070681_10024432
1764 Ga0070681_10057575
1765 Ga0068867_100203103
1766 Ga0070706_100712771
1767 Ga0070707_100082832
1768 Ga0070698_100028998
1769 Ga0070698_100176063
1770 Ga0070698_100604931
1771 Ga0070699_100501560
1772 Ga0070679_100018130
1773 Ga0070679_100075893
1774 Ga0070679_100079972
1775 Ga0070679_100168713
1776 Ga0070679_100256152
1777 Ga0070684_100026884
1778 Ga0070697_100515432
1779 Ga0068853_100003590
1780 Ga0068853_100009325
1781 Ga0068853_100040891
1782 Ga0068853_100097167
1783 Ga0068853_100210598
1784 Ga0068853_100214448
1785 Ga0068853_100357112
1786 Ga0068853_100678605
1787 Ga0070686_100061402
1788 Ga0070693_100104870
1789 Ga0070665_100013100
1790 Ga0070665_100030279
1791 Ga0070665_100128938
1792 Ga0070665_100154541
1793 Ga0070665_100263126
1794 Ga0070665_100662890
1795 Ga0070704_100191713
1796 Ga0068855_100007494
1797 Ga0068855_100051001
1798 Ga0068855_100074949
1799 Ga0068855_100100695
1800 Ga0068855_100157617
1801 Ga0068855_100173800
1802 Ga0068855_100179168
1803 Ga0068855_100286497
1804 Ga0068857_100010136
1805 Ga0068857_100028661
1806 Ga0068857_100046709
1807 Ga0068857_100090185
1808 Ga0068857_100152011
1809 Ga0068854_100004261
1810 Ga0068854_100014717
1811 Ga0068854_100167111
1812 Ga0068854_100498096
1813 Ga0068856_100000055
1814 Ga0068856_100002036
1815 Ga0068856_100035106
1816 Ga0068856_100813720
1817 Ga0070702_100030788
1818 Ga0070702_100380126
1819 Ga0068852_100061105
1820 Ga0068852_100126999
1821 Ga0068852_100182452
1822 Ga0068852_100338700
1823 Ga0068852_100388317
1824 Ga0068852_100466010
1825 Ga0068852_100597224
1826 Ga0068859_100029233
1827 Ga0068859_100160455
1828 Ga0068859_100197202
1829 Ga0068859_100271344
1830 Ga0068859_100854619
1831 Ga0068864_100155154
1832 Ga0068866_10121120
1833 Ga0068866_10150413
1834 Ga0068861_100222076
1835 Ga0068861_100380771
1836 Ga0068851_10018146
1837 Ga0068851_10199625
1838 Ga0068870_10162882
1839 Ga0068858_100060155
1840 Ga0068858_100084612
1841 Ga0068860_100004713
1842 Ga0068860_100218969
1843 Ga0068860_100438223
1844 Ga0068860_100511884
1845 Ga0068862_100565517
1846 Ga0081455_10005206
1847 Ga0081455_10014855
1848 Ga0081455_10029662
1849 Ga0081455_10109650
1850 Ga0081455_10121760
1851 Ga0081538_10014803
1852 Ga0081538_10052708
1853 Ga0081538_10121627
1854 Ga0081540_1001339
1855 Ga0081540_1002098
1856 Ga0081540_1005640
1857 Ga0081540_1007193
1858 Ga0081540_1007306
1859 Ga0081540_1007993
1860 Ga0081540_1014652
1861 Ga0081540_1075041
1862 Ga0081540_1098360
1863 Ga0081539_10000848
1864 Ga0081539_10000950
1865 Ga0081539_10023363
1866 Ga0081539_10090029
1867 Ga0081539_10096617
1868 Ga0070717_10000460
1869 Ga0070717_10004333
1870 Ga0070717_10061424
1871 Ga0070717_10333783
1872 Ga0070717_10362396
1873 Ga0075365_10002534
1874 Ga0075365_10016437
1875 Ga0075365_10032321
1876 Ga0075365_10041163
1877 Ga0075365_10046097
1878 Ga0075365_10082863
1879 Ga0075365_10230350
1880 Ga0075368_10005523
1881 Ga0075368_10042472
1882 Ga0075363_100002726
1883 Ga0075363_100040857
1884 Ga0075363_100054874
1885 Ga0070715_10128429
1886 Ga0070715_10216155
1887 Ga0070716_100006222
1888 Ga0070716_100373734
1889 Ga0070716_100432710
1890 Ga0070712_100098353
1891 Ga0075362_10085580
1892 Ga0075362_10193130
1893 Ga0075367_10016328
1894 Ga0075367_10037477
1895 Ga0075367_10040157
1896 Ga0075367_10081082
1897 Ga0075367_10110845
1898 Ga0075367_10341270
1899 Ga0075367_10388154
1900 Ga0075369_10056155
1901 Ga0075369_10227191
1902 Ga0075366_10024888
1903 Ga0075366_10050422
1904 Ga0075366_10107607
1905 Ga0097621_100512845
1906 Ga0075370_10005105
1907 Ga0075370_10043459
1908 Ga0075370_10232227
1909 Ga0075370_10323769
1910 Ga0075434_100016328
1911 Ga0075434_100189929
1912 Ga0068865_100300036
1913 Ga0075436_100057729
1914 Ga0097620_100029232
1915 Ga0097620_100160457
1916 Ga0097620_100197214
1917 Ga0097620_100271350
1918 Ga0097620_100854749
1919 Ga0099825_1026334
1920 Ga0099825_1033252
1921 Ga0099824_1008875
1922 Ga0099824_1012218
1923 Ga0099822_1020991
1924 Ga0099823_1051282
1925 Ga0075435_100520533
1926 Ga0099794_10197571
1927 Ga0099795_10094234
1928 Ga0099795_10107624
1929 Ga0105240_10004881
1930 Ga0105240_10004901
1931 Ga0105240_10016877
1932 Ga0105240_10097295
1933 Ga0105240_10150608
1934 Ga0105240_10188676
1935 Ga0105240_10309970
1936 Ga0105240_10375624
1937 Ga0105240_10438744
1938 Ga0111539_10071397
1939 Ga0105245_10060551
1940 Ga0105245_10288278
1941 Ga0105247_10060535
1942 Ga0105247_10080734
1943 Ga0105247_10541931
1944 Ga0114129_10144511
1945 Ga0105243_10353713
1946 Ga0105241_10001823
1947 Ga0105241_10012915
1948 Ga0105241_10066635
1949 Ga0105241_10360165
1950 Ga0105248_10799823
1951 Ga0105248_10860676
1952 Ga0105248_10918589
1953 Ga0105237_10003690
1954 Ga0105237_10018023
1955 Ga0105237_10026579
1956 Ga0105237_10084699
1957 Ga0105237_10208119
1958 Ga0105237_10412749
1959 Ga0105238_10001367
1960 Ga0105238_10001743
1961 Ga0105238_10004073
1962 Ga0105238_10105202
1963 Ga0105238_10108450
1964 Ga0105238_10126345
1965 Ga0105238_10216419
1966 Ga0105238_10348621
1967 Ga0105238_10627570
1968 Ga0105249_10025071
1969 Ga0105249_10696435
1970 Ga0105249_10975195
1971 Ga0105239_10001966
1972 Ga0105239_10015287
1973 Ga0105239_10018873
1974 Ga0105239_10045918
1975 Ga0105239_10071995
1976 Ga0105239_10126508
1977 Ga0105239_10181902
1978 Ga0105246_10089670
1979 Ga0105246_10776433
1980 Ga0157371_10328587
1981 Ga0157370_10026904
1982 Ga0157370_10041113
1983 Ga0157370_10101710
1984 Ga0157370_10648587
1985 Ga0157369_10020019
1986 Ga0157369_10037771
1987 Ga0157369_10105183
1988 Ga0157369_10133284
1989 Ga0157369_10334466
1990 Ga0157369_10498472
1991 Ga0157369_10505552
1992 Ga0157374_10019278
1993 Ga0157374_10026832
1994 Ga0157374_10066182
1995 Ga0157374_10298195
1996 Ga0157378_10031236
1997 Ga0157378_10218287
1998 Ga0157378_10431301
1999 Ga0163162_10044547
2000 Ga0163162_10129391
2001 Ga0163162_10206375
2002 Ga0157372_10170357
2003 Ga0157375_10174025
2004 Ga0157375_10404171
2005 Ga0157375_10436627
2006 Ga0163163_10006414
2007 Ga0163163_10057665
2008 Ga0163163_10073225
2009 Ga0163163_10264222
2010 Ga0157380_10109465
2011 Ga0157380_10157219
2012 Ga0157377_10133299
2013 Ga0157379_10120147
2014 Ga0157379_10148040
2015 Ga0157379_10547290
2016 Ga0157376_10046724
2017 Ga0157376_10139890
2018 Ga0157376_10337041
2019 Ga0163161_10313078
2020 Ga0206356_10252712
2021 Ga0206353_10542281
2022 Ga0214544_1000005
2023 Ga0214542_1000004
2024 Ga0214545_1000005
2025 Ga0214543_1000111
2026 Ga0213872_10128081
2027 Ga0213874_10008955
2028 Ga0213876_10001491
2029 Ga0213876_10100607
2030 Ga0213875_10000011
2031 Ga0209563_102320
2032 Ga0207425_1011133
2033 Ga0209677_101639
2034 Ga0209677_102591
2035 Ga0209148_1000235
2036 Ga0209233_1000694
2037 Ga0209233_1004340
2038 Ga0209233_1015229
2039 Ga0209233_1017519
2040 Ga0209455_1000637
2041 Ga0209455_1001472
2042 Ga0209455_1001710
2043 Ga0209564_1006563
2044 Ga0209564_1029711
2045 Ga0209758_1000102
2046 Ga0209758_1000680
2047 Ga0209758_1001266
2048 Ga0209758_1002859
2049 Ga0209758_1003592
2050 Ga0209758_1003725
2051 Ga0209758_1005478
2052 Ga0209758_1008851
2053 Ga0209758_1033809
2054 Ga0209758_1062345
2055 Ga0209256_1004953
2056 Ga0209256_1022780
2057 Ga0207426_1000532
2058 Ga0207426_1001761
2059 Ga0207426_1024324
2060 Ga0207426_1027105
2061 Ga0209051_1081854
2062 Ga0209257_1003378
2063 Ga0209257_1036799
2064 Ga0207656_10009313
2065 Ga0207656_10035763
2066 Ga0207656_10203137
2067 Ga0207682_10055865
2068 Ga0207692_10004617
2069 Ga0207692_10008895
2070 Ga0207692_10044255
2071 Ga0207642_10020324
2072 Ga0207710_10010195
2073 Ga0207688_10019383
2074 Ga0207688_10094246
2075 Ga0207680_10169761
2076 Ga0207647_10001253
2077 Ga0207647_10011423
2078 Ga0207685_10049121
2079 Ga0207685_10109283
2080 Ga0207685_10120325
2081 Ga0207685_10312104
2082 Ga0207699_10000886
2083 Ga0207699_10002476
2084 Ga0207699_10017538
2085 Ga0207699_10034416
2086 Ga0207699_10036391
2087 Ga0207645_10255310
2088 Ga0207643_10092234
2089 Ga0207705_10192989
2090 Ga0207705_10342863
2091 Ga0207654_10000446
2092 Ga0207654_10093238
2093 Ga0207654_10097462
2094 Ga0207654_10234412
2095 Ga0207707_10001016
2096 Ga0207707_10011000
2097 Ga0207707_10019818
2098 Ga0207695_10000006
2099 Ga0207695_10001480
2100 Ga0207695_10007711
2101 Ga0207695_10109077
2102 Ga0207695_10234230
2103 Ga0207695_10278423
2104 Ga0207671_10023100
2105 Ga0207671_10026440
2106 Ga0207671_10119378
2107 Ga0207671_10124980
2108 Ga0207671_10388054
2109 Ga0207693_10009325
2110 Ga0207693_10017747
2111 Ga0207693_10089742
2112 Ga0207693_10114318
2113 Ga0207663_10000175
2114 Ga0207663_10006211
2115 Ga0207663_10025502
2116 Ga0207663_10066321
2117 Ga0207660_10000924
2118 Ga0207660_10030322
2119 Ga0207660_10047947
2120 Ga0207657_10001391
2121 Ga0207657_10005387
2122 Ga0207657_10093424
2123 Ga0207657_10299202
2124 Ga0207657_10513144
2125 Ga0207649_10337619
2126 Ga0207652_10003893
2127 Ga0207652_10025815
2128 Ga0207652_10158337
2129 Ga0207646_10247409
2130 Ga0207646_10261644
2131 Ga0207694_10000136
2132 Ga0207694_10017893
2133 Ga0207694_10030192
2134 Ga0207694_10177989
2135 Ga0207694_10264468
2136 Ga0207650_10245228
2137 Ga0207659_10306420
2138 Ga0207659_10479667
2139 Ga0207687_10021012
2140 Ga0207687_10287346
2141 Ga0207700_10010911
2142 Ga0207700_10105626
2143 Ga0207700_10258635
2144 Ga0207700_10303157
2145 Ga0207700_10456751
2146 Ga0207700_10545000
2147 Ga0207700_10697227
2148 Ga0207700_10874417
2149 Ga0207664_10059318
2150 Ga0207664_10167671
2151 Ga0207664_10257075
2152 Ga0207644_10033155
2153 Ga0207644_10175774
2154 Ga0207644_10201610
2155 Ga0207644_10528968
2156 Ga0207690_10249924
2157 Ga0207706_10020636
2158 Ga0207706_10284054
2159 Ga0207706_10467045
2160 Ga0207709_10041130
2161 Ga0207669_10007035
2162 Ga0207704_10069991
2163 Ga0207665_10000525
2164 Ga0207665_10004656
2165 Ga0207665_10091265
2166 Ga0207665_10159842
2167 Ga0207691_10388593
2168 Ga0207691_10486764
2169 Ga0207689_10166013
2170 Ga0207689_10177802
2171 Ga0207689_10184753
2172 Ga0207689_10510341
2173 Ga0207679_10266933
2174 Ga0207679_10619382
2175 Ga0207667_10011614
2176 Ga0207667_10032595
2177 Ga0207667_10039623
2178 Ga0207667_10050380
2179 Ga0207667_10101111
2180 Ga0207667_10108706
2181 Ga0207667_10217185
2182 Ga0207667_10223458
2183 Ga0207667_10320854
2184 Ga0207667_10321844
2185 Ga0207667_10323219
2186 Ga0207667_10755816
2187 Ga0207712_10433236
2188 Ga0207712_10616914
2189 Ga0207668_10008217
2190 Ga0207668_10231719
2191 Ga0207668_10489503
2192 Ga0207668_10529886
2193 Ga0207640_10021128
2194 Ga0207640_10072615
2195 Ga0207640_10396898
2196 Ga0207640_10451005
2197 Ga0207677_10249345
2198 Ga0207703_10411871
2199 Ga0207703_10745373
2200 Ga0207703_10976071
2201 Ga0207639_10022760
2202 Ga0207639_10030927
2203 Ga0207639_10036177
2204 Ga0207639_10050493
2205 Ga0207639_10098940
2206 Ga0207639_10249569
2207 Ga0207639_10337264
2208 Ga0207678_10004216
2209 Ga0207678_10025952
2210 Ga0207678_10089469
2211 Ga0207678_10099974
2212 Ga0207678_10123758
2213 Ga0207678_10139654
2214 Ga0207678_10185063
2215 Ga0207678_10209000
2216 Ga0207678_10227790
2217 Ga0207678_10268443
2218 Ga0207678_10268919
2219 Ga0207708_10049842
2220 Ga0207702_10000006
2221 Ga0207702_10002502
2222 Ga0207702_10013602
2223 Ga0207702_10068824
2224 Ga0207702_10229418
2225 Ga0207702_10549620
2226 Ga0207641_10214620
2227 Ga0207648_10097170
2228 Ga0207648_10319147
2229 Ga0207648_10632539
2230 Ga0207676_10096351
2231 Ga0207674_10012767
2232 Ga0207674_10016173
2233 Ga0207674_10037575
2234 Ga0207674_10091381
2235 Ga0207674_10204650
2236 Ga0207674_10408732
2237 Ga0207674_10419599
2238 Ga0207675_100049241
2239 Ga0207675_100251674
2240 Ga0207675_100354455
2241 Ga0207675_100687606
2242 Ga0207683_10029544
2243 Ga0207683_10827300
2244 Ga0207698_10086637
2245 Ga0207698_10347583
2246 Ga0207698_10458031
2247 Ga0207698_10520704
2248 Ga0207698_10559721
2249 Ga0209389_1000021
2250 Ga0209389_1000120
2251 Ga0209589_1000005
2252 Ga0209589_1000027
2253 Ga0209489_100005
2254 Ga0209489_100023
2255 Ga0209489_100742
2256 Ga0209700_100006
2257 Ga0209700_100134
2258 Ga0209813_10050531
2259 Ga0268266_10001136
2260 Ga0268266_10003686
2261 Ga0268266_10031172
2262 Ga0268266_10094515
2263 Ga0268266_10212623
2264 Ga0268266_10367028
2265 Ga0268266_10535896
2266 Ga0268265_10124640
2267 Ga0268265_10271215
2268 Ga0268264_10000185
2269 Ga0268264_10233636
2270 Ga0268264_10270804
2271 Ga0268264_10557854
2272 Ga0265323_10047489
2273 Ga0265336_10000415
2274 Ga0307517_10000098
2275 Ga0307515_10104075
2276 Ga0307515_10378216
2277 Ga0307511_10050282
2278 Ga0307511_10112612
2279 Ga0265763_1002394
2280 Ga0265330_10022841
2281 Ga0265330_10070540
2282 Ga0265330_10102798
2283 Ga0265332_10115012
2284 Ga0265325_10030068
2285 Ga0265329_10087994
2286 Ga0265340_10006734
2287 Ga0265339_10000906
2288 Ga0265316_10167245
2289 Ga0307513_10014560
2290 Ga0307513_10379211
2291 Ga0307509_10043196
2292 Ga0307509_10123960
2293 Ga0307509_10128015
2294 Ga0307509_10180048
2295 Ga0307509_10232256
2296 Ga0307509_10295143
2297 Ga0307408_100678065
2298 Ga0307508_10000012
2299 Ga0307508_10205567
2300 Ga0307508_10331970
2301 Ga0265314_10014193
2302 Ga0265314_10028062
2303 Ga0265314_10149051
2304 Ga0265314_10278961
2305 Ga0265342_10003016
2306 Ga0307516_10008865
2307 Ga0307516_10277261
2308 Ga0307516_10355841
2309 Ga0307405_10059833
2310 Ga0307410_10251268
2311 Ga0307410_10422215
2312 Ga0307406_10302548
2313 Ga0307406_10600384
2314 Ga0307412_10076186
2315 Ga0307412_10176842
2316 Ga0307409_100168169
2317 Ga0307414_10445796
2318 Ga0307414_10921453
2319 Ga0307411_10076739
2320 Ga0307411_10167068
2321 Ga0307411_10695831
2322 Ga0307415_100042705
2323 Ga0307507_10160269
2324 Ga0307510_10007562
2325 Ga0307510_10066813
2326 Ga0307510_10101326
2327 Ga0307510_10194593
2328 Ga0315911_1000005
2329 Ga0316215_1001897
2330 Ga0373958_0013101
2331 Ga0373926_0125648
2332 Ga0373929_0044211
2333 Ga0373944_0090449
2334 Ga0373944_0105147
2335 Ga0373951_0044318
2336 Ga0373952_0052584
2337 Ga0373923_0001382
2338 Ga0373923_0002101
2339 Ga0373923_0148183
2340 Ga0373936_0043384
2341 Ga0373936_0052240
2342 Ga0373936_0138144
2343 Ga0373941_0041926
2344 Ga0373953_0000985
2345 Ga0373953_0004518
2346 Ga0373953_0250028
2347 Ga0373954_0001160
2348 Ga0373954_0003164
2349 Ga0373954_0004646
2350 Ga0373954_0271664
2351 Ga0373956_0001463
2352 Ga0373956_0032250
2353 Ga0373956_0058883
2354 Ga0373957_0010109
2355 Ga0373957_0015715
2356 Ga0373957_0166333
2357 Ga0373960_0006254
2358 Ga0373943_0020170
2359 Ga0373943_0121755
2360 Ga0373943_0261882
2361 Ga0373946_0013105
2362 Ga0373946_0159688
2363 Ga0373955_0001372
2364 Ga0373955_0012729
2365 Ga0373955_0022165
2366 Ga0373942_0014531
2367 Ga0373942_0054265
2368 Ga0373961_0026944
2369 Ga0373962_0044737
2370 Ga0373924_0018660
2371 Ga0373924_0027315
2372 Ga0373924_0076217
2373 Ga0373931_0001100
2374 Ga0373931_0003428
2375 Ga0373931_0211512
2376 Ga0373935_0000520
2377 Ga0373935_0097809
2378 Ga0373935_0127371
2379 Ga0373935_0247709
2380 Ga0373935_0312586
2381 Ga0373935_0340452
2382 Ga0373927_0000046
2383 Ga0373927_0005938
2384 Ga0373927_0009305
2385 Ga0373927_0015109
2386 Ga0373927_0039246
2387 Ga0373927_0155395
2388 Ga0373933_0000026
2389 Ga0373933_0006390
2390 Ga0373933_0017205
2391 Ga0373933_0028682
2392 Ga0373933_0073161
2393 Ga0373947_0001392
2394 Ga0373947_0002439
2395 Ga0373947_0052793
2396 Ga0373947_0303254
2397 Ga0373937_0016441
2398 Ga0373937_0048844
2399 Ga0373937_0112764
2400 Ga0373937_0168370
2401 Ga0373937_0376743
2402 Ga0372808_008862
2403 Ga0373925_0009905
2404 Ga0373925_0013452
2405 Ga0373925_0062764
2406 Ga0373925_0134813
2407 Ga0395900_0016187
2408 Ga0395900_0020667
2409 Ga0395900_0032079
2410 Ga0395900_0174183
2411 Ga0395900_0179879
2412 Ga0395898_0035872
2413 Ga0395898_0270372
2414 Ga0395898_0409137
2415 Ga0395905_0025920
2416 Ga0395905_0081275
2417 Ga0395905_0081461
2418 Ga0436364_0224834
2419 Ga0436364_0328296
2420 Ga0436364_0796332
2421 Ga0436364_1001125
2422 Ga0436364_1109971
2423 Ga0395901_0050817
2424 Ga0395901_0178216
2425 Ga0436365_0221110
2426 Ga0436365_0600630
2427 Ga0436365_0709391
2428 Ga0436365_0921625
2429 Ga0436365_0939476
2430 Ga0436365_1231387
2431 Ga0436365_1846147
2432 Ga0436360_0159371
2433 Ga0436361_0298970
2434 Ga0436361_0873949
2435 Ga0436361_1011559
2436 Ga0436363_0355443
2437 Ga0436363_0468710
2438 Ga0436363_0615662
2439 Ga0436363_0726412
2440 Ga0436363_1594013
2441 Ga0436362_0496995
2442 Ga0436362_0763354
2443 Ga0436362_0804184
2444 Ga0439465_0039024
2445 Ga0451802_0319345
2446 Ga0451851_0100858
2447 Ga0451853_2272543
2448 Ga0439463_029581
2449 Ga0439464_0074624
2450 Ga0466969_0037230
2451 Ga0466972_0000126
2452 Ga0466972_0013988
2453 Ga0466966_0001157
2454 Ga0466966_0339054
2455 Ga0466961_0000025
2456 Ga0466963_0031093
2457 Ga0466963_0138053
2458 Ga0466964_0024242
2459 Ga0466964_0054150
2460 Ga0466964_0245229
2461 Ga0466968_0003372
2462 Ga0466968_0157046
2463 Ga0466957_0057047
2464 Ga0466960_0008649
2465 Ga0466959_0000873
2466 Ga0466967_0130167
2467 Ga0466967_0192733
2468 Ga0466967_0497597
2469 Ga0466967_0783637
2470 Ga0495617_007122
2471 Ga0495617_033379
2472 Ga0495592_0001238
2473 Ga0495592_0071092
2474 Ga0495592_0136576
2475 Ga0495592_0171163
2476 Ga0495592_0293095
2477 Ga0495592_0296046
2478 Ga0495603_0000051
2479 Ga0495603_0043229
2480 Ga0495603_0074766
2481 Ga0495603_0203339
2482 Ga0495603_0236613
2483 Ga0495629_0000182
2484 Ga0495629_0000750
2485 Ga0495629_0006753
2486 Ga0495638_0003938
2487 Ga0495638_0021430
2488 Ga0495638_0311579
2489 Ga0495641_0006374
2490 Ga0495651_0015643
2491 Ga0495651_0019393
2492 Ga0495651_0047283
2493 Ga0495653_0014575
2494 Ga0495653_0065346
2495 Ga0495653_0193226
2496 Ga0495653_0241395
2497 Ga0495580_0004021
2498 Ga0495580_0012063
2499 Ga0495580_0214672
2500 Ga0495582_0000137
2501 Ga0495582_0157604
2502 Ga0495582_0172306
2503 Ga0495582_0269021
2504 Ga0495605_0073209
2505 Ga0495605_0207331
2506 Ga0495639_0002873
2507 Ga0495639_0050090
2508 Ga0495639_0072703
2509 Ga0495639_0308456
2510 Ga0495662_0000583
2511 Ga0495662_0121487
2512 Ga0495662_0160899
2513 Ga0495662_0244340
2514 Ga0495664_0009075
2515 Ga0495664_0028765
2516 Ga0495664_0055529
2517 Ga0495664_0095702
2518 Ga0495664_0098986
2519 Ga0495664_0338305
2520 Ga0495664_0378697
2521 Ga0495584_0024795
2522 Ga0495584_0047078
2523 Ga0495584_0197946
2524 Ga0495585_0029073
2525 Ga0495585_0202481
2526 Ga0495594_0001833
2527 Ga0495594_0042613
2528 Ga0495594_0049922
2529 Ga0495594_0176874
2530 Ga0495594_0332935
2531 Ga0495596_0059130
2532 Ga0495583_0025223
2533 Ga0495606_0001505
2534 Ga0495606_0012177
2535 Ga0495606_0064028
2536 Ga0495606_0176508
2537 Ga0495606_0281926
2538 Ga0495608_0000738
2539 Ga0495608_0060188
2540 Ga0495608_0066723
2541 Ga0495610_0089149
2542 Ga0495616_0104198
2543 Ga0495616_0116693
2544 Ga0495616_0179280
2545 Ga0495618_0012424
2546 Ga0495618_0075980
2547 Ga0495618_0240434
2548 Ga0495620_0084717
2549 Ga0495620_0121754
2550 Ga0495628_0021321
2551 Ga0495628_0033413
2552 Ga0495628_0034008
2553 Ga0495628_0259219
2554 Ga0495630_0002625
2555 Ga0495630_0062540
2556 Ga0495631_0015803
2557 Ga0495632_0094535
2558 Ga0495632_0127013
2559 Ga0495637_0165966
2560 Ga0495643_0012291
2561 Ga0495643_0049687
2562 Ga0495644_0052273
2563 Ga0495648_0001119
2564 Ga0495648_0093465
2565 Ga0495648_0138167
2566 Ga0495648_0143187
2567 Ga0495648_0204372
2568 Ga0495666_0035675
2569 Ga0495642_0132019
2570 Ga0495652_0004125
2571 Ga0495652_0035614
2572 Ga0495652_0037670
2573 Ga0495652_0041725
2574 Ga0495652_0119701
2575 Ga0495652_0187308
2576 Ga0495652_0384571
2577 Ga0495665_0001239
2578 Ga0495665_0020494
2579 Ga0495640_0011216
2580 Ga0495640_0041782
2581 Ga0495640_0055752
2582 Ga0495640_0071490
2583 Ga0495640_0132243
2584 Ga0495586_0037182
2585 Ga0495587_0012212
2586 Ga0495587_0070475
2587 Ga0495587_0115572
2588 Ga0495598_0079149
2589 Ga0495609_0028259
2590 Ga0495621_0018971
2591 Ga0495597_0033416
2592 Ga0495645_0025912
2593 Ga0495645_0066982
2594 Ga0495622_0005490
2595 Ga0495622_0016785
2596 Ga0495633_0053651
2597 Ga0495633_0179924
2598 Ga0495667_0067100
2599 Ga0495667_0112302
2600 Ga0495667_0187630
2601 Ga0495667_0428145
2602 Ga0495656_0084365
2603 Ga0495668_0026683
2604 Ga0495668_0029734
2605 Ga0495668_0082172
2606 Ga0495634_0002221
2607 Ga0495634_0018650
2608 Ga0495634_0025310
2609 Ga0495634_0037628
2610 Ga0495634_0109829
2611 Ga0495611_0043715
2612 Ga0495625_0058534
2613 Ga0495625_0380108
2614 Ga0495635_0000166
2615 Ga0495635_0001455
2616 Ga0495635_0001614
2617 Ga0495635_0021252
2618 Ga0495635_0116182
2619 Ga0495659_0095246
2620 Ga0495659_0121847
2621 Ga0495661_0258832
2622 Ga0495588_0007336
2623 Ga0495588_0046469
2624 Ga0495588_0110523
2625 Ga0495657_0004131
2626 Ga0495657_0007196
2627 Ga0495657_0018249
2628 Ga0495657_0147798
2629 Ga0495657_0203447
2630 Ga0495599_0004838
2631 Ga0495599_0005025
2632 Ga0495599_0012226
2633 Ga0495599_0188922
2634 Ga0495599_0205758
2635 Ga0495599_0362565
2636 Ga0495623_0002267
2637 Ga0495623_0188426
2638 Ga0495646_0019980
2639 Ga0495646_0020107
2640 Ga0495646_0060132
2641 Ga0495646_0067140
2642 Ga0495646_0148533
2643 Ga0495647_0032438
2644 Ga0495647_0071742
2645 Ga0495658_0008017
2646 Ga0495658_0074828
2647 Ga0495658_0112303
2648 Ga0495658_0396400
2649 Ga0495669_0061491
2650 Ga0495669_0108830
2651 Ga0495669_0136339
2652 Ga0495613_0047965
2653 Ga0495613_0114323
2654 Ga0495613_0132297
2655 Ga0495613_0196387
2656 Ga0495613_0273679
2657 Ga0495624_0000898
2658 Ga0495624_0018283
2659 Ga0495624_0048677
2660 Ga0495624_0085390
2661 Ga0495671_0161490
2662 Ga0495649_0011337
2663 Ga0495649_0146140
2664 Ga0495589_0117431
2665 Ga0495600_0008000
2666 Ga0495600_0011474
2667 Ga0495600_0035461
2668 Ga0495600_0035500
2669 Ga0495600_0067086
2670 Ga0495581_0007805
2671 Ga0495581_0035924
2672 Ga0495581_0070797
2673 Ga0495581_0081158
2674 Ga0495581_0099714
2675 Ga0495604_0025793
2676 Ga0495604_0047644
2677 Ga0495604_0225347
2678 Ga0495604_0435960
2679 Ga0495674_0010092
2680 Ga0495674_0011184
2681 Ga0495674_0046482
2682 Ga0495674_0597790
2683 Ga0495672_0024126
2684 Ga0495672_0092467
2685 Ga0495672_0178904
2686 Ga0495676_0031814
2687 Ga0495676_0203301
2688 Ga0495676_0240363
2689 Ga0495680_0003456
2690 Ga0495680_0016657
2691 Ga0495683_0185020
2692 Ga0495687_040167
2693 Ga0495675_0062655
2694 Ga0495677_0052671
2695 Ga0495685_059934
2696 Ga0495673_0022298
2697 Ga0495681_0102971
2698 Ga0495684_0007715
2699 Ga0495684_0064967
2700 Ga0495684_0074579
2701 Ga0495684_0083133
2702 Ga0495686_0033518
2703 Ga0495686_0127118
2704 Ga0495593_0000469
2705 Ga0495593_0006819
2706 Ga0495593_0023148
2707 Ga0495593_0041675
2708 Ga0495593_0130701
2709 Ga0495602_0009739
2710 Ga0495615_0063028
2711 Ga0496100_0001098
2712 Ga0496100_0126913
2713 Ga0496100_0220574
2714 Ga0496100_0342189
2715 Ga0496101_0011608
2716 Ga0496101_0205467
2717 Ga0496102_0008520
2718 Ga0496102_0092154
2719 Ga0496102_0195455
2720 Ga0496102_0240520
2721 Ga0496102_0649090
2722 Ga0496103_0037555
2723 Ga0496103_0280311
2724 Ga0496104_0015075
2725 Ga0496104_0026734
2726 Ga0496104_0036163
2727 Ga0496104_0037264
2728 Ga0496104_0097220
2729 Ga0496104_0208151
2730 Ga0496104_0356829
2731 Ga0496104_0396442
2732 Ga0496104_0592513
2733 Ga0496105_0000208
2734 Ga0496105_0030338
2735 Ga0496105_0066489
2736 Ga0496105_0120936
2737 Ga0496105_0375439
2738 Ga0496106_0002121
2739 Ga0496106_0031033
2740 Ga0496106_0123661
2741 Ga0496106_0228788
2742 Ga0496106_0329249
2743 Ga0496106_0419870
2744 Ga0496107_0046162
2745 Ga0496107_0174158
2746 Ga0496107_0307918
2747 Ga0496108_0000681
2748 Ga0496108_0042075
2749 Ga0496108_0122333
2750 Ga0496108_0232274
2751 Ga0496108_0538366
2752 Ga0496109_0000450
2753 Ga0496109_0027672
2754 Ga0496109_0053052
2755 Ga0496109_0167884
2756 Ga0496110_0013956
2757 Ga0496110_0031106
2758 Ga0496110_0037630
2759 Ga0496110_0091129
2760 Ga0496110_0145854
2761 Ga0496110_0369813
2762 Ga0496110_0371924
2763 Ga0496111_0040302
2764 Ga0496111_0184327
2765 Ga0496112_0000040
2766 Ga0496112_0003971
2767 Ga0496112_0005466
2768 Ga0496112_0012229
2769 Ga0496112_0023844
2770 Ga0496112_0025634
2771 Ga0496112_0319638
2772 Ga0496112_0407027
2773 Ga0496112_0816038
2774 Ga0496113_0015425
2775 Ga0496113_0151391
2776 Ga0496113_0358608
2777 Ga0496113_0453572
2778 Ga0496113_0559723
2779 Ga0496114_0033230
2780 Ga0496114_0043995
2781 Ga0496114_0108243
2782 Ga0496114_0113023
2783 Ga0496114_0213364
2784 Ga0496114_0236676
2785 Ga0496114_0499662
2786 Ga0496114_0547196
2787 Ga0496114_0757644
2788 Ga0496115_0017046
2789 Ga0496115_0046053
2790 Ga0496115_0259875
2791 Ga0496115_0318080
2792 Ga0496115_0359774
2793 Ga0496115_0414887
2794 Ga0496116_0164240
2795 Ga0496117_0008070
2796 Ga0496117_0079878
2797 Ga0496117_0125246
2798 Ga0496118_0002570
2799 Ga0496118_0087129
2800 Ga0496118_0142539
2801 Ga0496118_0189448
2802 Ga0496118_0243919
2803 Ga0496119_0043743
2804 Ga0496119_0098757
2805 Ga0496121_0000265
2806 Ga0496121_0001125
2807 Ga0496121_0011280
2808 Ga0496121_0011669
2809 Ga0496121_0028222
2810 Ga0496121_0044559
2811 Ga0496121_0054026
2812 Ga0496121_0112182
2813 Ga0496121_0138490
2814 Ga0496121_0287384
2815 Ga0496121_0440548
2816 Ga0496122_0259050
2817 Ga0496122_0295814
2818 Ga0496124_0001146
2819 Ga0496124_0038040
2820 Ga0496124_0155785
2821 Ga0496124_0215642
2822 Ga0496125_0000176
2823 Ga0496125_0034884
2824 Ga0496125_0065382
2825 Ga0496125_0123900
2826 Ga0496125_0154485
2827 Ga0496125_0195405
2828 Ga0496126_0005831
2829 Ga0496126_0011852
2830 Ga0496126_0015449
2831 Ga0496126_0020296
2832 Ga0496126_0024497
2833 Ga0496126_0032606
2834 Ga0496126_0042857
2835 Ga0496126_0057447
2836 Ga0496126_0070795
2837 Ga0496126_0072217
2838 Ga0496126_0120816
2839 Ga0496126_0121358
2840 Ga0496126_0229919
2841 Ga0496126_0612167
2842 Ga0495678_084520
2843 Ga0495682_0018288
2844 Ga0501031_0001415
2845 Ga0501032_0003300
2846 Ga0501032_0034880
2847 Ga0501032_0047787
2848 Ga0501032_0067767
2849 Ga0501032_0128686
2850 Ga0501033_0000175
2851 Ga0501033_0000207
2852 Ga0501033_0023002
2853 Ga0501033_0060484
2854 Ga0501033_0219426
2855 Ga0501033_0407430
2856 Ga0501034_0000202
2857 Ga0501034_0052329
2858 Ga0501034_0079493
2859 Ga0501034_0129594
2860 Ga0501034_0178709
2861 Ga0501034_0594583
2862 Ga0501034_0595299
2863 Ga0501034_0723716
2864 Ga0501036_0000042
2865 Ga0501036_0106719
2866 Ga0501036_0117764
2867 Ga0501036_0503889
2868 Ga0501037_0000100
2869 Ga0501037_0000334
2870 Ga0501037_0212015
2871 Ga0501037_0273387
2872 Ga0501038_0000157
2873 Ga0501038_0043349
2874 Ga0501038_0085789
2875 Ga0501038_0205940
2876 Ga0501039_0000216
2877 Ga0501039_0007971
2878 Ga0501039_0011255
2879 Ga0501039_0298952
2880 Ga0501040_0083811
2881 Ga0501042_0044070
2882 Ga0501042_0053023
2883 Ga0501042_0083958
2884 Ga0501043_0001316
2885 Ga0501043_0040872
2886 Ga0501043_0050219
2887 Ga0501043_0387968
2888 Ga0501046_0000387
2889 Ga0501046_0101168
2890 Ga0501046_0137214
2891 Ga0501047_0000159
2892 Ga0501047_0006707
2893 Ga0501047_0154680
2894 Ga0501047_0389810
2895 Ga0501047_0432753
2896 Ga0501048_0000655
2897 Ga0501048_0197317
2898 Ga0501067_0011823
2899 Ga0501067_0022683
2900 Ga0501068_0000168
2901 Ga0501068_0004245
2902 Ga0501068_0103177
2903 Ga0501069_0002689
2904 Ga0501069_0025378
2905 Ga0501069_0100739
2906 Ga0501070_0002236
2907 Ga0501070_0004540
2908 Ga0501070_0024309
2909 Ga0501070_0070516
2910 Ga0501070_0357855
2911 Ga0501071_0072452
2912 Ga0501071_0203185
2913 Ga0501072_0000475
2914 Ga0501072_0307036
2915 Ga0501073_0000678
2916 Ga0501073_0021963
2917 Ga0501073_0046988
2918 Ga0501073_0232206
2919 Ga0501073_0510202
2920 Ga0501074_0001904
2921 Ga0501074_0004788
2922 Ga0501075_0380494
2923 Ga0501076_0399186
2924 Ga0501076_0517097
2925 Ga0501079_0006064
2926 Ga0501079_0013419
2927 Ga0501080_0004449
2928 Ga0501080_0005538
2929 Ga0501080_0108484
2930 Ga0501080_0649821
2931 Ga0501081_0135027
2932 Ga0501083_0001555
2933 Ga0501083_0227962
2934 Ga0501035_0000172
2935 Ga0501035_0089560
2936 Ga0501035_0211197
2937 Ga0501035_0254251
2938 Ga0501035_0425185
2939 Ga0501035_0511269
2940 Ga0501044_0000282
2941 Ga0501044_0017300
2942 Ga0501044_0027827
2943 Ga0501044_0046842
2944 Ga0501044_0052100
2945 Ga0501044_0136440
2946 Ga0501045_0019340
2947 Ga0501045_0056911
2948 nmdc:mga03n38_1607_c1
2949 nmdc:mga03n38_294452_c1
2950 nmdc:mga03n38_37646_c1
2951 nmdc:mga03n38_62564_c1
2952 nmdc:mga00v17_266012_c1
2953 nmdc:mga0yw44_125590_c1
2954 nmdc:mga0yw44_2044_c1
2955 nmdc:mga0yw44_56048_c1
2956 nmdc:mga0yw44_91277_c1
2957 nmdc:mga0yw44_95497_c1
2958 nmdc:mga0k408_109312_c1
2959 nmdc:mga0k408_30290_c1
2960 nmdc:mga0k408_345967_c1
2961 nmdc:mga06z11_64327_c1
2962 nmdc:mga06z11_8466_c1
2963 nmdc:mga06z11_8851_c1
2964 nmdc:mga04h51_197101_c1
2965 nmdc:mga04h51_38767_c1
2966 nmdc:mga04h51_51084_c1
2967 nmdc:mga04h51_55291_c1
2968 nmdc:mga07m45_47170_c1
2969 nmdc:mga07m45_59524_c1
2970 nmdc:mga07m45_82080_c1
2971 nmdc:mga05p37_196622_c1
2972 nmdc:mga0qj67_579749_c1
2973 nmdc:mga08y16_351549_c1
2974 nmdc:mga08y16_40252_c1
2975 nmdc:mga08y16_841950_c1
2976 nmdc:mga0n895_131877_c1
2977 nmdc:mga0n895_13760_c1
2978 nmdc:mga0n895_499664_c1
2979 nmdc:mga0rr50_144231_c1
2980 nmdc:mga08x19_50119_c1
2981 nmdc:mga0a205_315262_c1
2982 nmdc:mga0sz30_60389_c1
2983 nmdc:mga0sz30_73278_c1
2984 nmdc:mga0sz30_96610_c1
2985 Ga0495601_0037678
2986 Ga0495601_0096036
2987 Ga0495601_0106010
2988 Ga0495612_0007550
2989 Ga0495612_0022244
2990 Ga0495612_0078734
2991 Ga0495612_0094368
2992 Ga0500610_0032128
2993 Ga0500610_0082336
2994 Ga0500635_0039043
2995 Ga0500635_0096668
2996 Ga0495595_0000332
2997 Ga0495595_0107394
2998 Ga0495619_0000633
2999 Ga0495619_0183969
3000 Ga0500578_0078699
3001 Ga0500578_0270688
3002 Ga0500643_000016
3003 Ga0500644_0040572
3004 Ga0500646_0026612
3005 Ga0500651_0004739
3006 Ga0500651_0034823
3007 Ga0500566_0000078
3008 Ga0500566_0000290
3009 Ga0500566_0075616
3010 Ga0500566_0095532
3011 Ga0500566_0177840
3012 Ga0500640_000121
3013 Ga0500641_0000385
3014 Ga0500641_0146332
3015 Ga0500648_148817
3016 Ga0500650_0053851
3017 Ga0500554_023672
3018 Ga0500555_023736
3019 Ga0500556_0030267
3020 Ga0500557_000011
3021 Ga0500572_000170
3022 Ga0500572_034970
3023 Ga0500592_010304
3024 Ga0500594_0017047
3025 Ga0500595_001686
3026 Ga0500595_002442
3027 Ga0500595_002477
3028 Ga0500595_004672
3029 Ga0500595_024639
3030 Ga0500595_026908
3031 Ga0500595_055910
3032 Ga0500607_104330
3033 Ga0500614_004910
3034 Ga0500614_085275
3035 Ga0500642_0000090
3036 Ga0500642_0121991
3037 Ga0500642_0123555
3038 Ga0500655_009005
3039 Ga0500658_0051360
3040 Ga0500559_0009508
3041 Ga0500561_0007905
3042 Ga0500568_0011274
3043 Ga0500568_0018416
3044 Ga0500568_0035763
3045 Ga0500573_0056514
3046 Ga0500577_0000619
3047 Ga0500577_0080646
3048 Ga0500588_0046427
3049 Ga0500589_060298
3050 Ga0500590_073986
3051 Ga0500590_128847
3052 Ga0500603_000081
3053 Ga0500603_012969
3054 Ga0500604_0011079
3055 Ga0500616_0047459
3056 Ga0500620_074910
3057 Ga0500627_0015439
3058 Ga0500630_004509
3059 Ga0500638_018006
3060 Ga0500638_021427
3061 Ga0500638_097678
3062 Ga0500638_150816
3063 Ga0500639_000028
3064 Ga0500639_112012
3065 Ga0500639_177365
3066 Ga0500636_0001766
3067 Ga0500636_0065953
3068 Ga0500636_0127461
3069 Ga0500637_0039902
3070 Ga0500637_0052431
3071 Ga0500611_094937
3072 Ga0500625_002925
3073 Ga0500645_029720
3074 Ga0500609_001414
3075 Ga0500609_017433
3076 Ga0500596_000324
3077 Ga0500596_000655
3078 Ga0500596_012941
3079 Ga0501084_0023457
3080 Ga0501084_0180813
3081 Ga0501084_0299323
3082 Ga0500661_000381
3083 Ga0500661_002428
3084 Ga0501082_0005465
3085 Ga0501082_0182571
3086 Ga0501082_0383448
3087 Ga0530510_0173880
3088 2507511468
3089 2508545275
3090 2509147818
3091 2511397251
3092 2513624041
3093 2513641004
3094 2513648417
3095 2513655374
3096 2513696102
3097 2513703640
3098 2513716371
3099 2513860061
3100 2513875072
3101 2513893102
3102 2513916548
3103 2514013854
3104 2515624958
3105 2517101232
3106 2517889862
3107 2524439825
3108 2524532952
3109 2528855422
3110 2617348363
3111 2617374904
3112 2671121116
3113 2723848834
3114 2728751744
3115 2745075895
3116 2793061365
3117 2793073410
3118 2793078832
3119 2805916338
3120 2818239999
3121 2824607022
3122 2824614307
3123 2824622306
3124 2824631481
3125 2824638001
3126 2824664140
3127 2824674569
3128 2824685737
3129 2824690532
3130 2824697888
3131 2824726683
3132 2824736398
3133 2824752063
3134 2824770293
3135 2824776233
3136 2838129999
3137 2841947038
3138 2841955031
3139 2841969988
3140 2841977370
3141 2841990216
3142 2842042218
3143 2842050261
3144 2844316440
3145 2847939261
3146 2847943776
3147 2849081990
3148 2857513529
3149 2874594683
3150 2874606033
3151 2874615253
3152 2874622660
3153 2874633589
3154 2874647260
3155 2876765421
3156 2876773815
3157 2876817821
3158 2876819947
3159 2879076066
3160 2879086933
3161 2879104325
3162 2879116803
3163 2879129328
3164 2879144098
3165 2881369416
3166 2881668267
3167 2885373655
3168 2885378564
3169 2888387049
3170 2888389729
3171 2888421358
3172 2889034457
3173 2903732321
3174 2903749002
3175 2904671333
3176 2904692699
3177 2904711224
3178 2904719632
3179 2906606366
3180 2906612403
3181 2906626835
3182 2906636751
3183 2906649081
3184 2906663446
3185 2908745671
3186 2908757661
3187 2908777388
3188 2922366553
3189 2922377183
3190 2922389537
3191 2922398331
3192 2922426889
3193 2929623584
3194 2929632714
3195 2932793026
3196 2932795838
3197 2932802076
3198 2932814703
3199 2932823560
3200 2932832997
3201 2933585487
3202 2935616342
3203 2935623728
3204 2935633050
3205 2935639499
3206 2935650736
3207 2935662116
3208 2935670444
3209 2935679873
3210 2935687443
3211 2935696585
3212 2935705403
3213 2935718902
3214 2935728554
3215 2935736849
3216 2935746148
3217 2935753409
3218 2935766198
3219 2935770395
3220 2935777574
3221 2935786552
3222 2935794607
3223 2935807146
3224 2935813940
3225 2935827139
3226 2935828982
3227 2935844154
3228 2935854320
3229 2935862047
3230 2935871611
3231 2935880278
3232 2935886264
3233 2935913586
3234 2935923484
3235 2935931097
3236 2935935379
3237 2935946945
3238 2935953960
3239 2935961407
3240 2935968986
3241 2935982365
3242 2935985822
3243 2935996944
3244 2936005979
3245 2936016302
3246 2936025050
3247 2936033607
3248 2936039496
3249 2936050961
3250 2936057710
3251 2940559322
3252 2941509648
3253 2941517477
3254 2941526570
3255 2941536917
3256 2941542017
3257 3005476076
3258 3005491240
3259 3005511086
3260 3005591933
3261 3005596058
3262 3005712013
3263 3005719249
3264 8006932931
3265 8006937386
3266 8006971082
3267 8006977416
3268 8006992949
3269 8006996796
3270 8016517053
3271 8016524596
3272 8016538158
3273 8016542438
3274 8016559250
3275 8016567827
3276 8016580514
3277 8016588514
3278 8016597200
3279 8016605073
3280 8016619944
3281 8016624165
3282 8016637558
3283 8017059528
3284 8019537829
3285 8019551185
3286 8019571329
3287 8019597037
3288 8019604646
3289 8019624460
3290 8019637582
3291 8019642034
3292 8019650516
3293 8019665511
3294 8019675055
3295 8019681043
3296 8019694678
3297 8055749744
3298 8056675378
3299 8056692027
3300 8056973957

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

47

93

0.96

PF13305

TetR_C_33

Tetracyclin repressor-like, C-terminal domain

120

227

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3on2-assembly1.cif.gz_A structure of a protein with unknown function from rhodococcus sp. rha1 0.8151 10 207
3on2-assembly3.cif.gz_C structure of a protein with unknown function from rhodococcus sp. rha1 0.8052 11 210
5gpa-assembly1.cif.gz_A structural analysis of fatty acid degradation regulator fadr from bacillus halodurans 0.8027 17 199
3on2-assembly3.cif.gz_C structure of a protein with unknown function from rhodococcus sp. rha1 0.8015 11 210
3on2-assembly1.cif.gz_A structure of a protein with unknown function from rhodococcus sp. rha1 0.7999 10 207
ID Description Score Start End Superfamily
4xk4D01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8606 19 68 1.10.10.60
4xk4A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8601 19 68 1.10.10.60
4xk4B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8587 19 68 1.10.10.60
6azhA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8518 20 65 1.10.10.60
6azhB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8501 22 65 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A7Y2UQR5-F1-model_v4 TetR/AcrR family transcriptional regulator 0.911 11 160 GO:0000976
GO:0003700
AF-A0A7Y2UQR5-F1-model_v4 TetR/AcrR family transcriptional regulator 0.8941 11 160 GO:0000976
GO:0003700
AF-A0A643FAU4-F1-model_v4 TetR/AcrR family transcriptional regulator 0.8539 20 207 GO:0000976
GO:0003700
AF-A0A356QJZ8-F1-model_v4 TetR family transcriptional regulator 0.8533 19 148 GO:0000976
GO:0003700
AF-A0A6N4W4B7-F1-model_v4 TetR family transcriptional regulator 0.8362 19 207 GO:0000976
GO:0003700

Map