F495196
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1648 | 962 | 1151 | 325 |
Family's Representative Sequence
| Representative Sequence | 3300039453|Ga0436362_0413279|Ga0436362_0413279_2592_3674 |
| Length | 360 |
| Sequence | MITSFRGAQSANPEPRDSGLDAAHRPGMTGGNPMPIPKHVFDPPFNIIRCSHAVLDVTDLKLSREFYETTVGLHVEDADDSAVYLRASEEHQHHSLVLRRADVAACNRLGFKVGNDSDLDKAAAFFSENGIPYAFAEQPFQGRTLHFTDPFGYRIELYARMDKRPHLLRRYDLYKGCHPQRLDHFNVFAAEVQDTMDFYVRLGFRLTEYAEEDGPNGRIAAAWLHRKGNVHDFALTNGKGPRLHHVAYWTPTAMNIIHLCDVMASSGYLKNIERGPGRHGISNAFFLYIRDPDGHRLELYTSDYFTGDHDHEPLRWSLRDPRRQTLWGAPAPRSWFEQGSPFTGQQVREPQFVADVTVAD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 3 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 4 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 5 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 6 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 7 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 8 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 9 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 10 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 11 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 12 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 13 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 14 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 15 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 16 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 17 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 18 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 19 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 20 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 21 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 22 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 23 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 24 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 25 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 26 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 27 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 28 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 29 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 30 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 31 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 32 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 33 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 34 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 35 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 36 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 37 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 38 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 39 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 40 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 41 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 42 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 43 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 44 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 45 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 46 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 47 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 48 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 49 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 50 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 51 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 52 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 53 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 54 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 55 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 56 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 57 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 58 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 59 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 60 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 61 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 62 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 63 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 64 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 65 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 66 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 67 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 68 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 69 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 70 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 71 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 72 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 73 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 74 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 75 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 76 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 77 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 78 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 79 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 80 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 81 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 82 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 83 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 84 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 85 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 86 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 87 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 88 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 89 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 90 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 91 | 2791355199 | |||
| 92 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 93 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 94 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 95 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 96 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 97 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 98 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 99 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 100 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 101 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 102 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 103 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 104 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 105 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 106 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 107 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 108 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 109 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 110 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 111 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 112 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 113 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 114 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 115 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 116 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 117 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 118 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 119 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 120 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 121 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 122 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 123 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 124 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 125 | 2840878972 | Albibacillus kandeliae J95 | Isolate | Rhizosphere |
| 126 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 127 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 128 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 129 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 130 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 131 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 132 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 133 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 134 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 135 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 136 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 137 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 138 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 139 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 140 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 141 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 142 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 143 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 144 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 145 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 146 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 147 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 148 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 149 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 150 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 151 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 152 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 153 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 154 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 155 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 156 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 157 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 158 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 159 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 160 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 161 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 162 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 163 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 164 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 165 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 166 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 167 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 168 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 169 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 170 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 171 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 172 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 173 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 174 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 175 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 176 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 177 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 178 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 179 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 180 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 181 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 182 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 183 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 184 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 185 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 186 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 187 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 188 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 189 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 190 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 191 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 192 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 193 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 194 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 195 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 196 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 197 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 198 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 199 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 200 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 201 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 202 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 203 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 204 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 205 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 206 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 207 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 208 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 209 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 210 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 211 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 212 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 213 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 214 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 215 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 216 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 217 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 218 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 219 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 220 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 221 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 222 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 223 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 224 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 225 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 226 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 227 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 228 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 229 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 230 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 231 | 2898795034 | Rhodobacter sp. SGA-6-6 | Isolate | Rhizosphere |
| 232 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 233 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 234 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 235 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 236 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 237 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 238 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 239 | 2904699407 | |||
| 240 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 241 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 242 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 243 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 244 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 245 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 246 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 247 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 248 | 2906610324 | |||
| 249 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 250 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 251 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 252 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 253 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 254 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 255 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 256 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 257 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 258 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 259 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 260 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 261 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 262 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 263 | 2922368715 | |||
| 264 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 265 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 266 | 2922425934 | |||
| 267 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 268 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 269 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 270 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 271 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 272 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 273 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 274 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 275 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 276 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 277 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 278 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 279 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 280 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 281 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 282 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 283 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 284 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 285 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 286 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 287 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 288 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 289 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 290 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 291 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 292 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 293 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 294 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 295 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 296 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 297 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 298 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 299 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 300 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 301 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 302 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 303 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 304 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 305 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 306 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 307 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 308 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 309 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 310 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 311 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 312 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 313 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 314 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 315 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 316 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 317 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 318 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 319 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 320 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 321 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 322 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 323 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 324 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 325 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 326 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 327 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 328 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 329 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 330 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 331 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 332 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 333 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 334 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 335 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 336 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 337 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 338 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 339 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 340 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 341 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 342 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 343 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 344 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 345 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 346 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 347 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 348 | 2952252522 | Salinicola sp. DM10 | Isolate | Unclassified |
| 349 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 350 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 351 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 352 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 353 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 354 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 355 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 356 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 357 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 358 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 359 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 360 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 361 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 362 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 363 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 364 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 365 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 366 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 367 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 368 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 369 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 370 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 371 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 372 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 373 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 374 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 375 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 376 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 377 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 378 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 379 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 380 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 381 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 382 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 383 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 384 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 385 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 386 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 387 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 388 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 389 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 390 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 391 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 392 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 393 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 394 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 395 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 396 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 397 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 398 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 399 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 400 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 401 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 402 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 403 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 404 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 405 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 406 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 407 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 408 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 409 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 410 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 411 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 412 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 413 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 414 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 415 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 416 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 417 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 418 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 419 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 420 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 421 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 422 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 423 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 424 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 425 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 426 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 427 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 428 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 429 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 430 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 431 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 432 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 433 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 434 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 435 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 436 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 437 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 438 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 439 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 440 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 441 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 442 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 443 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 444 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 445 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 446 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 447 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 448 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 449 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 450 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 451 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 452 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 453 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 454 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 455 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 456 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 457 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 458 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 459 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 460 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 461 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 462 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 463 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 464 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 465 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 466 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 467 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 468 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 469 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 470 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 471 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 472 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 473 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 474 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 475 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 476 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 477 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 478 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 479 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 480 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 481 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 482 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 483 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 484 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 485 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 486 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 487 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 488 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 489 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 490 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 491 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 492 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 493 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 494 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 495 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 496 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 497 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 498 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 499 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 500 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 501 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 502 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 503 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 504 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 505 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 506 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 507 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 508 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 509 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 510 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 511 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 512 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 513 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 514 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 515 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 516 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 517 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 518 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 519 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 520 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 521 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 522 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 523 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 524 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 525 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 526 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 527 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 528 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 529 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 530 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 531 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 532 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 533 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 534 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 535 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 536 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 537 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 538 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 539 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 540 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 541 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 542 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 543 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 544 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 545 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 546 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 547 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 548 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 549 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 550 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 551 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 552 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 553 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 554 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 555 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 556 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 557 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 558 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 559 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 560 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 561 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 562 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 563 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 564 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 565 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 566 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 567 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 568 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 569 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 570 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 571 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 572 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 573 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 574 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 575 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 576 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 577 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 578 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 579 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 580 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 581 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 582 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 583 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 584 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 585 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 586 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 587 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 588 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 589 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 590 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 591 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 592 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 593 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 594 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 595 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 596 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 597 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 598 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 599 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 600 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 601 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 602 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 603 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 604 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 605 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 606 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 607 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 608 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 609 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 610 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 611 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 612 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 613 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 614 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 615 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 616 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 617 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 618 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 619 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 620 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 621 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 622 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 623 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 624 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 625 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 626 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 627 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 628 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 629 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 630 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 631 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 632 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 633 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 634 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 635 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 636 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 637 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 638 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 639 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 640 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 641 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 642 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 643 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 644 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 645 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 646 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 647 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 648 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 649 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 650 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 651 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 652 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 653 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 654 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 655 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 656 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 657 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 658 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 659 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 660 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 661 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 662 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 663 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 664 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 665 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 666 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 667 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 668 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 669 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 670 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 671 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 672 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 673 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 674 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 675 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 676 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 677 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 678 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 679 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 680 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 681 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 682 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 683 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 684 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 685 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 686 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 687 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 688 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 689 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 690 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 691 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 692 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 693 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 694 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 695 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 696 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 697 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 698 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 699 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 700 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 701 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 702 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 703 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 704 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 705 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 706 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 707 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 708 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 709 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 710 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 711 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 712 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 713 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 714 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 715 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 716 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 717 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 718 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 719 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 720 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 721 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 722 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 723 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 724 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 725 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 726 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 727 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 728 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 729 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 730 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 731 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 732 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 733 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 734 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 735 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 736 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 737 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 738 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 739 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 740 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 741 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 742 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 743 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 744 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 745 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 746 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 747 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 748 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 749 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 750 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 751 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 752 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 753 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 754 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 755 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 756 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 757 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 758 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 759 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 760 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 761 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 762 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 763 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 764 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 765 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 766 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 767 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 768 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 769 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 770 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 771 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 772 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 773 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 774 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 775 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 776 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 777 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 778 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 779 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 780 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 781 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 782 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 783 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 784 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 785 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 786 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 787 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 788 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 789 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 790 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 791 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 792 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 793 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 794 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 795 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 796 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 797 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 798 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 799 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 800 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 801 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 802 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 803 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 804 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 805 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 806 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 807 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 808 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 809 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 810 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 811 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 812 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 813 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 814 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 815 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 816 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 817 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 818 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 819 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 820 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 821 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 822 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 823 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 824 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 825 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 826 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 827 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 828 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 829 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 830 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 831 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 832 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 833 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 834 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 835 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 836 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 837 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 838 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 839 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 840 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 841 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 842 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 843 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 844 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 845 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 846 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 847 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 848 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 849 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 850 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 851 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 852 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 853 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 854 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 855 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 856 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 857 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 858 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 859 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 860 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 861 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 862 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 863 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 864 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 865 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 866 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 867 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 868 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 869 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 870 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 871 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 872 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 873 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 874 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 875 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 876 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 877 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 878 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 879 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 880 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 881 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 882 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 883 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 884 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 885 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 886 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 887 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 888 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 889 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 890 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 891 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 892 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 893 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 894 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 895 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 896 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 897 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 898 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 899 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 900 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 901 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 902 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 903 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 904 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 905 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 906 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 907 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 908 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 909 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 910 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 911 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 912 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 913 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 914 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 915 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 916 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 917 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 918 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 919 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 920 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 921 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 922 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 923 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 924 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 925 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 926 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 927 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 928 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 929 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 930 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 931 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 932 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 933 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 934 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 935 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 936 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 937 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 938 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 939 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 940 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 941 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 942 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 943 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 944 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 945 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 946 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 947 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 948 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 949 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 950 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 951 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 952 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 953 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 954 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 955 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 956 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 957 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 958 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 959 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 960 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
| 961 | 8057160832 | Larsenimonas rhizosphaerae GH2-1 | Isolate | Rhizosphere |
| 962 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 70.05 |
| Metatranscriptomes | 0 |
| Isolates | 29.95 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.71 |
| Nodule | 24.03 |
| Rhizoplane | 4.79 |
| Rhizosphere | 45.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.08 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10008285 | 3300001979 | Bacteria | 4151 |
| 2 | JGI25155J39150_1000046 | 3300002704 | Bacteria | 80685 |
| 3 | JGI25156J39149_1000070 | 3300002705 | Bacteria | 80840 |
| 4 | JGI25156J39149_1009007 | 3300002705 | Bacteria | 2461 |
| 5 | JGI25162J39368_1000247 | 3300002737 | Bacteria | 54064 |
| 6 | JGI25162J39368_1000735 | 3300002737 | Bacteria | 22503 |
| 7 | JGI25154J39366_1000092 | 3300002738 | Bacteria | 80685 |
| 8 | JGI25157J39369_1000087 | 3300002741 | Bacteria | 80840 |
| 9 | JGI25157J39369_1000175 | 3300002741 | Bacteria | 54070 |
| 10 | JGI25159J45721_1000030 | 3300002987 | Bacteria | 102429 |
| 11 | JGI25151J46595_10048693 | 3300003187 | Bacteria | 1462 |
| 12 | JGI25406J46586_10000214 | 3300003203 | Bacteria | 25609 |
| 13 | JGI25165J46597_1000020 | 3300003214 | Bacteria | 370477 |
| 14 | JGI25165J46597_1000237 | 3300003214 | Bacteria | 75663 |
| 15 | JGI25165J46597_1000412 | 3300003214 | Bacteria | 44966 |
| 16 | JGI25165J46597_1005141 | 3300003214 | Bacteria | 2592 |
| 17 | JGI25153J46596_10000151 | 3300003215 | Bacteria | 70139 |
| 18 | JGI25153J46596_10003908 | 3300003215 | Bacteria | 8174 |
| 19 | JGI25153J46596_10005616 | 3300003215 | Bacteria | 6556 |
| 20 | JGI25160J50197_1000075 | 3300003354 | Bacteria | 102429 |
| 21 | JGI25160J50197_1003595 | 3300003354 | Bacteria | 6881 |
| 22 | JGI25160J50197_1024708 | 3300003354 | Bacteria | 1699 |
| 23 | JGI25160J50197_1025086 | 3300003354 | Bacteria | 1676 |
| 24 | JGI25161J50226_1000316 | 3300003374 | Bacteria | 26515 |
| 25 | JGI25404J52841_10002699 | 3300003659 | Bacteria | 3396 |
| 26 | Ga0055539_1008676 | 3300003752 | Bacteria | 1269 |
| 27 | Ga0055542_1000841 | 3300003762 | Bacteria | 21767 |
| 28 | Ga0055529_1007252 | 3300003763 | Bacteria | 1515 |
| 29 | Ga0055526_1005688 | 3300003771 | Bacteria | 7073 |
| 30 | Ga0055526_1029564 | 3300003771 | Bacteria | 1623 |
| 31 | Ga0055524_1000960 | 3300003775 | Bacteria | 18186 |
| 32 | Ga0055536_1003695 | 3300003781 | Bacteria | 8124 |
| 33 | Ga0055540_1000131 | 3300003792 | Bacteria | 75615 |
| 34 | Ga0055531_10014237 | 3300003794 | Bacteria | 3599 |
| 35 | Ga0055543_1003338 | 3300004625 | Bacteria | 4791 |
| 36 | Ga0065165_1000048 | 3300005262 | Bacteria | 196539 |
| 37 | Ga0065165_1000206 | 3300005262 | Bacteria | 102467 |
| 38 | Ga0065165_1000582 | 3300005262 | Bacteria | 53862 |
| 39 | Ga0065165_1002074 | 3300005262 | Bacteria | 18412 |
| 40 | Ga0065165_1002220 | 3300005262 | Bacteria | 17337 |
| 41 | Ga0065165_1005485 | 3300005262 | Bacteria | 7101 |
| 42 | Ga0065712_10099907 | 3300005290 | Bacteria | 2077 |
| 43 | Ga0070683_100052860 | 3300005329 | Bacteria | 3764 |
| 44 | Ga0070690_100103442 | 3300005330 | Bacteria | 1891 |
| 45 | Ga0070690_100212356 | 3300005330 | Bacteria | 1352 |
| 46 | Ga0068869_100129353 | 3300005334 | Bacteria | 1939 |
| 47 | Ga0070680_100052018 | 3300005336 | Bacteria | 3343 |
| 48 | Ga0070680_100075104 | 3300005336 | Bacteria | 2782 |
| 49 | Ga0070680_100131570 | 3300005336 | Bacteria | 2094 |
| 50 | Ga0070682_100409483 | 3300005337 | Bacteria | 1028 |
| 51 | Ga0070660_100051646 | 3300005339 | Bacteria | 3167 |
| 52 | Ga0070660_100206106 | 3300005339 | Bacteria | 1596 |
| 53 | Ga0070661_100232344 | 3300005344 | Bacteria | 1418 |
| 54 | Ga0070668_100151197 | 3300005347 | Bacteria | 1877 |
| 55 | Ga0070671_100068387 | 3300005355 | Bacteria | 2962 |
| 56 | Ga0070674_100027518 | 3300005356 | Bacteria | 3727 |
| 57 | Ga0070674_100086602 | 3300005356 | Bacteria | 2250 |
| 58 | Ga0070674_100201329 | 3300005356 | Bacteria | 1538 |
| 59 | Ga0070688_100060270 | 3300005365 | Bacteria | 2396 |
| 60 | Ga0070659_100012688 | 3300005366 | Bacteria | 6251 |
| 61 | Ga0070659_100053918 | 3300005366 | Bacteria | 3166 |
| 62 | Ga0070667_100188613 | 3300005367 | Bacteria | 1826 |
| 63 | Ga0070709_10000203 | 3300005434 | Bacteria | 38151 |
| 64 | Ga0070709_10004227 | 3300005434 | Bacteria | 7743 |
| 65 | Ga0070709_10004390 | 3300005434 | Bacteria | 7605 |
| 66 | Ga0070709_10065310 | 3300005434 | Bacteria | 2330 |
| 67 | Ga0070714_100065966 | 3300005435 | Bacteria | 3119 |
| 68 | Ga0070714_100149564 | 3300005435 | Bacteria | 2103 |
| 69 | Ga0070713_100001761 | 3300005436 | Bacteria | 13967 |
| 70 | Ga0070713_100010384 | 3300005436 | Bacteria | 6727 |
| 71 | Ga0070713_100016592 | 3300005436 | Bacteria | 5539 |
| 72 | Ga0070713_100183503 | 3300005436 | Bacteria | 1881 |
| 73 | Ga0070710_10002045 | 3300005437 | Bacteria | 9560 |
| 74 | Ga0070711_100001730 | 3300005439 | Bacteria | 12117 |
| 75 | Ga0070711_100006659 | 3300005439 | Bacteria | 6985 |
| 76 | Ga0070711_100011938 | 3300005439 | Bacteria | 5407 |
| 77 | Ga0070711_100014917 | 3300005439 | Bacteria | 4908 |
| 78 | Ga0070711_100019115 | 3300005439 | Bacteria | 4390 |
| 79 | Ga0070708_100109740 | 3300005445 | Bacteria | 2535 |
| 80 | Ga0070663_100076740 | 3300005455 | Bacteria | 2444 |
| 81 | Ga0070662_100365092 | 3300005457 | Bacteria | 1185 |
| 82 | Ga0070681_10003273 | 3300005458 | Bacteria | 15113 |
| 83 | Ga0070681_10025087 | 3300005458 | Bacteria | 6000 |
| 84 | Ga0070681_10065024 | 3300005458 | Bacteria | 3617 |
| 85 | Ga0070706_100156571 | 3300005467 | Bacteria | 2127 |
| 86 | Ga0070707_100176291 | 3300005468 | Bacteria | 2084 |
| 87 | Ga0070679_100017482 | 3300005530 | Bacteria | 6941 |
| 88 | Ga0070679_100024100 | 3300005530 | Bacteria | 5962 |
| 89 | Ga0070679_100174677 | 3300005530 | Bacteria | 2121 |
| 90 | Ga0070684_100013567 | 3300005535 | Bacteria | 6575 |
| 91 | Ga0070684_100089906 | 3300005535 | Bacteria | 2729 |
| 92 | Ga0070684_100094373 | 3300005535 | Bacteria | 2665 |
| 93 | Ga0070684_100285812 | 3300005535 | Bacteria | 1512 |
| 94 | Ga0070697_100106656 | 3300005536 | Bacteria | 2331 |
| 95 | Ga0068853_100009540 | 3300005539 | Bacteria | 7820 |
| 96 | Ga0068853_100040363 | 3300005539 | Bacteria | 3982 |
| 97 | Ga0068853_100416381 | 3300005539 | Bacteria | 1259 |
| 98 | Ga0070665_100014994 | 3300005548 | Bacteria | 7779 |
| 99 | Ga0070665_100552780 | 3300005548 | Bacteria | 1163 |
| 100 | Ga0068855_100018899 | 3300005563 | Bacteria | 8282 |
| 101 | Ga0068855_100067952 | 3300005563 | Bacteria | 4150 |
| 102 | Ga0068855_100114327 | 3300005563 | Bacteria | 3095 |
| 103 | Ga0068855_100151551 | 3300005563 | Bacteria | 2636 |
| 104 | Ga0068855_100184319 | 3300005563 | Bacteria | 2359 |
| 105 | Ga0068855_100386568 | 3300005563 | Bacteria | 1536 |
| 106 | Ga0068855_100419655 | 3300005563 | Bacteria | 1464 |
| 107 | Ga0068855_100480299 | 3300005563 | Bacteria | 1353 |
| 108 | Ga0070664_100283719 | 3300005564 | Bacteria | 1494 |
| 109 | Ga0068857_100016047 | 3300005577 | Bacteria | 6562 |
| 110 | Ga0068854_100192480 | 3300005578 | Bacteria | 1599 |
| 111 | Ga0068854_100207275 | 3300005578 | Bacteria | 1544 |
| 112 | Ga0068856_100003888 | 3300005614 | Bacteria | 14981 |
| 113 | Ga0068856_100055216 | 3300005614 | Bacteria | 3919 |
| 114 | Ga0068856_100068625 | 3300005614 | Bacteria | 3505 |
| 115 | Ga0068856_100230817 | 3300005614 | Bacteria | 1866 |
| 116 | Ga0070702_100045764 | 3300005615 | Bacteria | 2477 |
| 117 | Ga0068852_100011984 | 3300005616 | Bacteria | 6558 |
| 118 | Ga0068852_100032466 | 3300005616 | Bacteria | 4323 |
| 119 | Ga0068852_100213007 | 3300005616 | Bacteria | 1834 |
| 120 | Ga0068859_100160460 | 3300005617 | Bacteria | 2327 |
| 121 | Ga0068859_100163980 | 3300005617 | Bacteria | 2301 |
| 122 | Ga0068864_100384391 | 3300005618 | Bacteria | 1331 |
| 123 | Ga0068864_100544067 | 3300005618 | Bacteria | 1121 |
| 124 | Ga0068851_10004825 | 3300005834 | Bacteria | 6103 |
| 125 | Ga0068863_100315590 | 3300005841 | Bacteria | 1518 |
| 126 | Ga0068858_100228037 | 3300005842 | Bacteria | 1765 |
| 127 | Ga0068860_100000081 | 3300005843 | Bacteria | 170066 |
| 128 | Ga0068860_100081543 | 3300005843 | Bacteria | 3076 |
| 129 | Ga0068860_100100065 | 3300005843 | Bacteria | 2765 |
| 130 | Ga0068860_100134124 | 3300005843 | Bacteria | 2377 |
| 131 | Ga0068862_100103763 | 3300005844 | Bacteria | 2490 |
| 132 | Ga0068862_100213910 | 3300005844 | Bacteria | 1742 |
| 133 | Ga0081455_10001734 | 3300005937 | Bacteria | 26379 |
| 134 | Ga0081455_10013417 | 3300005937 | Bacteria | 8100 |
| 135 | Ga0081455_10015026 | 3300005937 | Bacteria | 7541 |
| 136 | Ga0081455_10028177 | 3300005937 | Bacteria | 5135 |
| 137 | Ga0081455_10056973 | 3300005937 | Bacteria | 3315 |
| 138 | Ga0081455_10120310 | 3300005937 | Bacteria | 2070 |
| 139 | Ga0081540_1003965 | 3300005983 | Bacteria | 11501 |
| 140 | Ga0081540_1006422 | 3300005983 | Bacteria | 8558 |
| 141 | Ga0081540_1007697 | 3300005983 | Bacteria | 7637 |
| 142 | Ga0081540_1011844 | 3300005983 | Bacteria | 5796 |
| 143 | Ga0081540_1012349 | 3300005983 | Bacteria | 5635 |
| 144 | Ga0081540_1013491 | 3300005983 | Bacteria | 5308 |
| 145 | Ga0081540_1014236 | 3300005983 | Bacteria | 5110 |
| 146 | Ga0081540_1018818 | 3300005983 | Bacteria | 4222 |
| 147 | Ga0081539_10000768 | 3300005985 | Bacteria | 63055 |
| 148 | Ga0081539_10001470 | 3300005985 | Bacteria | 39952 |
| 149 | Ga0070717_10001267 | 3300006028 | Bacteria | 17258 |
| 150 | Ga0070717_10106472 | 3300006028 | Bacteria | 2388 |
| 151 | Ga0070717_10115762 | 3300006028 | Bacteria | 2291 |
| 152 | Ga0075365_10086145 | 3300006038 | Bacteria | 2135 |
| 153 | Ga0075365_10103698 | 3300006038 | Bacteria | 1949 |
| 154 | Ga0075368_10001363 | 3300006042 | Bacteria | 7775 |
| 155 | Ga0075368_10021695 | 3300006042 | Bacteria | 2441 |
| 156 | Ga0075368_10057252 | 3300006042 | Bacteria | 1556 |
| 157 | Ga0075363_100013881 | 3300006048 | Bacteria | 3920 |
| 158 | Ga0075363_100067582 | 3300006048 | Bacteria | 1937 |
| 159 | Ga0075363_100077073 | 3300006048 | Bacteria | 1819 |
| 160 | Ga0075364_10060783 | 3300006051 | Bacteria | 2477 |
| 161 | Ga0075364_10145166 | 3300006051 | Bacteria | 1597 |
| 162 | Ga0075364_10251643 | 3300006051 | Bacteria | 1201 |
| 163 | Ga0070715_10005933 | 3300006163 | Bacteria | 4117 |
| 164 | Ga0070715_10121468 | 3300006163 | Bacteria | 1246 |
| 165 | Ga0070716_100002732 | 3300006173 | Bacteria | 8182 |
| 166 | Ga0070712_100006733 | 3300006175 | Bacteria | 7144 |
| 167 | Ga0070712_100055550 | 3300006175 | Bacteria | 2774 |
| 168 | Ga0070712_100074402 | 3300006175 | Bacteria | 2440 |
| 169 | Ga0070712_100085459 | 3300006175 | Bacteria | 2297 |
| 170 | Ga0070712_100200603 | 3300006175 | Bacteria | 1567 |
| 171 | Ga0075362_10024903 | 3300006177 | Bacteria | 2541 |
| 172 | Ga0075362_10040701 | 3300006177 | Bacteria | 2047 |
| 173 | Ga0075362_10056901 | 3300006177 | Bacteria | 1761 |
| 174 | Ga0075362_10065700 | 3300006177 | Bacteria | 1647 |
| 175 | Ga0075367_10007415 | 3300006178 | Bacteria | 5612 |
| 176 | Ga0075367_10081807 | 3300006178 | Bacteria | 1954 |
| 177 | Ga0075369_10035267 | 3300006186 | Bacteria | 2126 |
| 178 | Ga0075369_10055915 | 3300006186 | Bacteria | 1715 |
| 179 | Ga0075369_10080657 | 3300006186 | Bacteria | 1443 |
| 180 | Ga0075366_10072981 | 3300006195 | Bacteria | 2045 |
| 181 | Ga0097621_100315787 | 3300006237 | Bacteria | 1383 |
| 182 | Ga0075370_10013567 | 3300006353 | Bacteria | 4335 |
| 183 | Ga0075370_10109286 | 3300006353 | Bacteria | 1604 |
| 184 | Ga0075428_100424997 | 3300006844 | Bacteria | 1424 |
| 185 | Ga0075431_100002184 | 3300006847 | Bacteria | 18706 |
| 186 | Ga0075434_100066744 | 3300006871 | Bacteria | 3584 |
| 187 | Ga0075429_100020728 | 3300006880 | Bacteria | 5706 |
| 188 | Ga0075436_100101586 | 3300006914 | Bacteria | 2003 |
| 189 | Ga0097620_100160446 | 3300006931 | Bacteria | 2327 |
| 190 | Ga0097620_100163987 | 3300006931 | Bacteria | 2301 |
| 191 | Ga0099825_1032134 | 3300006941 | Bacteria | 2158 |
| 192 | Ga0099824_1007408 | 3300006942 | Bacteria | 14551 |
| 193 | Ga0099824_1023175 | 3300006942 | Bacteria | 3914 |
| 194 | Ga0099822_1018218 | 3300006943 | Bacteria | 7346 |
| 195 | Ga0099823_1024506 | 3300006944 | Bacteria | 5452 |
| 196 | Ga0075435_100249788 | 3300007076 | Bacteria | 1510 |
| 197 | Ga0099795_10047078 | 3300007788 | Bacteria | 1557 |
| 198 | Ga0105240_10008768 | 3300009093 | Bacteria | 14409 |
| 199 | Ga0105240_10034221 | 3300009093 | Bacteria | 6557 |
| 200 | Ga0105240_10076136 | 3300009093 | Bacteria | 4137 |
| 201 | Ga0105240_10120101 | 3300009093 | Bacteria | 3165 |
| 202 | Ga0105240_10129667 | 3300009093 | Bacteria | 3026 |
| 203 | Ga0105240_10206609 | 3300009093 | Bacteria | 2298 |
| 204 | Ga0105240_10255829 | 3300009093 | Bacteria | 2022 |
| 205 | Ga0105245_10063788 | 3300009098 | Bacteria | 3328 |
| 206 | Ga0105245_10098072 | 3300009098 | Bacteria | 2707 |
| 207 | Ga0105247_10026143 | 3300009101 | Bacteria | 3524 |
| 208 | Ga0105247_10091007 | 3300009101 | Bacteria | 1936 |
| 209 | Ga0105247_10116887 | 3300009101 | Bacteria | 1723 |
| 210 | Ga0114129_10069546 | 3300009147 | Bacteria | 4907 |
| 211 | Ga0105241_10028779 | 3300009174 | Bacteria | 4140 |
| 212 | Ga0105241_10035078 | 3300009174 | Bacteria | 3773 |
| 213 | Ga0105241_10265431 | 3300009174 | Bacteria | 1460 |
| 214 | Ga0105242_10262412 | 3300009176 | Bacteria | 1561 |
| 215 | Ga0105248_10374305 | 3300009177 | Bacteria | 1603 |
| 216 | Ga0105237_10004427 | 3300009545 | Bacteria | 16284 |
| 217 | Ga0105237_10047513 | 3300009545 | Bacteria | 4315 |
| 218 | Ga0105237_10133855 | 3300009545 | Bacteria | 2473 |
| 219 | Ga0105237_10263849 | 3300009545 | Bacteria | 1725 |
| 220 | Ga0105237_10388095 | 3300009545 | Bacteria | 1401 |
| 221 | Ga0105237_10389256 | 3300009545 | Bacteria | 1399 |
| 222 | Ga0105237_10510928 | 3300009545 | Bacteria | 1208 |
| 223 | Ga0105238_10017402 | 3300009551 | Bacteria | 7303 |
| 224 | Ga0105238_10081432 | 3300009551 | Bacteria | 3227 |
| 225 | Ga0105238_10105713 | 3300009551 | Bacteria | 2796 |
| 226 | Ga0105238_10193087 | 3300009551 | Bacteria | 2012 |
| 227 | Ga0105249_10206780 | 3300009553 | Bacteria | 1924 |
| 228 | Ga0099796_10014810 | 3300010159 | Bacteria | 2263 |
| 229 | Ga0105239_10017021 | 3300010375 | Bacteria | 8036 |
| 230 | Ga0105239_10063018 | 3300010375 | Bacteria | 4070 |
| 231 | Ga0105239_10083385 | 3300010375 | Bacteria | 3520 |
| 232 | Ga0105239_10092409 | 3300010375 | Bacteria | 3340 |
| 233 | Ga0105239_10132432 | 3300010375 | Bacteria | 2774 |
| 234 | Ga0105239_10139240 | 3300010375 | Bacteria | 2703 |
| 235 | Ga0105239_10684333 | 3300010375 | Bacteria | 1172 |
| 236 | Ga0105246_10132761 | 3300011119 | Bacteria | 1862 |
| 237 | Ga0105246_10202766 | 3300011119 | Bacteria | 1543 |
| 238 | Ga0105246_10224999 | 3300011119 | Bacteria | 1473 |
| 239 | Ga0105246_10270163 | 3300011119 | Bacteria | 1359 |
| 240 | Ga0157371_10075245 | 3300013102 | Bacteria | 2391 |
| 241 | Ga0157370_10014947 | 3300013104 | Bacteria | 7918 |
| 242 | Ga0157370_10025078 | 3300013104 | Bacteria | 5903 |
| 243 | Ga0157369_10012270 | 3300013105 | Bacteria | 9731 |
| 244 | Ga0157369_10021190 | 3300013105 | Bacteria | 7267 |
| 245 | Ga0157369_10151314 | 3300013105 | Bacteria | 2452 |
| 246 | Ga0157369_10187272 | 3300013105 | Bacteria | 2176 |
| 247 | Ga0157369_10227813 | 3300013105 | Bacteria | 1949 |
| 248 | Ga0157374_10200703 | 3300013296 | Bacteria | 1953 |
| 249 | Ga0157378_10009041 | 3300013297 | Bacteria | 8671 |
| 250 | Ga0157378_10345420 | 3300013297 | Bacteria | 1452 |
| 251 | Ga0163162_10088250 | 3300013306 | Bacteria | 3181 |
| 252 | Ga0163162_10317092 | 3300013306 | Bacteria | 1692 |
| 253 | Ga0157375_10047518 | 3300013308 | Bacteria | 4192 |
| 254 | Ga0157375_10189822 | 3300013308 | Bacteria | 2209 |
| 255 | Ga0157375_10197290 | 3300013308 | Bacteria | 2168 |
| 256 | Ga0163163_10008215 | 3300014325 | Bacteria | 9260 |
| 257 | Ga0163163_10011315 | 3300014325 | Bacteria | 8088 |
| 258 | Ga0163163_10179953 | 3300014325 | Bacteria | 2161 |
| 259 | Ga0163163_10232184 | 3300014325 | Bacteria | 1894 |
| 260 | Ga0163163_10414029 | 3300014325 | Bacteria | 1407 |
| 261 | Ga0157380_10141045 | 3300014326 | Bacteria | 2071 |
| 262 | Ga0182008_10006828 | 3300014497 | Bacteria | 6350 |
| 263 | Ga0157377_10191485 | 3300014745 | Bacteria | 1293 |
| 264 | Ga0157379_10100048 | 3300014968 | Bacteria | 2603 |
| 265 | Ga0157376_10347565 | 3300014969 | Bacteria | 1418 |
| 266 | Ga0163161_10149601 | 3300017792 | Bacteria | 1774 |
| 267 | Ga0163161_10196512 | 3300017792 | Bacteria | 1553 |
| 268 | Ga0163161_10205589 | 3300017792 | Bacteria | 1519 |
| 269 | Ga0214544_1001813 | 3300021320 | Bacteria | 44864 |
| 270 | Ga0214544_1032568 | 3300021320 | Bacteria | 1615 |
| 271 | Ga0214542_1001236 | 3300021321 | Bacteria | 51849 |
| 272 | Ga0214542_1028629 | 3300021321 | Bacteria | 2383 |
| 273 | Ga0214542_1039400 | 3300021321 | Bacteria | 1254 |
| 274 | Ga0214545_1000924 | 3300021324 | Bacteria | 51830 |
| 275 | Ga0214545_1023651 | 3300021324 | Bacteria | 3988 |
| 276 | Ga0214545_1027979 | 3300021324 | Bacteria | 2781 |
| 277 | Ga0214543_1003531 | 3300021327 | Bacteria | 30263 |
| 278 | Ga0214543_1024471 | 3300021327 | Bacteria | 3724 |
| 279 | Ga0214543_1034461 | 3300021327 | Bacteria | 1731 |
| 280 | Ga0214543_1035893 | 3300021327 | Bacteria | 1583 |
| 281 | Ga0213876_10000520 | 3300021384 | Bacteria | 29496 |
| 282 | Ga0213876_10001886 | 3300021384 | Bacteria | 12605 |
| 283 | Ga0213876_10008410 | 3300021384 | Bacteria | 5584 |
| 284 | Ga0213876_10020027 | 3300021384 | Bacteria | 3534 |
| 285 | Ga0213876_10089360 | 3300021384 | Bacteria | 1632 |
| 286 | Ga0209435_100059 | 3300025206 | Bacteria | 80744 |
| 287 | Ga0209436_100823 | 3300025208 | Bacteria | 12589 |
| 288 | Ga0209563_101384 | 3300025230 | Bacteria | 6524 |
| 289 | Ga0209563_102893 | 3300025230 | Bacteria | 3718 |
| 290 | Ga0209437_100042 | 3300025233 | Bacteria | 444095 |
| 291 | Ga0209437_100062 | 3300025233 | Bacteria | 336900 |
| 292 | Ga0209646_1000179 | 3300025246 | Bacteria | 80892 |
| 293 | Ga0209646_1011629 | 3300025246 | Bacteria | 1360 |
| 294 | Ga0209026_1000005 | 3300025250 | Bacteria | 731387 |
| 295 | Ga0209026_1000212 | 3300025250 | Bacteria | 80892 |
| 296 | Ga0209677_106293 | 3300025253 | Bacteria | 2846 |
| 297 | Ga0209148_1000136 | 3300025254 | Bacteria | 169088 |
| 298 | Ga0209148_1000180 | 3300025254 | Bacteria | 124830 |
| 299 | Ga0209759_1000111 | 3300025256 | Bacteria | 143545 |
| 300 | Ga0209759_1000246 | 3300025256 | Bacteria | 80892 |
| 301 | Ga0209233_1000047 | 3300025261 | Bacteria | 459614 |
| 302 | Ga0209233_1000054 | 3300025261 | Bacteria | 439669 |
| 303 | Ga0209233_1000082 | 3300025261 | Bacteria | 336320 |
| 304 | Ga0209233_1010707 | 3300025261 | Bacteria | 2732 |
| 305 | Ga0209565_1009385 | 3300025263 | Bacteria | 2488 |
| 306 | Ga0209455_1000170 | 3300025272 | Bacteria | 110681 |
| 307 | Ga0209455_1003748 | 3300025272 | Bacteria | 5242 |
| 308 | Ga0209673_1000642 | 3300025273 | Bacteria | 52672 |
| 309 | Ga0209130_1000071 | 3300025284 | Bacteria | 178273 |
| 310 | Ga0209130_1000154 | 3300025284 | Bacteria | 102645 |
| 311 | Ga0209676_1004026 | 3300025292 | Bacteria | 8461 |
| 312 | Ga0209025_1000032 | 3300025294 | Bacteria | 416141 |
| 313 | Ga0209025_1002646 | 3300025294 | Bacteria | 18319 |
| 314 | Ga0209564_1000025 | 3300025295 | Bacteria | 520535 |
| 315 | Ga0209564_1000385 | 3300025295 | Bacteria | 80273 |
| 316 | Ga0209564_1017303 | 3300025295 | Bacteria | 2818 |
| 317 | Ga0209564_1023087 | 3300025295 | Bacteria | 2174 |
| 318 | Ga0209758_1000011 | 3300025297 | Bacteria | 1049685 |
| 319 | Ga0209758_1000120 | 3300025297 | Bacteria | 192212 |
| 320 | Ga0209758_1001210 | 3300025297 | Bacteria | 32486 |
| 321 | Ga0209758_1004569 | 3300025297 | Bacteria | 11413 |
| 322 | Ga0209758_1008059 | 3300025297 | Bacteria | 6953 |
| 323 | Ga0209758_1015568 | 3300025297 | Bacteria | 3925 |
| 324 | Ga0209758_1029522 | 3300025297 | Bacteria | 2290 |
| 325 | Ga0209050_1005957 | 3300025298 | Bacteria | 7411 |
| 326 | Ga0209256_1000073 | 3300025299 | Bacteria | 237553 |
| 327 | Ga0209256_1000907 | 3300025299 | Bacteria | 36321 |
| 328 | Ga0209256_1005155 | 3300025299 | Bacteria | 7715 |
| 329 | Ga0207426_1000286 | 3300025302 | Bacteria | 102853 |
| 330 | Ga0207426_1000572 | 3300025302 | Bacteria | 49561 |
| 331 | Ga0207426_1001763 | 3300025302 | Bacteria | 16381 |
| 332 | Ga0207426_1039826 | 3300025302 | Bacteria | 1468 |
| 333 | Ga0209051_1000038 | 3300025303 | Bacteria | 320926 |
| 334 | Ga0209051_1002477 | 3300025303 | Bacteria | 13187 |
| 335 | Ga0209257_1003099 | 3300025304 | Bacteria | 14900 |
| 336 | Ga0209257_1009764 | 3300025304 | Bacteria | 5037 |
| 337 | Ga0209257_1013498 | 3300025304 | Bacteria | 3624 |
| 338 | Ga0209257_1035619 | 3300025304 | Bacteria | 1538 |
| 339 | Ga0207692_10058851 | 3300025898 | Bacteria | 1981 |
| 340 | Ga0207692_10065222 | 3300025898 | Bacteria | 1899 |
| 341 | Ga0207642_10105860 | 3300025899 | Bacteria | 1422 |
| 342 | Ga0207710_10014873 | 3300025900 | Bacteria | 3287 |
| 343 | Ga0207710_10016392 | 3300025900 | Bacteria | 3134 |
| 344 | Ga0207688_10021360 | 3300025901 | Bacteria | 3536 |
| 345 | Ga0207647_10035646 | 3300025904 | Bacteria | 3169 |
| 346 | Ga0207699_10002275 | 3300025906 | Bacteria | 9062 |
| 347 | Ga0207699_10008564 | 3300025906 | Bacteria | 5056 |
| 348 | Ga0207699_10056061 | 3300025906 | Bacteria | 2347 |
| 349 | Ga0207699_10167145 | 3300025906 | Bacteria | 1469 |
| 350 | Ga0207705_10191644 | 3300025909 | Bacteria | 1546 |
| 351 | Ga0207684_10294696 | 3300025910 | Bacteria | 1399 |
| 352 | Ga0207684_10302188 | 3300025910 | Bacteria | 1380 |
| 353 | Ga0207654_10033726 | 3300025911 | Bacteria | 2840 |
| 354 | Ga0207654_10036096 | 3300025911 | Bacteria | 2759 |
| 355 | Ga0207654_10086640 | 3300025911 | Bacteria | 1899 |
| 356 | Ga0207707_10000419 | 3300025912 | Bacteria | 44410 |
| 357 | Ga0207707_10002705 | 3300025912 | Bacteria | 15850 |
| 358 | Ga0207707_10002868 | 3300025912 | Bacteria | 15401 |
| 359 | Ga0207707_10045918 | 3300025912 | Bacteria | 3804 |
| 360 | Ga0207695_10000008 | 3300025913 | Bacteria | 1058268 |
| 361 | Ga0207695_10152018 | 3300025913 | Bacteria | 2253 |
| 362 | Ga0207695_10180414 | 3300025913 | Bacteria | 2032 |
| 363 | Ga0207671_10008982 | 3300025914 | Bacteria | 8407 |
| 364 | Ga0207671_10034078 | 3300025914 | Bacteria | 3785 |
| 365 | Ga0207671_10059255 | 3300025914 | Bacteria | 2839 |
| 366 | Ga0207671_10061259 | 3300025914 | Bacteria | 2792 |
| 367 | Ga0207671_10088306 | 3300025914 | Bacteria | 2332 |
| 368 | Ga0207671_10156832 | 3300025914 | Bacteria | 1761 |
| 369 | Ga0207671_10170665 | 3300025914 | Bacteria | 1689 |
| 370 | Ga0207693_10013446 | 3300025915 | Bacteria | 6599 |
| 371 | Ga0207693_10019720 | 3300025915 | Bacteria | 5362 |
| 372 | Ga0207693_10033602 | 3300025915 | Bacteria | 4046 |
| 373 | Ga0207693_10188687 | 3300025915 | Bacteria | 1622 |
| 374 | Ga0207693_10228159 | 3300025915 | Bacteria | 1462 |
| 375 | Ga0207663_10000249 | 3300025916 | Bacteria | 23744 |
| 376 | Ga0207663_10002050 | 3300025916 | Bacteria | 9597 |
| 377 | Ga0207663_10007087 | 3300025916 | Bacteria | 5789 |
| 378 | Ga0207663_10067281 | 3300025916 | Bacteria | 2297 |
| 379 | Ga0207660_10106711 | 3300025917 | Bacteria | 2100 |
| 380 | Ga0207657_10026743 | 3300025919 | Bacteria | 5295 |
| 381 | Ga0207657_10188524 | 3300025919 | Bacteria | 1665 |
| 382 | Ga0207657_10262314 | 3300025919 | Bacteria | 1375 |
| 383 | Ga0207649_10039488 | 3300025920 | Bacteria | 2862 |
| 384 | Ga0207649_10084927 | 3300025920 | Bacteria | 2059 |
| 385 | Ga0207649_10151437 | 3300025920 | Bacteria | 1598 |
| 386 | Ga0207652_10001690 | 3300025921 | Bacteria | 19300 |
| 387 | Ga0207652_10011695 | 3300025921 | Bacteria | 7082 |
| 388 | Ga0207652_10048077 | 3300025921 | Bacteria | 3646 |
| 389 | Ga0207646_10238573 | 3300025922 | Bacteria | 1643 |
| 390 | Ga0207694_10027290 | 3300025924 | Bacteria | 4347 |
| 391 | Ga0207694_10068409 | 3300025924 | Bacteria | 2773 |
| 392 | Ga0207694_10191173 | 3300025924 | Bacteria | 1663 |
| 393 | Ga0207694_10245057 | 3300025924 | Bacteria | 1465 |
| 394 | Ga0207694_10324959 | 3300025924 | Bacteria | 1270 |
| 395 | Ga0207694_10327683 | 3300025924 | Bacteria | 1265 |
| 396 | Ga0207650_10303663 | 3300025925 | Bacteria | 1304 |
| 397 | Ga0207659_10098980 | 3300025926 | Bacteria | 2194 |
| 398 | Ga0207700_10035637 | 3300025928 | Bacteria | 3586 |
| 399 | Ga0207700_10047104 | 3300025928 | Bacteria | 3193 |
| 400 | Ga0207700_10136610 | 3300025928 | Bacteria | 2009 |
| 401 | Ga0207664_10029904 | 3300025929 | Bacteria | 4155 |
| 402 | Ga0207664_10071647 | 3300025929 | Bacteria | 2792 |
| 403 | Ga0207690_10030753 | 3300025932 | Bacteria | 3428 |
| 404 | Ga0207706_10275897 | 3300025933 | Bacteria | 1467 |
| 405 | Ga0207709_10074401 | 3300025935 | Bacteria | 2167 |
| 406 | Ga0207670_10053842 | 3300025936 | Bacteria | 2713 |
| 407 | Ga0207670_10420066 | 3300025936 | Bacteria | 1073 |
| 408 | Ga0207669_10183380 | 3300025937 | Bacteria | 1503 |
| 409 | Ga0207704_10175967 | 3300025938 | Bacteria | 1541 |
| 410 | Ga0207665_10001320 | 3300025939 | Bacteria | 16732 |
| 411 | Ga0207665_10001972 | 3300025939 | Bacteria | 13825 |
| 412 | Ga0207711_10043240 | 3300025941 | Bacteria | 3841 |
| 413 | Ga0207689_10044019 | 3300025942 | Bacteria | 3690 |
| 414 | Ga0207689_10088660 | 3300025942 | Bacteria | 2541 |
| 415 | Ga0207661_10001270 | 3300025944 | Bacteria | 16867 |
| 416 | Ga0207661_10008213 | 3300025944 | Bacteria | 7451 |
| 417 | Ga0207661_10264831 | 3300025944 | Bacteria | 1532 |
| 418 | Ga0207679_10069235 | 3300025945 | Bacteria | 2654 |
| 419 | Ga0207679_10286765 | 3300025945 | Bacteria | 1414 |
| 420 | Ga0207667_10002017 | 3300025949 | Bacteria | 25487 |
| 421 | Ga0207667_10124956 | 3300025949 | Bacteria | 2650 |
| 422 | Ga0207667_10134592 | 3300025949 | Bacteria | 2545 |
| 423 | Ga0207667_10209954 | 3300025949 | Bacteria | 1995 |
| 424 | Ga0207651_10125014 | 3300025960 | Bacteria | 1958 |
| 425 | Ga0207712_10312704 | 3300025961 | Bacteria | 1293 |
| 426 | Ga0207668_10050204 | 3300025972 | Bacteria | 2873 |
| 427 | Ga0207668_10245334 | 3300025972 | Bacteria | 1451 |
| 428 | Ga0207640_10148313 | 3300025981 | Bacteria | 1720 |
| 429 | Ga0207640_10189558 | 3300025981 | Bacteria | 1549 |
| 430 | Ga0207640_10274661 | 3300025981 | Bacteria | 1320 |
| 431 | Ga0207658_10150957 | 3300025986 | Bacteria | 1893 |
| 432 | Ga0207658_10211814 | 3300025986 | Bacteria | 1625 |
| 433 | Ga0207658_10218779 | 3300025986 | Bacteria | 1601 |
| 434 | Ga0207677_10073275 | 3300026023 | Bacteria | 2424 |
| 435 | Ga0207703_10136925 | 3300026035 | Bacteria | 2121 |
| 436 | Ga0207639_10006277 | 3300026041 | Bacteria | 8071 |
| 437 | Ga0207639_10035603 | 3300026041 | Bacteria | 3685 |
| 438 | Ga0207639_10379100 | 3300026041 | Bacteria | 1270 |
| 439 | Ga0207678_10060137 | 3300026067 | Bacteria | 3268 |
| 440 | Ga0207678_10061454 | 3300026067 | Bacteria | 3231 |
| 441 | Ga0207678_10067879 | 3300026067 | Bacteria | 3060 |
| 442 | Ga0207678_10072014 | 3300026067 | Bacteria | 2962 |
| 443 | Ga0207708_10115077 | 3300026075 | Bacteria | 2091 |
| 444 | Ga0207702_10000548 | 3300026078 | Bacteria | 41978 |
| 445 | Ga0207702_10019097 | 3300026078 | Bacteria | 5673 |
| 446 | Ga0207702_10049458 | 3300026078 | Bacteria | 3548 |
| 447 | Ga0207702_10098547 | 3300026078 | Bacteria | 2575 |
| 448 | Ga0207702_10248491 | 3300026078 | Bacteria | 1669 |
| 449 | Ga0207641_10036305 | 3300026088 | Bacteria | 4114 |
| 450 | Ga0207676_10271343 | 3300026095 | Bacteria | 1536 |
| 451 | Ga0207674_10010575 | 3300026116 | Bacteria | 10440 |
| 452 | Ga0207674_10226613 | 3300026116 | Bacteria | 1817 |
| 453 | Ga0207675_100112829 | 3300026118 | Bacteria | 2566 |
| 454 | Ga0207675_100114354 | 3300026118 | Bacteria | 2549 |
| 455 | Ga0207675_100130814 | 3300026118 | Bacteria | 2380 |
| 456 | Ga0207675_100218893 | 3300026118 | Bacteria | 1834 |
| 457 | Ga0207683_10021694 | 3300026121 | Bacteria | 5504 |
| 458 | Ga0207683_10033936 | 3300026121 | Bacteria | 4434 |
| 459 | Ga0207683_10040045 | 3300026121 | Bacteria | 4087 |
| 460 | Ga0207683_10124367 | 3300026121 | Bacteria | 2317 |
| 461 | Ga0207683_10222480 | 3300026121 | Bacteria | 1720 |
| 462 | Ga0207698_10012367 | 3300026142 | Bacteria | 5581 |
| 463 | Ga0207698_10034409 | 3300026142 | Bacteria | 3693 |
| 464 | Ga0207698_10071611 | 3300026142 | Bacteria | 2751 |
| 465 | Ga0207698_10288218 | 3300026142 | Bacteria | 1522 |
| 466 | Ga0207698_10326389 | 3300026142 | Bacteria | 1440 |
| 467 | Ga0209389_1000080 | 3300027296 | Bacteria | 89649 |
| 468 | Ga0209389_1000115 | 3300027296 | Bacteria | 71798 |
| 469 | Ga0209589_1000014 | 3300027357 | Bacteria | 227996 |
| 470 | Ga0209589_1000033 | 3300027357 | Bacteria | 140561 |
| 471 | Ga0209489_100014 | 3300027361 | Bacteria | 227996 |
| 472 | Ga0209489_100027 | 3300027361 | Bacteria | 188074 |
| 473 | Ga0209489_100040 | 3300027361 | Bacteria | 164986 |
| 474 | Ga0209700_100022 | 3300027363 | Bacteria | 229977 |
| 475 | Ga0209700_100024 | 3300027363 | Bacteria | 227996 |
| 476 | Ga0209179_1013166 | 3300027512 | Bacteria | 1498 |
| 477 | Ga0209588_1009865 | 3300027671 | Bacteria | 2862 |
| 478 | Ga0209813_10000555 | 3300027866 | Bacteria | 8806 |
| 479 | Ga0268266_10011262 | 3300028379 | Bacteria | 7784 |
| 480 | Ga0268266_10162564 | 3300028379 | Bacteria | 2021 |
| 481 | Ga0268266_10173266 | 3300028379 | Bacteria | 1959 |
| 482 | Ga0268266_10207318 | 3300028379 | Bacteria | 1796 |
| 483 | Ga0268266_10222593 | 3300028379 | Bacteria | 1735 |
| 484 | Ga0268266_10290155 | 3300028379 | Bacteria | 1523 |
| 485 | Ga0268265_10063828 | 3300028380 | Bacteria | 2835 |
| 486 | Ga0268265_10110095 | 3300028380 | Bacteria | 2246 |
| 487 | Ga0268265_10319263 | 3300028380 | Bacteria | 1406 |
| 488 | Ga0268265_10460809 | 3300028380 | Bacteria | 1189 |
| 489 | Ga0268264_10000048 | 3300028381 | Bacteria | 334457 |
| 490 | Ga0268264_10140130 | 3300028381 | Bacteria | 2155 |
| 491 | Ga0265318_10021190 | 3300028577 | Bacteria | 2613 |
| 492 | Ga0307517_10000634 | 3300028786 | Bacteria | 60194 |
| 493 | Ga0307517_10039620 | 3300028786 | Bacteria | 5167 |
| 494 | Ga0307515_10000130 | 3300028794 | Bacteria | 179263 |
| 495 | Ga0307515_10000375 | 3300028794 | Bacteria | 109285 |
| 496 | Ga0307515_10006012 | 3300028794 | Bacteria | 24419 |
| 497 | Ga0307515_10011208 | 3300028794 | Bacteria | 17036 |
| 498 | Ga0265332_10072944 | 3300031238 | Bacteria | 1461 |
| 499 | Ga0265329_10010852 | 3300031242 | Bacteria | 3331 |
| 500 | Ga0265340_10000942 | 3300031247 | Bacteria | 16552 |
| 501 | Ga0265340_10062324 | 3300031247 | Bacteria | 1781 |
| 502 | Ga0265339_10003224 | 3300031249 | Bacteria | 11450 |
| 503 | Ga0265339_10004321 | 3300031249 | Bacteria | 9716 |
| 504 | Ga0265339_10139606 | 3300031249 | Bacteria | 1234 |
| 505 | Ga0265331_10005402 | 3300031250 | Bacteria | 7726 |
| 506 | Ga0265331_10008950 | 3300031250 | Bacteria | 5658 |
| 507 | Ga0307513_10000335 | 3300031456 | Bacteria | 67961 |
| 508 | Ga0307513_10020103 | 3300031456 | Bacteria | 7925 |
| 509 | Ga0307509_10005537 | 3300031507 | Bacteria | 17522 |
| 510 | Ga0307508_10000032 | 3300031616 | Bacteria | 163293 |
| 511 | Ga0316575_10027004 | 3300031665 | Bacteria | 2233 |
| 512 | Ga0265314_10004266 | 3300031711 | Bacteria | 13380 |
| 513 | Ga0265314_10070042 | 3300031711 | Bacteria | 2351 |
| 514 | Ga0265314_10206222 | 3300031711 | Bacteria | 1158 |
| 515 | Ga0265342_10000245 | 3300031712 | Bacteria | 60848 |
| 516 | Ga0265342_10042218 | 3300031712 | Bacteria | 2756 |
| 517 | Ga0307516_10005934 | 3300031730 | Bacteria | 14450 |
| 518 | Ga0307516_10010247 | 3300031730 | Bacteria | 10328 |
| 519 | Ga0307516_10039539 | 3300031730 | Bacteria | 4700 |
| 520 | Ga0307516_10107771 | 3300031730 | Bacteria | 2594 |
| 521 | Ga0307516_10290617 | 3300031730 | Bacteria | 1313 |
| 522 | Ga0307405_10124851 | 3300031731 | Bacteria | 1768 |
| 523 | Ga0307407_10110918 | 3300031903 | Bacteria | 1722 |
| 524 | Ga0307412_10148803 | 3300031911 | Bacteria | 1725 |
| 525 | Ga0307409_100018896 | 3300031995 | Bacteria | 4650 |
| 526 | Ga0307414_10015462 | 3300032004 | Bacteria | 4607 |
| 527 | Ga0307415_100080075 | 3300032126 | Bacteria | 2329 |
| 528 | Ga0307415_100154121 | 3300032126 | Bacteria | 1772 |
| 529 | Ga0316583_10000299 | 3300032133 | Bacteria | 13887 |
| 530 | Ga0307507_10011278 | 3300033179 | Bacteria | 11327 |
| 531 | Ga0307510_10016157 | 3300033180 | Bacteria | 8816 |
| 532 | Ga0307510_10033062 | 3300033180 | Bacteria | 5817 |
| 533 | Ga0307510_10079195 | 3300033180 | Bacteria | 3206 |
| 534 | Ga0307510_10192031 | 3300033180 | Bacteria | 1589 |
| 535 | Ga0315911_1000002 | 3300033442 | Bacteria | 926833 |
| 536 | Ga0373950_0007558 | 3300034818 | Bacteria | 1690 |
| 537 | Ga0373923_0018497 | 3300035111 | Bacteria | 2683 |
| 538 | Ga0373923_0023017 | 3300035111 | Bacteria | 2447 |
| 539 | Ga0373945_0007554 | 3300035116 | Bacteria | 3526 |
| 540 | Ga0373954_0000645 | 3300035118 | Bacteria | 13339 |
| 541 | Ga0373954_0089346 | 3300035118 | Bacteria | 1478 |
| 542 | Ga0373956_0005180 | 3300035119 | Bacteria | 5219 |
| 543 | Ga0373957_0001340 | 3300035120 | Bacteria | 6621 |
| 544 | Ga0373957_0074282 | 3300035120 | Bacteria | 1334 |
| 545 | Ga0373943_0044140 | 3300035170 | Bacteria | 2169 |
| 546 | Ga0373943_0046304 | 3300035170 | Bacteria | 2122 |
| 547 | Ga0373946_0017066 | 3300035171 | Bacteria | 2773 |
| 548 | Ga0373946_0024016 | 3300035171 | Bacteria | 2386 |
| 549 | Ga0373946_0137953 | 3300035171 | Bacteria | 1128 |
| 550 | Ga0373955_0114878 | 3300035172 | Bacteria | 1559 |
| 551 | Ga0373924_0073578 | 3300035410 | Bacteria | 1444 |
| 552 | Ga0373924_0076719 | 3300035410 | Bacteria | 1416 |
| 553 | Ga0373931_0002187 | 3300035691 | Bacteria | 8629 |
| 554 | Ga0373935_0012923 | 3300035692 | Bacteria | 5031 |
| 555 | Ga0373935_0054823 | 3300035692 | Bacteria | 2540 |
| 556 | Ga0373935_0063455 | 3300035692 | Bacteria | 2368 |
| 557 | Ga0373927_0000177 | 3300035695 | Bacteria | 50406 |
| 558 | Ga0373927_0013220 | 3300035695 | Bacteria | 5489 |
| 559 | Ga0373927_0017091 | 3300035695 | Bacteria | 4780 |
| 560 | Ga0373933_0000182 | 3300035724 | Bacteria | 41434 |
| 561 | Ga0373933_0003690 | 3300035724 | Bacteria | 8470 |
| 562 | Ga0373933_0112009 | 3300035724 | Bacteria | 1703 |
| 563 | Ga0373947_0025283 | 3300035725 | Bacteria | 3462 |
| 564 | Ga0373947_0028707 | 3300035725 | Bacteria | 3263 |
| 565 | Ga0373947_0057990 | 3300035725 | Bacteria | 2345 |
| 566 | Ga0373947_0071426 | 3300035725 | Bacteria | 2129 |
| 567 | Ga0373947_0103986 | 3300035725 | Bacteria | 1787 |
| 568 | Ga0373937_0013771 | 3300036401 | Bacteria | 7126 |
| 569 | Ga0373937_0028281 | 3300036401 | Bacteria | 5072 |
| 570 | Ga0373937_0033145 | 3300036401 | Bacteria | 4689 |
| 571 | Ga0373925_0000912 | 3300037068 | Bacteria | 26965 |
| 572 | Ga0373925_0021953 | 3300037068 | Bacteria | 4653 |
| 573 | Ga0373925_0108321 | 3300037068 | Bacteria | 2144 |
| 574 | Ga0395899_0038352 | 3300037312 | Bacteria | 3589 |
| 575 | Ga0395899_0083732 | 3300037312 | Bacteria | 2319 |
| 576 | Ga0395900_0001029 | 3300037418 | Bacteria | 35765 |
| 577 | Ga0395900_0004780 | 3300037418 | Bacteria | 14275 |
| 578 | Ga0395900_0017080 | 3300037418 | Bacteria | 7408 |
| 579 | Ga0395898_0002778 | 3300037466 | Bacteria | 20117 |
| 580 | Ga0395898_0022553 | 3300037466 | Bacteria | 6376 |
| 581 | Ga0395898_0169433 | 3300037466 | Bacteria | 2087 |
| 582 | Ga0395898_0179146 | 3300037466 | Bacteria | 2025 |
| 583 | Ga0395898_0211039 | 3300037466 | Bacteria | 1852 |
| 584 | Ga0395905_0002254 | 3300037471 | Bacteria | 21651 |
| 585 | Ga0395905_0006562 | 3300037471 | Bacteria | 11688 |
| 586 | Ga0395905_0136044 | 3300037471 | Bacteria | 2311 |
| 587 | Ga0395905_0198854 | 3300037471 | Bacteria | 1879 |
| 588 | Ga0395905_0229979 | 3300037471 | Bacteria | 1734 |
| 589 | Ga0436364_0341704 | 3300037853 | Bacteria | 12661 |
| 590 | Ga0395901_0014425 | 3300038443 | Bacteria | 8041 |
| 591 | Ga0395901_0031413 | 3300038443 | Bacteria | 5477 |
| 592 | Ga0395901_0044477 | 3300038443 | Bacteria | 4606 |
| 593 | Ga0395901_0052460 | 3300038443 | Bacteria | 4239 |
| 594 | Ga0395901_0158660 | 3300038443 | Bacteria | 2376 |
| 595 | Ga0395901_0386583 | 3300038443 | Bacteria | 1439 |
| 596 | Ga0395901_0548932 | 3300038443 | Bacteria | 1171 |
| 597 | Ga0400483_059947 | 3300039062 | Bacteria | 2407 |
| 598 | Ga0400483_121196 | 3300039062 | Bacteria | 2271 |
| 599 | Ga0400483_179252 | 3300039062 | Bacteria | 3054 |
| 600 | Ga0400483_189090 | 3300039062 | Bacteria | 1650 |
| 601 | Ga0400483_225275 | 3300039062 | Bacteria | 2254 |
| 602 | Ga0400483_291972 | 3300039062 | Bacteria | 2334 |
| 603 | Ga0436365_0229539 | 3300039437 | Bacteria | 3406 |
| 604 | Ga0436365_0459631 | 3300039437 | Bacteria | 25364 |
| 605 | Ga0436365_0745092 | 3300039437 | Bacteria | 1475 |
| 606 | Ga0436365_0982014 | 3300039437 | Bacteria | 2305 |
| 607 | Ga0436365_1142591 | 3300039437 | Bacteria | 1157 |
| 608 | Ga0436365_1590122 | 3300039437 | Bacteria | 23962 |
| 609 | Ga0436360_0768015 | 3300039438 | Bacteria | 1096 |
| 610 | Ga0436360_1204026 | 3300039438 | Bacteria | 1212 |
| 611 | Ga0436361_0665242 | 3300039447 | Bacteria | 3058 |
| 612 | Ga0436363_0725193 | 3300039450 | Bacteria | 1644 |
| 613 | Ga0436363_1172772 | 3300039450 | Bacteria | 18869 |
| 614 | Ga0436362_0413279 | 3300039453 | Bacteria | 4306 |
| 615 | Ga0436362_1155470 | 3300039453 | Bacteria | 10535 |
| 616 | Ga0451807_1061003 | 3300041486 | Bacteria | 1313 |
| 617 | Ga0451833_0369965 | 3300041491 | Bacteria | 43703 |
| 618 | Ga0451837_0964406 | 3300041494 | Bacteria | 15188 |
| 619 | Ga0451839_0063950 | 3300041496 | Bacteria | 43670 |
| 620 | Ga0451845_0249129 | 3300041501 | Bacteria | 20670 |
| 621 | Ga0451847_0341155 | 3300041503 | Bacteria | 20211 |
| 622 | Ga0451851_1180298 | 3300041507 | Bacteria | 43516 |
| 623 | Ga0451855_0392051 | 3300041511 | Bacteria | 3102 |
| 624 | Ga0451853_2474193 | 3300041512 | Bacteria | 23134 |
| 625 | Ga0439458_0013895 | 3300042157 | Bacteria | 1815 |
| 626 | Ga0466972_0000172 | 3300044658 | Bacteria | 50564 |
| 627 | Ga0466965_0005988 | 3300044683 | Bacteria | 5494 |
| 628 | Ga0466966_0000128 | 3300044684 | Bacteria | 48511 |
| 629 | Ga0466966_0074228 | 3300044684 | Bacteria | 2126 |
| 630 | Ga0466966_0103222 | 3300044684 | Bacteria | 1762 |
| 631 | Ga0466961_0000236 | 3300044693 | Bacteria | 37237 |
| 632 | Ga0466963_0000255 | 3300044694 | Bacteria | 23380 |
| 633 | Ga0466963_0200354 | 3300044694 | Bacteria | 1396 |
| 634 | Ga0466968_0010295 | 3300044735 | Bacteria | 3623 |
| 635 | Ga0466970_0000134 | 3300044765 | Bacteria | 33918 |
| 636 | Ga0466970_0088464 | 3300044765 | Bacteria | 1680 |
| 637 | Ga0466967_0091577 | 3300045976 | Bacteria | 2764 |
| 638 | Ga0466967_0099398 | 3300045976 | Bacteria | 2657 |
| 639 | Ga0466967_0132211 | 3300045976 | Bacteria | 2318 |
| 640 | Ga0466967_0211131 | 3300045976 | Bacteria | 1841 |
| 641 | Ga0495592_0039287 | 3300046454 | Bacteria | 3556 |
| 642 | Ga0495592_0072650 | 3300046454 | Bacteria | 2502 |
| 643 | Ga0495603_0000217 | 3300046455 | Bacteria | 29788 |
| 644 | Ga0495603_0039310 | 3300046455 | Bacteria | 2835 |
| 645 | Ga0495603_0050966 | 3300046455 | Bacteria | 2460 |
| 646 | Ga0495590_0050349 | 3300046457 | Bacteria | 1454 |
| 647 | Ga0495629_0000373 | 3300046459 | Bacteria | 37733 |
| 648 | Ga0495629_0000862 | 3300046459 | Bacteria | 24478 |
| 649 | Ga0495629_0021438 | 3300046459 | Bacteria | 4611 |
| 650 | Ga0495629_0179830 | 3300046459 | Bacteria | 1466 |
| 651 | Ga0495638_0004887 | 3300046460 | Bacteria | 10075 |
| 652 | Ga0495638_0005277 | 3300046460 | Bacteria | 9656 |
| 653 | Ga0495638_0007591 | 3300046460 | Bacteria | 7759 |
| 654 | Ga0495638_0031312 | 3300046460 | Bacteria | 3419 |
| 655 | Ga0495638_0035964 | 3300046460 | Bacteria | 3155 |
| 656 | Ga0495638_0036703 | 3300046460 | Bacteria | 3121 |
| 657 | Ga0495638_0041257 | 3300046460 | Bacteria | 2921 |
| 658 | Ga0495641_0019640 | 3300046461 | Bacteria | 3450 |
| 659 | Ga0495641_0048799 | 3300046461 | Bacteria | 1940 |
| 660 | Ga0495651_0007091 | 3300046462 | Bacteria | 8568 |
| 661 | Ga0495651_0019146 | 3300046462 | Bacteria | 5304 |
| 662 | Ga0495653_0218377 | 3300046463 | Bacteria | 1283 |
| 663 | Ga0495653_0255541 | 3300046463 | Bacteria | 1161 |
| 664 | Ga0495653_0270068 | 3300046463 | Bacteria | 1120 |
| 665 | Ga0495580_0006588 | 3300046472 | Bacteria | 9437 |
| 666 | Ga0495580_0059540 | 3300046472 | Bacteria | 2684 |
| 667 | Ga0495582_0006572 | 3300046473 | Bacteria | 6452 |
| 668 | Ga0495582_0036743 | 3300046473 | Bacteria | 2694 |
| 669 | Ga0495605_0046230 | 3300046474 | Bacteria | 2141 |
| 670 | Ga0495639_0000544 | 3300046475 | Bacteria | 17562 |
| 671 | Ga0495639_0038283 | 3300046475 | Bacteria | 2153 |
| 672 | Ga0495639_0059296 | 3300046475 | Bacteria | 1752 |
| 673 | Ga0495662_0045498 | 3300046476 | Bacteria | 2119 |
| 674 | Ga0495662_0083343 | 3300046476 | Bacteria | 1556 |
| 675 | Ga0495662_0123647 | 3300046476 | Bacteria | 1271 |
| 676 | Ga0495664_0001505 | 3300046477 | Bacteria | 12344 |
| 677 | Ga0495664_0019029 | 3300046477 | Bacteria | 3944 |
| 678 | Ga0495664_0034156 | 3300046477 | Bacteria | 2991 |
| 679 | Ga0495664_0039921 | 3300046477 | Bacteria | 2774 |
| 680 | Ga0495664_0089999 | 3300046477 | Bacteria | 1845 |
| 681 | Ga0495664_0098203 | 3300046477 | Bacteria | 1763 |
| 682 | Ga0495584_0124283 | 3300046491 | Bacteria | 1307 |
| 683 | Ga0495585_0033769 | 3300046492 | Bacteria | 2894 |
| 684 | Ga0495606_0043636 | 3300046507 | Bacteria | 2988 |
| 685 | Ga0495608_0002876 | 3300046511 | Bacteria | 12326 |
| 686 | Ga0495608_0046266 | 3300046511 | Bacteria | 2896 |
| 687 | Ga0495608_0224764 | 3300046511 | Bacteria | 1177 |
| 688 | Ga0495610_0050549 | 3300046512 | Bacteria | 2029 |
| 689 | Ga0495618_0009642 | 3300046514 | Bacteria | 5830 |
| 690 | Ga0495618_0035976 | 3300046514 | Bacteria | 3107 |
| 691 | Ga0495618_0066415 | 3300046514 | Bacteria | 2293 |
| 692 | Ga0495628_0009755 | 3300046516 | Bacteria | 8185 |
| 693 | Ga0495630_0026624 | 3300046517 | Bacteria | 4283 |
| 694 | Ga0495630_0060767 | 3300046517 | Bacteria | 2837 |
| 695 | Ga0495631_0005680 | 3300046518 | Bacteria | 6509 |
| 696 | Ga0495632_0015036 | 3300046519 | Bacteria | 4354 |
| 697 | Ga0495648_0001373 | 3300046524 | Bacteria | 23995 |
| 698 | Ga0495648_0042914 | 3300046524 | Bacteria | 2841 |
| 699 | Ga0495648_0071291 | 3300046524 | Bacteria | 2015 |
| 700 | Ga0495663_0032864 | 3300046525 | Bacteria | 1547 |
| 701 | Ga0495666_0067701 | 3300046526 | Bacteria | 1701 |
| 702 | Ga0495652_0076709 | 3300046529 | Bacteria | 2772 |
| 703 | Ga0495652_0090139 | 3300046529 | Bacteria | 2509 |
| 704 | Ga0495652_0104274 | 3300046529 | Bacteria | 2294 |
| 705 | Ga0495652_0158158 | 3300046529 | Bacteria | 1762 |
| 706 | Ga0495654_0048470 | 3300046530 | Bacteria | 2084 |
| 707 | Ga0495665_0006186 | 3300046531 | Bacteria | 6465 |
| 708 | Ga0495665_0131920 | 3300046531 | Bacteria | 1308 |
| 709 | Ga0495640_0002595 | 3300046533 | Bacteria | 14526 |
| 710 | Ga0495586_0079707 | 3300046535 | Bacteria | 1798 |
| 711 | Ga0495587_0197223 | 3300046536 | Bacteria | 1139 |
| 712 | Ga0495597_0103842 | 3300046542 | Bacteria | 1196 |
| 713 | Ga0495622_0034428 | 3300046557 | Bacteria | 2362 |
| 714 | Ga0495622_0132899 | 3300046557 | Bacteria | 1132 |
| 715 | Ga0495667_0034851 | 3300046559 | Bacteria | 3366 |
| 716 | Ga0495668_0022434 | 3300046616 | Bacteria | 3608 |
| 717 | Ga0495634_0001583 | 3300046642 | Bacteria | 19998 |
| 718 | Ga0495634_0061661 | 3300046642 | Bacteria | 2492 |
| 719 | Ga0495625_0069908 | 3300046660 | Bacteria | 2466 |
| 720 | Ga0495625_0127525 | 3300046660 | Bacteria | 1726 |
| 721 | Ga0495625_0145977 | 3300046660 | Bacteria | 1593 |
| 722 | Ga0495625_0150911 | 3300046660 | Bacteria | 1562 |
| 723 | Ga0495625_0205758 | 3300046660 | Bacteria | 1296 |
| 724 | Ga0495635_0000436 | 3300046663 | Bacteria | 26341 |
| 725 | Ga0495635_0051959 | 3300046663 | Bacteria | 2823 |
| 726 | Ga0495635_0224503 | 3300046663 | Bacteria | 1270 |
| 727 | Ga0495635_0229304 | 3300046663 | Bacteria | 1255 |
| 728 | Ga0495635_0272705 | 3300046663 | Bacteria | 1137 |
| 729 | Ga0495661_0020469 | 3300046665 | Bacteria | 4318 |
| 730 | Ga0495588_0183087 | 3300046674 | Bacteria | 1107 |
| 731 | Ga0495657_0028186 | 3300046675 | Bacteria | 3953 |
| 732 | Ga0495657_0053230 | 3300046675 | Bacteria | 2709 |
| 733 | Ga0495657_0058184 | 3300046675 | Bacteria | 2567 |
| 734 | Ga0495657_0193184 | 3300046675 | Bacteria | 1243 |
| 735 | Ga0495599_0042775 | 3300046678 | Bacteria | 2843 |
| 736 | Ga0495599_0209926 | 3300046678 | Bacteria | 1194 |
| 737 | Ga0495623_0056660 | 3300046679 | Bacteria | 2467 |
| 738 | Ga0495623_0097772 | 3300046679 | Bacteria | 1793 |
| 739 | Ga0495623_0184015 | 3300046679 | Bacteria | 1211 |
| 740 | Ga0495646_0005491 | 3300046680 | Bacteria | 8015 |
| 741 | Ga0495647_0011285 | 3300046681 | Bacteria | 3060 |
| 742 | Ga0495658_0003203 | 3300046683 | Bacteria | 8153 |
| 743 | Ga0495669_0000650 | 3300046684 | Bacteria | 15146 |
| 744 | Ga0495613_0007707 | 3300046689 | Bacteria | 8008 |
| 745 | Ga0495613_0332423 | 3300046689 | Bacteria | 1047 |
| 746 | Ga0495624_0023168 | 3300046690 | Bacteria | 4096 |
| 747 | Ga0495624_0040628 | 3300046690 | Bacteria | 2978 |
| 748 | Ga0495624_0082181 | 3300046690 | Bacteria | 1994 |
| 749 | Ga0495649_0036062 | 3300046694 | Bacteria | 2718 |
| 750 | Ga0495581_0003127 | 3300047315 | Bacteria | 9472 |
| 751 | Ga0495581_0019323 | 3300047315 | Bacteria | 3954 |
| 752 | Ga0495604_0006866 | 3300047317 | Bacteria | 9024 |
| 753 | Ga0495604_0025855 | 3300047317 | Bacteria | 4675 |
| 754 | Ga0495604_0027516 | 3300047317 | Bacteria | 4521 |
| 755 | Ga0495604_0290784 | 3300047317 | Bacteria | 1100 |
| 756 | Ga0495674_0008459 | 3300047319 | Bacteria | 9804 |
| 757 | Ga0495674_0069954 | 3300047319 | Bacteria | 3034 |
| 758 | Ga0495674_0093019 | 3300047319 | Bacteria | 2573 |
| 759 | Ga0495674_0208714 | 3300047319 | Bacteria | 1618 |
| 760 | Ga0495672_0133076 | 3300047320 | Bacteria | 1306 |
| 761 | Ga0495672_0137431 | 3300047320 | Bacteria | 1280 |
| 762 | Ga0495676_0027208 | 3300047321 | Bacteria | 4908 |
| 763 | Ga0495676_0146496 | 3300047321 | Bacteria | 1686 |
| 764 | Ga0495680_0001711 | 3300047322 | Bacteria | 23324 |
| 765 | Ga0495680_0009863 | 3300047322 | Bacteria | 8560 |
| 766 | Ga0495687_024676 | 3300047443 | Bacteria | 2854 |
| 767 | Ga0495687_080788 | 3300047443 | Bacteria | 1274 |
| 768 | Ga0495675_0005291 | 3300047444 | Bacteria | 7859 |
| 769 | Ga0495675_0148817 | 3300047444 | Bacteria | 1447 |
| 770 | Ga0495675_0267562 | 3300047444 | Bacteria | 1022 |
| 771 | Ga0495673_0051615 | 3300047469 | Bacteria | 1800 |
| 772 | Ga0495673_0079470 | 3300047469 | Bacteria | 1361 |
| 773 | Ga0495681_0001771 | 3300047470 | Bacteria | 15902 |
| 774 | Ga0495686_0015184 | 3300047472 | Bacteria | 5273 |
| 775 | Ga0495686_0046169 | 3300047472 | Bacteria | 2755 |
| 776 | Ga0495686_0060792 | 3300047472 | Bacteria | 2348 |
| 777 | Ga0495686_0215198 | 3300047472 | Bacteria | 1096 |
| 778 | Ga0495593_0000439 | 3300047673 | Bacteria | 23237 |
| 779 | Ga0495593_0011115 | 3300047673 | Bacteria | 5179 |
| 780 | Ga0495602_0009113 | 3300048088 | Bacteria | 10332 |
| 781 | Ga0495602_0112361 | 3300048088 | Bacteria | 2211 |
| 782 | Ga0496100_0239829 | 3300048903 | Bacteria | 1337 |
| 783 | Ga0496100_0361047 | 3300048903 | Bacteria | 1099 |
| 784 | Ga0496101_0230194 | 3300048904 | Bacteria | 1440 |
| 785 | Ga0496101_0389923 | 3300048904 | Bacteria | 1096 |
| 786 | Ga0496102_0001771 | 3300048905 | Bacteria | 18745 |
| 787 | Ga0496102_0236815 | 3300048905 | Bacteria | 1721 |
| 788 | Ga0496103_0110315 | 3300048906 | Bacteria | 1747 |
| 789 | Ga0496104_0009950 | 3300048907 | Bacteria | 8486 |
| 790 | Ga0496104_0020613 | 3300048907 | Bacteria | 6045 |
| 791 | Ga0496104_0048391 | 3300048907 | Bacteria | 4009 |
| 792 | Ga0496104_0136187 | 3300048907 | Bacteria | 2360 |
| 793 | Ga0496104_0183454 | 3300048907 | Bacteria | 2003 |
| 794 | Ga0496105_0009060 | 3300048908 | Bacteria | 7765 |
| 795 | Ga0496105_0011039 | 3300048908 | Bacteria | 7120 |
| 796 | Ga0496105_0030405 | 3300048908 | Bacteria | 4425 |
| 797 | Ga0496105_0050186 | 3300048908 | Bacteria | 3446 |
| 798 | Ga0496105_0078455 | 3300048908 | Bacteria | 2726 |
| 799 | Ga0496105_0265527 | 3300048908 | Bacteria | 1387 |
| 800 | Ga0496106_0009997 | 3300048909 | Bacteria | 7007 |
| 801 | Ga0496106_0024362 | 3300048909 | Bacteria | 4499 |
| 802 | Ga0496106_0075303 | 3300048909 | Bacteria | 2585 |
| 803 | Ga0496106_0080447 | 3300048909 | Bacteria | 2502 |
| 804 | Ga0496106_0144906 | 3300048909 | Bacteria | 1870 |
| 805 | Ga0496107_0036192 | 3300048910 | Bacteria | 3540 |
| 806 | Ga0496107_0081293 | 3300048910 | Bacteria | 2363 |
| 807 | Ga0496107_0087790 | 3300048910 | Bacteria | 2270 |
| 808 | Ga0496107_0156403 | 3300048910 | Bacteria | 1688 |
| 809 | Ga0496107_0250797 | 3300048910 | Bacteria | 1317 |
| 810 | Ga0496107_0295121 | 3300048910 | Bacteria | 1206 |
| 811 | Ga0496107_0360167 | 3300048910 | Bacteria | 1082 |
| 812 | Ga0496108_0006149 | 3300048911 | Bacteria | 9711 |
| 813 | Ga0496108_0052308 | 3300048911 | Bacteria | 3422 |
| 814 | Ga0496108_0066703 | 3300048911 | Bacteria | 3035 |
| 815 | Ga0496108_0171015 | 3300048911 | Bacteria | 1880 |
| 816 | Ga0496108_0460371 | 3300048911 | Bacteria | 1111 |
| 817 | Ga0496109_0003373 | 3300048912 | Bacteria | 13363 |
| 818 | Ga0496109_0031880 | 3300048912 | Bacteria | 4734 |
| 819 | Ga0496109_0067050 | 3300048912 | Bacteria | 3287 |
| 820 | Ga0496109_0328347 | 3300048912 | Bacteria | 1444 |
| 821 | Ga0496110_0004493 | 3300048913 | Bacteria | 10817 |
| 822 | Ga0496110_0055465 | 3300048913 | Bacteria | 3487 |
| 823 | Ga0496110_0060878 | 3300048913 | Bacteria | 3331 |
| 824 | Ga0496110_0111575 | 3300048913 | Bacteria | 2458 |
| 825 | Ga0496110_0229981 | 3300048913 | Bacteria | 1686 |
| 826 | Ga0496110_0266126 | 3300048913 | Bacteria | 1560 |
| 827 | Ga0496110_0349744 | 3300048913 | Bacteria | 1346 |
| 828 | Ga0496111_0029145 | 3300048914 | Bacteria | 3919 |
| 829 | Ga0496111_0039869 | 3300048914 | Bacteria | 3370 |
| 830 | Ga0496111_0108886 | 3300048914 | Bacteria | 2040 |
| 831 | Ga0496111_0239188 | 3300048914 | Bacteria | 1348 |
| 832 | Ga0496111_0251845 | 3300048914 | Bacteria | 1311 |
| 833 | Ga0496112_0000017 | 3300048915 | Bacteria | 191284 |
| 834 | Ga0496112_0013582 | 3300048915 | Bacteria | 7524 |
| 835 | Ga0496112_0017643 | 3300048915 | Bacteria | 6713 |
| 836 | Ga0496112_0019263 | 3300048915 | Bacteria | 6437 |
| 837 | Ga0496112_0023520 | 3300048915 | Bacteria | 5888 |
| 838 | Ga0496112_0137365 | 3300048915 | Bacteria | 2414 |
| 839 | Ga0496112_0258947 | 3300048915 | Bacteria | 1689 |
| 840 | Ga0496113_0011007 | 3300048916 | Bacteria | 6011 |
| 841 | Ga0496113_0031143 | 3300048916 | Bacteria | 3868 |
| 842 | Ga0496113_0071067 | 3300048916 | Bacteria | 2647 |
| 843 | Ga0496113_0098584 | 3300048916 | Bacteria | 2262 |
| 844 | Ga0496113_0111346 | 3300048916 | Bacteria | 2131 |
| 845 | Ga0496113_0117920 | 3300048916 | Bacteria | 2073 |
| 846 | Ga0496114_0011547 | 3300048917 | Bacteria | 7058 |
| 847 | Ga0496114_0075593 | 3300048917 | Bacteria | 2837 |
| 848 | Ga0496114_0266637 | 3300048917 | Bacteria | 1509 |
| 849 | Ga0496115_0000535 | 3300048918 | Bacteria | 29580 |
| 850 | Ga0496115_0002841 | 3300048918 | Bacteria | 12459 |
| 851 | Ga0496115_0019252 | 3300048918 | Bacteria | 5251 |
| 852 | Ga0496115_0034965 | 3300048918 | Bacteria | 3973 |
| 853 | Ga0496115_0281783 | 3300048918 | Bacteria | 1364 |
| 854 | Ga0496115_0323774 | 3300048918 | Bacteria | 1260 |
| 855 | Ga0496116_0003125 | 3300048919 | Bacteria | 16633 |
| 856 | Ga0496116_0040044 | 3300048919 | Bacteria | 3231 |
| 857 | Ga0496117_0030138 | 3300048920 | Bacteria | 4169 |
| 858 | Ga0496117_0035196 | 3300048920 | Bacteria | 3762 |
| 859 | Ga0496117_0040628 | 3300048920 | Bacteria | 3418 |
| 860 | Ga0496117_0118917 | 3300048920 | Bacteria | 1628 |
| 861 | Ga0496117_0208330 | 3300048920 | Bacteria | 1098 |
| 862 | Ga0496118_0003407 | 3300048921 | Bacteria | 20095 |
| 863 | Ga0496118_0046295 | 3300048921 | Bacteria | 3386 |
| 864 | Ga0496118_0069280 | 3300048921 | Bacteria | 2556 |
| 865 | Ga0496118_0088763 | 3300048921 | Bacteria | 2137 |
| 866 | Ga0496119_0001101 | 3300048922 | Bacteria | 34050 |
| 867 | Ga0496119_0007752 | 3300048922 | Bacteria | 9586 |
| 868 | Ga0496119_0008841 | 3300048922 | Bacteria | 8759 |
| 869 | Ga0496119_0103668 | 3300048922 | Bacteria | 1593 |
| 870 | Ga0496119_0117286 | 3300048922 | Bacteria | 1468 |
| 871 | Ga0496119_0167292 | 3300048922 | Bacteria | 1164 |
| 872 | Ga0496119_0177755 | 3300048922 | Bacteria | 1119 |
| 873 | Ga0496120_0001458 | 3300048923 | Bacteria | 28286 |
| 874 | Ga0496120_0009210 | 3300048923 | Bacteria | 7032 |
| 875 | Ga0496120_0073827 | 3300048923 | Bacteria | 1865 |
| 876 | Ga0496120_0138924 | 3300048923 | Bacteria | 1235 |
| 877 | Ga0496121_0000230 | 3300048924 | Bacteria | 120616 |
| 878 | Ga0496121_0004694 | 3300048924 | Bacteria | 18101 |
| 879 | Ga0496121_0017764 | 3300048924 | Bacteria | 7233 |
| 880 | Ga0496121_0024355 | 3300048924 | Bacteria | 5791 |
| 881 | Ga0496121_0041666 | 3300048924 | Bacteria | 4010 |
| 882 | Ga0496121_0080840 | 3300048924 | Bacteria | 2574 |
| 883 | Ga0496121_0091769 | 3300048924 | Bacteria | 2370 |
| 884 | Ga0496121_0125237 | 3300048924 | Bacteria | 1933 |
| 885 | Ga0496121_0169240 | 3300048924 | Bacteria | 1589 |
| 886 | Ga0496121_0192443 | 3300048924 | Bacteria | 1461 |
| 887 | Ga0496122_0030277 | 3300048925 | Bacteria | 4540 |
| 888 | Ga0496122_0038492 | 3300048925 | Bacteria | 3831 |
| 889 | Ga0496122_0073006 | 3300048925 | Bacteria | 2436 |
| 890 | Ga0496122_0125370 | 3300048925 | Bacteria | 1645 |
| 891 | Ga0496123_0037892 | 3300048926 | Bacteria | 3398 |
| 892 | Ga0496123_0041691 | 3300048926 | Bacteria | 3177 |
| 893 | Ga0496124_0025798 | 3300048927 | Bacteria | 5313 |
| 894 | Ga0496124_0027163 | 3300048927 | Bacteria | 5143 |
| 895 | Ga0496124_0133515 | 3300048927 | Bacteria | 1968 |
| 896 | Ga0496125_0000040 | 3300048928 | Bacteria | 314478 |
| 897 | Ga0496125_0004755 | 3300048928 | Bacteria | 15477 |
| 898 | Ga0496125_0022192 | 3300048928 | Bacteria | 5899 |
| 899 | Ga0496125_0070258 | 3300048928 | Bacteria | 2742 |
| 900 | Ga0496125_0089522 | 3300048928 | Bacteria | 2314 |
| 901 | Ga0496125_0165961 | 3300048928 | Bacteria | 1492 |
| 902 | Ga0496125_0197085 | 3300048928 | Bacteria | 1323 |
| 903 | Ga0496125_0252256 | 3300048928 | Bacteria | 1112 |
| 904 | Ga0496126_0002483 | 3300048929 | Bacteria | 24817 |
| 905 | Ga0496126_0005712 | 3300048929 | Bacteria | 14100 |
| 906 | Ga0496126_0012513 | 3300048929 | Bacteria | 8686 |
| 907 | Ga0496126_0019903 | 3300048929 | Bacteria | 6598 |
| 908 | Ga0496126_0024496 | 3300048929 | Bacteria | 5826 |
| 909 | Ga0496126_0026298 | 3300048929 | Bacteria | 5582 |
| 910 | Ga0496126_0037757 | 3300048929 | Bacteria | 4503 |
| 911 | Ga0496126_0082588 | 3300048929 | Bacteria | 2838 |
| 912 | Ga0496126_0102216 | 3300048929 | Bacteria | 2506 |
| 913 | Ga0496126_0113178 | 3300048929 | Bacteria | 2362 |
| 914 | Ga0496126_0209858 | 3300048929 | Bacteria | 1640 |
| 915 | Ga0495682_0026404 | 3300049460 | Bacteria | 2156 |
| 916 | Ga0495682_0046817 | 3300049460 | Bacteria | 1578 |
| 917 | Ga0501031_0000007 | 3300049568 | Bacteria | 166008 |
| 918 | Ga0501031_0008668 | 3300049568 | Bacteria | 6613 |
| 919 | Ga0501031_0029381 | 3300049568 | Bacteria | 3585 |
| 920 | Ga0501031_0153083 | 3300049568 | Bacteria | 1507 |
| 921 | Ga0501032_0000007 | 3300049569 | Bacteria | 253881 |
| 922 | Ga0501032_0000107 | 3300049569 | Bacteria | 71122 |
| 923 | Ga0501032_0003811 | 3300049569 | Bacteria | 11447 |
| 924 | Ga0501032_0256784 | 3300049569 | Bacteria | 1134 |
| 925 | Ga0501033_0000040 | 3300049570 | Bacteria | 142586 |
| 926 | Ga0501033_0000144 | 3300049570 | Bacteria | 68553 |
| 927 | Ga0501033_0000311 | 3300049570 | Bacteria | 46039 |
| 928 | Ga0501033_0000377 | 3300049570 | Bacteria | 42799 |
| 929 | Ga0501033_0009009 | 3300049570 | Bacteria | 7699 |
| 930 | Ga0501033_0024192 | 3300049570 | Bacteria | 4582 |
| 931 | Ga0501033_0123389 | 3300049570 | Bacteria | 1878 |
| 932 | Ga0501033_0240288 | 3300049570 | Bacteria | 1285 |
| 933 | Ga0501033_0258130 | 3300049570 | Bacteria | 1234 |
| 934 | Ga0501034_0000029 | 3300049571 | Bacteria | 253881 |
| 935 | Ga0501034_0000039 | 3300049571 | Bacteria | 237357 |
| 936 | Ga0501034_0000340 | 3300049571 | Bacteria | 81287 |
| 937 | Ga0501034_0000412 | 3300049571 | Bacteria | 71925 |
| 938 | Ga0501034_0042626 | 3300049571 | Bacteria | 4594 |
| 939 | Ga0501034_0056930 | 3300049571 | Bacteria | 3932 |
| 940 | Ga0501034_0062003 | 3300049571 | Bacteria | 3754 |
| 941 | Ga0501034_0083900 | 3300049571 | Bacteria | 3188 |
| 942 | Ga0501034_0159669 | 3300049571 | Bacteria | 2226 |
| 943 | Ga0501034_0224874 | 3300049571 | Bacteria | 1828 |
| 944 | Ga0501034_0260170 | 3300049571 | Bacteria | 1678 |
| 945 | Ga0501036_0000004 | 3300049572 | Bacteria | 253881 |
| 946 | Ga0501036_0000007 | 3300049572 | Bacteria | 240500 |
| 947 | Ga0501036_0000127 | 3300049572 | Bacteria | 48559 |
| 948 | Ga0501036_0017468 | 3300049572 | Bacteria | 5998 |
| 949 | Ga0501037_0000004 | 3300049573 | Bacteria | 253989 |
| 950 | Ga0501037_0000025 | 3300049573 | Bacteria | 143276 |
| 951 | Ga0501037_0000066 | 3300049573 | Bacteria | 96723 |
| 952 | Ga0501037_0000198 | 3300049573 | Bacteria | 54028 |
| 953 | Ga0501037_0178247 | 3300049573 | Bacteria | 1509 |
| 954 | Ga0501038_0000005 | 3300049574 | Bacteria | 253881 |
| 955 | Ga0501038_0000026 | 3300049574 | Bacteria | 146493 |
| 956 | Ga0501038_0000342 | 3300049574 | Bacteria | 40148 |
| 957 | Ga0501038_0048255 | 3300049574 | Bacteria | 3685 |
| 958 | Ga0501039_0000005 | 3300049575 | Bacteria | 295471 |
| 959 | Ga0501039_0000009 | 3300049575 | Bacteria | 253881 |
| 960 | Ga0501039_0000840 | 3300049575 | Bacteria | 22181 |
| 961 | Ga0501039_0128660 | 3300049575 | Bacteria | 1987 |
| 962 | Ga0501039_0205172 | 3300049575 | Bacteria | 1550 |
| 963 | Ga0501040_0000754 | 3300049576 | Bacteria | 20093 |
| 964 | Ga0501043_0000036 | 3300049579 | Bacteria | 132959 |
| 965 | Ga0501043_0000100 | 3300049579 | Bacteria | 79167 |
| 966 | Ga0501043_0000120 | 3300049579 | Bacteria | 72670 |
| 967 | Ga0501043_0000836 | 3300049579 | Bacteria | 27366 |
| 968 | Ga0501043_0050992 | 3300049579 | Bacteria | 3253 |
| 969 | Ga0501043_0056514 | 3300049579 | Bacteria | 3083 |
| 970 | Ga0501043_0141832 | 3300049579 | Bacteria | 1881 |
| 971 | Ga0501046_0000359 | 3300049580 | Bacteria | 45929 |
| 972 | Ga0501046_0002399 | 3300049580 | Bacteria | 17586 |
| 973 | Ga0501046_0062699 | 3300049580 | Bacteria | 2904 |
| 974 | Ga0501046_0164346 | 3300049580 | Bacteria | 1668 |
| 975 | Ga0501047_0000209 | 3300049581 | Bacteria | 70658 |
| 976 | Ga0501047_0000379 | 3300049581 | Bacteria | 50147 |
| 977 | Ga0501047_0000895 | 3300049581 | Bacteria | 30440 |
| 978 | Ga0501047_0007647 | 3300049581 | Bacteria | 10175 |
| 979 | Ga0501047_0022062 | 3300049581 | Bacteria | 6116 |
| 980 | Ga0501047_0117808 | 3300049581 | Bacteria | 2537 |
| 981 | Ga0501047_0209162 | 3300049581 | Bacteria | 1810 |
| 982 | Ga0501048_0000352 | 3300049582 | Bacteria | 31854 |
| 983 | Ga0501048_0004356 | 3300049582 | Bacteria | 10775 |
| 984 | Ga0501067_0000025 | 3300049583 | Bacteria | 91481 |
| 985 | Ga0501067_0048682 | 3300049583 | Bacteria | 2350 |
| 986 | Ga0501067_0160307 | 3300049583 | Bacteria | 1253 |
| 987 | Ga0501068_0000801 | 3300049584 | Bacteria | 16289 |
| 988 | Ga0501068_0001230 | 3300049584 | Bacteria | 13601 |
| 989 | Ga0501068_0024081 | 3300049584 | Bacteria | 3573 |
| 990 | Ga0501069_0000020 | 3300049585 | Bacteria | 122595 |
| 991 | Ga0501069_0001694 | 3300049585 | Bacteria | 10972 |
| 992 | Ga0501069_0016353 | 3300049585 | Bacteria | 3984 |
| 993 | Ga0501070_0000174 | 3300049586 | Bacteria | 59663 |
| 994 | Ga0501070_0002185 | 3300049586 | Bacteria | 17207 |
| 995 | Ga0501070_0005683 | 3300049586 | Bacteria | 10634 |
| 996 | Ga0501070_0011186 | 3300049586 | Bacteria | 7576 |
| 997 | Ga0501070_0069472 | 3300049586 | Bacteria | 2916 |
| 998 | Ga0501070_0135263 | 3300049586 | Bacteria | 2035 |
| 999 | Ga0501070_0176217 | 3300049586 | Bacteria | 1760 |
| 1000 | Ga0501071_0017012 | 3300049587 | Bacteria | 5007 |
| 1001 | Ga0501072_0149146 | 3300049588 | Bacteria | 1865 |
| 1002 | Ga0501073_0000070 | 3300049589 | Bacteria | 63026 |
| 1003 | Ga0501073_0000091 | 3300049589 | Bacteria | 57029 |
| 1004 | Ga0501073_0015856 | 3300049589 | Bacteria | 5461 |
| 1005 | Ga0501073_0021242 | 3300049589 | Bacteria | 4679 |
| 1006 | Ga0501073_0035474 | 3300049589 | Bacteria | 3545 |
| 1007 | Ga0501074_0000015 | 3300049590 | Bacteria | 79939 |
| 1008 | Ga0501074_0000489 | 3300049590 | Bacteria | 24170 |
| 1009 | Ga0501074_0001218 | 3300049590 | Bacteria | 16946 |
| 1010 | Ga0501074_0120763 | 3300049590 | Bacteria | 1874 |
| 1011 | Ga0501075_0045965 | 3300049591 | Bacteria | 3279 |
| 1012 | Ga0501076_0118741 | 3300049592 | Bacteria | 2141 |
| 1013 | Ga0501079_0096719 | 3300049741 | Bacteria | 2289 |
| 1014 | Ga0501080_0000132 | 3300049742 | Bacteria | 52967 |
| 1015 | Ga0501080_0000321 | 3300049742 | Bacteria | 36637 |
| 1016 | Ga0501080_0026275 | 3300049742 | Bacteria | 5410 |
| 1017 | Ga0501080_0080954 | 3300049742 | Bacteria | 3018 |
| 1018 | Ga0501080_0118362 | 3300049742 | Bacteria | 2456 |
| 1019 | Ga0501080_0146807 | 3300049742 | Bacteria | 2180 |
| 1020 | Ga0501080_0252213 | 3300049742 | Bacteria | 1609 |
| 1021 | Ga0501081_0124769 | 3300049743 | Bacteria | 1836 |
| 1022 | Ga0501083_0000284 | 3300049744 | Bacteria | 32169 |
| 1023 | Ga0501083_0151276 | 3300049744 | Bacteria | 1519 |
| 1024 | Ga0501083_0193412 | 3300049744 | Bacteria | 1328 |
| 1025 | Ga0501035_0000014 | 3300049822 | Bacteria | 253874 |
| 1026 | Ga0501035_0000016 | 3300049822 | Bacteria | 243412 |
| 1027 | Ga0501035_0000070 | 3300049822 | Bacteria | 127442 |
| 1028 | Ga0501035_0000346 | 3300049822 | Bacteria | 53542 |
| 1029 | Ga0501035_0001251 | 3300049822 | Bacteria | 26410 |
| 1030 | Ga0501035_0001605 | 3300049822 | Bacteria | 22866 |
| 1031 | Ga0501035_0011180 | 3300049822 | Bacteria | 8313 |
| 1032 | Ga0501035_0025723 | 3300049822 | Bacteria | 5395 |
| 1033 | Ga0501035_0225697 | 3300049822 | Bacteria | 1598 |
| 1034 | Ga0501035_0361460 | 3300049822 | Bacteria | 1213 |
| 1035 | Ga0501044_0000012 | 3300049823 | Bacteria | 253881 |
| 1036 | Ga0501044_0000037 | 3300049823 | Bacteria | 161924 |
| 1037 | Ga0501044_0000274 | 3300049823 | Bacteria | 65668 |
| 1038 | Ga0501044_0000383 | 3300049823 | Bacteria | 54973 |
| 1039 | Ga0501044_0024200 | 3300049823 | Bacteria | 6451 |
| 1040 | Ga0501044_0057358 | 3300049823 | Bacteria | 3996 |
| 1041 | Ga0501044_0066220 | 3300049823 | Bacteria | 3684 |
| 1042 | Ga0501044_0090497 | 3300049823 | Bacteria | 3087 |
| 1043 | Ga0501044_0102592 | 3300049823 | Bacteria | 2876 |
| 1044 | Ga0501044_0158683 | 3300049823 | Bacteria | 2240 |
| 1045 | Ga0501044_0202591 | 3300049823 | Bacteria | 1942 |
| 1046 | Ga0501045_0020164 | 3300049824 | Bacteria | 4760 |
| 1047 | nmdc:mga03683_19105_c1 | 3300050489 | Bacteria | 2612 |
| 1048 | nmdc:mga03683_48412_c1 | 3300050489 | Bacteria | 1766 |
| 1049 | nmdc:mga03n38_121304_c1 | 3300050490 | Bacteria | 1285 |
| 1050 | nmdc:mga03n38_2341_c1 | 3300050490 | Bacteria | 5824 |
| 1051 | nmdc:mga03n38_84717_c1 | 3300050490 | Bacteria | 1497 |
| 1052 | nmdc:mga00v17_29763_c1 | 3300050491 | Bacteria | 3206 |
| 1053 | nmdc:mga00v17_60502_c1 | 3300050491 | Bacteria | 2326 |
| 1054 | nmdc:mga0yw44_247562_c1 | 3300050492 | Bacteria | 1186 |
| 1055 | nmdc:mga0yw44_72110_c1 | 3300050492 | Bacteria | 2146 |
| 1056 | nmdc:mga06z11_101586_c1 | 3300050494 | Bacteria | 1579 |
| 1057 | nmdc:mga06z11_119861_c1 | 3300050494 | Bacteria | 1467 |
| 1058 | nmdc:mga06z11_246042_c1 | 3300050494 | Bacteria | 1052 |
| 1059 | nmdc:mga06z11_4265_c1 | 3300050494 | Bacteria | 5612 |
| 1060 | nmdc:mga06z11_78986_c2 | 3300050494 | Bacteria | 1425 |
| 1061 | nmdc:mga04h51_1143_c1 | 3300050495 | Bacteria | 6129 |
| 1062 | nmdc:mga07m45_38017_c1 | 3300050496 | Bacteria | 2685 |
| 1063 | nmdc:mga07m45_745_c1 | 3300050496 | Bacteria | 13914 |
| 1064 | nmdc:mga05p37_196560_c1 | 3300050507 | Bacteria | 2445 |
| 1065 | nmdc:mga09592_18338_c1 | 3300050508 | Bacteria | 5739 |
| 1066 | nmdc:mga0qj67_76787_c1 | 3300050509 | Bacteria | 2672 |
| 1067 | nmdc:mga06r32_1860_c1 | 3300050510 | Bacteria | 18800 |
| 1068 | nmdc:mga0n895_44891_c1 | 3300050512 | Bacteria | 4310 |
| 1069 | nmdc:mga0rr50_459721_c1 | 3300050513 | Bacteria | 1079 |
| 1070 | nmdc:mga08x19_102727_c1 | 3300050514 | Bacteria | 1898 |
| 1071 | nmdc:mga0sz30_1713_c1 | 3300050516 | Bacteria | 7785 |
| 1072 | nmdc:mga0sz30_23321_c1 | 3300050516 | Bacteria | 2516 |
| 1073 | nmdc:mga0sz30_24928_c1 | 3300050516 | Bacteria | 2444 |
| 1074 | nmdc:mga0sz30_45346_c1 | 3300050516 | Bacteria | 1854 |
| 1075 | Ga0495601_0158215 | 3300053077 | Bacteria | 1480 |
| 1076 | Ga0495601_0256864 | 3300053077 | Bacteria | 1141 |
| 1077 | Ga0500635_0075124 | 3300053080 | Bacteria | 1205 |
| 1078 | Ga0495595_0006301 | 3300053084 | Bacteria | 4832 |
| 1079 | Ga0495595_0053818 | 3300053084 | Bacteria | 1870 |
| 1080 | Ga0500578_0168169 | 3300053086 | Bacteria | 1357 |
| 1081 | Ga0500643_000456 | 3300053087 | Bacteria | 30270 |
| 1082 | Ga0500646_0008495 | 3300053090 | Bacteria | 2626 |
| 1083 | Ga0500651_0069381 | 3300053093 | Bacteria | 2194 |
| 1084 | Ga0500566_0000370 | 3300053094 | Bacteria | 24642 |
| 1085 | Ga0500566_0006011 | 3300053094 | Bacteria | 7218 |
| 1086 | Ga0500566_0006917 | 3300053094 | Bacteria | 6718 |
| 1087 | Ga0500566_0040773 | 3300053094 | Bacteria | 2684 |
| 1088 | Ga0500640_013671 | 3300053095 | Bacteria | 3364 |
| 1089 | Ga0500641_0002674 | 3300053096 | Bacteria | 6295 |
| 1090 | Ga0500641_0027454 | 3300053096 | Bacteria | 2216 |
| 1091 | Ga0500650_0000365 | 3300053098 | Bacteria | 10988 |
| 1092 | Ga0500650_0036142 | 3300053098 | Bacteria | 2266 |
| 1093 | Ga0500554_004225 | 3300053102 | Bacteria | 3024 |
| 1094 | Ga0500555_003144 | 3300053103 | Bacteria | 4710 |
| 1095 | Ga0500556_0044111 | 3300053104 | Bacteria | 1586 |
| 1096 | Ga0500557_000003 | 3300053105 | Bacteria | 228429 |
| 1097 | Ga0500569_021582 | 3300053109 | Bacteria | 1704 |
| 1098 | Ga0500572_000024 | 3300053111 | Bacteria | 47391 |
| 1099 | Ga0500595_000537 | 3300053119 | Bacteria | 22809 |
| 1100 | Ga0500595_003301 | 3300053119 | Bacteria | 7598 |
| 1101 | Ga0500595_009837 | 3300053119 | Bacteria | 3838 |
| 1102 | Ga0500595_016895 | 3300053119 | Bacteria | 2708 |
| 1103 | Ga0500595_022156 | 3300053119 | Bacteria | 2255 |
| 1104 | Ga0500608_000807 | 3300053122 | Bacteria | 11372 |
| 1105 | Ga0500608_001300 | 3300053122 | Bacteria | 8888 |
| 1106 | Ga0500608_099345 | 3300053122 | Bacteria | 1350 |
| 1107 | Ga0500618_000334 | 3300053125 | Bacteria | 33962 |
| 1108 | Ga0500642_0000019 | 3300053130 | Bacteria | 159944 |
| 1109 | Ga0500642_0000252 | 3300053130 | Bacteria | 20158 |
| 1110 | Ga0500655_005108 | 3300053133 | Bacteria | 2364 |
| 1111 | Ga0500559_0001011 | 3300053136 | Bacteria | 17309 |
| 1112 | Ga0500559_0003877 | 3300053136 | Bacteria | 7232 |
| 1113 | Ga0500568_0001665 | 3300053139 | Bacteria | 13926 |
| 1114 | Ga0500577_0000833 | 3300053142 | Bacteria | 7986 |
| 1115 | Ga0500586_000414 | 3300053145 | Bacteria | 8543 |
| 1116 | Ga0500590_000050 | 3300053148 | Bacteria | 28213 |
| 1117 | Ga0500590_017662 | 3300053148 | Bacteria | 3688 |
| 1118 | Ga0500590_047558 | 3300053148 | Bacteria | 2189 |
| 1119 | Ga0500603_000391 | 3300053150 | Bacteria | 11472 |
| 1120 | Ga0500603_000801 | 3300053150 | Bacteria | 7516 |
| 1121 | Ga0500604_0001275 | 3300053151 | Bacteria | 7050 |
| 1122 | Ga0500604_0059581 | 3300053151 | Bacteria | 1196 |
| 1123 | Ga0500616_0000041 | 3300053153 | Bacteria | 359328 |
| 1124 | Ga0500616_0000210 | 3300053153 | Bacteria | 94120 |
| 1125 | Ga0500616_0046158 | 3300053153 | Bacteria | 2317 |
| 1126 | Ga0500620_000042 | 3300053155 | Bacteria | 23446 |
| 1127 | Ga0500622_0002498 | 3300053156 | Bacteria | 13232 |
| 1128 | Ga0500627_0029367 | 3300053158 | Bacteria | 2293 |
| 1129 | Ga0500627_0069753 | 3300053158 | Bacteria | 1556 |
| 1130 | Ga0500630_000112 | 3300053159 | Bacteria | 26672 |
| 1131 | Ga0500634_0033049 | 3300053161 | Bacteria | 2820 |
| 1132 | Ga0500638_047219 | 3300053162 | Bacteria | 2085 |
| 1133 | Ga0500638_068958 | 3300053162 | Bacteria | 1692 |
| 1134 | Ga0500639_000040 | 3300053163 | Bacteria | 63516 |
| 1135 | Ga0500636_0000365 | 3300053177 | Bacteria | 24884 |
| 1136 | Ga0500636_0012982 | 3300053177 | Bacteria | 4887 |
| 1137 | Ga0500636_0036809 | 3300053177 | Bacteria | 2895 |
| 1138 | Ga0500636_0064889 | 3300053177 | Bacteria | 2126 |
| 1139 | Ga0500637_0000042 | 3300053178 | Bacteria | 46215 |
| 1140 | Ga0500637_0002167 | 3300053178 | Bacteria | 8637 |
| 1141 | Ga0500570_082598 | 3300053724 | Bacteria | 1439 |
| 1142 | Ga0500625_009292 | 3300053729 | Bacteria | 4380 |
| 1143 | Ga0500645_039063 | 3300053730 | Bacteria | 1407 |
| 1144 | Ga0500596_000794 | 3300053735 | Bacteria | 6229 |
| 1145 | Ga0500599_007283 | 3300053736 | Bacteria | 1421 |
| 1146 | Ga0500601_000203 | 3300053737 | Bacteria | 12048 |
| 1147 | Ga0501084_0104186 | 3300054114 | Bacteria | 2383 |
| 1148 | Ga0500661_000056 | 3300055283 | Bacteria | 17736 |
| 1149 | Ga0500661_015268 | 3300055283 | Bacteria | 1378 |
| 1150 | Ga0501082_0040063 | 3300060353 | Bacteria | 4042 |
| 1151 | Ga0530510_0057533 | 3300061734 | Bacteria | 2809 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006944 | Ga0099823_1024506 | Ga0099823_10245065 | 265 |
| 2 | 3300025915 | Ga0207693_10188687 | Ga0207693_101886872 | 272 |
| 3 | iso_pu_bacteria | 8019629233 | 8019633319 | 289 |
| 4 | iso_pu_bacteria | 2876406927 | 2876407709 | 290 |
| 5 | 3300049571 | Ga0501034_0056930 | Ga0501034_0056930_23_922 | 299 |
| 6 | 3300053737 | Ga0500601_000203 | Ga0500601_000203_5969_6952 | 303 |
| 7 | 3300035725 | Ga0373947_0025283 | Ga0373947_0025283_10_933 | 306 |
| 8 | 3300037466 | Ga0395898_0211039 | Ga0395898_0211039_221_1204 | 306 |
| 9 | 3300045976 | Ga0466967_0211131 | Ga0466967_0211131_901_1824 | 306 |
| 10 | 3300046476 | Ga0495662_0083343 | Ga0495662_0083343_21_944 | 306 |
| 11 | 3300046678 | Ga0495599_0209926 | Ga0495599_0209926_19_942 | 306 |
| 12 | 3300047444 | Ga0495675_0267562 | Ga0495675_0267562_78_1001 | 306 |
| 13 | 3300048904 | Ga0496101_0389923 | Ga0496101_0389923_157_1080 | 306 |
| 14 | 3300048922 | Ga0496119_0177755 | Ga0496119_0177755_180_1103 | 306 |
| 15 | 3300046529 | Ga0495652_0158158 | Ga0495652_0158158_49_1032 | 307 |
| 16 | iso_pu_bacteria | 8016511872 | 8016520679 | 308 |
| 17 | 3300042157 | Ga0439458_0013895 | Ga0439458_0013895_799_1782 | 310 |
| 18 | 3300006177 | Ga0075362_10024903 | Ga0075362_100249031 | 311 |
| 19 | 3300047320 | Ga0495672_0137431 | Ga0495672_0137431_196_1179 | 311 |
| 20 | 3300050489 | nmdc:mga03683_19105_c1 | nmdc:mga03683_19105_c1_1462_2445 | 311 |
| 21 | iso_pu_bacteria | 2876761206 | 2876766224 | 311 |
| 22 | 3300007788 | Ga0099795_10047078 | Ga0099795_100470782 | 312 |
| 23 | 3300027512 | Ga0209179_1013166 | Ga0209179_10131661 | 312 |
| 24 | 3300036401 | Ga0373937_0028281 | Ga0373937_0028281_3820_4803 | 312 |
| 25 | 3300049586 | Ga0501070_0135263 | Ga0501070_0135263_37_975 | 312 |
| 26 | 3300050494 | nmdc:mga06z11_119861_c1 | nmdc:mga06z11_119861_c1_519_1457 | 312 |
| 27 | 3300031250 | Ga0265331_10008950 | Ga0265331_100089505 | 315 |
| 28 | 3300031711 | Ga0265314_10070042 | Ga0265314_100700422 | 315 |
| 29 | 3300031712 | Ga0265342_10042218 | Ga0265342_100422183 | 315 |
| 30 | 3300046455 | Ga0495603_0050966 | Ga0495603_0050966_449_1405 | 317 |
| 31 | 3300048929 | Ga0496126_0019903 | Ga0496126_0019903_1017_2000 | 317 |
| 32 | iso_pu_bacteria | 2885342637 | 2885350578 | 317 |
| 33 | 3300035695 | Ga0373927_0017091 | Ga0373927_0017091_2374_3339 | 320 |
| 34 | 3300048917 | Ga0496114_0266637 | Ga0496114_0266637_429_1394 | 320 |
| 35 | iso_pu_bacteria | 2503198000 | 2503198697 | 322 |
| 36 | iso_pu_bacteria | 2507262055 | 2507507680 | 322 |
| 37 | iso_pu_bacteria | 2508501009 | 2508541796 | 322 |
| 38 | iso_pu_bacteria | 2508501042 | 2508692656 | 322 |
| 39 | iso_pu_bacteria | 2508501122 | 2509111107 | 322 |
| 40 | iso_pu_bacteria | 2508501128 | 2509149317 | 322 |
| 41 | iso_pu_bacteria | 2510065059 | 2510315015 | 322 |
| 42 | iso_pu_bacteria | 2510917030 | 2511197977 | 322 |
| 43 | iso_pu_bacteria | 2511231028 | 2511400924 | 322 |
| 44 | iso_pu_bacteria | 2512875024 | 2512962102 | 322 |
| 45 | iso_pu_bacteria | 2513237090 | 2513607902 | 322 |
| 46 | iso_pu_bacteria | 2513237092 | 2513628413 | 322 |
| 47 | iso_pu_bacteria | 2513237094 | 2513642969 | 322 |
| 48 | iso_pu_bacteria | 2513237095 | 2513647497 | 322 |
| 49 | iso_pu_bacteria | 2513237096 | 2513654072 | 322 |
| 50 | iso_pu_bacteria | 2513237098 | 2513679253 | 322 |
| 51 | iso_pu_bacteria | 2513237101 | 2513698087 | 322 |
| 52 | iso_pu_bacteria | 2513237104 | 2513719465 | 322 |
| 53 | iso_pu_bacteria | 2513237137 | 2513856824 | 322 |
| 54 | iso_pu_bacteria | 2513237139 | 2513878505 | 322 |
| 55 | iso_pu_bacteria | 2513237141 | 2513891269 | 322 |
| 56 | iso_pu_bacteria | 2513237145 | 2513918412 | 322 |
| 57 | iso_pu_bacteria | 2513237161 | 2514009448 | 322 |
| 58 | iso_pu_bacteria | 2513237162 | 2514024326 | 322 |
| 59 | iso_pu_bacteria | 2513237164 | 2514037202 | 322 |
| 60 | iso_pu_bacteria | 2513237305 | 2514421707 | 322 |
| 61 | iso_pu_bacteria | 2515154112 | 2515626062 | 322 |
| 62 | iso_pu_bacteria | 2515154114 | 2515646152 | 322 |
| 63 | iso_pu_bacteria | 2515154116 | 2515654730 | 322 |
| 64 | iso_pu_bacteria | 2516653077 | 2517040513 | 322 |
| 65 | iso_pu_bacteria | 2517093001 | 2517104141 | 322 |
| 66 | iso_pu_bacteria | 2517287029 | 2517411265 | 322 |
| 67 | iso_pu_bacteria | 2517572143 | 2517891354 | 322 |
| 68 | iso_pu_bacteria | 2519899620 | 2520378830 | 322 |
| 69 | iso_pu_bacteria | 2524023205 | 2524436294 | 322 |
| 70 | iso_pu_bacteria | 2524023210 | 2524468463 | 322 |
| 71 | iso_pu_bacteria | 2524023228 | 2524538460 | 322 |
| 72 | iso_pu_bacteria | 2528768022 | 2528848998 | 322 |
| 73 | iso_pu_bacteria | 2558860100 | 2558861119 | 322 |
| 74 | iso_pu_bacteria | 2582581316 | 2585332647 | 322 |
| 75 | iso_pu_bacteria | 2582581866 | 2585394946 | 322 |
| 76 | iso_pu_bacteria | 2585427590 | 2585824976 | 322 |
| 77 | iso_pu_bacteria | 2585427633 | 2585993168 | 322 |
| 78 | iso_pu_bacteria | 2599185301 | 2599939489 | 322 |
| 79 | iso_pu_bacteria | 2599185352 | 2600193850 | 322 |
| 80 | iso_pu_bacteria | 2602042107 | 2603860915 | 322 |
| 81 | iso_pu_bacteria | 2615840698 | 2616552956 | 322 |
| 82 | iso_pu_bacteria | 2617270735 | 2617346782 | 322 |
| 83 | iso_pu_bacteria | 2617270741 | 2617372711 | 322 |
| 84 | iso_pu_bacteria | 2617270742 | 2617381272 | 322 |
| 85 | iso_pu_bacteria | 2643221547 | 2643757944 | 322 |
| 86 | iso_pu_bacteria | 2643221557 | 2643805291 | 322 |
| 87 | iso_pu_bacteria | 2643221599 | 2644005370 | 322 |
| 88 | iso_pu_bacteria | 2643221610 | 2644064135 | 322 |
| 89 | iso_pu_bacteria | 2643221618 | 2644105330 | 322 |
| 90 | iso_pu_bacteria | 2643221626 | 2644147297 | 322 |
| 91 | iso_pu_bacteria | 2643221636 | 2644200670 | 322 |
| 92 | iso_pu_bacteria | 2643221651 | 2644291297 | 322 |
| 93 | iso_pu_bacteria | 2643221655 | 2644309817 | 322 |
| 94 | iso_pu_bacteria | 2643221659 | 2644333332 | 322 |
| 95 | iso_pu_bacteria | 2643221668 | 2644375741 | 322 |
| 96 | iso_pu_bacteria | 2643221675 | 2644415967 | 322 |
| 97 | iso_pu_bacteria | 2643221680 | 2644449008 | 322 |
| 98 | iso_pu_bacteria | 2643221698 | 2644543475 | 322 |
| 99 | iso_pu_bacteria | 2643221712 | 2644614390 | 322 |
| 100 | iso_pu_bacteria | 2643221723 | 2644674214 | 322 |
| 101 | iso_pu_bacteria | 2643221726 | 2644686468 | 322 |
| 102 | iso_pu_bacteria | 2657244999 | 2657685568 | 322 |
| 103 | iso_pu_bacteria | 2667528174 | 2671114629 | 322 |
| 104 | iso_pu_bacteria | 2667528175 | 2671118866 | 322 |
| 105 | iso_pu_bacteria | 2687453392 | 2688595985 | 322 |
| 106 | iso_pu_bacteria | 2690316117 | 2692319262 | 322 |
| 107 | iso_pu_bacteria | 2693429783 | 2694632799 | 322 |
| 108 | iso_pu_bacteria | 2693429784 | 2694639472 | 322 |
| 109 | iso_pu_bacteria | 2718217927 | 2719389855 | 322 |
| 110 | iso_pu_bacteria | 2718218423 | 2721403494 | 322 |
| 111 | iso_pu_bacteria | 2721755556 | 2723030455 | 322 |
| 112 | iso_pu_bacteria | 2721755684 | 2723564817 | 322 |
| 113 | iso_pu_bacteria | 2721755686 | 2723578132 | 322 |
| 114 | iso_pu_bacteria | 2721755755 | 2723843701 | 322 |
| 115 | iso_pu_bacteria | 2721755809 | 2724035070 | 322 |
| 116 | iso_pu_bacteria | 2728368998 | 2728750066 | 322 |
| 117 | iso_pu_bacteria | 2728368998 | 2728754014 | 322 |
| 118 | iso_pu_bacteria | 2728369352 | 2730110988 | 322 |
| 119 | iso_pu_bacteria | 2738543024 | 2739305594 | 322 |
| 120 | iso_pu_bacteria | 2744054633 | 2745080751 | 322 |
| 121 | iso_pu_bacteria | 2744054633 | 2745082613 | 322 |
| 122 | iso_pu_bacteria | 2775507266 | 2778174592 | 322 |
| 123 | iso_pu_bacteria | 2791355123 | 2792747194 | 322 |
| 124 | iso_pu_bacteria | 2791355196 | 2793065225 | 322 |
| 125 | iso_pu_bacteria | 2791355197 | 2793066722 | 322 |
| 126 | iso_pu_bacteria | 2791355199 | 2793080654 | 322 |
| 127 | iso_pu_bacteria | 2791355261 | 2793331291 | 322 |
| 128 | iso_pu_bacteria | 2791355263 | 2793344447 | 322 |
| 129 | iso_pu_bacteria | 2791355266 | 2793360053 | 322 |
| 130 | iso_pu_bacteria | 2791355267 | 2793367392 | 322 |
| 131 | iso_pu_bacteria | 2802429268 | 2804755187 | 322 |
| 132 | iso_pu_bacteria | 2802429603 | 2805919071 | 322 |
| 133 | iso_pu_bacteria | 2802429634 | 2806055854 | 322 |
| 134 | iso_pu_bacteria | 2802429635 | 2806061302 | 322 |
| 135 | iso_pu_bacteria | 2802429636 | 2806065765 | 322 |
| 136 | iso_pu_bacteria | 2816332527 | 2818236534 | 322 |
| 137 | iso_pu_bacteria | 2824600985 | 2824605713 | 322 |
| 138 | iso_pu_bacteria | 2824609381 | 2824611724 | 322 |
| 139 | iso_pu_bacteria | 2824617872 | 2824620392 | 322 |
| 140 | iso_pu_bacteria | 2824626560 | 2824628560 | 322 |
| 141 | iso_pu_bacteria | 2824635225 | 2824639088 | 322 |
| 142 | iso_pu_bacteria | 2824644064 | 2824649553 | 322 |
| 143 | iso_pu_bacteria | 2824653114 | 2824658215 | 322 |
| 144 | iso_pu_bacteria | 2824661429 | 2824666470 | 322 |
| 145 | iso_pu_bacteria | 2824671348 | 2824674137 | 322 |
| 146 | iso_pu_bacteria | 2824679649 | 2824685665 | 322 |
| 147 | iso_pu_bacteria | 2824687955 | 2824691978 | 322 |
| 148 | iso_pu_bacteria | 2824696289 | 2824701126 | 322 |
| 149 | iso_pu_bacteria | 2824704595 | 2824710247 | 322 |
| 150 | iso_pu_bacteria | 2824714736 | 2824720680 | 322 |
| 151 | iso_pu_bacteria | 2824723954 | 2824730942 | 322 |
| 152 | iso_pu_bacteria | 2824732956 | 2824735842 | 322 |
| 153 | iso_pu_bacteria | 2824746037 | 2824750089 | 322 |
| 154 | iso_pu_bacteria | 2824753945 | 2824755965 | 322 |
| 155 | iso_pu_bacteria | 2824763712 | 2824767503 | 322 |
| 156 | iso_pu_bacteria | 2824773399 | 2824775142 | 322 |
| 157 | iso_pu_bacteria | 2838029111 | 2838032564 | 322 |
| 158 | iso_pu_bacteria | 2838042994 | 2838047581 | 322 |
| 159 | iso_pu_bacteria | 2838122688 | 2838128809 | 322 |
| 160 | iso_pu_bacteria | 2840878972 | 2840881695 | 322 |
| 161 | iso_pu_bacteria | 2841760612 | 2841766398 | 322 |
| 162 | iso_pu_bacteria | 2841941048 | 2841945039 | 322 |
| 163 | iso_pu_bacteria | 2841949485 | 2841953460 | 322 |
| 164 | iso_pu_bacteria | 2841957949 | 2841959708 | 322 |
| 165 | iso_pu_bacteria | 2841966195 | 2841972063 | 322 |
| 166 | iso_pu_bacteria | 2841974524 | 2841978189 | 322 |
| 167 | iso_pu_bacteria | 2841983080 | 2841986184 | 322 |
| 168 | iso_pu_bacteria | 2842038055 | 2842040907 | 322 |
| 169 | iso_pu_bacteria | 2842045827 | 2842046148 | 322 |
| 170 | iso_pu_bacteria | 2842341865 | 2842345732 | 322 |
| 171 | iso_pu_bacteria | 2842475841 | 2842479296 | 322 |
| 172 | iso_pu_bacteria | 2842482326 | 2842485625 | 322 |
| 173 | iso_pu_bacteria | 2842502639 | 2842506545 | 322 |
| 174 | iso_pu_bacteria | 2842509118 | 2842515068 | 322 |
| 175 | iso_pu_bacteria | 2844002411 | 2844008707 | 322 |
| 176 | iso_pu_bacteria | 2844009547 | 2844010811 | 322 |
| 177 | iso_pu_bacteria | 2844104063 | 2844106165 | 322 |
| 178 | iso_pu_bacteria | 2844163670 | 2844166537 | 322 |
| 179 | iso_pu_bacteria | 2844315083 | 2844320005 | 322 |
| 180 | iso_pu_bacteria | 2847417321 | 2847422229 | 322 |
| 181 | iso_pu_bacteria | 2847930680 | 2847938317 | 322 |
| 182 | iso_pu_bacteria | 2847939898 | 2847947723 | 322 |
| 183 | iso_pu_bacteria | 2848992105 | 2848998272 | 322 |
| 184 | iso_pu_bacteria | 2849076700 | 2849078416 | 322 |
| 185 | iso_pu_bacteria | 2851182111 | 2851186666 | 322 |
| 186 | iso_pu_bacteria | 2851246043 | 2851246521 | 322 |
| 187 | iso_pu_bacteria | 2856320880 | 2856322160 | 322 |
| 188 | iso_pu_bacteria | 2856328259 | 2856332531 | 322 |
| 189 | iso_pu_bacteria | 2856334872 | 2856338463 | 322 |
| 190 | iso_pu_bacteria | 2856349417 | 2856355114 | 322 |
| 191 | iso_pu_bacteria | 2856364286 | 2856365541 | 322 |
| 192 | iso_pu_bacteria | 2857367948 | 2857369761 | 322 |
| 193 | iso_pu_bacteria | 2857509624 | 2857511302 | 322 |
| 194 | iso_pu_bacteria | 2857516855 | 2857523887 | 322 |
| 195 | iso_pu_bacteria | 2857524615 | 2857524633 | 322 |
| 196 | iso_pu_bacteria | 2869169390 | 2869170494 | 322 |
| 197 | iso_pu_bacteria | 2869234852 | 2869239438 | 322 |
| 198 | iso_pu_bacteria | 2869242130 | 2869249464 | 322 |
| 199 | iso_pu_bacteria | 2869256925 | 2869262908 | 322 |
| 200 | iso_pu_bacteria | 2869271264 | 2869277225 | 322 |
| 201 | iso_pu_bacteria | 2869278585 | 2869279018 | 322 |
| 202 | iso_pu_bacteria | 2869278585 | 2869284744 | 322 |
| 203 | iso_pu_bacteria | 2869285874 | 2869287016 | 322 |
| 204 | iso_pu_bacteria | 2871429161 | 2871434322 | 322 |
| 205 | iso_pu_bacteria | 2871435913 | 2871437928 | 322 |
| 206 | iso_pu_bacteria | 2871451962 | 2871454338 | 322 |
| 207 | iso_pu_bacteria | 2871481445 | 2871486562 | 322 |
| 208 | iso_pu_bacteria | 2871488783 | 2871492547 | 322 |
| 209 | iso_pu_bacteria | 2874109183 | 2874111300 | 322 |
| 210 | iso_pu_bacteria | 2874116593 | 2874119132 | 322 |
| 211 | iso_pu_bacteria | 2874139085 | 2874142935 | 322 |
| 212 | iso_pu_bacteria | 2874146452 | 2874147457 | 322 |
| 213 | iso_pu_bacteria | 2874155637 | 2874156463 | 322 |
| 214 | iso_pu_bacteria | 2874162495 | 2874165913 | 322 |
| 215 | iso_pu_bacteria | 2874168670 | 2874172453 | 322 |
| 216 | iso_pu_bacteria | 2874590934 | 2874598790 | 322 |
| 217 | iso_pu_bacteria | 2874604998 | 2874607390 | 322 |
| 218 | iso_pu_bacteria | 2874612657 | 2874614590 | 322 |
| 219 | iso_pu_bacteria | 2874620515 | 2874628346 | 322 |
| 220 | iso_pu_bacteria | 2874628541 | 2874635023 | 322 |
| 221 | iso_pu_bacteria | 2874645413 | 2874652246 | 322 |
| 222 | iso_pu_bacteria | 2876369609 | 2876371235 | 322 |
| 223 | iso_pu_bacteria | 2876377896 | 2876381839 | 322 |
| 224 | iso_pu_bacteria | 2876386047 | 2876390242 | 322 |
| 225 | iso_pu_bacteria | 2876399893 | 2876400112 | 322 |
| 226 | iso_pu_bacteria | 2876413966 | 2876414651 | 322 |
| 227 | iso_pu_bacteria | 2876420981 | 2876427681 | 322 |
| 228 | iso_pu_bacteria | 2876761206 | 2876765276 | 322 |
| 229 | iso_pu_bacteria | 2876771140 | 2876778829 | 322 |
| 230 | iso_pu_bacteria | 2876808645 | 2876814619 | 322 |
| 231 | iso_pu_bacteria | 2876818435 | 2876824276 | 322 |
| 232 | iso_pu_bacteria | 2878730984 | 2878732153 | 322 |
| 233 | iso_pu_bacteria | 2878738818 | 2878740995 | 322 |
| 234 | iso_pu_bacteria | 2878738818 | 2878745848 | 322 |
| 235 | iso_pu_bacteria | 2878745973 | 2878747197 | 322 |
| 236 | iso_pu_bacteria | 2878753008 | 2878758429 | 322 |
| 237 | iso_pu_bacteria | 2878774303 | 2878774470 | 322 |
| 238 | iso_pu_bacteria | 2878781027 | 2878784650 | 322 |
| 239 | iso_pu_bacteria | 2879074833 | 2879082622 | 322 |
| 240 | iso_pu_bacteria | 2879083081 | 2879086097 | 322 |
| 241 | iso_pu_bacteria | 2879099564 | 2879107115 | 322 |
| 242 | iso_pu_bacteria | 2879110137 | 2879114700 | 322 |
| 243 | iso_pu_bacteria | 2879127579 | 2879131539 | 322 |
| 244 | iso_pu_bacteria | 2879142872 | 2879147985 | 322 |
| 245 | iso_pu_bacteria | 2881147464 | 2881154226 | 322 |
| 246 | iso_pu_bacteria | 2881155292 | 2881158008 | 322 |
| 247 | iso_pu_bacteria | 2881161766 | 2881163294 | 322 |
| 248 | iso_pu_bacteria | 2881364244 | 2881371477 | 322 |
| 249 | iso_pu_bacteria | 2881665667 | 2881666560 | 322 |
| 250 | iso_pu_bacteria | 2881845957 | 2881850983 | 322 |
| 251 | iso_pu_bacteria | 2881853255 | 2881856911 | 322 |
| 252 | iso_pu_bacteria | 2881861095 | 2881866803 | 322 |
| 253 | iso_pu_bacteria | 2882912400 | 2882912913 | 322 |
| 254 | iso_pu_bacteria | 2885318864 | 2885323745 | 322 |
| 255 | iso_pu_bacteria | 2885350715 | 2885351991 | 322 |
| 256 | iso_pu_bacteria | 2885366525 | 2885370233 | 322 |
| 257 | iso_pu_bacteria | 2885374607 | 2885374991 | 322 |
| 258 | iso_pu_bacteria | 2885383462 | 2885384044 | 322 |
| 259 | iso_pu_bacteria | 2885409591 | 2885410280 | 322 |
| 260 | iso_pu_bacteria | 2888337043 | 2888343400 | 322 |
| 261 | iso_pu_bacteria | 2888378607 | 2888385434 | 322 |
| 262 | iso_pu_bacteria | 2888388044 | 2888392799 | 322 |
| 263 | iso_pu_bacteria | 2888419890 | 2888425868 | 322 |
| 264 | iso_pu_bacteria | 2889033259 | 2889038033 | 322 |
| 265 | iso_pu_bacteria | 2893066018 | 2893069154 | 322 |
| 266 | iso_pu_bacteria | 2898795034 | 2898795429 | 322 |
| 267 | iso_pu_bacteria | 2903492973 | 2903496722 | 322 |
| 268 | iso_pu_bacteria | 2903513507 | 2903519249 | 322 |
| 269 | iso_pu_bacteria | 2903727486 | 2903730320 | 322 |
| 270 | iso_pu_bacteria | 2903748898 | 2903755315 | 322 |
| 271 | iso_pu_bacteria | 2903768456 | 2903769712 | 322 |
| 272 | iso_pu_bacteria | 2904666416 | 2904674035 | 322 |
| 273 | iso_pu_bacteria | 2904690495 | 2904691222 | 322 |
| 274 | iso_pu_bacteria | 2904699407 | 2904701308 | 322 |
| 275 | iso_pu_bacteria | 2904711408 | 2904711990 | 322 |
| 276 | iso_pu_bacteria | 2906308376 | 2906309369 | 322 |
| 277 | iso_pu_bacteria | 2906321335 | 2906327019 | 322 |
| 278 | iso_pu_bacteria | 2906386501 | 2906390459 | 322 |
| 279 | iso_pu_bacteria | 2906401398 | 2906405745 | 322 |
| 280 | iso_pu_bacteria | 2906408224 | 2906412546 | 322 |
| 281 | iso_pu_bacteria | 2906427513 | 2906433675 | 322 |
| 282 | iso_pu_bacteria | 2906602504 | 2906604745 | 322 |
| 283 | iso_pu_bacteria | 2906610324 | 2906616540 | 322 |
| 284 | iso_pu_bacteria | 2906626472 | 2906627327 | 322 |
| 285 | iso_pu_bacteria | 2906635258 | 2906635313 | 322 |
| 286 | iso_pu_bacteria | 2906643746 | 2906648862 | 322 |
| 287 | iso_pu_bacteria | 2906660503 | 2906666858 | 322 |
| 288 | iso_pu_bacteria | 2908739725 | 2908741708 | 322 |
| 289 | iso_pu_bacteria | 2908756301 | 2908759137 | 322 |
| 290 | iso_pu_bacteria | 2908775508 | 2908781154 | 322 |
| 291 | iso_pu_bacteria | 2913295892 | 2913299984 | 322 |
| 292 | iso_pu_bacteria | 2919073203 | 2919078515 | 322 |
| 293 | iso_pu_bacteria | 2919408235 | 2919413356 | 322 |
| 294 | iso_pu_bacteria | 2922151315 | 2922156921 | 322 |
| 295 | iso_pu_bacteria | 2922172374 | 2922175696 | 322 |
| 296 | iso_pu_bacteria | 2922178524 | 2922181182 | 322 |
| 297 | iso_pu_bacteria | 2922361189 | 2922366032 | 322 |
| 298 | iso_pu_bacteria | 2922368715 | 2922372424 | 322 |
| 299 | iso_pu_bacteria | 2922386360 | 2922387367 | 322 |
| 300 | iso_pu_bacteria | 2922393267 | 2922397088 | 322 |
| 301 | iso_pu_bacteria | 2922425934 | 2922431440 | 322 |
| 302 | iso_pu_bacteria | 2924710171 | 2924714927 | 322 |
| 303 | iso_pu_bacteria | 2924718760 | 2924723530 | 322 |
| 304 | iso_pu_bacteria | 2924733363 | 2924734817 | 322 |
| 305 | iso_pu_bacteria | 2924741084 | 2924742272 | 322 |
| 306 | iso_pu_bacteria | 2924748358 | 2924748904 | 322 |
| 307 | iso_pu_bacteria | 2924776078 | 2924778596 | 322 |
| 308 | iso_pu_bacteria | 2924776078 | 2924784247 | 322 |
| 309 | iso_pu_bacteria | 2924784321 | 2924784526 | 322 |
| 310 | iso_pu_bacteria | 2929615660 | 2929621006 | 322 |
| 311 | iso_pu_bacteria | 2929624759 | 2929626163 | 322 |
| 312 | iso_pu_bacteria | 2932784394 | 2932784958 | 322 |
| 313 | iso_pu_bacteria | 2932794094 | 2932795164 | 322 |
| 314 | iso_pu_bacteria | 2932801729 | 2932805692 | 322 |
| 315 | iso_pu_bacteria | 2932809354 | 2932809990 | 322 |
| 316 | iso_pu_bacteria | 2932818245 | 2932818267 | 322 |
| 317 | iso_pu_bacteria | 2932828146 | 2932828795 | 322 |
| 318 | iso_pu_bacteria | 2933577622 | 2933583124 | 322 |
| 319 | iso_pu_bacteria | 2935608549 | 2935609810 | 322 |
| 320 | iso_pu_bacteria | 2935616580 | 2935619785 | 322 |
| 321 | iso_pu_bacteria | 2935630451 | 2935634036 | 322 |
| 322 | iso_pu_bacteria | 2935638405 | 2935638766 | 322 |
| 323 | iso_pu_bacteria | 2935648319 | 2935652160 | 322 |
| 324 | iso_pu_bacteria | 2935656913 | 2935659867 | 322 |
| 325 | iso_pu_bacteria | 2935665750 | 2935666383 | 322 |
| 326 | iso_pu_bacteria | 2935675223 | 2935676571 | 322 |
| 327 | iso_pu_bacteria | 2935684952 | 2935684954 | 322 |
| 328 | iso_pu_bacteria | 2935694250 | 2935694651 | 322 |
| 329 | iso_pu_bacteria | 2935703347 | 2935703772 | 322 |
| 330 | iso_pu_bacteria | 2935713505 | 2935713507 | 322 |
| 331 | iso_pu_bacteria | 2935722832 | 2935724127 | 322 |
| 332 | iso_pu_bacteria | 2935732158 | 2935733515 | 322 |
| 333 | iso_pu_bacteria | 2935741537 | 2935742894 | 322 |
| 334 | iso_pu_bacteria | 2935750917 | 2935750919 | 322 |
| 335 | iso_pu_bacteria | 2935760218 | 2935760550 | 322 |
| 336 | iso_pu_bacteria | 2935769743 | 2935771960 | 322 |
| 337 | iso_pu_bacteria | 2935777560 | 2935784324 | 322 |
| 338 | iso_pu_bacteria | 2935785616 | 2935787652 | 322 |
| 339 | iso_pu_bacteria | 2935793552 | 2935796284 | 322 |
| 340 | iso_pu_bacteria | 2935801545 | 2935801909 | 322 |
| 341 | iso_pu_bacteria | 2935810662 | 2935810680 | 322 |
| 342 | iso_pu_bacteria | 2935819856 | 2935822971 | 322 |
| 343 | iso_pu_bacteria | 2935827899 | 2935828260 | 322 |
| 344 | iso_pu_bacteria | 2935837841 | 2935842464 | 322 |
| 345 | iso_pu_bacteria | 2935847175 | 2935848553 | 322 |
| 346 | iso_pu_bacteria | 2935855204 | 2935857900 | 322 |
| 347 | iso_pu_bacteria | 2935864058 | 2935868758 | 322 |
| 348 | iso_pu_bacteria | 2935873716 | 2935874173 | 322 |
| 349 | iso_pu_bacteria | 2935883170 | 2935883938 | 322 |
| 350 | iso_pu_bacteria | 2935908558 | 2935909639 | 322 |
| 351 | iso_pu_bacteria | 2935916978 | 2935917364 | 322 |
| 352 | iso_pu_bacteria | 2935926038 | 2935927120 | 322 |
| 353 | iso_pu_bacteria | 2935934488 | 2935937036 | 322 |
| 354 | iso_pu_bacteria | 2935942939 | 2935944661 | 322 |
| 355 | iso_pu_bacteria | 2935951376 | 2935953098 | 322 |
| 356 | iso_pu_bacteria | 2935959822 | 2935966599 | 322 |
| 357 | iso_pu_bacteria | 2935967501 | 2935969938 | 322 |
| 358 | iso_pu_bacteria | 2935975950 | 2935980229 | 322 |
| 359 | iso_pu_bacteria | 2935984226 | 2935987011 | 322 |
| 360 | iso_pu_bacteria | 2935992306 | 2935992902 | 322 |
| 361 | iso_pu_bacteria | 2936002035 | 2936002815 | 322 |
| 362 | iso_pu_bacteria | 2936011229 | 2936014283 | 322 |
| 363 | iso_pu_bacteria | 2936019824 | 2936023877 | 322 |
| 364 | iso_pu_bacteria | 2936028420 | 2936031520 | 322 |
| 365 | iso_pu_bacteria | 2936037263 | 2936037900 | 322 |
| 366 | iso_pu_bacteria | 2936046547 | 2936049389 | 322 |
| 367 | iso_pu_bacteria | 2936055302 | 2936062139 | 322 |
| 368 | iso_pu_bacteria | 2936381700 | 2936384463 | 322 |
| 369 | iso_pu_bacteria | 2937813078 | 2937813728 | 322 |
| 370 | iso_pu_bacteria | 2937843397 | 2937845035 | 322 |
| 371 | iso_pu_bacteria | 2937848649 | 2937848839 | 322 |
| 372 | iso_pu_bacteria | 2937861824 | 2937867764 | 322 |
| 373 | iso_pu_bacteria | 2937877337 | 2937878769 | 322 |
| 374 | iso_pu_bacteria | 2937972304 | 2937974450 | 322 |
| 375 | iso_pu_bacteria | 2937980651 | 2937983285 | 322 |
| 376 | iso_pu_bacteria | 2938014810 | 2938022336 | 322 |
| 377 | iso_pu_bacteria | 2940556831 | 2940558278 | 322 |
| 378 | iso_pu_bacteria | 2941499720 | 2941502592 | 322 |
| 379 | iso_pu_bacteria | 2941507105 | 2941510661 | 322 |
| 380 | iso_pu_bacteria | 2941515067 | 2941518045 | 322 |
| 381 | iso_pu_bacteria | 2941523033 | 2941527084 | 322 |
| 382 | iso_pu_bacteria | 2941531003 | 2941531190 | 322 |
| 383 | iso_pu_bacteria | 2941538514 | 2941542513 | 322 |
| 384 | iso_pu_bacteria | 2952252522 | 2952255351 | 322 |
| 385 | iso_pu_bacteria | 2958034702 | 2958041401 | 322 |
| 386 | iso_pu_bacteria | 2958041894 | 2958042375 | 322 |
| 387 | iso_pu_bacteria | 2958041894 | 2958048520 | 322 |
| 388 | iso_pu_bacteria | 2958041894 | 2958058275 | 322 |
| 389 | iso_pu_bacteria | 2958064165 | 2958065222 | 322 |
| 390 | iso_pu_bacteria | 2958084443 | 2958085920 | 322 |
| 391 | iso_pu_bacteria | 2958092219 | 2958097307 | 322 |
| 392 | iso_pu_bacteria | 2958108152 | 2958111820 | 322 |
| 393 | iso_pu_bacteria | 2958122699 | 2958124033 | 322 |
| 394 | iso_pu_bacteria | 2958130278 | 2958131415 | 322 |
| 395 | iso_pu_bacteria | 2958137437 | 2958139621 | 322 |
| 396 | iso_pu_bacteria | 2958144490 | 2958146972 | 322 |
| 397 | iso_pu_bacteria | 2958158011 | 2958158804 | 322 |
| 398 | iso_pu_bacteria | 2958179912 | 2958181240 | 322 |
| 399 | iso_pu_bacteria | 2961077736 | 2961079078 | 322 |
| 400 | iso_pu_bacteria | 2961127735 | 2961133613 | 322 |
| 401 | iso_pu_bacteria | 2961136820 | 2961137375 | 322 |
| 402 | iso_pu_bacteria | 2961170736 | 2961173378 | 322 |
| 403 | iso_pu_bacteria | 2961183825 | 2961184251 | 322 |
| 404 | iso_pu_bacteria | 2965025482 | 2965029979 | 322 |
| 405 | iso_pu_bacteria | 2965032056 | 2965037083 | 322 |
| 406 | iso_pu_bacteria | 2965047637 | 2965054627 | 322 |
| 407 | iso_pu_bacteria | 2965102966 | 2965103158 | 322 |
| 408 | iso_pu_bacteria | 2965110997 | 2965111365 | 322 |
| 409 | iso_pu_bacteria | 2967996073 | 2967998548 | 322 |
| 410 | iso_pu_bacteria | 2968003550 | 2968006026 | 322 |
| 411 | iso_pu_bacteria | 2968016561 | 2968022921 | 322 |
| 412 | iso_pu_bacteria | 2968117919 | 2968121655 | 322 |
| 413 | iso_pu_bacteria | 2968138860 | 2968142659 | 322 |
| 414 | iso_pu_bacteria | 2970469710 | 2970475506 | 322 |
| 415 | iso_pu_bacteria | 2970489779 | 2970492047 | 322 |
| 416 | iso_pu_bacteria | 2970503327 | 2970505971 | 322 |
| 417 | iso_pu_bacteria | 2970510686 | 2970513165 | 322 |
| 418 | iso_pu_bacteria | 2970532167 | 2970534378 | 322 |
| 419 | iso_pu_bacteria | 2970547951 | 2970553279 | 322 |
| 420 | iso_pu_bacteria | 2970593180 | 2970593612 | 322 |
| 421 | iso_pu_bacteria | 2970593180 | 2970599355 | 322 |
| 422 | iso_pu_bacteria | 2970619444 | 2970625486 | 322 |
| 423 | iso_pu_bacteria | 2970627176 | 2970632670 | 322 |
| 424 | iso_pu_bacteria | 2977821940 | 2977826962 | 322 |
| 425 | iso_pu_bacteria | 2977828996 | 2977836884 | 322 |
| 426 | iso_pu_bacteria | 2977843712 | 2977843880 | 322 |
| 427 | iso_pu_bacteria | 2977851361 | 2977856713 | 322 |
| 428 | iso_pu_bacteria | 2977864932 | 2977867751 | 322 |
| 429 | iso_pu_bacteria | 2977872689 | 2977876633 | 322 |
| 430 | iso_pu_bacteria | 2977898635 | 2977904206 | 322 |
| 431 | iso_pu_bacteria | 2977907340 | 2977907989 | 322 |
| 432 | iso_pu_bacteria | 2977922695 | 2977925469 | 322 |
| 433 | iso_pu_bacteria | 2977935797 | 2977941098 | 322 |
| 434 | iso_pu_bacteria | 2977957713 | 2977960594 | 322 |
| 435 | iso_pu_bacteria | 2979764755 | 2979767002 | 322 |
| 436 | iso_pu_bacteria | 2979772303 | 2979775848 | 322 |
| 437 | iso_pu_bacteria | 2979793036 | 2979794610 | 322 |
| 438 | iso_pu_bacteria | 2979808191 | 2979810692 | 322 |
| 439 | iso_pu_bacteria | 2987645492 | 2987646222 | 322 |
| 440 | iso_pu_bacteria | 2987673487 | 2987677341 | 322 |
| 441 | iso_pu_bacteria | 2989349275 | 2989354481 | 322 |
| 442 | iso_pu_bacteria | 2996348954 | 2996355884 | 322 |
| 443 | iso_pu_bacteria | 2996386984 | 2996387051 | 322 |
| 444 | iso_pu_bacteria | 3000135777 | 3000137352 | 322 |
| 445 | iso_pu_bacteria | 3004167301 | 3004173259 | 322 |
| 446 | iso_pu_bacteria | 3004211236 | 3004217003 | 322 |
| 447 | iso_pu_bacteria | 3004218560 | 3004225404 | 322 |
| 448 | iso_pu_bacteria | 3004232784 | 3004235065 | 322 |
| 449 | iso_pu_bacteria | 3004239961 | 3004242256 | 322 |
| 450 | iso_pu_bacteria | 3004248173 | 3004253673 | 322 |
| 451 | iso_pu_bacteria | 3004268573 | 3004271785 | 322 |
| 452 | iso_pu_bacteria | 3004275668 | 3004282310 | 322 |
| 453 | iso_pu_bacteria | 3004289098 | 3004293706 | 322 |
| 454 | iso_pu_bacteria | 3004334049 | 3004337292 | 322 |
| 455 | iso_pu_bacteria | 3005452660 | 3005457599 | 322 |
| 456 | iso_pu_bacteria | 3005474847 | 3005481233 | 322 |
| 457 | iso_pu_bacteria | 3005483717 | 3005484812 | 322 |
| 458 | iso_pu_bacteria | 3005506211 | 3005508450 | 322 |
| 459 | iso_pu_bacteria | 3005587118 | 3005588047 | 322 |
| 460 | iso_pu_bacteria | 3005594810 | 3005600296 | 322 |
| 461 | iso_pu_bacteria | 3005710791 | 3005715790 | 322 |
| 462 | iso_pu_bacteria | 3005718088 | 3005723146 | 322 |
| 463 | iso_pu_bacteria | 643692032 | 643823865 | 322 |
| 464 | iso_pu_bacteria | 649633066 | 649870553 | 322 |
| 465 | iso_pu_bacteria | 8002285264 | 8002289714 | 322 |
| 466 | iso_pu_bacteria | 8003570095 | 8003574891 | 322 |
| 467 | iso_pu_bacteria | 8004300914 | 8004301825 | 322 |
| 468 | iso_pu_bacteria | 8004312739 | 8004319500 | 322 |
| 469 | iso_pu_bacteria | 8004374579 | 8004379945 | 322 |
| 470 | iso_pu_bacteria | 8004387939 | 8004390434 | 322 |
| 471 | iso_pu_bacteria | 8004640170 | 8004642558 | 322 |
| 472 | iso_pu_bacteria | 8004695233 | 8004696347 | 322 |
| 473 | iso_pu_bacteria | 8004714634 | 8004715627 | 322 |
| 474 | iso_pu_bacteria | 8004727605 | 8004727872 | 322 |
| 475 | iso_pu_bacteria | 8005258706 | 8005260488 | 322 |
| 476 | iso_pu_bacteria | 8005275841 | 8005275978 | 322 |
| 477 | iso_pu_bacteria | 8005282627 | 8005286279 | 322 |
| 478 | iso_pu_bacteria | 8005301065 | 8005301696 | 322 |
| 479 | iso_pu_bacteria | 8005382845 | 8005383353 | 322 |
| 480 | iso_pu_bacteria | 8005395548 | 8005398947 | 322 |
| 481 | iso_pu_bacteria | 8005682033 | 8005683620 | 322 |
| 482 | iso_pu_bacteria | 8005695170 | 8005695441 | 322 |
| 483 | iso_pu_bacteria | 8006926726 | 8006927959 | 322 |
| 484 | iso_pu_bacteria | 8006933436 | 8006939476 | 322 |
| 485 | iso_pu_bacteria | 8006964411 | 8006972134 | 322 |
| 486 | iso_pu_bacteria | 8006973647 | 8006979226 | 322 |
| 487 | iso_pu_bacteria | 8006984368 | 8006984411 | 322 |
| 488 | iso_pu_bacteria | 8006994254 | 8007001345 | 322 |
| 489 | iso_pu_bacteria | 8016522445 | 8016528704 | 322 |
| 490 | iso_pu_bacteria | 8016530956 | 8016533885 | 322 |
| 491 | iso_pu_bacteria | 8016539877 | 8016547107 | 322 |
| 492 | iso_pu_bacteria | 8016548790 | 8016555014 | 322 |
| 493 | iso_pu_bacteria | 8016557553 | 8016563383 | 322 |
| 494 | iso_pu_bacteria | 8016566248 | 8016572221 | 322 |
| 495 | iso_pu_bacteria | 8016575299 | 8016576410 | 322 |
| 496 | iso_pu_bacteria | 8016583857 | 8016594315 | 322 |
| 497 | iso_pu_bacteria | 8016595262 | 8016601134 | 322 |
| 498 | iso_pu_bacteria | 8016613128 | 8016615590 | 322 |
| 499 | iso_pu_bacteria | 8017057580 | 8017064904 | 322 |
| 500 | iso_pu_bacteria | 8018127388 | 8018128504 | 322 |
| 501 | iso_pu_bacteria | 8018163183 | 8018163385 | 322 |
| 502 | iso_pu_bacteria | 8018176218 | 8018180862 | 322 |
| 503 | iso_pu_bacteria | 8019530166 | 8019533654 | 322 |
| 504 | iso_pu_bacteria | 8019538911 | 8019546011 | 322 |
| 505 | iso_pu_bacteria | 8019547302 | 8019552709 | 322 |
| 506 | iso_pu_bacteria | 8019555841 | 8019565355 | 322 |
| 507 | iso_pu_bacteria | 8019565922 | 8019575454 | 322 |
| 508 | iso_pu_bacteria | 8019576017 | 8019584280 | 322 |
| 509 | iso_pu_bacteria | 8019586578 | 8019592048 | 322 |
| 510 | iso_pu_bacteria | 8019597564 | 8019599235 | 322 |
| 511 | iso_pu_bacteria | 8019608314 | 8019609123 | 322 |
| 512 | iso_pu_bacteria | 8019619141 | 8019619796 | 322 |
| 513 | iso_pu_bacteria | 8019648815 | 8019649351 | 322 |
| 514 | iso_pu_bacteria | 8019659431 | 8019661193 | 322 |
| 515 | iso_pu_bacteria | 8019668869 | 8019670744 | 322 |
| 516 | iso_pu_bacteria | 8019678201 | 8019685460 | 322 |
| 517 | iso_pu_bacteria | 8019687851 | 8019691049 | 322 |
| 518 | iso_pu_bacteria | 8055742211 | 8055745131 | 322 |
| 519 | iso_pu_bacteria | 8056375014 | 8056381797 | 322 |
| 520 | iso_pu_bacteria | 8056673599 | 8056681089 | 322 |
| 521 | iso_pu_bacteria | 8056681323 | 8056684736 | 322 |
| 522 | iso_pu_bacteria | 8056689827 | 8056693080 | 322 |
| 523 | iso_pu_bacteria | 8056967851 | 8056975088 | 322 |
| 524 | iso_pu_bacteria | 8057160832 | 8057163668 | 322 |
| 525 | iso_pu_bacteria | 8057529695 | 8057531285 | 322 |
| 526 | 3300021384 | Ga0213876_10089360 | Ga0213876_100893602 | 324 |
| 527 | 3300049571 | Ga0501034_0062003 | Ga0501034_0062003_343_1317 | 324 |
| 528 | 3300049589 | Ga0501073_0035474 | Ga0501073_0035474_572_1546 | 324 |
| 529 | 3300049742 | Ga0501080_0118362 | Ga0501080_0118362_1273_2247 | 324 |
| 530 | 3300039062 | Ga0400483_189090 | Ga0400483_189090_185_1162 | 325 |
| 531 | 3300001979 | JGI24740J21852_10008285 | JGI24740J21852_100082853 | 326 |
| 532 | 3300002704 | JGI25155J39150_1000046 | JGI25155J39150_100004628 | 326 |
| 533 | 3300002705 | JGI25156J39149_1000070 | JGI25156J39149_100007050 | 326 |
| 534 | 3300002705 | JGI25156J39149_1009007 | JGI25156J39149_10090072 | 326 |
| 535 | 3300002737 | JGI25162J39368_1000247 | JGI25162J39368_100024716 | 326 |
| 536 | 3300002737 | JGI25162J39368_1000735 | JGI25162J39368_100073519 | 326 |
| 537 | 3300002738 | JGI25154J39366_1000092 | JGI25154J39366_100009228 | 326 |
| 538 | 3300002741 | JGI25157J39369_1000087 | JGI25157J39369_100008729 | 326 |
| 539 | 3300002741 | JGI25157J39369_1000175 | JGI25157J39369_100017536 | 326 |
| 540 | 3300002987 | JGI25159J45721_1000030 | JGI25159J45721_100003053 | 326 |
| 541 | 3300003187 | JGI25151J46595_10048693 | JGI25151J46595_100486932 | 326 |
| 542 | 3300003203 | JGI25406J46586_10000214 | JGI25406J46586_1000021413 | 326 |
| 543 | 3300003214 | JGI25165J46597_1000020 | JGI25165J46597_1000020279 | 326 |
| 544 | 3300003214 | JGI25165J46597_1000237 | JGI25165J46597_100023760 | 326 |
| 545 | 3300003214 | JGI25165J46597_1000412 | JGI25165J46597_100041230 | 326 |
| 546 | 3300003214 | JGI25165J46597_1005141 | JGI25165J46597_10051411 | 326 |
| 547 | 3300003215 | JGI25153J46596_10000151 | JGI25153J46596_1000015160 | 326 |
| 548 | 3300003215 | JGI25153J46596_10003908 | JGI25153J46596_100039082 | 326 |
| 549 | 3300003215 | JGI25153J46596_10005616 | JGI25153J46596_100056162 | 326 |
| 550 | 3300003354 | JGI25160J50197_1000075 | JGI25160J50197_100007553 | 326 |
| 551 | 3300003354 | JGI25160J50197_1003595 | JGI25160J50197_10035956 | 326 |
| 552 | 3300003354 | JGI25160J50197_1024708 | JGI25160J50197_10247082 | 326 |
| 553 | 3300003354 | JGI25160J50197_1025086 | JGI25160J50197_10250862 | 326 |
| 554 | 3300003374 | JGI25161J50226_1000316 | JGI25161J50226_10003164 | 326 |
| 555 | 3300003659 | JGI25404J52841_10002699 | JGI25404J52841_100026993 | 326 |
| 556 | 3300003752 | Ga0055539_1008676 | Ga0055539_10086761 | 326 |
| 557 | 3300003762 | Ga0055542_1000841 | Ga0055542_100084121 | 326 |
| 558 | 3300003763 | Ga0055529_1007252 | Ga0055529_10072522 | 326 |
| 559 | 3300003771 | Ga0055526_1005688 | Ga0055526_10056882 | 326 |
| 560 | 3300003771 | Ga0055526_1029564 | Ga0055526_10295641 | 326 |
| 561 | 3300003775 | Ga0055524_1000960 | Ga0055524_100096016 | 326 |
| 562 | 3300003781 | Ga0055536_1003695 | Ga0055536_10036954 | 326 |
| 563 | 3300003792 | Ga0055540_1000131 | Ga0055540_100013137 | 326 |
| 564 | 3300003794 | Ga0055531_10014237 | Ga0055531_100142372 | 326 |
| 565 | 3300004625 | Ga0055543_1003338 | Ga0055543_10033382 | 326 |
| 566 | 3300005262 | Ga0065165_1000048 | Ga0065165_100004875 | 326 |
| 567 | 3300005262 | Ga0065165_1000206 | Ga0065165_100020653 | 326 |
| 568 | 3300005262 | Ga0065165_1000582 | Ga0065165_10005826 | 326 |
| 569 | 3300005262 | Ga0065165_1002074 | Ga0065165_10020748 | 326 |
| 570 | 3300005262 | Ga0065165_1002220 | Ga0065165_100222010 | 326 |
| 571 | 3300005262 | Ga0065165_1005485 | Ga0065165_10054856 | 326 |
| 572 | 3300005290 | Ga0065712_10099907 | Ga0065712_100999072 | 326 |
| 573 | 3300005329 | Ga0070683_100052860 | Ga0070683_1000528602 | 326 |
| 574 | 3300005330 | Ga0070690_100103442 | Ga0070690_1001034422 | 326 |
| 575 | 3300005330 | Ga0070690_100212356 | Ga0070690_1002123561 | 326 |
| 576 | 3300005334 | Ga0068869_100129353 | Ga0068869_1001293531 | 326 |
| 577 | 3300005336 | Ga0070680_100052018 | Ga0070680_1000520183 | 326 |
| 578 | 3300005336 | Ga0070680_100075104 | Ga0070680_1000751043 | 326 |
| 579 | 3300005336 | Ga0070680_100131570 | Ga0070680_1001315702 | 326 |
| 580 | 3300005337 | Ga0070682_100409483 | Ga0070682_1004094831 | 326 |
| 581 | 3300005339 | Ga0070660_100051646 | Ga0070660_1000516461 | 326 |
| 582 | 3300005339 | Ga0070660_100206106 | Ga0070660_1002061061 | 326 |
| 583 | 3300005344 | Ga0070661_100232344 | Ga0070661_1002323441 | 326 |
| 584 | 3300005347 | Ga0070668_100151197 | Ga0070668_1001511972 | 326 |
| 585 | 3300005355 | Ga0070671_100068387 | Ga0070671_1000683873 | 326 |
| 586 | 3300005356 | Ga0070674_100027518 | Ga0070674_1000275184 | 326 |
| 587 | 3300005356 | Ga0070674_100086602 | Ga0070674_1000866021 | 326 |
| 588 | 3300005356 | Ga0070674_100201329 | Ga0070674_1002013292 | 326 |
| 589 | 3300005365 | Ga0070688_100060270 | Ga0070688_1000602702 | 326 |
| 590 | 3300005366 | Ga0070659_100012688 | Ga0070659_1000126883 | 326 |
| 591 | 3300005366 | Ga0070659_100053918 | Ga0070659_1000539182 | 326 |
| 592 | 3300005367 | Ga0070667_100188613 | Ga0070667_1001886132 | 326 |
| 593 | 3300005434 | Ga0070709_10000203 | Ga0070709_1000020324 | 326 |
| 594 | 3300005434 | Ga0070709_10004227 | Ga0070709_100042275 | 326 |
| 595 | 3300005434 | Ga0070709_10004390 | Ga0070709_100043902 | 326 |
| 596 | 3300005434 | Ga0070709_10065310 | Ga0070709_100653102 | 326 |
| 597 | 3300005435 | Ga0070714_100065966 | Ga0070714_1000659662 | 326 |
| 598 | 3300005435 | Ga0070714_100149564 | Ga0070714_1001495642 | 326 |
| 599 | 3300005436 | Ga0070713_100001761 | Ga0070713_1000017615 | 326 |
| 600 | 3300005436 | Ga0070713_100010384 | Ga0070713_1000103847 | 326 |
| 601 | 3300005436 | Ga0070713_100016592 | Ga0070713_1000165922 | 326 |
| 602 | 3300005436 | Ga0070713_100183503 | Ga0070713_1001835032 | 326 |
| 603 | 3300005437 | Ga0070710_10002045 | Ga0070710_100020458 | 326 |
| 604 | 3300005439 | Ga0070711_100001730 | Ga0070711_1000017304 | 326 |
| 605 | 3300005439 | Ga0070711_100006659 | Ga0070711_1000066592 | 326 |
| 606 | 3300005439 | Ga0070711_100011938 | Ga0070711_1000119384 | 326 |
| 607 | 3300005439 | Ga0070711_100014917 | Ga0070711_1000149174 | 326 |
| 608 | 3300005439 | Ga0070711_100019115 | Ga0070711_1000191151 | 326 |
| 609 | 3300005445 | Ga0070708_100109740 | Ga0070708_1001097403 | 326 |
| 610 | 3300005455 | Ga0070663_100076740 | Ga0070663_1000767401 | 326 |
| 611 | 3300005457 | Ga0070662_100365092 | Ga0070662_1003650921 | 326 |
| 612 | 3300005458 | Ga0070681_10003273 | Ga0070681_1000327312 | 326 |
| 613 | 3300005458 | Ga0070681_10025087 | Ga0070681_100250872 | 326 |
| 614 | 3300005458 | Ga0070681_10065024 | Ga0070681_100650243 | 326 |
| 615 | 3300005467 | Ga0070706_100156571 | Ga0070706_1001565712 | 326 |
| 616 | 3300005468 | Ga0070707_100176291 | Ga0070707_1001762912 | 326 |
| 617 | 3300005530 | Ga0070679_100017482 | Ga0070679_1000174823 | 326 |
| 618 | 3300005530 | Ga0070679_100024100 | Ga0070679_1000241006 | 326 |
| 619 | 3300005530 | Ga0070679_100174677 | Ga0070679_1001746772 | 326 |
| 620 | 3300005535 | Ga0070684_100013567 | Ga0070684_1000135676 | 326 |
| 621 | 3300005535 | Ga0070684_100089906 | Ga0070684_1000899062 | 326 |
| 622 | 3300005535 | Ga0070684_100094373 | Ga0070684_1000943732 | 326 |
| 623 | 3300005535 | Ga0070684_100285812 | Ga0070684_1002858122 | 326 |
| 624 | 3300005536 | Ga0070697_100106656 | Ga0070697_1001066562 | 326 |
| 625 | 3300005539 | Ga0068853_100009540 | Ga0068853_1000095408 | 326 |
| 626 | 3300005539 | Ga0068853_100040363 | Ga0068853_1000403632 | 326 |
| 627 | 3300005539 | Ga0068853_100416381 | Ga0068853_1004163811 | 326 |
| 628 | 3300005548 | Ga0070665_100014994 | Ga0070665_1000149945 | 326 |
| 629 | 3300005548 | Ga0070665_100552780 | Ga0070665_1005527801 | 326 |
| 630 | 3300005563 | Ga0068855_100018899 | Ga0068855_1000188994 | 326 |
| 631 | 3300005563 | Ga0068855_100067952 | Ga0068855_1000679525 | 326 |
| 632 | 3300005563 | Ga0068855_100114327 | Ga0068855_1001143272 | 326 |
| 633 | 3300005563 | Ga0068855_100151551 | Ga0068855_1001515513 | 326 |
| 634 | 3300005563 | Ga0068855_100184319 | Ga0068855_1001843193 | 326 |
| 635 | 3300005563 | Ga0068855_100386568 | Ga0068855_1003865682 | 326 |
| 636 | 3300005563 | Ga0068855_100419655 | Ga0068855_1004196552 | 326 |
| 637 | 3300005563 | Ga0068855_100480299 | Ga0068855_1004802991 | 326 |
| 638 | 3300005564 | Ga0070664_100283719 | Ga0070664_1002837192 | 326 |
| 639 | 3300005577 | Ga0068857_100016047 | Ga0068857_1000160476 | 326 |
| 640 | 3300005578 | Ga0068854_100192480 | Ga0068854_1001924802 | 326 |
| 641 | 3300005578 | Ga0068854_100207275 | Ga0068854_1002072751 | 326 |
| 642 | 3300005614 | Ga0068856_100003888 | Ga0068856_10000388813 | 326 |
| 643 | 3300005614 | Ga0068856_100055216 | Ga0068856_1000552163 | 326 |
| 644 | 3300005614 | Ga0068856_100068625 | Ga0068856_1000686252 | 326 |
| 645 | 3300005614 | Ga0068856_100230817 | Ga0068856_1002308172 | 326 |
| 646 | 3300005615 | Ga0070702_100045764 | Ga0070702_1000457642 | 326 |
| 647 | 3300005616 | Ga0068852_100011984 | Ga0068852_1000119843 | 326 |
| 648 | 3300005616 | Ga0068852_100032466 | Ga0068852_1000324664 | 326 |
| 649 | 3300005616 | Ga0068852_100213007 | Ga0068852_1002130072 | 326 |
| 650 | 3300005617 | Ga0068859_100160460 | Ga0068859_1001604602 | 326 |
| 651 | 3300005617 | Ga0068859_100163980 | Ga0068859_1001639802 | 326 |
| 652 | 3300005618 | Ga0068864_100384391 | Ga0068864_1003843912 | 326 |
| 653 | 3300005618 | Ga0068864_100544067 | Ga0068864_1005440671 | 326 |
| 654 | 3300005834 | Ga0068851_10004825 | Ga0068851_100048254 | 326 |
| 655 | 3300005841 | Ga0068863_100315590 | Ga0068863_1003155902 | 326 |
| 656 | 3300005842 | Ga0068858_100228037 | Ga0068858_1002280372 | 326 |
| 657 | 3300005843 | Ga0068860_100000081 | Ga0068860_10000008191 | 326 |
| 658 | 3300005843 | Ga0068860_100081543 | Ga0068860_1000815432 | 326 |
| 659 | 3300005843 | Ga0068860_100100065 | Ga0068860_1001000653 | 326 |
| 660 | 3300005843 | Ga0068860_100134124 | Ga0068860_1001341242 | 326 |
| 661 | 3300005844 | Ga0068862_100103763 | Ga0068862_1001037632 | 326 |
| 662 | 3300005844 | Ga0068862_100213910 | Ga0068862_1002139102 | 326 |
| 663 | 3300005937 | Ga0081455_10001734 | Ga0081455_100017342 | 326 |
| 664 | 3300005937 | Ga0081455_10013417 | Ga0081455_100134172 | 326 |
| 665 | 3300005937 | Ga0081455_10015026 | Ga0081455_100150268 | 326 |
| 666 | 3300005937 | Ga0081455_10028177 | Ga0081455_100281772 | 326 |
| 667 | 3300005937 | Ga0081455_10056973 | Ga0081455_100569732 | 326 |
| 668 | 3300005937 | Ga0081455_10120310 | Ga0081455_101203102 | 326 |
| 669 | 3300005983 | Ga0081540_1003965 | Ga0081540_100396511 | 326 |
| 670 | 3300005983 | Ga0081540_1006422 | Ga0081540_10064227 | 326 |
| 671 | 3300005983 | Ga0081540_1007697 | Ga0081540_10076972 | 326 |
| 672 | 3300005983 | Ga0081540_1011844 | Ga0081540_10118443 | 326 |
| 673 | 3300005983 | Ga0081540_1012349 | Ga0081540_10123494 | 326 |
| 674 | 3300005983 | Ga0081540_1013491 | Ga0081540_10134913 | 326 |
| 675 | 3300005983 | Ga0081540_1014236 | Ga0081540_10142363 | 326 |
| 676 | 3300005983 | Ga0081540_1018818 | Ga0081540_10188185 | 326 |
| 677 | 3300005985 | Ga0081539_10000768 | Ga0081539_1000076839 | 326 |
| 678 | 3300005985 | Ga0081539_10001470 | Ga0081539_100014703 | 326 |
| 679 | 3300006028 | Ga0070717_10001267 | Ga0070717_100012675 | 326 |
| 680 | 3300006028 | Ga0070717_10106472 | Ga0070717_101064722 | 326 |
| 681 | 3300006028 | Ga0070717_10115762 | Ga0070717_101157622 | 326 |
| 682 | 3300006038 | Ga0075365_10086145 | Ga0075365_100861452 | 326 |
| 683 | 3300006038 | Ga0075365_10103698 | Ga0075365_101036982 | 326 |
| 684 | 3300006042 | Ga0075368_10001363 | Ga0075368_100013633 | 326 |
| 685 | 3300006042 | Ga0075368_10021695 | Ga0075368_100216952 | 326 |
| 686 | 3300006042 | Ga0075368_10057252 | Ga0075368_100572522 | 326 |
| 687 | 3300006048 | Ga0075363_100013881 | Ga0075363_1000138814 | 326 |
| 688 | 3300006048 | Ga0075363_100067582 | Ga0075363_1000675822 | 326 |
| 689 | 3300006048 | Ga0075363_100077073 | Ga0075363_1000770732 | 326 |
| 690 | 3300006051 | Ga0075364_10060783 | Ga0075364_100607832 | 326 |
| 691 | 3300006051 | Ga0075364_10145166 | Ga0075364_101451662 | 326 |
| 692 | 3300006051 | Ga0075364_10251643 | Ga0075364_102516432 | 326 |
| 693 | 3300006163 | Ga0070715_10005933 | Ga0070715_100059333 | 326 |
| 694 | 3300006163 | Ga0070715_10121468 | Ga0070715_101214681 | 326 |
| 695 | 3300006173 | Ga0070716_100002732 | Ga0070716_1000027323 | 326 |
| 696 | 3300006175 | Ga0070712_100006733 | Ga0070712_1000067337 | 326 |
| 697 | 3300006175 | Ga0070712_100055550 | Ga0070712_1000555502 | 326 |
| 698 | 3300006175 | Ga0070712_100074402 | Ga0070712_1000744022 | 326 |
| 699 | 3300006175 | Ga0070712_100085459 | Ga0070712_1000854592 | 326 |
| 700 | 3300006175 | Ga0070712_100200603 | Ga0070712_1002006032 | 326 |
| 701 | 3300006177 | Ga0075362_10040701 | Ga0075362_100407012 | 326 |
| 702 | 3300006177 | Ga0075362_10056901 | Ga0075362_100569011 | 326 |
| 703 | 3300006177 | Ga0075362_10065700 | Ga0075362_100657002 | 326 |
| 704 | 3300006178 | Ga0075367_10007415 | Ga0075367_100074151 | 326 |
| 705 | 3300006178 | Ga0075367_10081807 | Ga0075367_100818072 | 326 |
| 706 | 3300006186 | Ga0075369_10035267 | Ga0075369_100352672 | 326 |
| 707 | 3300006186 | Ga0075369_10055915 | Ga0075369_100559152 | 326 |
| 708 | 3300006186 | Ga0075369_10080657 | Ga0075369_100806572 | 326 |
| 709 | 3300006195 | Ga0075366_10072981 | Ga0075366_100729811 | 326 |
| 710 | 3300006237 | Ga0097621_100315787 | Ga0097621_1003157872 | 326 |
| 711 | 3300006353 | Ga0075370_10013567 | Ga0075370_100135674 | 326 |
| 712 | 3300006353 | Ga0075370_10109286 | Ga0075370_101092862 | 326 |
| 713 | 3300006844 | Ga0075428_100424997 | Ga0075428_1004249972 | 326 |
| 714 | 3300006847 | Ga0075431_100002184 | Ga0075431_10000218411 | 326 |
| 715 | 3300006871 | Ga0075434_100066744 | Ga0075434_1000667443 | 326 |
| 716 | 3300006880 | Ga0075429_100020728 | Ga0075429_1000207281 | 326 |
| 717 | 3300006914 | Ga0075436_100101586 | Ga0075436_1001015862 | 326 |
| 718 | 3300006931 | Ga0097620_100160446 | Ga0097620_1001604462 | 326 |
| 719 | 3300006931 | Ga0097620_100163987 | Ga0097620_1001639873 | 326 |
| 720 | 3300006941 | Ga0099825_1032134 | Ga0099825_10321342 | 326 |
| 721 | 3300006942 | Ga0099824_1007408 | Ga0099824_10074089 | 326 |
| 722 | 3300006942 | Ga0099824_1023175 | Ga0099824_10231753 | 326 |
| 723 | 3300006943 | Ga0099822_1018218 | Ga0099822_10182187 | 326 |
| 724 | 3300007076 | Ga0075435_100249788 | Ga0075435_1002497881 | 326 |
| 725 | 3300009093 | Ga0105240_10008768 | Ga0105240_100087684 | 326 |
| 726 | 3300009093 | Ga0105240_10034221 | Ga0105240_100342213 | 326 |
| 727 | 3300009093 | Ga0105240_10076136 | Ga0105240_100761362 | 326 |
| 728 | 3300009093 | Ga0105240_10120101 | Ga0105240_101201012 | 326 |
| 729 | 3300009093 | Ga0105240_10129667 | Ga0105240_101296672 | 326 |
| 730 | 3300009093 | Ga0105240_10206609 | Ga0105240_102066092 | 326 |
| 731 | 3300009093 | Ga0105240_10255829 | Ga0105240_102558292 | 326 |
| 732 | 3300009098 | Ga0105245_10063788 | Ga0105245_100637883 | 326 |
| 733 | 3300009098 | Ga0105245_10098072 | Ga0105245_100980722 | 326 |
| 734 | 3300009101 | Ga0105247_10026143 | Ga0105247_100261434 | 326 |
| 735 | 3300009101 | Ga0105247_10091007 | Ga0105247_100910072 | 326 |
| 736 | 3300009101 | Ga0105247_10116887 | Ga0105247_101168872 | 326 |
| 737 | 3300009147 | Ga0114129_10069546 | Ga0114129_100695466 | 326 |
| 738 | 3300009174 | Ga0105241_10028779 | Ga0105241_100287792 | 326 |
| 739 | 3300009174 | Ga0105241_10035078 | Ga0105241_100350784 | 326 |
| 740 | 3300009174 | Ga0105241_10265431 | Ga0105241_102654311 | 326 |
| 741 | 3300009176 | Ga0105242_10262412 | Ga0105242_102624122 | 326 |
| 742 | 3300009177 | Ga0105248_10374305 | Ga0105248_103743051 | 326 |
| 743 | 3300009545 | Ga0105237_10004427 | Ga0105237_1000442714 | 326 |
| 744 | 3300009545 | Ga0105237_10047513 | Ga0105237_100475134 | 326 |
| 745 | 3300009545 | Ga0105237_10133855 | Ga0105237_101338551 | 326 |
| 746 | 3300009545 | Ga0105237_10263849 | Ga0105237_102638492 | 326 |
| 747 | 3300009545 | Ga0105237_10388095 | Ga0105237_103880952 | 326 |
| 748 | 3300009545 | Ga0105237_10389256 | Ga0105237_103892562 | 326 |
| 749 | 3300009545 | Ga0105237_10510928 | Ga0105237_105109282 | 326 |
| 750 | 3300009551 | Ga0105238_10017402 | Ga0105238_100174024 | 326 |
| 751 | 3300009551 | Ga0105238_10081432 | Ga0105238_100814323 | 326 |
| 752 | 3300009551 | Ga0105238_10105713 | Ga0105238_101057132 | 326 |
| 753 | 3300009551 | Ga0105238_10193087 | Ga0105238_101930872 | 326 |
| 754 | 3300009553 | Ga0105249_10206780 | Ga0105249_102067802 | 326 |
| 755 | 3300010159 | Ga0099796_10014810 | Ga0099796_100148102 | 326 |
| 756 | 3300010375 | Ga0105239_10017021 | Ga0105239_100170218 | 326 |
| 757 | 3300010375 | Ga0105239_10063018 | Ga0105239_100630182 | 326 |
| 758 | 3300010375 | Ga0105239_10083385 | Ga0105239_100833852 | 326 |
| 759 | 3300010375 | Ga0105239_10092409 | Ga0105239_100924094 | 326 |
| 760 | 3300010375 | Ga0105239_10132432 | Ga0105239_101324322 | 326 |
| 761 | 3300010375 | Ga0105239_10139240 | Ga0105239_101392402 | 326 |
| 762 | 3300010375 | Ga0105239_10684333 | Ga0105239_106843332 | 326 |
| 763 | 3300011119 | Ga0105246_10132761 | Ga0105246_101327612 | 326 |
| 764 | 3300011119 | Ga0105246_10202766 | Ga0105246_102027661 | 326 |
| 765 | 3300011119 | Ga0105246_10224999 | Ga0105246_102249992 | 326 |
| 766 | 3300011119 | Ga0105246_10270163 | Ga0105246_102701631 | 326 |
| 767 | 3300013102 | Ga0157371_10075245 | Ga0157371_100752452 | 326 |
| 768 | 3300013104 | Ga0157370_10014947 | Ga0157370_100149478 | 326 |
| 769 | 3300013104 | Ga0157370_10025078 | Ga0157370_100250785 | 326 |
| 770 | 3300013105 | Ga0157369_10012270 | Ga0157369_100122702 | 326 |
| 771 | 3300013105 | Ga0157369_10021190 | Ga0157369_100211904 | 326 |
| 772 | 3300013105 | Ga0157369_10151314 | Ga0157369_101513142 | 326 |
| 773 | 3300013105 | Ga0157369_10187272 | Ga0157369_101872723 | 326 |
| 774 | 3300013105 | Ga0157369_10227813 | Ga0157369_102278132 | 326 |
| 775 | 3300013296 | Ga0157374_10200703 | Ga0157374_102007031 | 326 |
| 776 | 3300013297 | Ga0157378_10009041 | Ga0157378_100090418 | 326 |
| 777 | 3300013297 | Ga0157378_10345420 | Ga0157378_103454201 | 326 |
| 778 | 3300013306 | Ga0163162_10088250 | Ga0163162_100882505 | 326 |
| 779 | 3300013306 | Ga0163162_10317092 | Ga0163162_103170921 | 326 |
| 780 | 3300013308 | Ga0157375_10047518 | Ga0157375_100475182 | 326 |
| 781 | 3300013308 | Ga0157375_10189822 | Ga0157375_101898222 | 326 |
| 782 | 3300013308 | Ga0157375_10197290 | Ga0157375_101972902 | 326 |
| 783 | 3300014325 | Ga0163163_10008215 | Ga0163163_1000821510 | 326 |
| 784 | 3300014325 | Ga0163163_10011315 | Ga0163163_100113154 | 326 |
| 785 | 3300014325 | Ga0163163_10179953 | Ga0163163_101799531 | 326 |
| 786 | 3300014325 | Ga0163163_10232184 | Ga0163163_102321841 | 326 |
| 787 | 3300014325 | Ga0163163_10414029 | Ga0163163_104140292 | 326 |
| 788 | 3300014326 | Ga0157380_10141045 | Ga0157380_101410452 | 326 |
| 789 | 3300014497 | Ga0182008_10006828 | Ga0182008_100068282 | 326 |
| 790 | 3300014745 | Ga0157377_10191485 | Ga0157377_101914852 | 326 |
| 791 | 3300014968 | Ga0157379_10100048 | Ga0157379_101000481 | 326 |
| 792 | 3300014969 | Ga0157376_10347565 | Ga0157376_103475651 | 326 |
| 793 | 3300017792 | Ga0163161_10149601 | Ga0163161_101496012 | 326 |
| 794 | 3300017792 | Ga0163161_10196512 | Ga0163161_101965123 | 326 |
| 795 | 3300017792 | Ga0163161_10205589 | Ga0163161_102055892 | 326 |
| 796 | 3300021320 | Ga0214544_1001813 | Ga0214544_100181317 | 326 |
| 797 | 3300021320 | Ga0214544_1032568 | Ga0214544_10325682 | 326 |
| 798 | 3300021321 | Ga0214542_1001236 | Ga0214542_100123622 | 326 |
| 799 | 3300021321 | Ga0214542_1028629 | Ga0214542_10286292 | 326 |
| 800 | 3300021321 | Ga0214542_1039400 | Ga0214542_10394002 | 326 |
| 801 | 3300021324 | Ga0214545_1000924 | Ga0214545_100092423 | 326 |
| 802 | 3300021324 | Ga0214545_1023651 | Ga0214545_10236513 | 326 |
| 803 | 3300021324 | Ga0214545_1027979 | Ga0214545_10279792 | 326 |
| 804 | 3300021327 | Ga0214543_1003531 | Ga0214543_100353121 | 326 |
| 805 | 3300021327 | Ga0214543_1024471 | Ga0214543_10244711 | 326 |
| 806 | 3300021327 | Ga0214543_1034461 | Ga0214543_10344612 | 326 |
| 807 | 3300021327 | Ga0214543_1035893 | Ga0214543_10358932 | 326 |
| 808 | 3300021384 | Ga0213876_10000520 | Ga0213876_100005206 | 326 |
| 809 | 3300021384 | Ga0213876_10001886 | Ga0213876_100018862 | 326 |
| 810 | 3300021384 | Ga0213876_10008410 | Ga0213876_100084105 | 326 |
| 811 | 3300021384 | Ga0213876_10020027 | Ga0213876_100200274 | 326 |
| 812 | 3300025206 | Ga0209435_100059 | Ga0209435_10005950 | 326 |
| 813 | 3300025208 | Ga0209436_100823 | Ga0209436_1008239 | 326 |
| 814 | 3300025230 | Ga0209563_101384 | Ga0209563_1013842 | 326 |
| 815 | 3300025230 | Ga0209563_102893 | Ga0209563_1028934 | 326 |
| 816 | 3300025233 | Ga0209437_100042 | Ga0209437_100042369 | 326 |
| 817 | 3300025233 | Ga0209437_100062 | Ga0209437_10006246 | 326 |
| 818 | 3300025246 | Ga0209646_1000179 | Ga0209646_100017928 | 326 |
| 819 | 3300025246 | Ga0209646_1011629 | Ga0209646_10116292 | 326 |
| 820 | 3300025250 | Ga0209026_1000005 | Ga0209026_1000005550 | 326 |
| 821 | 3300025250 | Ga0209026_1000212 | Ga0209026_100021228 | 326 |
| 822 | 3300025253 | Ga0209677_106293 | Ga0209677_1062933 | 326 |
| 823 | 3300025254 | Ga0209148_1000136 | Ga0209148_1000136125 | 326 |
| 824 | 3300025254 | Ga0209148_1000180 | Ga0209148_100018096 | 326 |
| 825 | 3300025256 | Ga0209759_1000111 | Ga0209759_100011183 | 326 |
| 826 | 3300025256 | Ga0209759_1000246 | Ga0209759_100024628 | 326 |
| 827 | 3300025261 | Ga0209233_1000047 | Ga0209233_100004756 | 326 |
| 828 | 3300025261 | Ga0209233_1000054 | Ga0209233_1000054292 | 326 |
| 829 | 3300025261 | Ga0209233_1000082 | Ga0209233_100008246 | 326 |
| 830 | 3300025261 | Ga0209233_1010707 | Ga0209233_10107072 | 326 |
| 831 | 3300025263 | Ga0209565_1009385 | Ga0209565_10093852 | 326 |
| 832 | 3300025272 | Ga0209455_1000170 | Ga0209455_10001706 | 326 |
| 833 | 3300025272 | Ga0209455_1003748 | Ga0209455_10037485 | 326 |
| 834 | 3300025273 | Ga0209673_1000642 | Ga0209673_100064224 | 326 |
| 835 | 3300025284 | Ga0209130_1000071 | Ga0209130_100007157 | 326 |
| 836 | 3300025284 | Ga0209130_1000154 | Ga0209130_100015455 | 326 |
| 837 | 3300025292 | Ga0209676_1004026 | Ga0209676_10040266 | 326 |
| 838 | 3300025294 | Ga0209025_1000032 | Ga0209025_1000032341 | 326 |
| 839 | 3300025294 | Ga0209025_1002646 | Ga0209025_10026468 | 326 |
| 840 | 3300025295 | Ga0209564_1000025 | Ga0209564_1000025438 | 326 |
| 841 | 3300025295 | Ga0209564_1000385 | Ga0209564_100038571 | 326 |
| 842 | 3300025295 | Ga0209564_1017303 | Ga0209564_10173032 | 326 |
| 843 | 3300025295 | Ga0209564_1023087 | Ga0209564_10230872 | 326 |
| 844 | 3300025297 | Ga0209758_1000011 | Ga0209758_1000011302 | 326 |
| 845 | 3300025297 | Ga0209758_1000120 | Ga0209758_100012089 | 326 |
| 846 | 3300025297 | Ga0209758_1001210 | Ga0209758_100121024 | 326 |
| 847 | 3300025297 | Ga0209758_1004569 | Ga0209758_10045698 | 326 |
| 848 | 3300025297 | Ga0209758_1008059 | Ga0209758_10080594 | 326 |
| 849 | 3300025297 | Ga0209758_1015568 | Ga0209758_10155683 | 326 |
| 850 | 3300025297 | Ga0209758_1029522 | Ga0209758_10295221 | 326 |
| 851 | 3300025298 | Ga0209050_1005957 | Ga0209050_10059575 | 326 |
| 852 | 3300025299 | Ga0209256_1000073 | Ga0209256_1000073200 | 326 |
| 853 | 3300025299 | Ga0209256_1000907 | Ga0209256_100090715 | 326 |
| 854 | 3300025299 | Ga0209256_1005155 | Ga0209256_10051552 | 326 |
| 855 | 3300025302 | Ga0207426_1000286 | Ga0207426_100028655 | 326 |
| 856 | 3300025302 | Ga0207426_1000572 | Ga0207426_100057228 | 326 |
| 857 | 3300025302 | Ga0207426_1001763 | Ga0207426_10017638 | 326 |
| 858 | 3300025302 | Ga0207426_1039826 | Ga0207426_10398262 | 326 |
| 859 | 3300025303 | Ga0209051_1000038 | Ga0209051_1000038266 | 326 |
| 860 | 3300025303 | Ga0209051_1002477 | Ga0209051_100247712 | 326 |
| 861 | 3300025304 | Ga0209257_1003099 | Ga0209257_100309910 | 326 |
| 862 | 3300025304 | Ga0209257_1009764 | Ga0209257_10097644 | 326 |
| 863 | 3300025304 | Ga0209257_1013498 | Ga0209257_10134982 | 326 |
| 864 | 3300025304 | Ga0209257_1035619 | Ga0209257_10356192 | 326 |
| 865 | 3300025898 | Ga0207692_10058851 | Ga0207692_100588512 | 326 |
| 866 | 3300025898 | Ga0207692_10065222 | Ga0207692_100652221 | 326 |
| 867 | 3300025899 | Ga0207642_10105860 | Ga0207642_101058602 | 326 |
| 868 | 3300025900 | Ga0207710_10014873 | Ga0207710_100148734 | 326 |
| 869 | 3300025900 | Ga0207710_10016392 | Ga0207710_100163923 | 326 |
| 870 | 3300025901 | Ga0207688_10021360 | Ga0207688_100213602 | 326 |
| 871 | 3300025904 | Ga0207647_10035646 | Ga0207647_100356462 | 326 |
| 872 | 3300025906 | Ga0207699_10002275 | Ga0207699_100022758 | 326 |
| 873 | 3300025906 | Ga0207699_10008564 | Ga0207699_100085642 | 326 |
| 874 | 3300025906 | Ga0207699_10056061 | Ga0207699_100560612 | 326 |
| 875 | 3300025906 | Ga0207699_10167145 | Ga0207699_101671452 | 326 |
| 876 | 3300025909 | Ga0207705_10191644 | Ga0207705_101916442 | 326 |
| 877 | 3300025910 | Ga0207684_10294696 | Ga0207684_102946962 | 326 |
| 878 | 3300025910 | Ga0207684_10302188 | Ga0207684_103021882 | 326 |
| 879 | 3300025911 | Ga0207654_10033726 | Ga0207654_100337263 | 326 |
| 880 | 3300025911 | Ga0207654_10036096 | Ga0207654_100360963 | 326 |
| 881 | 3300025911 | Ga0207654_10086640 | Ga0207654_100866402 | 326 |
| 882 | 3300025912 | Ga0207707_10000419 | Ga0207707_1000041932 | 326 |
| 883 | 3300025912 | Ga0207707_10002705 | Ga0207707_100027055 | 326 |
| 884 | 3300025912 | Ga0207707_10002868 | Ga0207707_100028683 | 326 |
| 885 | 3300025912 | Ga0207707_10045918 | Ga0207707_100459182 | 326 |
| 886 | 3300025913 | Ga0207695_10000008 | Ga0207695_10000008786 | 326 |
| 887 | 3300025913 | Ga0207695_10152018 | Ga0207695_101520182 | 326 |
| 888 | 3300025913 | Ga0207695_10180414 | Ga0207695_101804143 | 326 |
| 889 | 3300025914 | Ga0207671_10008982 | Ga0207671_100089828 | 326 |
| 890 | 3300025914 | Ga0207671_10034078 | Ga0207671_100340782 | 326 |
| 891 | 3300025914 | Ga0207671_10059255 | Ga0207671_100592553 | 326 |
| 892 | 3300025914 | Ga0207671_10061259 | Ga0207671_100612591 | 326 |
| 893 | 3300025914 | Ga0207671_10088306 | Ga0207671_100883063 | 326 |
| 894 | 3300025914 | Ga0207671_10156832 | Ga0207671_101568322 | 326 |
| 895 | 3300025914 | Ga0207671_10170665 | Ga0207671_101706652 | 326 |
| 896 | 3300025915 | Ga0207693_10013446 | Ga0207693_100134463 | 326 |
| 897 | 3300025915 | Ga0207693_10019720 | Ga0207693_100197205 | 326 |
| 898 | 3300025915 | Ga0207693_10033602 | Ga0207693_100336023 | 326 |
| 899 | 3300025915 | Ga0207693_10228159 | Ga0207693_102281592 | 326 |
| 900 | 3300025916 | Ga0207663_10000249 | Ga0207663_100002492 | 326 |
| 901 | 3300025916 | Ga0207663_10002050 | Ga0207663_100020504 | 326 |
| 902 | 3300025916 | Ga0207663_10007087 | Ga0207663_100070874 | 326 |
| 903 | 3300025916 | Ga0207663_10067281 | Ga0207663_100672811 | 326 |
| 904 | 3300025917 | Ga0207660_10106711 | Ga0207660_101067112 | 326 |
| 905 | 3300025919 | Ga0207657_10026743 | Ga0207657_100267435 | 326 |
| 906 | 3300025919 | Ga0207657_10188524 | Ga0207657_101885242 | 326 |
| 907 | 3300025919 | Ga0207657_10262314 | Ga0207657_102623142 | 326 |
| 908 | 3300025920 | Ga0207649_10039488 | Ga0207649_100394883 | 326 |
| 909 | 3300025920 | Ga0207649_10084927 | Ga0207649_100849271 | 326 |
| 910 | 3300025920 | Ga0207649_10151437 | Ga0207649_101514372 | 326 |
| 911 | 3300025921 | Ga0207652_10001690 | Ga0207652_1000169014 | 326 |
| 912 | 3300025921 | Ga0207652_10011695 | Ga0207652_100116953 | 326 |
| 913 | 3300025921 | Ga0207652_10048077 | Ga0207652_100480771 | 326 |
| 914 | 3300025922 | Ga0207646_10238573 | Ga0207646_102385731 | 326 |
| 915 | 3300025924 | Ga0207694_10027290 | Ga0207694_100272903 | 326 |
| 916 | 3300025924 | Ga0207694_10068409 | Ga0207694_100684093 | 326 |
| 917 | 3300025924 | Ga0207694_10191173 | Ga0207694_101911732 | 326 |
| 918 | 3300025924 | Ga0207694_10245057 | Ga0207694_102450571 | 326 |
| 919 | 3300025924 | Ga0207694_10324959 | Ga0207694_103249592 | 326 |
| 920 | 3300025924 | Ga0207694_10327683 | Ga0207694_103276832 | 326 |
| 921 | 3300025925 | Ga0207650_10303663 | Ga0207650_103036632 | 326 |
| 922 | 3300025926 | Ga0207659_10098980 | Ga0207659_100989802 | 326 |
| 923 | 3300025928 | Ga0207700_10035637 | Ga0207700_100356374 | 326 |
| 924 | 3300025928 | Ga0207700_10047104 | Ga0207700_100471043 | 326 |
| 925 | 3300025928 | Ga0207700_10136610 | Ga0207700_101366101 | 326 |
| 926 | 3300025929 | Ga0207664_10029904 | Ga0207664_100299044 | 326 |
| 927 | 3300025929 | Ga0207664_10071647 | Ga0207664_100716471 | 326 |
| 928 | 3300025932 | Ga0207690_10030753 | Ga0207690_100307534 | 326 |
| 929 | 3300025933 | Ga0207706_10275897 | Ga0207706_102758972 | 326 |
| 930 | 3300025935 | Ga0207709_10074401 | Ga0207709_100744012 | 326 |
| 931 | 3300025936 | Ga0207670_10053842 | Ga0207670_100538423 | 326 |
| 932 | 3300025936 | Ga0207670_10420066 | Ga0207670_104200661 | 326 |
| 933 | 3300025937 | Ga0207669_10183380 | Ga0207669_101833802 | 326 |
| 934 | 3300025938 | Ga0207704_10175967 | Ga0207704_101759671 | 326 |
| 935 | 3300025939 | Ga0207665_10001320 | Ga0207665_1000132016 | 326 |
| 936 | 3300025939 | Ga0207665_10001972 | Ga0207665_100019725 | 326 |
| 937 | 3300025941 | Ga0207711_10043240 | Ga0207711_100432402 | 326 |
| 938 | 3300025942 | Ga0207689_10044019 | Ga0207689_100440191 | 326 |
| 939 | 3300025942 | Ga0207689_10088660 | Ga0207689_100886603 | 326 |
| 940 | 3300025944 | Ga0207661_10001270 | Ga0207661_100012707 | 326 |
| 941 | 3300025944 | Ga0207661_10008213 | Ga0207661_100082136 | 326 |
| 942 | 3300025944 | Ga0207661_10264831 | Ga0207661_102648312 | 326 |
| 943 | 3300025945 | Ga0207679_10069235 | Ga0207679_100692352 | 326 |
| 944 | 3300025945 | Ga0207679_10286765 | Ga0207679_102867652 | 326 |
| 945 | 3300025949 | Ga0207667_10002017 | Ga0207667_1000201711 | 326 |
| 946 | 3300025949 | Ga0207667_10124956 | Ga0207667_101249563 | 326 |
| 947 | 3300025949 | Ga0207667_10134592 | Ga0207667_101345923 | 326 |
| 948 | 3300025949 | Ga0207667_10209954 | Ga0207667_102099541 | 326 |
| 949 | 3300025960 | Ga0207651_10125014 | Ga0207651_101250142 | 326 |
| 950 | 3300025961 | Ga0207712_10312704 | Ga0207712_103127042 | 326 |
| 951 | 3300025972 | Ga0207668_10050204 | Ga0207668_100502041 | 326 |
| 952 | 3300025972 | Ga0207668_10245334 | Ga0207668_102453341 | 326 |
| 953 | 3300025981 | Ga0207640_10148313 | Ga0207640_101483132 | 326 |
| 954 | 3300025981 | Ga0207640_10189558 | Ga0207640_101895582 | 326 |
| 955 | 3300025981 | Ga0207640_10274661 | Ga0207640_102746611 | 326 |
| 956 | 3300025986 | Ga0207658_10150957 | Ga0207658_101509571 | 326 |
| 957 | 3300025986 | Ga0207658_10211814 | Ga0207658_102118142 | 326 |
| 958 | 3300025986 | Ga0207658_10218779 | Ga0207658_102187792 | 326 |
| 959 | 3300026023 | Ga0207677_10073275 | Ga0207677_100732752 | 326 |
| 960 | 3300026035 | Ga0207703_10136925 | Ga0207703_101369252 | 326 |
| 961 | 3300026041 | Ga0207639_10006277 | Ga0207639_100062777 | 326 |
| 962 | 3300026041 | Ga0207639_10035603 | Ga0207639_100356034 | 326 |
| 963 | 3300026041 | Ga0207639_10379100 | Ga0207639_103791002 | 326 |
| 964 | 3300026067 | Ga0207678_10060137 | Ga0207678_100601372 | 326 |
| 965 | 3300026067 | Ga0207678_10061454 | Ga0207678_100614541 | 326 |
| 966 | 3300026067 | Ga0207678_10067879 | Ga0207678_100678792 | 326 |
| 967 | 3300026067 | Ga0207678_10072014 | Ga0207678_100720142 | 326 |
| 968 | 3300026075 | Ga0207708_10115077 | Ga0207708_101150771 | 326 |
| 969 | 3300026078 | Ga0207702_10000548 | Ga0207702_1000054831 | 326 |
| 970 | 3300026078 | Ga0207702_10019097 | Ga0207702_100190976 | 326 |
| 971 | 3300026078 | Ga0207702_10049458 | Ga0207702_100494582 | 326 |
| 972 | 3300026078 | Ga0207702_10098547 | Ga0207702_100985472 | 326 |
| 973 | 3300026078 | Ga0207702_10248491 | Ga0207702_102484911 | 326 |
| 974 | 3300026088 | Ga0207641_10036305 | Ga0207641_100363053 | 326 |
| 975 | 3300026095 | Ga0207676_10271343 | Ga0207676_102713432 | 326 |
| 976 | 3300026116 | Ga0207674_10010575 | Ga0207674_100105752 | 326 |
| 977 | 3300026116 | Ga0207674_10226613 | Ga0207674_102266132 | 326 |
| 978 | 3300026118 | Ga0207675_100112829 | Ga0207675_1001128293 | 326 |
| 979 | 3300026118 | Ga0207675_100114354 | Ga0207675_1001143542 | 326 |
| 980 | 3300026118 | Ga0207675_100130814 | Ga0207675_1001308142 | 326 |
| 981 | 3300026118 | Ga0207675_100218893 | Ga0207675_1002188932 | 326 |
| 982 | 3300026121 | Ga0207683_10021694 | Ga0207683_100216944 | 326 |
| 983 | 3300026121 | Ga0207683_10033936 | Ga0207683_100339364 | 326 |
| 984 | 3300026121 | Ga0207683_10040045 | Ga0207683_100400453 | 326 |
| 985 | 3300026121 | Ga0207683_10124367 | Ga0207683_101243673 | 326 |
| 986 | 3300026121 | Ga0207683_10222480 | Ga0207683_102224802 | 326 |
| 987 | 3300026142 | Ga0207698_10012367 | Ga0207698_100123674 | 326 |
| 988 | 3300026142 | Ga0207698_10034409 | Ga0207698_100344094 | 326 |
| 989 | 3300026142 | Ga0207698_10071611 | Ga0207698_100716112 | 326 |
| 990 | 3300026142 | Ga0207698_10288218 | Ga0207698_102882182 | 326 |
| 991 | 3300026142 | Ga0207698_10326389 | Ga0207698_103263892 | 326 |
| 992 | 3300027296 | Ga0209389_1000080 | Ga0209389_100008023 | 326 |
| 993 | 3300027296 | Ga0209389_1000115 | Ga0209389_100011529 | 326 |
| 994 | 3300027357 | Ga0209589_1000014 | Ga0209589_1000014169 | 326 |
| 995 | 3300027357 | Ga0209589_1000033 | Ga0209589_100003329 | 326 |
| 996 | 3300027361 | Ga0209489_100014 | Ga0209489_100014169 | 326 |
| 997 | 3300027361 | Ga0209489_100027 | Ga0209489_100027130 | 326 |
| 998 | 3300027361 | Ga0209489_100040 | Ga0209489_100040121 | 326 |
| 999 | 3300027363 | Ga0209700_100022 | Ga0209700_100022163 | 326 |
| 1000 | 3300027363 | Ga0209700_100024 | Ga0209700_100024169 | 326 |
| 1001 | 3300027671 | Ga0209588_1009865 | Ga0209588_10098653 | 326 |
| 1002 | 3300027866 | Ga0209813_10000555 | Ga0209813_100005556 | 326 |
| 1003 | 3300028379 | Ga0268266_10011262 | Ga0268266_100112628 | 326 |
| 1004 | 3300028379 | Ga0268266_10162564 | Ga0268266_101625642 | 326 |
| 1005 | 3300028379 | Ga0268266_10173266 | Ga0268266_101732661 | 326 |
| 1006 | 3300028379 | Ga0268266_10207318 | Ga0268266_102073182 | 326 |
| 1007 | 3300028379 | Ga0268266_10222593 | Ga0268266_102225932 | 326 |
| 1008 | 3300028379 | Ga0268266_10290155 | Ga0268266_102901551 | 326 |
| 1009 | 3300028380 | Ga0268265_10063828 | Ga0268265_100638281 | 326 |
| 1010 | 3300028380 | Ga0268265_10110095 | Ga0268265_101100952 | 326 |
| 1011 | 3300028380 | Ga0268265_10319263 | Ga0268265_103192632 | 326 |
| 1012 | 3300028380 | Ga0268265_10460809 | Ga0268265_104608091 | 326 |
| 1013 | 3300028381 | Ga0268264_10000048 | Ga0268264_1000004886 | 326 |
| 1014 | 3300028381 | Ga0268264_10140130 | Ga0268264_101401302 | 326 |
| 1015 | 3300028577 | Ga0265318_10021190 | Ga0265318_100211902 | 326 |
| 1016 | 3300028786 | Ga0307517_10000634 | Ga0307517_1000063444 | 326 |
| 1017 | 3300028786 | Ga0307517_10039620 | Ga0307517_100396203 | 326 |
| 1018 | 3300028794 | Ga0307515_10000130 | Ga0307515_1000013049 | 326 |
| 1019 | 3300028794 | Ga0307515_10000375 | Ga0307515_1000037577 | 326 |
| 1020 | 3300028794 | Ga0307515_10006012 | Ga0307515_1000601213 | 326 |
| 1021 | 3300028794 | Ga0307515_10011208 | Ga0307515_1001120814 | 326 |
| 1022 | 3300031238 | Ga0265332_10072944 | Ga0265332_100729441 | 326 |
| 1023 | 3300031242 | Ga0265329_10010852 | Ga0265329_100108523 | 326 |
| 1024 | 3300031247 | Ga0265340_10000942 | Ga0265340_1000094215 | 326 |
| 1025 | 3300031247 | Ga0265340_10062324 | Ga0265340_100623242 | 326 |
| 1026 | 3300031249 | Ga0265339_10003224 | Ga0265339_100032246 | 326 |
| 1027 | 3300031249 | Ga0265339_10004321 | Ga0265339_100043217 | 326 |
| 1028 | 3300031249 | Ga0265339_10139606 | Ga0265339_101396061 | 326 |
| 1029 | 3300031250 | Ga0265331_10005402 | Ga0265331_100054023 | 326 |
| 1030 | 3300031456 | Ga0307513_10000335 | Ga0307513_1000033512 | 326 |
| 1031 | 3300031456 | Ga0307513_10020103 | Ga0307513_100201032 | 326 |
| 1032 | 3300031507 | Ga0307509_10005537 | Ga0307509_1000553714 | 326 |
| 1033 | 3300031616 | Ga0307508_10000032 | Ga0307508_1000003277 | 326 |
| 1034 | 3300031665 | Ga0316575_10027004 | Ga0316575_100270041 | 326 |
| 1035 | 3300031711 | Ga0265314_10004266 | Ga0265314_100042664 | 326 |
| 1036 | 3300031711 | Ga0265314_10206222 | Ga0265314_102062222 | 326 |
| 1037 | 3300031712 | Ga0265342_10000245 | Ga0265342_1000024528 | 326 |
| 1038 | 3300031730 | Ga0307516_10005934 | Ga0307516_100059345 | 326 |
| 1039 | 3300031730 | Ga0307516_10010247 | Ga0307516_100102479 | 326 |
| 1040 | 3300031730 | Ga0307516_10039539 | Ga0307516_100395394 | 326 |
| 1041 | 3300031730 | Ga0307516_10107771 | Ga0307516_101077713 | 326 |
| 1042 | 3300031730 | Ga0307516_10290617 | Ga0307516_102906172 | 326 |
| 1043 | 3300031731 | Ga0307405_10124851 | Ga0307405_101248512 | 326 |
| 1044 | 3300031903 | Ga0307407_10110918 | Ga0307407_101109182 | 326 |
| 1045 | 3300031911 | Ga0307412_10148803 | Ga0307412_101488032 | 326 |
| 1046 | 3300031995 | Ga0307409_100018896 | Ga0307409_1000188963 | 326 |
| 1047 | 3300032004 | Ga0307414_10015462 | Ga0307414_100154622 | 326 |
| 1048 | 3300032126 | Ga0307415_100080075 | Ga0307415_1000800752 | 326 |
| 1049 | 3300032126 | Ga0307415_100154121 | Ga0307415_1001541212 | 326 |
| 1050 | 3300032133 | Ga0316583_10000299 | Ga0316583_1000029912 | 326 |
| 1051 | 3300033179 | Ga0307507_10011278 | Ga0307507_100112789 | 326 |
| 1052 | 3300033180 | Ga0307510_10016157 | Ga0307510_100161574 | 326 |
| 1053 | 3300033180 | Ga0307510_10033062 | Ga0307510_100330624 | 326 |
| 1054 | 3300033180 | Ga0307510_10079195 | Ga0307510_100791951 | 326 |
| 1055 | 3300033180 | Ga0307510_10192031 | Ga0307510_101920312 | 326 |
| 1056 | 3300033442 | Ga0315911_1000002 | Ga0315911_1000002151 | 326 |
| 1057 | 3300034818 | Ga0373950_0007558 | Ga0373950_0007558_670_1650 | 326 |
| 1058 | 3300035111 | Ga0373923_0018497 | Ga0373923_0018497_1566_2549 | 326 |
| 1059 | 3300035111 | Ga0373923_0023017 | Ga0373923_0023017_143_1126 | 326 |
| 1060 | 3300035116 | Ga0373945_0007554 | Ga0373945_0007554_711_1694 | 326 |
| 1061 | 3300035118 | Ga0373954_0000645 | Ga0373954_0000645_11806_12789 | 326 |
| 1062 | 3300035118 | Ga0373954_0089346 | Ga0373954_0089346_179_1162 | 326 |
| 1063 | 3300035119 | Ga0373956_0005180 | Ga0373956_0005180_4212_5195 | 326 |
| 1064 | 3300035120 | Ga0373957_0001340 | Ga0373957_0001340_4077_5060 | 326 |
| 1065 | 3300035120 | Ga0373957_0074282 | Ga0373957_0074282_165_1148 | 326 |
| 1066 | 3300035170 | Ga0373943_0044140 | Ga0373943_0044140_555_1538 | 326 |
| 1067 | 3300035170 | Ga0373943_0046304 | Ga0373943_0046304_1009_1992 | 326 |
| 1068 | 3300035171 | Ga0373946_0017066 | Ga0373946_0017066_1009_1992 | 326 |
| 1069 | 3300035171 | Ga0373946_0024016 | Ga0373946_0024016_627_1607 | 326 |
| 1070 | 3300035171 | Ga0373946_0137953 | Ga0373946_0137953_87_1070 | 326 |
| 1071 | 3300035172 | Ga0373955_0114878 | Ga0373955_0114878_181_1164 | 326 |
| 1072 | 3300035410 | Ga0373924_0073578 | Ga0373924_0073578_281_1264 | 326 |
| 1073 | 3300035410 | Ga0373924_0076719 | Ga0373924_0076719_104_1087 | 326 |
| 1074 | 3300035691 | Ga0373931_0002187 | Ga0373931_0002187_6636_7682 | 326 |
| 1075 | 3300035692 | Ga0373935_0012923 | Ga0373935_0012923_3100_4083 | 326 |
| 1076 | 3300035692 | Ga0373935_0054823 | Ga0373935_0054823_402_1385 | 326 |
| 1077 | 3300035692 | Ga0373935_0063455 | Ga0373935_0063455_808_1791 | 326 |
| 1078 | 3300035695 | Ga0373927_0000177 | Ga0373927_0000177_42495_43475 | 326 |
| 1079 | 3300035695 | Ga0373927_0013220 | Ga0373927_0013220_4481_5464 | 326 |
| 1080 | 3300035724 | Ga0373933_0000182 | Ga0373933_0000182_18522_19505 | 326 |
| 1081 | 3300035724 | Ga0373933_0003690 | Ga0373933_0003690_297_1280 | 326 |
| 1082 | 3300035724 | Ga0373933_0112009 | Ga0373933_0112009_592_1575 | 326 |
| 1083 | 3300035725 | Ga0373947_0028707 | Ga0373947_0028707_955_1938 | 326 |
| 1084 | 3300035725 | Ga0373947_0057990 | Ga0373947_0057990_575_1555 | 326 |
| 1085 | 3300035725 | Ga0373947_0071426 | Ga0373947_0071426_908_1891 | 326 |
| 1086 | 3300035725 | Ga0373947_0103986 | Ga0373947_0103986_604_1587 | 326 |
| 1087 | 3300036401 | Ga0373937_0013771 | Ga0373937_0013771_3338_4321 | 326 |
| 1088 | 3300036401 | Ga0373937_0033145 | Ga0373937_0033145_2840_3823 | 326 |
| 1089 | 3300037068 | Ga0373925_0000912 | Ga0373925_0000912_20046_21026 | 326 |
| 1090 | 3300037068 | Ga0373925_0021953 | Ga0373925_0021953_1558_2541 | 326 |
| 1091 | 3300037068 | Ga0373925_0108321 | Ga0373925_0108321_1075_2058 | 326 |
| 1092 | 3300037312 | Ga0395899_0038352 | Ga0395899_0038352_612_1595 | 326 |
| 1093 | 3300037312 | Ga0395899_0083732 | Ga0395899_0083732_81_1064 | 326 |
| 1094 | 3300037418 | Ga0395900_0001029 | Ga0395900_0001029_13276_14259 | 326 |
| 1095 | 3300037418 | Ga0395900_0004780 | Ga0395900_0004780_11985_12965 | 326 |
| 1096 | 3300037418 | Ga0395900_0017080 | Ga0395900_0017080_4664_5647 | 326 |
| 1097 | 3300037466 | Ga0395898_0002778 | Ga0395898_0002778_12879_13862 | 326 |
| 1098 | 3300037466 | Ga0395898_0022553 | Ga0395898_0022553_907_1890 | 326 |
| 1099 | 3300037466 | Ga0395898_0169433 | Ga0395898_0169433_399_1382 | 326 |
| 1100 | 3300037466 | Ga0395898_0179146 | Ga0395898_0179146_376_1359 | 326 |
| 1101 | 3300037471 | Ga0395905_0002254 | Ga0395905_0002254_2060_3040 | 326 |
| 1102 | 3300037471 | Ga0395905_0006562 | Ga0395905_0006562_10062_11042 | 326 |
| 1103 | 3300037471 | Ga0395905_0136044 | Ga0395905_0136044_213_1193 | 326 |
| 1104 | 3300037471 | Ga0395905_0198854 | Ga0395905_0198854_324_1307 | 326 |
| 1105 | 3300037471 | Ga0395905_0229979 | Ga0395905_0229979_315_1298 | 326 |
| 1106 | 3300037853 | Ga0436364_0341704 | Ga0436364_0341704_4942_5922 | 326 |
| 1107 | 3300038443 | Ga0395901_0014425 | Ga0395901_0014425_2641_3621 | 326 |
| 1108 | 3300038443 | Ga0395901_0031413 | Ga0395901_0031413_1843_2826 | 326 |
| 1109 | 3300038443 | Ga0395901_0044477 | Ga0395901_0044477_3481_4464 | 326 |
| 1110 | 3300038443 | Ga0395901_0052460 | Ga0395901_0052460_2314_3297 | 326 |
| 1111 | 3300038443 | Ga0395901_0158660 | Ga0395901_0158660_1082_2095 | 326 |
| 1112 | 3300038443 | Ga0395901_0386583 | Ga0395901_0386583_284_1267 | 326 |
| 1113 | 3300038443 | Ga0395901_0548932 | Ga0395901_0548932_112_1092 | 326 |
| 1114 | 3300039062 | Ga0400483_059947 | Ga0400483_059947_1251_2234 | 326 |
| 1115 | 3300039062 | Ga0400483_121196 | Ga0400483_121196_1028_2008 | 326 |
| 1116 | 3300039062 | Ga0400483_179252 | Ga0400483_179252_1216_2196 | 326 |
| 1117 | 3300039062 | Ga0400483_225275 | Ga0400483_225275_772_1752 | 326 |
| 1118 | 3300039062 | Ga0400483_291972 | Ga0400483_291972_345_1328 | 326 |
| 1119 | 3300039437 | Ga0436365_0229539 | Ga0436365_0229539_2147_3130 | 326 |
| 1120 | 3300039437 | Ga0436365_0459631 | Ga0436365_0459631_12841_13821 | 326 |
| 1121 | 3300039437 | Ga0436365_0745092 | Ga0436365_0745092_340_1323 | 326 |
| 1122 | 3300039437 | Ga0436365_0982014 | Ga0436365_0982014_1089_2072 | 326 |
| 1123 | 3300039437 | Ga0436365_1142591 | Ga0436365_1142591_91_1074 | 326 |
| 1124 | 3300039437 | Ga0436365_1590122 | Ga0436365_1590122_16379_17359 | 326 |
| 1125 | 3300039438 | Ga0436360_0768015 | Ga0436360_0768015_88_1071 | 326 |
| 1126 | 3300039438 | Ga0436360_1204026 | Ga0436360_1204026_92_1075 | 326 |
| 1127 | 3300039447 | Ga0436361_0665242 | Ga0436361_0665242_1478_2461 | 326 |
| 1128 | 3300039450 | Ga0436363_0725193 | Ga0436363_0725193_30_1013 | 326 |
| 1129 | 3300039450 | Ga0436363_1172772 | Ga0436363_1172772_5744_6724 | 326 |
| 1130 | 3300039453 | Ga0436362_0413279 | Ga0436362_0413279_2592_3674 | 326 |
| 1131 | 3300039453 | Ga0436362_1155470 | Ga0436362_1155470_2271_3251 | 326 |
| 1132 | 3300041486 | Ga0451807_1061003 | Ga0451807_1061003_240_1223 | 326 |
| 1133 | 3300041491 | Ga0451833_0369965 | Ga0451833_0369965_14003_14983 | 326 |
| 1134 | 3300041494 | Ga0451837_0964406 | Ga0451837_0964406_297_1277 | 326 |
| 1135 | 3300041496 | Ga0451839_0063950 | Ga0451839_0063950_14019_14999 | 326 |
| 1136 | 3300041501 | Ga0451845_0249129 | Ga0451845_0249129_14019_14999 | 326 |
| 1137 | 3300041503 | Ga0451847_0341155 | Ga0451847_0341155_14019_14999 | 326 |
| 1138 | 3300041507 | Ga0451851_1180298 | Ga0451851_1180298_13922_14902 | 326 |
| 1139 | 3300041511 | Ga0451855_0392051 | Ga0451855_0392051_1976_2956 | 326 |
| 1140 | 3300041512 | Ga0451853_2474193 | Ga0451853_2474193_7551_8531 | 326 |
| 1141 | 3300044658 | Ga0466972_0000172 | Ga0466972_0000172_44835_45818 | 326 |
| 1142 | 3300044683 | Ga0466965_0005988 | Ga0466965_0005988_1393_2373 | 326 |
| 1143 | 3300044684 | Ga0466966_0000128 | Ga0466966_0000128_21758_22741 | 326 |
| 1144 | 3300044684 | Ga0466966_0074228 | Ga0466966_0074228_84_1064 | 326 |
| 1145 | 3300044684 | Ga0466966_0103222 | Ga0466966_0103222_494_1477 | 326 |
| 1146 | 3300044693 | Ga0466961_0000236 | Ga0466961_0000236_16620_17603 | 326 |
| 1147 | 3300044694 | Ga0466963_0000255 | Ga0466963_0000255_20041_21021 | 326 |
| 1148 | 3300044694 | Ga0466963_0200354 | Ga0466963_0200354_118_1098 | 326 |
| 1149 | 3300044735 | Ga0466968_0010295 | Ga0466968_0010295_911_1894 | 326 |
| 1150 | 3300044765 | Ga0466970_0000134 | Ga0466970_0000134_7046_8026 | 326 |
| 1151 | 3300044765 | Ga0466970_0088464 | Ga0466970_0088464_16_999 | 326 |
| 1152 | 3300045976 | Ga0466967_0091577 | Ga0466967_0091577_1089_2072 | 326 |
| 1153 | 3300045976 | Ga0466967_0099398 | Ga0466967_0099398_1218_2201 | 326 |
| 1154 | 3300045976 | Ga0466967_0132211 | Ga0466967_0132211_974_1957 | 326 |
| 1155 | 3300046454 | Ga0495592_0039287 | Ga0495592_0039287_556_1539 | 326 |
| 1156 | 3300046454 | Ga0495592_0072650 | Ga0495592_0072650_1018_2001 | 326 |
| 1157 | 3300046455 | Ga0495603_0000217 | Ga0495603_0000217_27399_28382 | 326 |
| 1158 | 3300046455 | Ga0495603_0039310 | Ga0495603_0039310_88_1071 | 326 |
| 1159 | 3300046457 | Ga0495590_0050349 | Ga0495590_0050349_183_1166 | 326 |
| 1160 | 3300046459 | Ga0495629_0000373 | Ga0495629_0000373_2534_3517 | 326 |
| 1161 | 3300046459 | Ga0495629_0000862 | Ga0495629_0000862_10595_11578 | 326 |
| 1162 | 3300046459 | Ga0495629_0021438 | Ga0495629_0021438_1618_2598 | 326 |
| 1163 | 3300046459 | Ga0495629_0179830 | Ga0495629_0179830_76_1059 | 326 |
| 1164 | 3300046460 | Ga0495638_0004887 | Ga0495638_0004887_6673_7653 | 326 |
| 1165 | 3300046460 | Ga0495638_0005277 | Ga0495638_0005277_617_1600 | 326 |
| 1166 | 3300046460 | Ga0495638_0007591 | Ga0495638_0007591_2902_3885 | 326 |
| 1167 | 3300046460 | Ga0495638_0031312 | Ga0495638_0031312_32_1015 | 326 |
| 1168 | 3300046460 | Ga0495638_0035964 | Ga0495638_0035964_1907_2890 | 326 |
| 1169 | 3300046460 | Ga0495638_0036703 | Ga0495638_0036703_769_1749 | 326 |
| 1170 | 3300046460 | Ga0495638_0041257 | Ga0495638_0041257_918_1898 | 326 |
| 1171 | 3300046461 | Ga0495641_0019640 | Ga0495641_0019640_1537_2520 | 326 |
| 1172 | 3300046461 | Ga0495641_0048799 | Ga0495641_0048799_729_1712 | 326 |
| 1173 | 3300046462 | Ga0495651_0007091 | Ga0495651_0007091_131_1114 | 326 |
| 1174 | 3300046462 | Ga0495651_0019146 | Ga0495651_0019146_1033_2016 | 326 |
| 1175 | 3300046463 | Ga0495653_0218377 | Ga0495653_0218377_159_1142 | 326 |
| 1176 | 3300046463 | Ga0495653_0255541 | Ga0495653_0255541_92_1075 | 326 |
| 1177 | 3300046463 | Ga0495653_0270068 | Ga0495653_0270068_40_1023 | 326 |
| 1178 | 3300046472 | Ga0495580_0006588 | Ga0495580_0006588_7988_8971 | 326 |
| 1179 | 3300046472 | Ga0495580_0059540 | Ga0495580_0059540_1017_2000 | 326 |
| 1180 | 3300046473 | Ga0495582_0006572 | Ga0495582_0006572_5339_6322 | 326 |
| 1181 | 3300046473 | Ga0495582_0036743 | Ga0495582_0036743_396_1379 | 326 |
| 1182 | 3300046474 | Ga0495605_0046230 | Ga0495605_0046230_447_1430 | 326 |
| 1183 | 3300046475 | Ga0495639_0000544 | Ga0495639_0000544_11560_12543 | 326 |
| 1184 | 3300046475 | Ga0495639_0038283 | Ga0495639_0038283_903_1886 | 326 |
| 1185 | 3300046475 | Ga0495639_0059296 | Ga0495639_0059296_704_1684 | 326 |
| 1186 | 3300046476 | Ga0495662_0045498 | Ga0495662_0045498_159_1142 | 326 |
| 1187 | 3300046476 | Ga0495662_0123647 | Ga0495662_0123647_148_1131 | 326 |
| 1188 | 3300046477 | Ga0495664_0001505 | Ga0495664_0001505_1334_2317 | 326 |
| 1189 | 3300046477 | Ga0495664_0019029 | Ga0495664_0019029_901_1884 | 326 |
| 1190 | 3300046477 | Ga0495664_0034156 | Ga0495664_0034156_243_1226 | 326 |
| 1191 | 3300046477 | Ga0495664_0039921 | Ga0495664_0039921_409_1392 | 326 |
| 1192 | 3300046477 | Ga0495664_0089999 | Ga0495664_0089999_763_1746 | 326 |
| 1193 | 3300046477 | Ga0495664_0098203 | Ga0495664_0098203_88_1071 | 326 |
| 1194 | 3300046491 | Ga0495584_0124283 | Ga0495584_0124283_55_1038 | 326 |
| 1195 | 3300046492 | Ga0495585_0033769 | Ga0495585_0033769_349_1332 | 326 |
| 1196 | 3300046507 | Ga0495606_0043636 | Ga0495606_0043636_106_1089 | 326 |
| 1197 | 3300046511 | Ga0495608_0002876 | Ga0495608_0002876_4235_5218 | 326 |
| 1198 | 3300046511 | Ga0495608_0046266 | Ga0495608_0046266_1136_2119 | 326 |
| 1199 | 3300046511 | Ga0495608_0224764 | Ga0495608_0224764_86_1069 | 326 |
| 1200 | 3300046512 | Ga0495610_0050549 | Ga0495610_0050549_425_1408 | 326 |
| 1201 | 3300046514 | Ga0495618_0009642 | Ga0495618_0009642_566_1549 | 326 |
| 1202 | 3300046514 | Ga0495618_0035976 | Ga0495618_0035976_673_1656 | 326 |
| 1203 | 3300046514 | Ga0495618_0066415 | Ga0495618_0066415_996_1979 | 326 |
| 1204 | 3300046516 | Ga0495628_0009755 | Ga0495628_0009755_2568_3551 | 326 |
| 1205 | 3300046517 | Ga0495630_0026624 | Ga0495630_0026624_2910_3893 | 326 |
| 1206 | 3300046517 | Ga0495630_0060767 | Ga0495630_0060767_123_1106 | 326 |
| 1207 | 3300046518 | Ga0495631_0005680 | Ga0495631_0005680_3343_4323 | 326 |
| 1208 | 3300046519 | Ga0495632_0015036 | Ga0495632_0015036_928_1908 | 326 |
| 1209 | 3300046524 | Ga0495648_0001373 | Ga0495648_0001373_13398_14378 | 326 |
| 1210 | 3300046524 | Ga0495648_0042914 | Ga0495648_0042914_178_1161 | 326 |
| 1211 | 3300046524 | Ga0495648_0071291 | Ga0495648_0071291_920_1900 | 326 |
| 1212 | 3300046525 | Ga0495663_0032864 | Ga0495663_0032864_65_1048 | 326 |
| 1213 | 3300046526 | Ga0495666_0067701 | Ga0495666_0067701_674_1657 | 326 |
| 1214 | 3300046529 | Ga0495652_0076709 | Ga0495652_0076709_73_1056 | 326 |
| 1215 | 3300046529 | Ga0495652_0090139 | Ga0495652_0090139_787_1770 | 326 |
| 1216 | 3300046529 | Ga0495652_0104274 | Ga0495652_0104274_553_1536 | 326 |
| 1217 | 3300046530 | Ga0495654_0048470 | Ga0495654_0048470_228_1211 | 326 |
| 1218 | 3300046531 | Ga0495665_0006186 | Ga0495665_0006186_5343_6326 | 326 |
| 1219 | 3300046531 | Ga0495665_0131920 | Ga0495665_0131920_109_1092 | 326 |
| 1220 | 3300046533 | Ga0495640_0002595 | Ga0495640_0002595_3327_4310 | 326 |
| 1221 | 3300046535 | Ga0495586_0079707 | Ga0495586_0079707_268_1251 | 326 |
| 1222 | 3300046536 | Ga0495587_0197223 | Ga0495587_0197223_66_1049 | 326 |
| 1223 | 3300046542 | Ga0495597_0103842 | Ga0495597_0103842_12_992 | 326 |
| 1224 | 3300046557 | Ga0495622_0034428 | Ga0495622_0034428_706_1689 | 326 |
| 1225 | 3300046557 | Ga0495622_0132899 | Ga0495622_0132899_38_1021 | 326 |
| 1226 | 3300046559 | Ga0495667_0034851 | Ga0495667_0034851_774_1757 | 326 |
| 1227 | 3300046616 | Ga0495668_0022434 | Ga0495668_0022434_959_1939 | 326 |
| 1228 | 3300046642 | Ga0495634_0001583 | Ga0495634_0001583_901_1884 | 326 |
| 1229 | 3300046642 | Ga0495634_0061661 | Ga0495634_0061661_1411_2394 | 326 |
| 1230 | 3300046660 | Ga0495625_0069908 | Ga0495625_0069908_1416_2396 | 326 |
| 1231 | 3300046660 | Ga0495625_0127525 | Ga0495625_0127525_468_1451 | 326 |
| 1232 | 3300046660 | Ga0495625_0145977 | Ga0495625_0145977_548_1531 | 326 |
| 1233 | 3300046660 | Ga0495625_0150911 | Ga0495625_0150911_58_1041 | 326 |
| 1234 | 3300046660 | Ga0495625_0205758 | Ga0495625_0205758_101_1084 | 326 |
| 1235 | 3300046663 | Ga0495635_0000436 | Ga0495635_0000436_4718_5701 | 326 |
| 1236 | 3300046663 | Ga0495635_0051959 | Ga0495635_0051959_1521_2504 | 326 |
| 1237 | 3300046663 | Ga0495635_0224503 | Ga0495635_0224503_118_1098 | 326 |
| 1238 | 3300046663 | Ga0495635_0229304 | Ga0495635_0229304_101_1084 | 326 |
| 1239 | 3300046663 | Ga0495635_0272705 | Ga0495635_0272705_32_1015 | 326 |
| 1240 | 3300046665 | Ga0495661_0020469 | Ga0495661_0020469_2543_3526 | 326 |
| 1241 | 3300046674 | Ga0495588_0183087 | Ga0495588_0183087_46_1029 | 326 |
| 1242 | 3300046675 | Ga0495657_0028186 | Ga0495657_0028186_1884_2867 | 326 |
| 1243 | 3300046675 | Ga0495657_0053230 | Ga0495657_0053230_1536_2519 | 326 |
| 1244 | 3300046675 | Ga0495657_0058184 | Ga0495657_0058184_759_1742 | 326 |
| 1245 | 3300046675 | Ga0495657_0193184 | Ga0495657_0193184_138_1121 | 326 |
| 1246 | 3300046678 | Ga0495599_0042775 | Ga0495599_0042775_1806_2789 | 326 |
| 1247 | 3300046679 | Ga0495623_0056660 | Ga0495623_0056660_1339_2322 | 326 |
| 1248 | 3300046679 | Ga0495623_0097772 | Ga0495623_0097772_786_1769 | 326 |
| 1249 | 3300046679 | Ga0495623_0184015 | Ga0495623_0184015_55_1038 | 326 |
| 1250 | 3300046680 | Ga0495646_0005491 | Ga0495646_0005491_3486_4469 | 326 |
| 1251 | 3300046681 | Ga0495647_0011285 | Ga0495647_0011285_994_1977 | 326 |
| 1252 | 3300046683 | Ga0495658_0003203 | Ga0495658_0003203_5529_6512 | 326 |
| 1253 | 3300046684 | Ga0495669_0000650 | Ga0495669_0000650_3404_4387 | 326 |
| 1254 | 3300046689 | Ga0495613_0007707 | Ga0495613_0007707_6954_7937 | 326 |
| 1255 | 3300046689 | Ga0495613_0332423 | Ga0495613_0332423_26_1009 | 326 |
| 1256 | 3300046690 | Ga0495624_0023168 | Ga0495624_0023168_944_1927 | 326 |
| 1257 | 3300046690 | Ga0495624_0040628 | Ga0495624_0040628_228_1211 | 326 |
| 1258 | 3300046690 | Ga0495624_0082181 | Ga0495624_0082181_90_1073 | 326 |
| 1259 | 3300046694 | Ga0495649_0036062 | Ga0495649_0036062_1566_2549 | 326 |
| 1260 | 3300047315 | Ga0495581_0003127 | Ga0495581_0003127_7050_8033 | 326 |
| 1261 | 3300047315 | Ga0495581_0019323 | Ga0495581_0019323_1789_2772 | 326 |
| 1262 | 3300047317 | Ga0495604_0006866 | Ga0495604_0006866_3093_4076 | 326 |
| 1263 | 3300047317 | Ga0495604_0025855 | Ga0495604_0025855_2691_3674 | 326 |
| 1264 | 3300047317 | Ga0495604_0027516 | Ga0495604_0027516_3318_4301 | 326 |
| 1265 | 3300047317 | Ga0495604_0290784 | Ga0495604_0290784_34_1017 | 326 |
| 1266 | 3300047319 | Ga0495674_0008459 | Ga0495674_0008459_974_1957 | 326 |
| 1267 | 3300047319 | Ga0495674_0069954 | Ga0495674_0069954_714_1697 | 326 |
| 1268 | 3300047319 | Ga0495674_0093019 | Ga0495674_0093019_1470_2453 | 326 |
| 1269 | 3300047319 | Ga0495674_0208714 | Ga0495674_0208714_244_1227 | 326 |
| 1270 | 3300047320 | Ga0495672_0133076 | Ga0495672_0133076_13_1089 | 326 |
| 1271 | 3300047321 | Ga0495676_0027208 | Ga0495676_0027208_3819_4802 | 326 |
| 1272 | 3300047321 | Ga0495676_0146496 | Ga0495676_0146496_15_998 | 326 |
| 1273 | 3300047322 | Ga0495680_0001711 | Ga0495680_0001711_1342_2325 | 326 |
| 1274 | 3300047322 | Ga0495680_0009863 | Ga0495680_0009863_4772_5755 | 326 |
| 1275 | 3300047443 | Ga0495687_024676 | Ga0495687_024676_63_1043 | 326 |
| 1276 | 3300047443 | Ga0495687_080788 | Ga0495687_080788_258_1241 | 326 |
| 1277 | 3300047444 | Ga0495675_0005291 | Ga0495675_0005291_2118_3101 | 326 |
| 1278 | 3300047444 | Ga0495675_0148817 | Ga0495675_0148817_308_1291 | 326 |
| 1279 | 3300047469 | Ga0495673_0051615 | Ga0495673_0051615_178_1197 | 326 |
| 1280 | 3300047469 | Ga0495673_0079470 | Ga0495673_0079470_232_1215 | 326 |
| 1281 | 3300047470 | Ga0495681_0001771 | Ga0495681_0001771_3336_4316 | 326 |
| 1282 | 3300047472 | Ga0495686_0015184 | Ga0495686_0015184_2125_3108 | 326 |
| 1283 | 3300047472 | Ga0495686_0046169 | Ga0495686_0046169_1605_2588 | 326 |
| 1284 | 3300047472 | Ga0495686_0060792 | Ga0495686_0060792_816_1799 | 326 |
| 1285 | 3300047472 | Ga0495686_0215198 | Ga0495686_0215198_75_1058 | 326 |
| 1286 | 3300047673 | Ga0495593_0000439 | Ga0495593_0000439_1373_2356 | 326 |
| 1287 | 3300047673 | Ga0495593_0011115 | Ga0495593_0011115_1923_2906 | 326 |
| 1288 | 3300048088 | Ga0495602_0009113 | Ga0495602_0009113_5148_6131 | 326 |
| 1289 | 3300048088 | Ga0495602_0112361 | Ga0495602_0112361_921_1904 | 326 |
| 1290 | 3300048903 | Ga0496100_0239829 | Ga0496100_0239829_311_1294 | 326 |
| 1291 | 3300048903 | Ga0496100_0361047 | Ga0496100_0361047_96_1079 | 326 |
| 1292 | 3300048904 | Ga0496101_0230194 | Ga0496101_0230194_443_1426 | 326 |
| 1293 | 3300048905 | Ga0496102_0001771 | Ga0496102_0001771_7452_8435 | 326 |
| 1294 | 3300048905 | Ga0496102_0236815 | Ga0496102_0236815_720_1703 | 326 |
| 1295 | 3300048906 | Ga0496103_0110315 | Ga0496103_0110315_511_1494 | 326 |
| 1296 | 3300048907 | Ga0496104_0009950 | Ga0496104_0009950_565_1545 | 326 |
| 1297 | 3300048907 | Ga0496104_0020613 | Ga0496104_0020613_1689_2672 | 326 |
| 1298 | 3300048907 | Ga0496104_0048391 | Ga0496104_0048391_173_1156 | 326 |
| 1299 | 3300048907 | Ga0496104_0136187 | Ga0496104_0136187_978_1961 | 326 |
| 1300 | 3300048907 | Ga0496104_0183454 | Ga0496104_0183454_999_1982 | 326 |
| 1301 | 3300048908 | Ga0496105_0009060 | Ga0496105_0009060_6042_7022 | 326 |
| 1302 | 3300048908 | Ga0496105_0011039 | Ga0496105_0011039_904_1887 | 326 |
| 1303 | 3300048908 | Ga0496105_0030405 | Ga0496105_0030405_2520_3503 | 326 |
| 1304 | 3300048908 | Ga0496105_0050186 | Ga0496105_0050186_1459_2442 | 326 |
| 1305 | 3300048908 | Ga0496105_0078455 | Ga0496105_0078455_523_1569 | 326 |
| 1306 | 3300048908 | Ga0496105_0265527 | Ga0496105_0265527_111_1094 | 326 |
| 1307 | 3300048909 | Ga0496106_0009997 | Ga0496106_0009997_3893_4876 | 326 |
| 1308 | 3300048909 | Ga0496106_0024362 | Ga0496106_0024362_628_1611 | 326 |
| 1309 | 3300048909 | Ga0496106_0075303 | Ga0496106_0075303_206_1189 | 326 |
| 1310 | 3300048909 | Ga0496106_0080447 | Ga0496106_0080447_195_1178 | 326 |
| 1311 | 3300048909 | Ga0496106_0144906 | Ga0496106_0144906_858_1841 | 326 |
| 1312 | 3300048910 | Ga0496107_0036192 | Ga0496107_0036192_1751_2734 | 326 |
| 1313 | 3300048910 | Ga0496107_0081293 | Ga0496107_0081293_841_1824 | 326 |
| 1314 | 3300048910 | Ga0496107_0087790 | Ga0496107_0087790_256_1239 | 326 |
| 1315 | 3300048910 | Ga0496107_0156403 | Ga0496107_0156403_236_1219 | 326 |
| 1316 | 3300048910 | Ga0496107_0250797 | Ga0496107_0250797_113_1096 | 326 |
| 1317 | 3300048910 | Ga0496107_0295121 | Ga0496107_0295121_202_1185 | 326 |
| 1318 | 3300048910 | Ga0496107_0360167 | Ga0496107_0360167_35_1018 | 326 |
| 1319 | 3300048911 | Ga0496108_0006149 | Ga0496108_0006149_4644_5624 | 326 |
| 1320 | 3300048911 | Ga0496108_0052308 | Ga0496108_0052308_214_1197 | 326 |
| 1321 | 3300048911 | Ga0496108_0066703 | Ga0496108_0066703_1350_2396 | 326 |
| 1322 | 3300048911 | Ga0496108_0171015 | Ga0496108_0171015_770_1750 | 326 |
| 1323 | 3300048911 | Ga0496108_0460371 | Ga0496108_0460371_33_1016 | 326 |
| 1324 | 3300048912 | Ga0496109_0003373 | Ga0496109_0003373_3973_4953 | 326 |
| 1325 | 3300048912 | Ga0496109_0031880 | Ga0496109_0031880_812_1795 | 326 |
| 1326 | 3300048912 | Ga0496109_0067050 | Ga0496109_0067050_1722_2768 | 326 |
| 1327 | 3300048912 | Ga0496109_0328347 | Ga0496109_0328347_123_1106 | 326 |
| 1328 | 3300048913 | Ga0496110_0004493 | Ga0496110_0004493_8269_9315 | 326 |
| 1329 | 3300048913 | Ga0496110_0055465 | Ga0496110_0055465_2202_3185 | 326 |
| 1330 | 3300048913 | Ga0496110_0060878 | Ga0496110_0060878_2002_2985 | 326 |
| 1331 | 3300048913 | Ga0496110_0111575 | Ga0496110_0111575_398_1381 | 326 |
| 1332 | 3300048913 | Ga0496110_0229981 | Ga0496110_0229981_25_1008 | 326 |
| 1333 | 3300048913 | Ga0496110_0266126 | Ga0496110_0266126_216_1196 | 326 |
| 1334 | 3300048913 | Ga0496110_0349744 | Ga0496110_0349744_327_1310 | 326 |
| 1335 | 3300048914 | Ga0496111_0029145 | Ga0496111_0029145_1975_2958 | 326 |
| 1336 | 3300048914 | Ga0496111_0039869 | Ga0496111_0039869_333_1316 | 326 |
| 1337 | 3300048914 | Ga0496111_0108886 | Ga0496111_0108886_322_1305 | 326 |
| 1338 | 3300048914 | Ga0496111_0239188 | Ga0496111_0239188_169_1215 | 326 |
| 1339 | 3300048914 | Ga0496111_0251845 | Ga0496111_0251845_135_1115 | 326 |
| 1340 | 3300048915 | Ga0496112_0000017 | Ga0496112_0000017_134086_135069 | 326 |
| 1341 | 3300048915 | Ga0496112_0013582 | Ga0496112_0013582_4698_5681 | 326 |
| 1342 | 3300048915 | Ga0496112_0017643 | Ga0496112_0017643_5054_6037 | 326 |
| 1343 | 3300048915 | Ga0496112_0019263 | Ga0496112_0019263_849_1832 | 326 |
| 1344 | 3300048915 | Ga0496112_0023520 | Ga0496112_0023520_3372_4418 | 326 |
| 1345 | 3300048915 | Ga0496112_0137365 | Ga0496112_0137365_93_1073 | 326 |
| 1346 | 3300048915 | Ga0496112_0258947 | Ga0496112_0258947_89_1072 | 326 |
| 1347 | 3300048916 | Ga0496113_0011007 | Ga0496113_0011007_62_1042 | 326 |
| 1348 | 3300048916 | Ga0496113_0031143 | Ga0496113_0031143_433_1479 | 326 |
| 1349 | 3300048916 | Ga0496113_0071067 | Ga0496113_0071067_1559_2542 | 326 |
| 1350 | 3300048916 | Ga0496113_0098584 | Ga0496113_0098584_337_1320 | 326 |
| 1351 | 3300048916 | Ga0496113_0111346 | Ga0496113_0111346_1060_2043 | 326 |
| 1352 | 3300048916 | Ga0496113_0117920 | Ga0496113_0117920_304_1287 | 326 |
| 1353 | 3300048917 | Ga0496114_0011547 | Ga0496114_0011547_3042_4088 | 326 |
| 1354 | 3300048917 | Ga0496114_0075593 | Ga0496114_0075593_401_1384 | 326 |
| 1355 | 3300048918 | Ga0496115_0000535 | Ga0496115_0000535_26500_27483 | 326 |
| 1356 | 3300048918 | Ga0496115_0002841 | Ga0496115_0002841_794_1840 | 326 |
| 1357 | 3300048918 | Ga0496115_0019252 | Ga0496115_0019252_4170_5150 | 326 |
| 1358 | 3300048918 | Ga0496115_0034965 | Ga0496115_0034965_2362_3345 | 326 |
| 1359 | 3300048918 | Ga0496115_0281783 | Ga0496115_0281783_172_1155 | 326 |
| 1360 | 3300048918 | Ga0496115_0323774 | Ga0496115_0323774_184_1167 | 326 |
| 1361 | 3300048919 | Ga0496116_0003125 | Ga0496116_0003125_10966_11949 | 326 |
| 1362 | 3300048919 | Ga0496116_0040044 | Ga0496116_0040044_1324_2307 | 326 |
| 1363 | 3300048920 | Ga0496117_0030138 | Ga0496117_0030138_3155_4138 | 326 |
| 1364 | 3300048920 | Ga0496117_0035196 | Ga0496117_0035196_920_1903 | 326 |
| 1365 | 3300048920 | Ga0496117_0040628 | Ga0496117_0040628_539_1519 | 326 |
| 1366 | 3300048920 | Ga0496117_0118917 | Ga0496117_0118917_32_1015 | 326 |
| 1367 | 3300048920 | Ga0496117_0208330 | Ga0496117_0208330_62_1045 | 326 |
| 1368 | 3300048921 | Ga0496118_0003407 | Ga0496118_0003407_12871_13854 | 326 |
| 1369 | 3300048921 | Ga0496118_0046295 | Ga0496118_0046295_140_1123 | 326 |
| 1370 | 3300048921 | Ga0496118_0069280 | Ga0496118_0069280_1275_2258 | 326 |
| 1371 | 3300048921 | Ga0496118_0088763 | Ga0496118_0088763_579_1559 | 326 |
| 1372 | 3300048922 | Ga0496119_0001101 | Ga0496119_0001101_26007_26987 | 326 |
| 1373 | 3300048922 | Ga0496119_0007752 | Ga0496119_0007752_990_1973 | 326 |
| 1374 | 3300048922 | Ga0496119_0008841 | Ga0496119_0008841_3831_4811 | 326 |
| 1375 | 3300048922 | Ga0496119_0103668 | Ga0496119_0103668_200_1183 | 326 |
| 1376 | 3300048922 | Ga0496119_0117286 | Ga0496119_0117286_11_991 | 326 |
| 1377 | 3300048922 | Ga0496119_0167292 | Ga0496119_0167292_150_1133 | 326 |
| 1378 | 3300048923 | Ga0496120_0001458 | Ga0496120_0001458_21468_22448 | 326 |
| 1379 | 3300048923 | Ga0496120_0009210 | Ga0496120_0009210_410_1390 | 326 |
| 1380 | 3300048923 | Ga0496120_0073827 | Ga0496120_0073827_704_1684 | 326 |
| 1381 | 3300048923 | Ga0496120_0138924 | Ga0496120_0138924_130_1113 | 326 |
| 1382 | 3300048924 | Ga0496121_0000230 | Ga0496121_0000230_71970_72953 | 326 |
| 1383 | 3300048924 | Ga0496121_0004694 | Ga0496121_0004694_10581_11564 | 326 |
| 1384 | 3300048924 | Ga0496121_0017764 | Ga0496121_0017764_5666_6649 | 326 |
| 1385 | 3300048924 | Ga0496121_0024355 | Ga0496121_0024355_1676_2659 | 326 |
| 1386 | 3300048924 | Ga0496121_0041666 | Ga0496121_0041666_2898_3878 | 326 |
| 1387 | 3300048924 | Ga0496121_0080840 | Ga0496121_0080840_511_1494 | 326 |
| 1388 | 3300048924 | Ga0496121_0091769 | Ga0496121_0091769_1121_2104 | 326 |
| 1389 | 3300048924 | Ga0496121_0125237 | Ga0496121_0125237_179_1189 | 326 |
| 1390 | 3300048924 | Ga0496121_0169240 | Ga0496121_0169240_465_1448 | 326 |
| 1391 | 3300048924 | Ga0496121_0192443 | Ga0496121_0192443_212_1195 | 326 |
| 1392 | 3300048925 | Ga0496122_0030277 | Ga0496122_0030277_2449_3429 | 326 |
| 1393 | 3300048925 | Ga0496122_0038492 | Ga0496122_0038492_915_1898 | 326 |
| 1394 | 3300048925 | Ga0496122_0073006 | Ga0496122_0073006_941_1924 | 326 |
| 1395 | 3300048925 | Ga0496122_0125370 | Ga0496122_0125370_182_1165 | 326 |
| 1396 | 3300048926 | Ga0496123_0037892 | Ga0496123_0037892_2169_3149 | 326 |
| 1397 | 3300048926 | Ga0496123_0041691 | Ga0496123_0041691_265_1248 | 326 |
| 1398 | 3300048927 | Ga0496124_0025798 | Ga0496124_0025798_161_1141 | 326 |
| 1399 | 3300048927 | Ga0496124_0027163 | Ga0496124_0027163_1487_2470 | 326 |
| 1400 | 3300048927 | Ga0496124_0133515 | Ga0496124_0133515_550_1530 | 326 |
| 1401 | 3300048928 | Ga0496125_0000040 | Ga0496125_0000040_16403_17386 | 326 |
| 1402 | 3300048928 | Ga0496125_0004755 | Ga0496125_0004755_10346_11329 | 326 |
| 1403 | 3300048928 | Ga0496125_0022192 | Ga0496125_0022192_2658_3641 | 326 |
| 1404 | 3300048928 | Ga0496125_0070258 | Ga0496125_0070258_1676_2659 | 326 |
| 1405 | 3300048928 | Ga0496125_0089522 | Ga0496125_0089522_691_1674 | 326 |
| 1406 | 3300048928 | Ga0496125_0165961 | Ga0496125_0165961_189_1172 | 326 |
| 1407 | 3300048928 | Ga0496125_0197085 | Ga0496125_0197085_214_1197 | 326 |
| 1408 | 3300048928 | Ga0496125_0252256 | Ga0496125_0252256_89_1072 | 326 |
| 1409 | 3300048929 | Ga0496126_0002483 | Ga0496126_0002483_3543_4526 | 326 |
| 1410 | 3300048929 | Ga0496126_0005712 | Ga0496126_0005712_43_1026 | 326 |
| 1411 | 3300048929 | Ga0496126_0012513 | Ga0496126_0012513_960_1943 | 326 |
| 1412 | 3300048929 | Ga0496126_0024496 | Ga0496126_0024496_4761_5741 | 326 |
| 1413 | 3300048929 | Ga0496126_0026298 | Ga0496126_0026298_4429_5412 | 326 |
| 1414 | 3300048929 | Ga0496126_0037757 | Ga0496126_0037757_3433_4416 | 326 |
| 1415 | 3300048929 | Ga0496126_0082588 | Ga0496126_0082588_1385_2368 | 326 |
| 1416 | 3300048929 | Ga0496126_0102216 | Ga0496126_0102216_295_1275 | 326 |
| 1417 | 3300048929 | Ga0496126_0113178 | Ga0496126_0113178_407_1390 | 326 |
| 1418 | 3300048929 | Ga0496126_0209858 | Ga0496126_0209858_354_1337 | 326 |
| 1419 | 3300049460 | Ga0495682_0026404 | Ga0495682_0026404_869_1852 | 326 |
| 1420 | 3300049460 | Ga0495682_0046817 | Ga0495682_0046817_506_1486 | 326 |
| 1421 | 3300049568 | Ga0501031_0000007 | Ga0501031_0000007_126216_127196 | 326 |
| 1422 | 3300049568 | Ga0501031_0008668 | Ga0501031_0008668_4402_5385 | 326 |
| 1423 | 3300049568 | Ga0501031_0029381 | Ga0501031_0029381_2468_3451 | 326 |
| 1424 | 3300049568 | Ga0501031_0153083 | Ga0501031_0153083_465_1445 | 326 |
| 1425 | 3300049569 | Ga0501032_0000007 | Ga0501032_0000007_38813_39793 | 326 |
| 1426 | 3300049569 | Ga0501032_0000107 | Ga0501032_0000107_46545_47528 | 326 |
| 1427 | 3300049569 | Ga0501032_0003811 | Ga0501032_0003811_10279_11259 | 326 |
| 1428 | 3300049569 | Ga0501032_0256784 | Ga0501032_0256784_20_1000 | 326 |
| 1429 | 3300049570 | Ga0501033_0000040 | Ga0501033_0000040_102794_103774 | 326 |
| 1430 | 3300049570 | Ga0501033_0000144 | Ga0501033_0000144_33325_34308 | 326 |
| 1431 | 3300049570 | Ga0501033_0000311 | Ga0501033_0000311_11614_12597 | 326 |
| 1432 | 3300049570 | Ga0501033_0000377 | Ga0501033_0000377_15068_16048 | 326 |
| 1433 | 3300049570 | Ga0501033_0009009 | Ga0501033_0009009_3619_4599 | 326 |
| 1434 | 3300049570 | Ga0501033_0024192 | Ga0501033_0024192_440_1420 | 326 |
| 1435 | 3300049570 | Ga0501033_0123389 | Ga0501033_0123389_697_1677 | 326 |
| 1436 | 3300049570 | Ga0501033_0240288 | Ga0501033_0240288_164_1144 | 326 |
| 1437 | 3300049570 | Ga0501033_0258130 | Ga0501033_0258130_50_1033 | 326 |
| 1438 | 3300049571 | Ga0501034_0000029 | Ga0501034_0000029_214089_215069 | 326 |
| 1439 | 3300049571 | Ga0501034_0000039 | Ga0501034_0000039_223058_224041 | 326 |
| 1440 | 3300049571 | Ga0501034_0000340 | Ga0501034_0000340_47634_48614 | 326 |
| 1441 | 3300049571 | Ga0501034_0000412 | Ga0501034_0000412_32918_33901 | 326 |
| 1442 | 3300049571 | Ga0501034_0042626 | Ga0501034_0042626_1635_2615 | 326 |
| 1443 | 3300049571 | Ga0501034_0083900 | Ga0501034_0083900_489_1469 | 326 |
| 1444 | 3300049571 | Ga0501034_0159669 | Ga0501034_0159669_97_1077 | 326 |
| 1445 | 3300049571 | Ga0501034_0224874 | Ga0501034_0224874_393_1373 | 326 |
| 1446 | 3300049571 | Ga0501034_0260170 | Ga0501034_0260170_155_1135 | 326 |
| 1447 | 3300049572 | Ga0501036_0000004 | Ga0501036_0000004_214089_215069 | 326 |
| 1448 | 3300049572 | Ga0501036_0000007 | Ga0501036_0000007_143618_144601 | 326 |
| 1449 | 3300049572 | Ga0501036_0000127 | Ga0501036_0000127_13448_14431 | 326 |
| 1450 | 3300049572 | Ga0501036_0017468 | Ga0501036_0017468_1789_2769 | 326 |
| 1451 | 3300049573 | Ga0501037_0000004 | Ga0501037_0000004_38813_39793 | 326 |
| 1452 | 3300049573 | Ga0501037_0000025 | Ga0501037_0000025_125627_126610 | 326 |
| 1453 | 3300049573 | Ga0501037_0000066 | Ga0501037_0000066_37857_38840 | 326 |
| 1454 | 3300049573 | Ga0501037_0000198 | Ga0501037_0000198_38882_39862 | 326 |
| 1455 | 3300049573 | Ga0501037_0178247 | Ga0501037_0178247_242_1222 | 326 |
| 1456 | 3300049574 | Ga0501038_0000005 | Ga0501038_0000005_214089_215069 | 326 |
| 1457 | 3300049574 | Ga0501038_0000026 | Ga0501038_0000026_3913_4896 | 326 |
| 1458 | 3300049574 | Ga0501038_0000342 | Ga0501038_0000342_34550_35533 | 326 |
| 1459 | 3300049574 | Ga0501038_0048255 | Ga0501038_0048255_1030_2010 | 326 |
| 1460 | 3300049575 | Ga0501039_0000005 | Ga0501039_0000005_107590_108573 | 326 |
| 1461 | 3300049575 | Ga0501039_0000009 | Ga0501039_0000009_214089_215069 | 326 |
| 1462 | 3300049575 | Ga0501039_0000840 | Ga0501039_0000840_5571_6554 | 326 |
| 1463 | 3300049575 | Ga0501039_0128660 | Ga0501039_0128660_289_1269 | 326 |
| 1464 | 3300049575 | Ga0501039_0205172 | Ga0501039_0205172_544_1524 | 326 |
| 1465 | 3300049576 | Ga0501040_0000754 | Ga0501040_0000754_6603_7583 | 326 |
| 1466 | 3300049579 | Ga0501043_0000036 | Ga0501043_0000036_47796_48779 | 326 |
| 1467 | 3300049579 | Ga0501043_0000100 | Ga0501043_0000100_69989_70969 | 326 |
| 1468 | 3300049579 | Ga0501043_0000120 | Ga0501043_0000120_31430_32413 | 326 |
| 1469 | 3300049579 | Ga0501043_0000836 | Ga0501043_0000836_10511_11491 | 326 |
| 1470 | 3300049579 | Ga0501043_0050992 | Ga0501043_0050992_259_1239 | 326 |
| 1471 | 3300049579 | Ga0501043_0056514 | Ga0501043_0056514_1766_2746 | 326 |
| 1472 | 3300049579 | Ga0501043_0141832 | Ga0501043_0141832_456_1436 | 326 |
| 1473 | 3300049580 | Ga0501046_0000359 | Ga0501046_0000359_13467_14450 | 326 |
| 1474 | 3300049580 | Ga0501046_0002399 | Ga0501046_0002399_10354_11337 | 326 |
| 1475 | 3300049580 | Ga0501046_0062699 | Ga0501046_0062699_155_1138 | 326 |
| 1476 | 3300049580 | Ga0501046_0164346 | Ga0501046_0164346_433_1413 | 326 |
| 1477 | 3300049581 | Ga0501047_0000209 | Ga0501047_0000209_66320_67303 | 326 |
| 1478 | 3300049581 | Ga0501047_0000379 | Ga0501047_0000379_3403_4386 | 326 |
| 1479 | 3300049581 | Ga0501047_0000895 | Ga0501047_0000895_3473_4453 | 326 |
| 1480 | 3300049581 | Ga0501047_0007647 | Ga0501047_0007647_2827_3807 | 326 |
| 1481 | 3300049581 | Ga0501047_0022062 | Ga0501047_0022062_2723_3706 | 326 |
| 1482 | 3300049581 | Ga0501047_0117808 | Ga0501047_0117808_1344_2324 | 326 |
| 1483 | 3300049581 | Ga0501047_0209162 | Ga0501047_0209162_619_1602 | 326 |
| 1484 | 3300049582 | Ga0501048_0000352 | Ga0501048_0000352_21606_22589 | 326 |
| 1485 | 3300049582 | Ga0501048_0004356 | Ga0501048_0004356_7770_8753 | 326 |
| 1486 | 3300049583 | Ga0501067_0000025 | Ga0501067_0000025_12030_13013 | 326 |
| 1487 | 3300049583 | Ga0501067_0048682 | Ga0501067_0048682_102_1085 | 326 |
| 1488 | 3300049583 | Ga0501067_0160307 | Ga0501067_0160307_136_1119 | 326 |
| 1489 | 3300049584 | Ga0501068_0000801 | Ga0501068_0000801_7899_8882 | 326 |
| 1490 | 3300049584 | Ga0501068_0001230 | Ga0501068_0001230_11000_11983 | 326 |
| 1491 | 3300049584 | Ga0501068_0024081 | Ga0501068_0024081_1485_2465 | 326 |
| 1492 | 3300049585 | Ga0501069_0000020 | Ga0501069_0000020_37094_38074 | 326 |
| 1493 | 3300049585 | Ga0501069_0001694 | Ga0501069_0001694_9609_10592 | 326 |
| 1494 | 3300049585 | Ga0501069_0016353 | Ga0501069_0016353_19_1002 | 326 |
| 1495 | 3300049586 | Ga0501070_0000174 | Ga0501070_0000174_16046_17026 | 326 |
| 1496 | 3300049586 | Ga0501070_0002185 | Ga0501070_0002185_6243_7226 | 326 |
| 1497 | 3300049586 | Ga0501070_0005683 | Ga0501070_0005683_7411_8391 | 326 |
| 1498 | 3300049586 | Ga0501070_0011186 | Ga0501070_0011186_3929_4909 | 326 |
| 1499 | 3300049586 | Ga0501070_0069472 | Ga0501070_0069472_937_1917 | 326 |
| 1500 | 3300049586 | Ga0501070_0176217 | Ga0501070_0176217_662_1642 | 326 |
| 1501 | 3300049587 | Ga0501071_0017012 | Ga0501071_0017012_3646_4626 | 326 |
| 1502 | 3300049588 | Ga0501072_0149146 | Ga0501072_0149146_548_1528 | 326 |
| 1503 | 3300049589 | Ga0501073_0000070 | Ga0501073_0000070_55536_56519 | 326 |
| 1504 | 3300049589 | Ga0501073_0000091 | Ga0501073_0000091_12805_13788 | 326 |
| 1505 | 3300049589 | Ga0501073_0015856 | Ga0501073_0015856_2682_3662 | 326 |
| 1506 | 3300049589 | Ga0501073_0021242 | Ga0501073_0021242_734_1714 | 326 |
| 1507 | 3300049590 | Ga0501074_0000015 | Ga0501074_0000015_39249_40229 | 326 |
| 1508 | 3300049590 | Ga0501074_0000489 | Ga0501074_0000489_11733_12716 | 326 |
| 1509 | 3300049590 | Ga0501074_0001218 | Ga0501074_0001218_10569_11552 | 326 |
| 1510 | 3300049590 | Ga0501074_0120763 | Ga0501074_0120763_429_1409 | 326 |
| 1511 | 3300049591 | Ga0501075_0045965 | Ga0501075_0045965_1643_2668 | 326 |
| 1512 | 3300049592 | Ga0501076_0118741 | Ga0501076_0118741_980_2005 | 326 |
| 1513 | 3300049741 | Ga0501079_0096719 | Ga0501079_0096719_989_2014 | 326 |
| 1514 | 3300049742 | Ga0501080_0000132 | Ga0501080_0000132_5564_6547 | 326 |
| 1515 | 3300049742 | Ga0501080_0000321 | Ga0501080_0000321_24606_25589 | 326 |
| 1516 | 3300049742 | Ga0501080_0026275 | Ga0501080_0026275_1540_2523 | 326 |
| 1517 | 3300049742 | Ga0501080_0080954 | Ga0501080_0080954_1640_2632 | 326 |
| 1518 | 3300049742 | Ga0501080_0146807 | Ga0501080_0146807_433_1413 | 326 |
| 1519 | 3300049742 | Ga0501080_0252213 | Ga0501080_0252213_333_1313 | 326 |
| 1520 | 3300049743 | Ga0501081_0124769 | Ga0501081_0124769_360_1385 | 326 |
| 1521 | 3300049744 | Ga0501083_0000284 | Ga0501083_0000284_24024_25007 | 326 |
| 1522 | 3300049744 | Ga0501083_0151276 | Ga0501083_0151276_276_1256 | 326 |
| 1523 | 3300049744 | Ga0501083_0193412 | Ga0501083_0193412_263_1249 | 326 |
| 1524 | 3300049822 | Ga0501035_0000014 | Ga0501035_0000014_214089_215069 | 326 |
| 1525 | 3300049822 | Ga0501035_0000016 | Ga0501035_0000016_49573_50556 | 326 |
| 1526 | 3300049822 | Ga0501035_0000070 | Ga0501035_0000070_84522_85502 | 326 |
| 1527 | 3300049822 | Ga0501035_0000346 | Ga0501035_0000346_23234_24214 | 326 |
| 1528 | 3300049822 | Ga0501035_0001251 | Ga0501035_0001251_23234_24217 | 326 |
| 1529 | 3300049822 | Ga0501035_0001605 | Ga0501035_0001605_11876_12856 | 326 |
| 1530 | 3300049822 | Ga0501035_0011180 | Ga0501035_0011180_356_1336 | 326 |
| 1531 | 3300049822 | Ga0501035_0025723 | Ga0501035_0025723_1665_2645 | 326 |
| 1532 | 3300049822 | Ga0501035_0225697 | Ga0501035_0225697_33_1013 | 326 |
| 1533 | 3300049822 | Ga0501035_0361460 | Ga0501035_0361460_80_1063 | 326 |
| 1534 | 3300049823 | Ga0501044_0000012 | Ga0501044_0000012_38813_39793 | 326 |
| 1535 | 3300049823 | Ga0501044_0000037 | Ga0501044_0000037_77170_78150 | 326 |
| 1536 | 3300049823 | Ga0501044_0000274 | Ga0501044_0000274_47988_48971 | 326 |
| 1537 | 3300049823 | Ga0501044_0000383 | Ga0501044_0000383_20157_21140 | 326 |
| 1538 | 3300049823 | Ga0501044_0024200 | Ga0501044_0024200_478_1458 | 326 |
| 1539 | 3300049823 | Ga0501044_0057358 | Ga0501044_0057358_1673_2653 | 326 |
| 1540 | 3300049823 | Ga0501044_0066220 | Ga0501044_0066220_1594_2574 | 326 |
| 1541 | 3300049823 | Ga0501044_0090497 | Ga0501044_0090497_164_1147 | 326 |
| 1542 | 3300049823 | Ga0501044_0102592 | Ga0501044_0102592_1116_2096 | 326 |
| 1543 | 3300049823 | Ga0501044_0158683 | Ga0501044_0158683_378_1361 | 326 |
| 1544 | 3300049823 | Ga0501044_0202591 | Ga0501044_0202591_738_1718 | 326 |
| 1545 | 3300049824 | Ga0501045_0020164 | Ga0501045_0020164_2058_3041 | 326 |
| 1546 | 3300050489 | nmdc:mga03683_48412_c1 | nmdc:mga03683_48412_c1_149_1129 | 326 |
| 1547 | 3300050490 | nmdc:mga03n38_121304_c1 | nmdc:mga03n38_121304_c1_18_998 | 326 |
| 1548 | 3300050490 | nmdc:mga03n38_2341_c1 | nmdc:mga03n38_2341_c1_4007_4990 | 326 |
| 1549 | 3300050490 | nmdc:mga03n38_84717_c1 | nmdc:mga03n38_84717_c1_162_1145 | 326 |
| 1550 | 3300050491 | nmdc:mga00v17_29763_c1 | nmdc:mga00v17_29763_c1_1227_2210 | 326 |
| 1551 | 3300050491 | nmdc:mga00v17_60502_c1 | nmdc:mga00v17_60502_c1_762_1745 | 326 |
| 1552 | 3300050492 | nmdc:mga0yw44_247562_c1 | nmdc:mga0yw44_247562_c1_161_1144 | 326 |
| 1553 | 3300050492 | nmdc:mga0yw44_72110_c1 | nmdc:mga0yw44_72110_c1_31_1014 | 326 |
| 1554 | 3300050494 | nmdc:mga06z11_101586_c1 | nmdc:mga06z11_101586_c1_148_1131 | 326 |
| 1555 | 3300050494 | nmdc:mga06z11_246042_c1 | nmdc:mga06z11_246042_c1_24_1007 | 326 |
| 1556 | 3300050494 | nmdc:mga06z11_4265_c1 | nmdc:mga06z11_4265_c1_257_1240 | 326 |
| 1557 | 3300050494 | nmdc:mga06z11_78986_c2 | nmdc:mga06z11_78986_c2_103_1086 | 326 |
| 1558 | 3300050495 | nmdc:mga04h51_1143_c1 | nmdc:mga04h51_1143_c1_1296_2279 | 326 |
| 1559 | 3300050496 | nmdc:mga07m45_38017_c1 | nmdc:mga07m45_38017_c1_1331_2314 | 326 |
| 1560 | 3300050496 | nmdc:mga07m45_745_c1 | nmdc:mga07m45_745_c1_7262_8245 | 326 |
| 1561 | 3300050507 | nmdc:mga05p37_196560_c1 | nmdc:mga05p37_196560_c1_1357_2340 | 326 |
| 1562 | 3300050508 | nmdc:mga09592_18338_c1 | nmdc:mga09592_18338_c1_229_1212 | 326 |
| 1563 | 3300050509 | nmdc:mga0qj67_76787_c1 | nmdc:mga0qj67_76787_c1_185_1168 | 326 |
| 1564 | 3300050510 | nmdc:mga06r32_1860_c1 | nmdc:mga06r32_1860_c1_8625_9608 | 326 |
| 1565 | 3300050512 | nmdc:mga0n895_44891_c1 | nmdc:mga0n895_44891_c1_1555_2538 | 326 |
| 1566 | 3300050513 | nmdc:mga0rr50_459721_c1 | nmdc:mga0rr50_459721_c1_80_1063 | 326 |
| 1567 | 3300050514 | nmdc:mga08x19_102727_c1 | nmdc:mga08x19_102727_c1_270_1253 | 326 |
| 1568 | 3300050516 | nmdc:mga0sz30_1713_c1 | nmdc:mga0sz30_1713_c1_5680_6660 | 326 |
| 1569 | 3300050516 | nmdc:mga0sz30_23321_c1 | nmdc:mga0sz30_23321_c1_1240_2220 | 326 |
| 1570 | 3300050516 | nmdc:mga0sz30_24928_c1 | nmdc:mga0sz30_24928_c1_910_1893 | 326 |
| 1571 | 3300050516 | nmdc:mga0sz30_45346_c1 | nmdc:mga0sz30_45346_c1_601_1584 | 326 |
| 1572 | 3300053077 | Ga0495601_0158215 | Ga0495601_0158215_268_1251 | 326 |
| 1573 | 3300053077 | Ga0495601_0256864 | Ga0495601_0256864_115_1098 | 326 |
| 1574 | 3300053080 | Ga0500635_0075124 | Ga0500635_0075124_84_1067 | 326 |
| 1575 | 3300053084 | Ga0495595_0006301 | Ga0495595_0006301_3337_4320 | 326 |
| 1576 | 3300053084 | Ga0495595_0053818 | Ga0495595_0053818_577_1560 | 326 |
| 1577 | 3300053086 | Ga0500578_0168169 | Ga0500578_0168169_92_1075 | 326 |
| 1578 | 3300053087 | Ga0500643_000456 | Ga0500643_000456_14927_15910 | 326 |
| 1579 | 3300053090 | Ga0500646_0008495 | Ga0500646_0008495_1267_2250 | 326 |
| 1580 | 3300053093 | Ga0500651_0069381 | Ga0500651_0069381_186_1169 | 326 |
| 1581 | 3300053094 | Ga0500566_0000370 | Ga0500566_0000370_9698_10681 | 326 |
| 1582 | 3300053094 | Ga0500566_0006011 | Ga0500566_0006011_3320_4303 | 326 |
| 1583 | 3300053094 | Ga0500566_0006917 | Ga0500566_0006917_955_1938 | 326 |
| 1584 | 3300053094 | Ga0500566_0040773 | Ga0500566_0040773_1023_2006 | 326 |
| 1585 | 3300053095 | Ga0500640_013671 | Ga0500640_013671_1388_2371 | 326 |
| 1586 | 3300053096 | Ga0500641_0002674 | Ga0500641_0002674_3267_4250 | 326 |
| 1587 | 3300053096 | Ga0500641_0027454 | Ga0500641_0027454_1024_2007 | 326 |
| 1588 | 3300053098 | Ga0500650_0000365 | Ga0500650_0000365_7121_8104 | 326 |
| 1589 | 3300053098 | Ga0500650_0036142 | Ga0500650_0036142_1155_2138 | 326 |
| 1590 | 3300053102 | Ga0500554_004225 | Ga0500554_004225_1988_2971 | 326 |
| 1591 | 3300053103 | Ga0500555_003144 | Ga0500555_003144_703_1686 | 326 |
| 1592 | 3300053104 | Ga0500556_0044111 | Ga0500556_0044111_180_1163 | 326 |
| 1593 | 3300053105 | Ga0500557_000003 | Ga0500557_000003_12149_13132 | 326 |
| 1594 | 3300053109 | Ga0500569_021582 | Ga0500569_021582_610_1593 | 326 |
| 1595 | 3300053111 | Ga0500572_000024 | Ga0500572_000024_6970_7953 | 326 |
| 1596 | 3300053119 | Ga0500595_000537 | Ga0500595_000537_1168_2151 | 326 |
| 1597 | 3300053119 | Ga0500595_003301 | Ga0500595_003301_105_1088 | 326 |
| 1598 | 3300053119 | Ga0500595_009837 | Ga0500595_009837_71_1054 | 326 |
| 1599 | 3300053119 | Ga0500595_016895 | Ga0500595_016895_674_1657 | 326 |
| 1600 | 3300053119 | Ga0500595_022156 | Ga0500595_022156_1252_2235 | 326 |
| 1601 | 3300053122 | Ga0500608_000807 | Ga0500608_000807_1003_1986 | 326 |
| 1602 | 3300053122 | Ga0500608_001300 | Ga0500608_001300_4329_5312 | 326 |
| 1603 | 3300053122 | Ga0500608_099345 | Ga0500608_099345_48_1028 | 326 |
| 1604 | 3300053125 | Ga0500618_000334 | Ga0500618_000334_13662_14642 | 326 |
| 1605 | 3300053130 | Ga0500642_0000019 | Ga0500642_0000019_141115_142098 | 326 |
| 1606 | 3300053130 | Ga0500642_0000252 | Ga0500642_0000252_14026_15009 | 326 |
| 1607 | 3300053133 | Ga0500655_005108 | Ga0500655_005108_1263_2246 | 326 |
| 1608 | 3300053136 | Ga0500559_0001011 | Ga0500559_0001011_6912_7895 | 326 |
| 1609 | 3300053136 | Ga0500559_0003877 | Ga0500559_0003877_724_1707 | 326 |
| 1610 | 3300053139 | Ga0500568_0001665 | Ga0500568_0001665_5060_6043 | 326 |
| 1611 | 3300053142 | Ga0500577_0000833 | Ga0500577_0000833_206_1189 | 326 |
| 1612 | 3300053145 | Ga0500586_000414 | Ga0500586_000414_4385_5368 | 326 |
| 1613 | 3300053148 | Ga0500590_000050 | Ga0500590_000050_705_1685 | 326 |
| 1614 | 3300053148 | Ga0500590_017662 | Ga0500590_017662_28_1011 | 326 |
| 1615 | 3300053148 | Ga0500590_047558 | Ga0500590_047558_1099_2082 | 326 |
| 1616 | 3300053150 | Ga0500603_000391 | Ga0500603_000391_41_1024 | 326 |
| 1617 | 3300053150 | Ga0500603_000801 | Ga0500603_000801_3423_4406 | 326 |
| 1618 | 3300053151 | Ga0500604_0001275 | Ga0500604_0001275_5728_6711 | 326 |
| 1619 | 3300053151 | Ga0500604_0059581 | Ga0500604_0059581_171_1154 | 326 |
| 1620 | 3300053153 | Ga0500616_0000041 | Ga0500616_0000041_10589_11572 | 326 |
| 1621 | 3300053153 | Ga0500616_0000210 | Ga0500616_0000210_43806_44786 | 326 |
| 1622 | 3300053153 | Ga0500616_0046158 | Ga0500616_0046158_935_1915 | 326 |
| 1623 | 3300053155 | Ga0500620_000042 | Ga0500620_000042_4551_5531 | 326 |
| 1624 | 3300053156 | Ga0500622_0002498 | Ga0500622_0002498_2567_3550 | 326 |
| 1625 | 3300053158 | Ga0500627_0029367 | Ga0500627_0029367_143_1126 | 326 |
| 1626 | 3300053158 | Ga0500627_0069753 | Ga0500627_0069753_259_1239 | 326 |
| 1627 | 3300053159 | Ga0500630_000112 | Ga0500630_000112_15373_16356 | 326 |
| 1628 | 3300053161 | Ga0500634_0033049 | Ga0500634_0033049_990_1973 | 326 |
| 1629 | 3300053162 | Ga0500638_047219 | Ga0500638_047219_47_1093 | 326 |
| 1630 | 3300053162 | Ga0500638_068958 | Ga0500638_068958_40_1023 | 326 |
| 1631 | 3300053163 | Ga0500639_000040 | Ga0500639_000040_30135_31118 | 326 |
| 1632 | 3300053177 | Ga0500636_0000365 | Ga0500636_0000365_10083_11066 | 326 |
| 1633 | 3300053177 | Ga0500636_0012982 | Ga0500636_0012982_3703_4686 | 326 |
| 1634 | 3300053177 | Ga0500636_0036809 | Ga0500636_0036809_209_1189 | 326 |
| 1635 | 3300053177 | Ga0500636_0064889 | Ga0500636_0064889_357_1337 | 326 |
| 1636 | 3300053178 | Ga0500637_0000042 | Ga0500637_0000042_11468_12451 | 326 |
| 1637 | 3300053178 | Ga0500637_0002167 | Ga0500637_0002167_7572_8555 | 326 |
| 1638 | 3300053724 | Ga0500570_082598 | Ga0500570_082598_367_1350 | 326 |
| 1639 | 3300053729 | Ga0500625_009292 | Ga0500625_009292_1819_2802 | 326 |
| 1640 | 3300053730 | Ga0500645_039063 | Ga0500645_039063_20_1003 | 326 |
| 1641 | 3300053735 | Ga0500596_000794 | Ga0500596_000794_2979_3962 | 326 |
| 1642 | 3300053736 | Ga0500599_007283 | Ga0500599_007283_397_1380 | 326 |
| 1643 | 3300054114 | Ga0501084_0104186 | Ga0501084_0104186_204_1184 | 326 |
| 1644 | 3300055283 | Ga0500661_000056 | Ga0500661_000056_5496_6479 | 326 |
| 1645 | 3300055283 | Ga0500661_015268 | Ga0500661_015268_68_1051 | 326 |
| 1646 | 3300060353 | Ga0501082_0040063 | Ga0501082_0040063_2153_3178 | 326 |
| 1647 | 3300061734 | Ga0530510_0057533 | Ga0530510_0057533_902_1927 | 326 |
| 1648 | iso_pu_bacteria | 2513237102 | 2513705469 | 326 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4z6o-assembly1.cif.gz_B | structure of h200e variant of homoprotocatechuate 2,3-dioxygenase from b.fuscum in complex with hpca at 1.63 ang resolution | 0.9339 | 3 | 320 |
| 4z6v-assembly1.cif.gz_B | structure of h200q variant of homoprotocatechuate 2,3-dioxygenase from b.fuscum in complex with 4-nitrocatechol at 1.37 ang resolution | 0.9319 | 2 | 320 |
| 5bwg-assembly1.cif.gz_D | structure of h200c variant of homoprotocatechuate 2,3-dioxygenase from b.fuscum at 1.75 ang resolution | 0.9313 | 2 | 320 |
| 4z6q-assembly1.cif.gz_B | structure of h200n variant of homoprotocatechuate 2,3-dioxygenase from b.fuscum in complex with hpca at 1.57 ang resolution | 0.9308 | 2 | 320 |
| 4ghh-assembly1.cif.gz_A | structure of homoprotocatechuate 2,3-dioxygenase from b.fuscum in complex with 4-nitrocatechol at 1.55 ang resolution | 0.9286 | 3 | 320 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1mpyD01 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9379 | 13 | 130 | 3.10.180.10 |
| 1q0cA02 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9271 | 148 | 307 | 3.10.180.10 |
| 3b59D01 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9256 | 12 | 127 | 3.10.180.10 |
| 1f1yA02 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9255 | 148 | 286 | 3.10.180.10 |
| 5zszA01 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9238 | 14 | 133 | 3.10.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A440FXN8-F1-model_v4 | deleted | 0.9917 | 1 | 186 |
|
| AF-A0A5R2N7E1-F1-model_v4 | 3,4-dihydroxyphenylacetate 2,3-dioxygenase | 0.9912 | 1 | 175 |
GO:0004462
GO:0046872 GO:0051213 |
| AF-A0A5R2N7E1-F1-model_v4 | 3,4-dihydroxyphenylacetate 2,3-dioxygenase | 0.9856 | 1 | 175 |
GO:0004462
GO:0046872 GO:0051213 |
| AF-A0A350AGD8-F1-model_v4 | 3,4-dihydroxyphenylacetate 2,3-dioxygenase | 0.9818 | 1 | 243 |
GO:0004462
GO:0046872 GO:0051213 |
| AF-A0A440FXN8-F1-model_v4 | deleted | 0.9812 | 1 | 186 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar