F495196

General Info

Members Datasets Scaffolds Average Seq Length
1648 962 1151 325

Family's Representative Sequence

Representative Sequence 3300039453|Ga0436362_0413279|Ga0436362_0413279_2592_3674
Length 360
Sequence MITSFRGAQSANPEPRDSGLDAAHRPGMTGGNPMPIPKHVFDPPFNIIRCSHAVLDVTDLKLSREFYETTVGLHVEDADDSAVYLRASEEHQHHSLVLRRADVAACNRLGFKVGNDSDLDKAAAFFSENGIPYAFAEQPFQGRTLHFTDPFGYRIELYARMDKRPHLLRRYDLYKGCHPQRLDHFNVFAAEVQDTMDFYVRLGFRLTEYAEEDGPNGRIAAAWLHRKGNVHDFALTNGKGPRLHHVAYWTPTAMNIIHLCDVMASSGYLKNIERGPGRHGISNAFFLYIRDPDGHRLELYTSDYFTGDHDHEPLRWSLRDPRRQTLWGAPAPRSWFEQGSPFTGQQVREPQFVADVTVAD

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
3 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
4 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
5 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
6 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
7 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
8 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
9 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
10 2512875024 Mesorhizobium loti R88b Isolate Nodule
11 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
12 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
13 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
14 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
15 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
16 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
17 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
18 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
19 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
20 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
21 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
22 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
23 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
24 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
25 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
26 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
27 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
28 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
29 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
30 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
31 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
32 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
33 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
34 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
35 2519899620 Rhizobium sp. Pop5 Isolate Nodule
36 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
37 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
38 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
39 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
40 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
41 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
42 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
43 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
44 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
45 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
46 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
47 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
48 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
49 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
50 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
51 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
52 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
53 2643221557 Ensifer sp. Root558 Isolate Unclassified
54 2643221599 Rhizobium sp. Root708 Isolate Unclassified
55 2643221610 Ensifer sp. Root74 Isolate Unclassified
56 2643221618 Ensifer sp. Root231 Isolate Unclassified
57 2643221626 Ensifer sp. Root31 Isolate Unclassified
58 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
59 2643221651 Afipia sp. Root123D2 Isolate Unclassified
60 2643221655 Ensifer sp. Root1252 Isolate Unclassified
61 2643221659 Ensifer sp. Root127 Isolate Unclassified
62 2643221668 Ensifer sp. Root423 Isolate Unclassified
63 2643221675 Ensifer sp. Root1298 Isolate Unclassified
64 2643221680 Ensifer sp. Root1312 Isolate Unclassified
65 2643221698 Ensifer sp. Root142 Isolate Unclassified
66 2643221712 Ensifer sp. Root258 Isolate Unclassified
67 2643221723 Ensifer sp. Root278 Isolate Unclassified
68 2643221726 Ensifer sp. Root954 Isolate Unclassified
69 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
70 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
71 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
72 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
73 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
74 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
75 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
76 2718217927 Rhizobium sp. N324 Isolate Nodule
77 2718218423 Rhizobium sp. N941 Isolate Nodule
78 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
79 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
80 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
81 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
82 2721755809 Rhizobium sp. N541 Isolate Nodule
83 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
84 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
85 2738543024 Aminobacter sp. AP02 Isolate Unclassified
86 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
87 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
88 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
89 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
90 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
91 2791355199
92 2791355261 Rhizobium sp. J15 Isolate Nodule
93 2791355263 Rhizobium chutanense C5 Isolate Nodule
94 2791355266 Rhizobium sp. L43 Isolate Nodule
95 2791355267 Rhizobium sp. L18 Isolate Nodule
96 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
97 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
98 2802429634 Rhizobium anhuiense S10 Isolate Nodule
99 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
100 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
101 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
102 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
103 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
104 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
105 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
106 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
107 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
108 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
109 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
110 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
111 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
112 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
113 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
114 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
115 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
116 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
117 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
118 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
119 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
120 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
121 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
122 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
123 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
124 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
125 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
126 2841760612 Bosea sp. Tri-49 Isolate Nodule
127 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
128 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
129 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
130 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
131 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
132 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
133 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
134 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
135 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
136 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
137 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
138 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
139 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
140 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
141 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
142 2844104063 Bosea sp. Tri-39 Isolate Nodule
143 2844163670 Ensifer sp. 1H6 Isolate Unclassified
144 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
145 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
146 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
147 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
148 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
149 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
150 2851182111 Bosea sp. Tri-44 Isolate Nodule
151 2851246043 Bosea sp. Tri-54 Isolate Nodule
152 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
153 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
154 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
155 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
156 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
157 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
158 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
159 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
160 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
161 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
162 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
163 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
164 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
165 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
166 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
167 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
168 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
169 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
170 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
171 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
172 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
173 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
174 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
175 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
176 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
177 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
178 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
179 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
180 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
181 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
182 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
183 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
184 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
185 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
186 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
187 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
188 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
189 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
190 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
191 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
192 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
193 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
194 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
195 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
196 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
197 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
198 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
199 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
200 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
201 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
202 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
203 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
204 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
205 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
206 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
207 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
208 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
209 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
210 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
211 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
212 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
213 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
214 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
215 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
216 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
217 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
218 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
219 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
220 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
221 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
222 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
223 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
224 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
225 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
226 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
227 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
228 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
229 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
230 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
231 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
232 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
233 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
234 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
235 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
236 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
237 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
238 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
239 2904699407
240 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
241 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
242 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
243 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
244 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
245 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
246 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
247 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
248 2906610324
249 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
250 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
251 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
252 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
253 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
254 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
255 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
256 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
257 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
258 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
259 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
260 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
261 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
262 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
263 2922368715
264 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
265 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
266 2922425934
267 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
268 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
269 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
270 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
271 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
272 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
273 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
274 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
275 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
276 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
277 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
278 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
279 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
280 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
281 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
282 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
283 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
284 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
285 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
286 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
287 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
288 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
289 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
290 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
291 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
292 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
293 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
294 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
295 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
296 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
297 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
298 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
299 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
300 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
301 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
302 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
303 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
304 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
305 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
306 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
307 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
308 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
309 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
310 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
311 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
312 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
313 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
314 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
315 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
316 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
317 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
318 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
319 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
320 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
321 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
322 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
323 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
324 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
325 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
326 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
327 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
328 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
329 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
330 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
331 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
332 2936381700 Rhizobium chutanense C16 Isolate Unclassified
333 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
334 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
335 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
336 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
337 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
338 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
339 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
340 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
341 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
342 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
343 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
344 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
345 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
346 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
347 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
348 2952252522 Salinicola sp. DM10 Isolate Unclassified
349 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
350 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
351 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
352 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
353 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
354 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
355 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
356 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
357 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
358 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
359 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
360 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
361 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
362 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
363 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
364 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
365 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
366 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
367 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
368 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
369 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
370 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
371 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
372 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
373 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
374 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
375 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
376 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
377 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
378 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
379 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
380 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
381 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
382 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
383 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
384 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
385 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
386 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
387 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
388 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
389 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
390 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
391 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
392 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
393 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
394 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
395 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
396 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
397 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
398 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
399 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
400 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
401 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
402 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
403 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
404 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
405 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
406 3004167301 Mesorhizobium loti 582 Isolate Unclassified
407 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
408 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
409 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
410 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
411 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
412 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
413 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
414 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
415 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
416 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
417 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
418 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
419 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
420 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
421 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
422 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
423 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
424 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
425 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
426 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
427 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
428 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
429 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
430 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
431 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
432 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
433 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
434 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
435 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
436 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
437 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
438 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
439 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
440 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
441 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
442 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
443 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
444 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
445 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
446 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
447 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
448 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
449 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
450 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
451 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
452 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
453 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
454 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
455 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
456 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
457 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
458 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
459 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
460 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
461 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
462 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
463 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
464 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
465 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
466 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
467 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
468 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
469 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
470 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
471 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
472 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
473 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
474 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
475 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
476 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
477 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
478 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
479 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
480 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
481 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
482 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
483 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
484 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
485 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
486 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
487 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
488 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
489 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
490 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
491 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
492 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
493 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
494 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
495 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
496 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
497 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
498 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
499 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
500 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
501 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
502 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
503 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
504 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
505 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
506 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
507 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
508 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
509 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
510 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
511 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
512 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
513 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
514 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
515 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
516 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
517 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
518 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
519 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
520 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
521 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
522 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
523 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
524 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
525 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
526 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
527 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
528 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
529 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
530 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
531 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
532 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
533 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
534 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
535 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
536 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
537 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
538 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
539 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
540 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
541 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
542 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
543 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
544 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
545 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
546 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
547 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
548 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
549 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
550 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
551 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
552 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
553 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
554 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
555 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
556 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
557 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
558 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
559 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
560 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
561 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
562 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
563 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
564 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
565 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
566 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
567 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
568 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
569 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
570 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
571 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
572 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
573 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
574 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
575 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
576 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
577 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
578 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
579 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
580 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
581 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
582 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
583 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
584 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
585 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
586 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
587 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
588 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
589 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
590 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
591 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
592 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
593 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
594 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
595 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
596 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
597 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
598 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
599 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
600 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
601 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
602 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
603 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
604 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
605 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
606 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
607 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
608 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
609 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
610 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
611 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
612 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
613 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
614 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
615 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
616 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
617 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
618 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
619 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
620 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
621 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
622 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
623 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
624 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
625 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
626 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
627 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
628 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
629 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
630 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
631 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
632 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
633 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
634 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
635 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
636 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
637 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
638 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
639 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
640 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
641 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
642 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
643 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
644 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
645 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
646 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
647 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
648 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
649 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
650 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
651 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
652 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
653 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
654 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
655 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
656 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
657 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
658 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
659 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
660 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
661 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
662 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
663 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
664 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
665 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
666 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
667 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
668 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
669 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
670 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
671 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
672 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
673 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
674 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
675 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
676 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
677 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
678 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
679 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
680 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
681 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
682 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
683 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
684 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
685 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
686 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
687 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
688 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
689 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
690 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
691 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
692 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
693 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
694 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
695 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
696 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
697 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
698 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
699 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
700 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
701 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
702 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
703 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
704 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
705 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
706 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
707 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
708 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
709 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
710 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
711 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
712 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
713 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
714 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
715 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
716 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
717 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
718 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
719 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
720 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
721 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
722 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
723 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
724 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
725 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
726 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
727 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
728 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
729 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
730 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
731 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
732 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
733 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
734 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
735 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
736 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
737 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
738 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
739 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
740 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
741 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
742 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
743 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
744 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
745 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
746 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
747 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
748 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
749 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
750 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
751 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
752 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
753 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
754 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
755 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
756 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
757 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
758 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
759 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
760 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
761 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
762 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
763 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
764 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
765 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
766 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
767 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
768 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
769 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
770 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
771 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
772 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
773 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
774 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
775 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
776 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
777 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
778 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
779 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
780 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
781 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
782 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
783 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
784 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
785 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
786 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
787 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
788 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
789 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
790 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
791 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
792 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
793 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
794 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
795 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
796 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
797 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
798 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
799 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
800 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
801 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
802 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
803 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
804 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
805 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
806 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
807 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
808 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
809 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
810 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
811 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
812 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
813 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
814 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
815 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
816 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
817 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
818 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
819 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
820 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
821 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
822 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
823 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
824 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
825 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
826 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
827 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
828 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
829 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
830 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
831 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
832 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
833 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
834 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
835 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
836 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
837 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
838 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
839 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
840 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
841 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
842 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
843 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
844 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
845 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
846 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
847 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
848 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
849 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
850 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
851 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
852 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
853 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
854 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
855 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
856 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
857 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
858 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
859 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
860 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
861 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
862 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
863 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
864 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
865 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
866 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
867 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
868 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
869 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
870 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
871 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
872 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
873 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
874 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
875 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
876 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
877 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
878 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
879 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
880 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
881 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
882 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
883 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
884 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
885 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
886 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
887 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
888 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
889 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
890 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
891 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
892 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
893 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
894 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
895 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
896 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
897 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
898 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
899 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
900 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
901 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
902 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
903 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
904 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
905 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
906 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
907 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
908 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
909 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
910 8005258706 Rhizobium sp. R693 Isolate Nodule
911 8005275841 Rhizobium sp. N4311 Isolate Nodule
912 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
913 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
914 8005382845 Rhizobium sp. R634 Isolate Nodule
915 8005395548 Rhizobium sp. R339 Isolate Nodule
916 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
917 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
918 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
919 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
920 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
921 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
922 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
923 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
924 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
925 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
926 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
927 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
928 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
929 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
930 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
931 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
932 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
933 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
934 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
935 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
936 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
937 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
938 8018176218 Rhizobium sp. N122 Isolate Nodule
939 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
940 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
941 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
942 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
943 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
944 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
945 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
946 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
947 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
948 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
949 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
950 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
951 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
952 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
953 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
954 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
955 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
956 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
957 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
958 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
959 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
960 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
961 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere
962 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 70.05
Metatranscriptomes 0
Isolates 29.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.71
Nodule 24.03
Rhizoplane 4.79
Rhizosphere 45.39
Stem 0
Stem Tuber 0
Unclassified 14.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10008285 3300001979 Bacteria 4151
2 JGI25155J39150_1000046 3300002704 Bacteria 80685
3 JGI25156J39149_1000070 3300002705 Bacteria 80840
4 JGI25156J39149_1009007 3300002705 Bacteria 2461
5 JGI25162J39368_1000247 3300002737 Bacteria 54064
6 JGI25162J39368_1000735 3300002737 Bacteria 22503
7 JGI25154J39366_1000092 3300002738 Bacteria 80685
8 JGI25157J39369_1000087 3300002741 Bacteria 80840
9 JGI25157J39369_1000175 3300002741 Bacteria 54070
10 JGI25159J45721_1000030 3300002987 Bacteria 102429
11 JGI25151J46595_10048693 3300003187 Bacteria 1462
12 JGI25406J46586_10000214 3300003203 Bacteria 25609
13 JGI25165J46597_1000020 3300003214 Bacteria 370477
14 JGI25165J46597_1000237 3300003214 Bacteria 75663
15 JGI25165J46597_1000412 3300003214 Bacteria 44966
16 JGI25165J46597_1005141 3300003214 Bacteria 2592
17 JGI25153J46596_10000151 3300003215 Bacteria 70139
18 JGI25153J46596_10003908 3300003215 Bacteria 8174
19 JGI25153J46596_10005616 3300003215 Bacteria 6556
20 JGI25160J50197_1000075 3300003354 Bacteria 102429
21 JGI25160J50197_1003595 3300003354 Bacteria 6881
22 JGI25160J50197_1024708 3300003354 Bacteria 1699
23 JGI25160J50197_1025086 3300003354 Bacteria 1676
24 JGI25161J50226_1000316 3300003374 Bacteria 26515
25 JGI25404J52841_10002699 3300003659 Bacteria 3396
26 Ga0055539_1008676 3300003752 Bacteria 1269
27 Ga0055542_1000841 3300003762 Bacteria 21767
28 Ga0055529_1007252 3300003763 Bacteria 1515
29 Ga0055526_1005688 3300003771 Bacteria 7073
30 Ga0055526_1029564 3300003771 Bacteria 1623
31 Ga0055524_1000960 3300003775 Bacteria 18186
32 Ga0055536_1003695 3300003781 Bacteria 8124
33 Ga0055540_1000131 3300003792 Bacteria 75615
34 Ga0055531_10014237 3300003794 Bacteria 3599
35 Ga0055543_1003338 3300004625 Bacteria 4791
36 Ga0065165_1000048 3300005262 Bacteria 196539
37 Ga0065165_1000206 3300005262 Bacteria 102467
38 Ga0065165_1000582 3300005262 Bacteria 53862
39 Ga0065165_1002074 3300005262 Bacteria 18412
40 Ga0065165_1002220 3300005262 Bacteria 17337
41 Ga0065165_1005485 3300005262 Bacteria 7101
42 Ga0065712_10099907 3300005290 Bacteria 2077
43 Ga0070683_100052860 3300005329 Bacteria 3764
44 Ga0070690_100103442 3300005330 Bacteria 1891
45 Ga0070690_100212356 3300005330 Bacteria 1352
46 Ga0068869_100129353 3300005334 Bacteria 1939
47 Ga0070680_100052018 3300005336 Bacteria 3343
48 Ga0070680_100075104 3300005336 Bacteria 2782
49 Ga0070680_100131570 3300005336 Bacteria 2094
50 Ga0070682_100409483 3300005337 Bacteria 1028
51 Ga0070660_100051646 3300005339 Bacteria 3167
52 Ga0070660_100206106 3300005339 Bacteria 1596
53 Ga0070661_100232344 3300005344 Bacteria 1418
54 Ga0070668_100151197 3300005347 Bacteria 1877
55 Ga0070671_100068387 3300005355 Bacteria 2962
56 Ga0070674_100027518 3300005356 Bacteria 3727
57 Ga0070674_100086602 3300005356 Bacteria 2250
58 Ga0070674_100201329 3300005356 Bacteria 1538
59 Ga0070688_100060270 3300005365 Bacteria 2396
60 Ga0070659_100012688 3300005366 Bacteria 6251
61 Ga0070659_100053918 3300005366 Bacteria 3166
62 Ga0070667_100188613 3300005367 Bacteria 1826
63 Ga0070709_10000203 3300005434 Bacteria 38151
64 Ga0070709_10004227 3300005434 Bacteria 7743
65 Ga0070709_10004390 3300005434 Bacteria 7605
66 Ga0070709_10065310 3300005434 Bacteria 2330
67 Ga0070714_100065966 3300005435 Bacteria 3119
68 Ga0070714_100149564 3300005435 Bacteria 2103
69 Ga0070713_100001761 3300005436 Bacteria 13967
70 Ga0070713_100010384 3300005436 Bacteria 6727
71 Ga0070713_100016592 3300005436 Bacteria 5539
72 Ga0070713_100183503 3300005436 Bacteria 1881
73 Ga0070710_10002045 3300005437 Bacteria 9560
74 Ga0070711_100001730 3300005439 Bacteria 12117
75 Ga0070711_100006659 3300005439 Bacteria 6985
76 Ga0070711_100011938 3300005439 Bacteria 5407
77 Ga0070711_100014917 3300005439 Bacteria 4908
78 Ga0070711_100019115 3300005439 Bacteria 4390
79 Ga0070708_100109740 3300005445 Bacteria 2535
80 Ga0070663_100076740 3300005455 Bacteria 2444
81 Ga0070662_100365092 3300005457 Bacteria 1185
82 Ga0070681_10003273 3300005458 Bacteria 15113
83 Ga0070681_10025087 3300005458 Bacteria 6000
84 Ga0070681_10065024 3300005458 Bacteria 3617
85 Ga0070706_100156571 3300005467 Bacteria 2127
86 Ga0070707_100176291 3300005468 Bacteria 2084
87 Ga0070679_100017482 3300005530 Bacteria 6941
88 Ga0070679_100024100 3300005530 Bacteria 5962
89 Ga0070679_100174677 3300005530 Bacteria 2121
90 Ga0070684_100013567 3300005535 Bacteria 6575
91 Ga0070684_100089906 3300005535 Bacteria 2729
92 Ga0070684_100094373 3300005535 Bacteria 2665
93 Ga0070684_100285812 3300005535 Bacteria 1512
94 Ga0070697_100106656 3300005536 Bacteria 2331
95 Ga0068853_100009540 3300005539 Bacteria 7820
96 Ga0068853_100040363 3300005539 Bacteria 3982
97 Ga0068853_100416381 3300005539 Bacteria 1259
98 Ga0070665_100014994 3300005548 Bacteria 7779
99 Ga0070665_100552780 3300005548 Bacteria 1163
100 Ga0068855_100018899 3300005563 Bacteria 8282
101 Ga0068855_100067952 3300005563 Bacteria 4150
102 Ga0068855_100114327 3300005563 Bacteria 3095
103 Ga0068855_100151551 3300005563 Bacteria 2636
104 Ga0068855_100184319 3300005563 Bacteria 2359
105 Ga0068855_100386568 3300005563 Bacteria 1536
106 Ga0068855_100419655 3300005563 Bacteria 1464
107 Ga0068855_100480299 3300005563 Bacteria 1353
108 Ga0070664_100283719 3300005564 Bacteria 1494
109 Ga0068857_100016047 3300005577 Bacteria 6562
110 Ga0068854_100192480 3300005578 Bacteria 1599
111 Ga0068854_100207275 3300005578 Bacteria 1544
112 Ga0068856_100003888 3300005614 Bacteria 14981
113 Ga0068856_100055216 3300005614 Bacteria 3919
114 Ga0068856_100068625 3300005614 Bacteria 3505
115 Ga0068856_100230817 3300005614 Bacteria 1866
116 Ga0070702_100045764 3300005615 Bacteria 2477
117 Ga0068852_100011984 3300005616 Bacteria 6558
118 Ga0068852_100032466 3300005616 Bacteria 4323
119 Ga0068852_100213007 3300005616 Bacteria 1834
120 Ga0068859_100160460 3300005617 Bacteria 2327
121 Ga0068859_100163980 3300005617 Bacteria 2301
122 Ga0068864_100384391 3300005618 Bacteria 1331
123 Ga0068864_100544067 3300005618 Bacteria 1121
124 Ga0068851_10004825 3300005834 Bacteria 6103
125 Ga0068863_100315590 3300005841 Bacteria 1518
126 Ga0068858_100228037 3300005842 Bacteria 1765
127 Ga0068860_100000081 3300005843 Bacteria 170066
128 Ga0068860_100081543 3300005843 Bacteria 3076
129 Ga0068860_100100065 3300005843 Bacteria 2765
130 Ga0068860_100134124 3300005843 Bacteria 2377
131 Ga0068862_100103763 3300005844 Bacteria 2490
132 Ga0068862_100213910 3300005844 Bacteria 1742
133 Ga0081455_10001734 3300005937 Bacteria 26379
134 Ga0081455_10013417 3300005937 Bacteria 8100
135 Ga0081455_10015026 3300005937 Bacteria 7541
136 Ga0081455_10028177 3300005937 Bacteria 5135
137 Ga0081455_10056973 3300005937 Bacteria 3315
138 Ga0081455_10120310 3300005937 Bacteria 2070
139 Ga0081540_1003965 3300005983 Bacteria 11501
140 Ga0081540_1006422 3300005983 Bacteria 8558
141 Ga0081540_1007697 3300005983 Bacteria 7637
142 Ga0081540_1011844 3300005983 Bacteria 5796
143 Ga0081540_1012349 3300005983 Bacteria 5635
144 Ga0081540_1013491 3300005983 Bacteria 5308
145 Ga0081540_1014236 3300005983 Bacteria 5110
146 Ga0081540_1018818 3300005983 Bacteria 4222
147 Ga0081539_10000768 3300005985 Bacteria 63055
148 Ga0081539_10001470 3300005985 Bacteria 39952
149 Ga0070717_10001267 3300006028 Bacteria 17258
150 Ga0070717_10106472 3300006028 Bacteria 2388
151 Ga0070717_10115762 3300006028 Bacteria 2291
152 Ga0075365_10086145 3300006038 Bacteria 2135
153 Ga0075365_10103698 3300006038 Bacteria 1949
154 Ga0075368_10001363 3300006042 Bacteria 7775
155 Ga0075368_10021695 3300006042 Bacteria 2441
156 Ga0075368_10057252 3300006042 Bacteria 1556
157 Ga0075363_100013881 3300006048 Bacteria 3920
158 Ga0075363_100067582 3300006048 Bacteria 1937
159 Ga0075363_100077073 3300006048 Bacteria 1819
160 Ga0075364_10060783 3300006051 Bacteria 2477
161 Ga0075364_10145166 3300006051 Bacteria 1597
162 Ga0075364_10251643 3300006051 Bacteria 1201
163 Ga0070715_10005933 3300006163 Bacteria 4117
164 Ga0070715_10121468 3300006163 Bacteria 1246
165 Ga0070716_100002732 3300006173 Bacteria 8182
166 Ga0070712_100006733 3300006175 Bacteria 7144
167 Ga0070712_100055550 3300006175 Bacteria 2774
168 Ga0070712_100074402 3300006175 Bacteria 2440
169 Ga0070712_100085459 3300006175 Bacteria 2297
170 Ga0070712_100200603 3300006175 Bacteria 1567
171 Ga0075362_10024903 3300006177 Bacteria 2541
172 Ga0075362_10040701 3300006177 Bacteria 2047
173 Ga0075362_10056901 3300006177 Bacteria 1761
174 Ga0075362_10065700 3300006177 Bacteria 1647
175 Ga0075367_10007415 3300006178 Bacteria 5612
176 Ga0075367_10081807 3300006178 Bacteria 1954
177 Ga0075369_10035267 3300006186 Bacteria 2126
178 Ga0075369_10055915 3300006186 Bacteria 1715
179 Ga0075369_10080657 3300006186 Bacteria 1443
180 Ga0075366_10072981 3300006195 Bacteria 2045
181 Ga0097621_100315787 3300006237 Bacteria 1383
182 Ga0075370_10013567 3300006353 Bacteria 4335
183 Ga0075370_10109286 3300006353 Bacteria 1604
184 Ga0075428_100424997 3300006844 Bacteria 1424
185 Ga0075431_100002184 3300006847 Bacteria 18706
186 Ga0075434_100066744 3300006871 Bacteria 3584
187 Ga0075429_100020728 3300006880 Bacteria 5706
188 Ga0075436_100101586 3300006914 Bacteria 2003
189 Ga0097620_100160446 3300006931 Bacteria 2327
190 Ga0097620_100163987 3300006931 Bacteria 2301
191 Ga0099825_1032134 3300006941 Bacteria 2158
192 Ga0099824_1007408 3300006942 Bacteria 14551
193 Ga0099824_1023175 3300006942 Bacteria 3914
194 Ga0099822_1018218 3300006943 Bacteria 7346
195 Ga0099823_1024506 3300006944 Bacteria 5452
196 Ga0075435_100249788 3300007076 Bacteria 1510
197 Ga0099795_10047078 3300007788 Bacteria 1557
198 Ga0105240_10008768 3300009093 Bacteria 14409
199 Ga0105240_10034221 3300009093 Bacteria 6557
200 Ga0105240_10076136 3300009093 Bacteria 4137
201 Ga0105240_10120101 3300009093 Bacteria 3165
202 Ga0105240_10129667 3300009093 Bacteria 3026
203 Ga0105240_10206609 3300009093 Bacteria 2298
204 Ga0105240_10255829 3300009093 Bacteria 2022
205 Ga0105245_10063788 3300009098 Bacteria 3328
206 Ga0105245_10098072 3300009098 Bacteria 2707
207 Ga0105247_10026143 3300009101 Bacteria 3524
208 Ga0105247_10091007 3300009101 Bacteria 1936
209 Ga0105247_10116887 3300009101 Bacteria 1723
210 Ga0114129_10069546 3300009147 Bacteria 4907
211 Ga0105241_10028779 3300009174 Bacteria 4140
212 Ga0105241_10035078 3300009174 Bacteria 3773
213 Ga0105241_10265431 3300009174 Bacteria 1460
214 Ga0105242_10262412 3300009176 Bacteria 1561
215 Ga0105248_10374305 3300009177 Bacteria 1603
216 Ga0105237_10004427 3300009545 Bacteria 16284
217 Ga0105237_10047513 3300009545 Bacteria 4315
218 Ga0105237_10133855 3300009545 Bacteria 2473
219 Ga0105237_10263849 3300009545 Bacteria 1725
220 Ga0105237_10388095 3300009545 Bacteria 1401
221 Ga0105237_10389256 3300009545 Bacteria 1399
222 Ga0105237_10510928 3300009545 Bacteria 1208
223 Ga0105238_10017402 3300009551 Bacteria 7303
224 Ga0105238_10081432 3300009551 Bacteria 3227
225 Ga0105238_10105713 3300009551 Bacteria 2796
226 Ga0105238_10193087 3300009551 Bacteria 2012
227 Ga0105249_10206780 3300009553 Bacteria 1924
228 Ga0099796_10014810 3300010159 Bacteria 2263
229 Ga0105239_10017021 3300010375 Bacteria 8036
230 Ga0105239_10063018 3300010375 Bacteria 4070
231 Ga0105239_10083385 3300010375 Bacteria 3520
232 Ga0105239_10092409 3300010375 Bacteria 3340
233 Ga0105239_10132432 3300010375 Bacteria 2774
234 Ga0105239_10139240 3300010375 Bacteria 2703
235 Ga0105239_10684333 3300010375 Bacteria 1172
236 Ga0105246_10132761 3300011119 Bacteria 1862
237 Ga0105246_10202766 3300011119 Bacteria 1543
238 Ga0105246_10224999 3300011119 Bacteria 1473
239 Ga0105246_10270163 3300011119 Bacteria 1359
240 Ga0157371_10075245 3300013102 Bacteria 2391
241 Ga0157370_10014947 3300013104 Bacteria 7918
242 Ga0157370_10025078 3300013104 Bacteria 5903
243 Ga0157369_10012270 3300013105 Bacteria 9731
244 Ga0157369_10021190 3300013105 Bacteria 7267
245 Ga0157369_10151314 3300013105 Bacteria 2452
246 Ga0157369_10187272 3300013105 Bacteria 2176
247 Ga0157369_10227813 3300013105 Bacteria 1949
248 Ga0157374_10200703 3300013296 Bacteria 1953
249 Ga0157378_10009041 3300013297 Bacteria 8671
250 Ga0157378_10345420 3300013297 Bacteria 1452
251 Ga0163162_10088250 3300013306 Bacteria 3181
252 Ga0163162_10317092 3300013306 Bacteria 1692
253 Ga0157375_10047518 3300013308 Bacteria 4192
254 Ga0157375_10189822 3300013308 Bacteria 2209
255 Ga0157375_10197290 3300013308 Bacteria 2168
256 Ga0163163_10008215 3300014325 Bacteria 9260
257 Ga0163163_10011315 3300014325 Bacteria 8088
258 Ga0163163_10179953 3300014325 Bacteria 2161
259 Ga0163163_10232184 3300014325 Bacteria 1894
260 Ga0163163_10414029 3300014325 Bacteria 1407
261 Ga0157380_10141045 3300014326 Bacteria 2071
262 Ga0182008_10006828 3300014497 Bacteria 6350
263 Ga0157377_10191485 3300014745 Bacteria 1293
264 Ga0157379_10100048 3300014968 Bacteria 2603
265 Ga0157376_10347565 3300014969 Bacteria 1418
266 Ga0163161_10149601 3300017792 Bacteria 1774
267 Ga0163161_10196512 3300017792 Bacteria 1553
268 Ga0163161_10205589 3300017792 Bacteria 1519
269 Ga0214544_1001813 3300021320 Bacteria 44864
270 Ga0214544_1032568 3300021320 Bacteria 1615
271 Ga0214542_1001236 3300021321 Bacteria 51849
272 Ga0214542_1028629 3300021321 Bacteria 2383
273 Ga0214542_1039400 3300021321 Bacteria 1254
274 Ga0214545_1000924 3300021324 Bacteria 51830
275 Ga0214545_1023651 3300021324 Bacteria 3988
276 Ga0214545_1027979 3300021324 Bacteria 2781
277 Ga0214543_1003531 3300021327 Bacteria 30263
278 Ga0214543_1024471 3300021327 Bacteria 3724
279 Ga0214543_1034461 3300021327 Bacteria 1731
280 Ga0214543_1035893 3300021327 Bacteria 1583
281 Ga0213876_10000520 3300021384 Bacteria 29496
282 Ga0213876_10001886 3300021384 Bacteria 12605
283 Ga0213876_10008410 3300021384 Bacteria 5584
284 Ga0213876_10020027 3300021384 Bacteria 3534
285 Ga0213876_10089360 3300021384 Bacteria 1632
286 Ga0209435_100059 3300025206 Bacteria 80744
287 Ga0209436_100823 3300025208 Bacteria 12589
288 Ga0209563_101384 3300025230 Bacteria 6524
289 Ga0209563_102893 3300025230 Bacteria 3718
290 Ga0209437_100042 3300025233 Bacteria 444095
291 Ga0209437_100062 3300025233 Bacteria 336900
292 Ga0209646_1000179 3300025246 Bacteria 80892
293 Ga0209646_1011629 3300025246 Bacteria 1360
294 Ga0209026_1000005 3300025250 Bacteria 731387
295 Ga0209026_1000212 3300025250 Bacteria 80892
296 Ga0209677_106293 3300025253 Bacteria 2846
297 Ga0209148_1000136 3300025254 Bacteria 169088
298 Ga0209148_1000180 3300025254 Bacteria 124830
299 Ga0209759_1000111 3300025256 Bacteria 143545
300 Ga0209759_1000246 3300025256 Bacteria 80892
301 Ga0209233_1000047 3300025261 Bacteria 459614
302 Ga0209233_1000054 3300025261 Bacteria 439669
303 Ga0209233_1000082 3300025261 Bacteria 336320
304 Ga0209233_1010707 3300025261 Bacteria 2732
305 Ga0209565_1009385 3300025263 Bacteria 2488
306 Ga0209455_1000170 3300025272 Bacteria 110681
307 Ga0209455_1003748 3300025272 Bacteria 5242
308 Ga0209673_1000642 3300025273 Bacteria 52672
309 Ga0209130_1000071 3300025284 Bacteria 178273
310 Ga0209130_1000154 3300025284 Bacteria 102645
311 Ga0209676_1004026 3300025292 Bacteria 8461
312 Ga0209025_1000032 3300025294 Bacteria 416141
313 Ga0209025_1002646 3300025294 Bacteria 18319
314 Ga0209564_1000025 3300025295 Bacteria 520535
315 Ga0209564_1000385 3300025295 Bacteria 80273
316 Ga0209564_1017303 3300025295 Bacteria 2818
317 Ga0209564_1023087 3300025295 Bacteria 2174
318 Ga0209758_1000011 3300025297 Bacteria 1049685
319 Ga0209758_1000120 3300025297 Bacteria 192212
320 Ga0209758_1001210 3300025297 Bacteria 32486
321 Ga0209758_1004569 3300025297 Bacteria 11413
322 Ga0209758_1008059 3300025297 Bacteria 6953
323 Ga0209758_1015568 3300025297 Bacteria 3925
324 Ga0209758_1029522 3300025297 Bacteria 2290
325 Ga0209050_1005957 3300025298 Bacteria 7411
326 Ga0209256_1000073 3300025299 Bacteria 237553
327 Ga0209256_1000907 3300025299 Bacteria 36321
328 Ga0209256_1005155 3300025299 Bacteria 7715
329 Ga0207426_1000286 3300025302 Bacteria 102853
330 Ga0207426_1000572 3300025302 Bacteria 49561
331 Ga0207426_1001763 3300025302 Bacteria 16381
332 Ga0207426_1039826 3300025302 Bacteria 1468
333 Ga0209051_1000038 3300025303 Bacteria 320926
334 Ga0209051_1002477 3300025303 Bacteria 13187
335 Ga0209257_1003099 3300025304 Bacteria 14900
336 Ga0209257_1009764 3300025304 Bacteria 5037
337 Ga0209257_1013498 3300025304 Bacteria 3624
338 Ga0209257_1035619 3300025304 Bacteria 1538
339 Ga0207692_10058851 3300025898 Bacteria 1981
340 Ga0207692_10065222 3300025898 Bacteria 1899
341 Ga0207642_10105860 3300025899 Bacteria 1422
342 Ga0207710_10014873 3300025900 Bacteria 3287
343 Ga0207710_10016392 3300025900 Bacteria 3134
344 Ga0207688_10021360 3300025901 Bacteria 3536
345 Ga0207647_10035646 3300025904 Bacteria 3169
346 Ga0207699_10002275 3300025906 Bacteria 9062
347 Ga0207699_10008564 3300025906 Bacteria 5056
348 Ga0207699_10056061 3300025906 Bacteria 2347
349 Ga0207699_10167145 3300025906 Bacteria 1469
350 Ga0207705_10191644 3300025909 Bacteria 1546
351 Ga0207684_10294696 3300025910 Bacteria 1399
352 Ga0207684_10302188 3300025910 Bacteria 1380
353 Ga0207654_10033726 3300025911 Bacteria 2840
354 Ga0207654_10036096 3300025911 Bacteria 2759
355 Ga0207654_10086640 3300025911 Bacteria 1899
356 Ga0207707_10000419 3300025912 Bacteria 44410
357 Ga0207707_10002705 3300025912 Bacteria 15850
358 Ga0207707_10002868 3300025912 Bacteria 15401
359 Ga0207707_10045918 3300025912 Bacteria 3804
360 Ga0207695_10000008 3300025913 Bacteria 1058268
361 Ga0207695_10152018 3300025913 Bacteria 2253
362 Ga0207695_10180414 3300025913 Bacteria 2032
363 Ga0207671_10008982 3300025914 Bacteria 8407
364 Ga0207671_10034078 3300025914 Bacteria 3785
365 Ga0207671_10059255 3300025914 Bacteria 2839
366 Ga0207671_10061259 3300025914 Bacteria 2792
367 Ga0207671_10088306 3300025914 Bacteria 2332
368 Ga0207671_10156832 3300025914 Bacteria 1761
369 Ga0207671_10170665 3300025914 Bacteria 1689
370 Ga0207693_10013446 3300025915 Bacteria 6599
371 Ga0207693_10019720 3300025915 Bacteria 5362
372 Ga0207693_10033602 3300025915 Bacteria 4046
373 Ga0207693_10188687 3300025915 Bacteria 1622
374 Ga0207693_10228159 3300025915 Bacteria 1462
375 Ga0207663_10000249 3300025916 Bacteria 23744
376 Ga0207663_10002050 3300025916 Bacteria 9597
377 Ga0207663_10007087 3300025916 Bacteria 5789
378 Ga0207663_10067281 3300025916 Bacteria 2297
379 Ga0207660_10106711 3300025917 Bacteria 2100
380 Ga0207657_10026743 3300025919 Bacteria 5295
381 Ga0207657_10188524 3300025919 Bacteria 1665
382 Ga0207657_10262314 3300025919 Bacteria 1375
383 Ga0207649_10039488 3300025920 Bacteria 2862
384 Ga0207649_10084927 3300025920 Bacteria 2059
385 Ga0207649_10151437 3300025920 Bacteria 1598
386 Ga0207652_10001690 3300025921 Bacteria 19300
387 Ga0207652_10011695 3300025921 Bacteria 7082
388 Ga0207652_10048077 3300025921 Bacteria 3646
389 Ga0207646_10238573 3300025922 Bacteria 1643
390 Ga0207694_10027290 3300025924 Bacteria 4347
391 Ga0207694_10068409 3300025924 Bacteria 2773
392 Ga0207694_10191173 3300025924 Bacteria 1663
393 Ga0207694_10245057 3300025924 Bacteria 1465
394 Ga0207694_10324959 3300025924 Bacteria 1270
395 Ga0207694_10327683 3300025924 Bacteria 1265
396 Ga0207650_10303663 3300025925 Bacteria 1304
397 Ga0207659_10098980 3300025926 Bacteria 2194
398 Ga0207700_10035637 3300025928 Bacteria 3586
399 Ga0207700_10047104 3300025928 Bacteria 3193
400 Ga0207700_10136610 3300025928 Bacteria 2009
401 Ga0207664_10029904 3300025929 Bacteria 4155
402 Ga0207664_10071647 3300025929 Bacteria 2792
403 Ga0207690_10030753 3300025932 Bacteria 3428
404 Ga0207706_10275897 3300025933 Bacteria 1467
405 Ga0207709_10074401 3300025935 Bacteria 2167
406 Ga0207670_10053842 3300025936 Bacteria 2713
407 Ga0207670_10420066 3300025936 Bacteria 1073
408 Ga0207669_10183380 3300025937 Bacteria 1503
409 Ga0207704_10175967 3300025938 Bacteria 1541
410 Ga0207665_10001320 3300025939 Bacteria 16732
411 Ga0207665_10001972 3300025939 Bacteria 13825
412 Ga0207711_10043240 3300025941 Bacteria 3841
413 Ga0207689_10044019 3300025942 Bacteria 3690
414 Ga0207689_10088660 3300025942 Bacteria 2541
415 Ga0207661_10001270 3300025944 Bacteria 16867
416 Ga0207661_10008213 3300025944 Bacteria 7451
417 Ga0207661_10264831 3300025944 Bacteria 1532
418 Ga0207679_10069235 3300025945 Bacteria 2654
419 Ga0207679_10286765 3300025945 Bacteria 1414
420 Ga0207667_10002017 3300025949 Bacteria 25487
421 Ga0207667_10124956 3300025949 Bacteria 2650
422 Ga0207667_10134592 3300025949 Bacteria 2545
423 Ga0207667_10209954 3300025949 Bacteria 1995
424 Ga0207651_10125014 3300025960 Bacteria 1958
425 Ga0207712_10312704 3300025961 Bacteria 1293
426 Ga0207668_10050204 3300025972 Bacteria 2873
427 Ga0207668_10245334 3300025972 Bacteria 1451
428 Ga0207640_10148313 3300025981 Bacteria 1720
429 Ga0207640_10189558 3300025981 Bacteria 1549
430 Ga0207640_10274661 3300025981 Bacteria 1320
431 Ga0207658_10150957 3300025986 Bacteria 1893
432 Ga0207658_10211814 3300025986 Bacteria 1625
433 Ga0207658_10218779 3300025986 Bacteria 1601
434 Ga0207677_10073275 3300026023 Bacteria 2424
435 Ga0207703_10136925 3300026035 Bacteria 2121
436 Ga0207639_10006277 3300026041 Bacteria 8071
437 Ga0207639_10035603 3300026041 Bacteria 3685
438 Ga0207639_10379100 3300026041 Bacteria 1270
439 Ga0207678_10060137 3300026067 Bacteria 3268
440 Ga0207678_10061454 3300026067 Bacteria 3231
441 Ga0207678_10067879 3300026067 Bacteria 3060
442 Ga0207678_10072014 3300026067 Bacteria 2962
443 Ga0207708_10115077 3300026075 Bacteria 2091
444 Ga0207702_10000548 3300026078 Bacteria 41978
445 Ga0207702_10019097 3300026078 Bacteria 5673
446 Ga0207702_10049458 3300026078 Bacteria 3548
447 Ga0207702_10098547 3300026078 Bacteria 2575
448 Ga0207702_10248491 3300026078 Bacteria 1669
449 Ga0207641_10036305 3300026088 Bacteria 4114
450 Ga0207676_10271343 3300026095 Bacteria 1536
451 Ga0207674_10010575 3300026116 Bacteria 10440
452 Ga0207674_10226613 3300026116 Bacteria 1817
453 Ga0207675_100112829 3300026118 Bacteria 2566
454 Ga0207675_100114354 3300026118 Bacteria 2549
455 Ga0207675_100130814 3300026118 Bacteria 2380
456 Ga0207675_100218893 3300026118 Bacteria 1834
457 Ga0207683_10021694 3300026121 Bacteria 5504
458 Ga0207683_10033936 3300026121 Bacteria 4434
459 Ga0207683_10040045 3300026121 Bacteria 4087
460 Ga0207683_10124367 3300026121 Bacteria 2317
461 Ga0207683_10222480 3300026121 Bacteria 1720
462 Ga0207698_10012367 3300026142 Bacteria 5581
463 Ga0207698_10034409 3300026142 Bacteria 3693
464 Ga0207698_10071611 3300026142 Bacteria 2751
465 Ga0207698_10288218 3300026142 Bacteria 1522
466 Ga0207698_10326389 3300026142 Bacteria 1440
467 Ga0209389_1000080 3300027296 Bacteria 89649
468 Ga0209389_1000115 3300027296 Bacteria 71798
469 Ga0209589_1000014 3300027357 Bacteria 227996
470 Ga0209589_1000033 3300027357 Bacteria 140561
471 Ga0209489_100014 3300027361 Bacteria 227996
472 Ga0209489_100027 3300027361 Bacteria 188074
473 Ga0209489_100040 3300027361 Bacteria 164986
474 Ga0209700_100022 3300027363 Bacteria 229977
475 Ga0209700_100024 3300027363 Bacteria 227996
476 Ga0209179_1013166 3300027512 Bacteria 1498
477 Ga0209588_1009865 3300027671 Bacteria 2862
478 Ga0209813_10000555 3300027866 Bacteria 8806
479 Ga0268266_10011262 3300028379 Bacteria 7784
480 Ga0268266_10162564 3300028379 Bacteria 2021
481 Ga0268266_10173266 3300028379 Bacteria 1959
482 Ga0268266_10207318 3300028379 Bacteria 1796
483 Ga0268266_10222593 3300028379 Bacteria 1735
484 Ga0268266_10290155 3300028379 Bacteria 1523
485 Ga0268265_10063828 3300028380 Bacteria 2835
486 Ga0268265_10110095 3300028380 Bacteria 2246
487 Ga0268265_10319263 3300028380 Bacteria 1406
488 Ga0268265_10460809 3300028380 Bacteria 1189
489 Ga0268264_10000048 3300028381 Bacteria 334457
490 Ga0268264_10140130 3300028381 Bacteria 2155
491 Ga0265318_10021190 3300028577 Bacteria 2613
492 Ga0307517_10000634 3300028786 Bacteria 60194
493 Ga0307517_10039620 3300028786 Bacteria 5167
494 Ga0307515_10000130 3300028794 Bacteria 179263
495 Ga0307515_10000375 3300028794 Bacteria 109285
496 Ga0307515_10006012 3300028794 Bacteria 24419
497 Ga0307515_10011208 3300028794 Bacteria 17036
498 Ga0265332_10072944 3300031238 Bacteria 1461
499 Ga0265329_10010852 3300031242 Bacteria 3331
500 Ga0265340_10000942 3300031247 Bacteria 16552
501 Ga0265340_10062324 3300031247 Bacteria 1781
502 Ga0265339_10003224 3300031249 Bacteria 11450
503 Ga0265339_10004321 3300031249 Bacteria 9716
504 Ga0265339_10139606 3300031249 Bacteria 1234
505 Ga0265331_10005402 3300031250 Bacteria 7726
506 Ga0265331_10008950 3300031250 Bacteria 5658
507 Ga0307513_10000335 3300031456 Bacteria 67961
508 Ga0307513_10020103 3300031456 Bacteria 7925
509 Ga0307509_10005537 3300031507 Bacteria 17522
510 Ga0307508_10000032 3300031616 Bacteria 163293
511 Ga0316575_10027004 3300031665 Bacteria 2233
512 Ga0265314_10004266 3300031711 Bacteria 13380
513 Ga0265314_10070042 3300031711 Bacteria 2351
514 Ga0265314_10206222 3300031711 Bacteria 1158
515 Ga0265342_10000245 3300031712 Bacteria 60848
516 Ga0265342_10042218 3300031712 Bacteria 2756
517 Ga0307516_10005934 3300031730 Bacteria 14450
518 Ga0307516_10010247 3300031730 Bacteria 10328
519 Ga0307516_10039539 3300031730 Bacteria 4700
520 Ga0307516_10107771 3300031730 Bacteria 2594
521 Ga0307516_10290617 3300031730 Bacteria 1313
522 Ga0307405_10124851 3300031731 Bacteria 1768
523 Ga0307407_10110918 3300031903 Bacteria 1722
524 Ga0307412_10148803 3300031911 Bacteria 1725
525 Ga0307409_100018896 3300031995 Bacteria 4650
526 Ga0307414_10015462 3300032004 Bacteria 4607
527 Ga0307415_100080075 3300032126 Bacteria 2329
528 Ga0307415_100154121 3300032126 Bacteria 1772
529 Ga0316583_10000299 3300032133 Bacteria 13887
530 Ga0307507_10011278 3300033179 Bacteria 11327
531 Ga0307510_10016157 3300033180 Bacteria 8816
532 Ga0307510_10033062 3300033180 Bacteria 5817
533 Ga0307510_10079195 3300033180 Bacteria 3206
534 Ga0307510_10192031 3300033180 Bacteria 1589
535 Ga0315911_1000002 3300033442 Bacteria 926833
536 Ga0373950_0007558 3300034818 Bacteria 1690
537 Ga0373923_0018497 3300035111 Bacteria 2683
538 Ga0373923_0023017 3300035111 Bacteria 2447
539 Ga0373945_0007554 3300035116 Bacteria 3526
540 Ga0373954_0000645 3300035118 Bacteria 13339
541 Ga0373954_0089346 3300035118 Bacteria 1478
542 Ga0373956_0005180 3300035119 Bacteria 5219
543 Ga0373957_0001340 3300035120 Bacteria 6621
544 Ga0373957_0074282 3300035120 Bacteria 1334
545 Ga0373943_0044140 3300035170 Bacteria 2169
546 Ga0373943_0046304 3300035170 Bacteria 2122
547 Ga0373946_0017066 3300035171 Bacteria 2773
548 Ga0373946_0024016 3300035171 Bacteria 2386
549 Ga0373946_0137953 3300035171 Bacteria 1128
550 Ga0373955_0114878 3300035172 Bacteria 1559
551 Ga0373924_0073578 3300035410 Bacteria 1444
552 Ga0373924_0076719 3300035410 Bacteria 1416
553 Ga0373931_0002187 3300035691 Bacteria 8629
554 Ga0373935_0012923 3300035692 Bacteria 5031
555 Ga0373935_0054823 3300035692 Bacteria 2540
556 Ga0373935_0063455 3300035692 Bacteria 2368
557 Ga0373927_0000177 3300035695 Bacteria 50406
558 Ga0373927_0013220 3300035695 Bacteria 5489
559 Ga0373927_0017091 3300035695 Bacteria 4780
560 Ga0373933_0000182 3300035724 Bacteria 41434
561 Ga0373933_0003690 3300035724 Bacteria 8470
562 Ga0373933_0112009 3300035724 Bacteria 1703
563 Ga0373947_0025283 3300035725 Bacteria 3462
564 Ga0373947_0028707 3300035725 Bacteria 3263
565 Ga0373947_0057990 3300035725 Bacteria 2345
566 Ga0373947_0071426 3300035725 Bacteria 2129
567 Ga0373947_0103986 3300035725 Bacteria 1787
568 Ga0373937_0013771 3300036401 Bacteria 7126
569 Ga0373937_0028281 3300036401 Bacteria 5072
570 Ga0373937_0033145 3300036401 Bacteria 4689
571 Ga0373925_0000912 3300037068 Bacteria 26965
572 Ga0373925_0021953 3300037068 Bacteria 4653
573 Ga0373925_0108321 3300037068 Bacteria 2144
574 Ga0395899_0038352 3300037312 Bacteria 3589
575 Ga0395899_0083732 3300037312 Bacteria 2319
576 Ga0395900_0001029 3300037418 Bacteria 35765
577 Ga0395900_0004780 3300037418 Bacteria 14275
578 Ga0395900_0017080 3300037418 Bacteria 7408
579 Ga0395898_0002778 3300037466 Bacteria 20117
580 Ga0395898_0022553 3300037466 Bacteria 6376
581 Ga0395898_0169433 3300037466 Bacteria 2087
582 Ga0395898_0179146 3300037466 Bacteria 2025
583 Ga0395898_0211039 3300037466 Bacteria 1852
584 Ga0395905_0002254 3300037471 Bacteria 21651
585 Ga0395905_0006562 3300037471 Bacteria 11688
586 Ga0395905_0136044 3300037471 Bacteria 2311
587 Ga0395905_0198854 3300037471 Bacteria 1879
588 Ga0395905_0229979 3300037471 Bacteria 1734
589 Ga0436364_0341704 3300037853 Bacteria 12661
590 Ga0395901_0014425 3300038443 Bacteria 8041
591 Ga0395901_0031413 3300038443 Bacteria 5477
592 Ga0395901_0044477 3300038443 Bacteria 4606
593 Ga0395901_0052460 3300038443 Bacteria 4239
594 Ga0395901_0158660 3300038443 Bacteria 2376
595 Ga0395901_0386583 3300038443 Bacteria 1439
596 Ga0395901_0548932 3300038443 Bacteria 1171
597 Ga0400483_059947 3300039062 Bacteria 2407
598 Ga0400483_121196 3300039062 Bacteria 2271
599 Ga0400483_179252 3300039062 Bacteria 3054
600 Ga0400483_189090 3300039062 Bacteria 1650
601 Ga0400483_225275 3300039062 Bacteria 2254
602 Ga0400483_291972 3300039062 Bacteria 2334
603 Ga0436365_0229539 3300039437 Bacteria 3406
604 Ga0436365_0459631 3300039437 Bacteria 25364
605 Ga0436365_0745092 3300039437 Bacteria 1475
606 Ga0436365_0982014 3300039437 Bacteria 2305
607 Ga0436365_1142591 3300039437 Bacteria 1157
608 Ga0436365_1590122 3300039437 Bacteria 23962
609 Ga0436360_0768015 3300039438 Bacteria 1096
610 Ga0436360_1204026 3300039438 Bacteria 1212
611 Ga0436361_0665242 3300039447 Bacteria 3058
612 Ga0436363_0725193 3300039450 Bacteria 1644
613 Ga0436363_1172772 3300039450 Bacteria 18869
614 Ga0436362_0413279 3300039453 Bacteria 4306
615 Ga0436362_1155470 3300039453 Bacteria 10535
616 Ga0451807_1061003 3300041486 Bacteria 1313
617 Ga0451833_0369965 3300041491 Bacteria 43703
618 Ga0451837_0964406 3300041494 Bacteria 15188
619 Ga0451839_0063950 3300041496 Bacteria 43670
620 Ga0451845_0249129 3300041501 Bacteria 20670
621 Ga0451847_0341155 3300041503 Bacteria 20211
622 Ga0451851_1180298 3300041507 Bacteria 43516
623 Ga0451855_0392051 3300041511 Bacteria 3102
624 Ga0451853_2474193 3300041512 Bacteria 23134
625 Ga0439458_0013895 3300042157 Bacteria 1815
626 Ga0466972_0000172 3300044658 Bacteria 50564
627 Ga0466965_0005988 3300044683 Bacteria 5494
628 Ga0466966_0000128 3300044684 Bacteria 48511
629 Ga0466966_0074228 3300044684 Bacteria 2126
630 Ga0466966_0103222 3300044684 Bacteria 1762
631 Ga0466961_0000236 3300044693 Bacteria 37237
632 Ga0466963_0000255 3300044694 Bacteria 23380
633 Ga0466963_0200354 3300044694 Bacteria 1396
634 Ga0466968_0010295 3300044735 Bacteria 3623
635 Ga0466970_0000134 3300044765 Bacteria 33918
636 Ga0466970_0088464 3300044765 Bacteria 1680
637 Ga0466967_0091577 3300045976 Bacteria 2764
638 Ga0466967_0099398 3300045976 Bacteria 2657
639 Ga0466967_0132211 3300045976 Bacteria 2318
640 Ga0466967_0211131 3300045976 Bacteria 1841
641 Ga0495592_0039287 3300046454 Bacteria 3556
642 Ga0495592_0072650 3300046454 Bacteria 2502
643 Ga0495603_0000217 3300046455 Bacteria 29788
644 Ga0495603_0039310 3300046455 Bacteria 2835
645 Ga0495603_0050966 3300046455 Bacteria 2460
646 Ga0495590_0050349 3300046457 Bacteria 1454
647 Ga0495629_0000373 3300046459 Bacteria 37733
648 Ga0495629_0000862 3300046459 Bacteria 24478
649 Ga0495629_0021438 3300046459 Bacteria 4611
650 Ga0495629_0179830 3300046459 Bacteria 1466
651 Ga0495638_0004887 3300046460 Bacteria 10075
652 Ga0495638_0005277 3300046460 Bacteria 9656
653 Ga0495638_0007591 3300046460 Bacteria 7759
654 Ga0495638_0031312 3300046460 Bacteria 3419
655 Ga0495638_0035964 3300046460 Bacteria 3155
656 Ga0495638_0036703 3300046460 Bacteria 3121
657 Ga0495638_0041257 3300046460 Bacteria 2921
658 Ga0495641_0019640 3300046461 Bacteria 3450
659 Ga0495641_0048799 3300046461 Bacteria 1940
660 Ga0495651_0007091 3300046462 Bacteria 8568
661 Ga0495651_0019146 3300046462 Bacteria 5304
662 Ga0495653_0218377 3300046463 Bacteria 1283
663 Ga0495653_0255541 3300046463 Bacteria 1161
664 Ga0495653_0270068 3300046463 Bacteria 1120
665 Ga0495580_0006588 3300046472 Bacteria 9437
666 Ga0495580_0059540 3300046472 Bacteria 2684
667 Ga0495582_0006572 3300046473 Bacteria 6452
668 Ga0495582_0036743 3300046473 Bacteria 2694
669 Ga0495605_0046230 3300046474 Bacteria 2141
670 Ga0495639_0000544 3300046475 Bacteria 17562
671 Ga0495639_0038283 3300046475 Bacteria 2153
672 Ga0495639_0059296 3300046475 Bacteria 1752
673 Ga0495662_0045498 3300046476 Bacteria 2119
674 Ga0495662_0083343 3300046476 Bacteria 1556
675 Ga0495662_0123647 3300046476 Bacteria 1271
676 Ga0495664_0001505 3300046477 Bacteria 12344
677 Ga0495664_0019029 3300046477 Bacteria 3944
678 Ga0495664_0034156 3300046477 Bacteria 2991
679 Ga0495664_0039921 3300046477 Bacteria 2774
680 Ga0495664_0089999 3300046477 Bacteria 1845
681 Ga0495664_0098203 3300046477 Bacteria 1763
682 Ga0495584_0124283 3300046491 Bacteria 1307
683 Ga0495585_0033769 3300046492 Bacteria 2894
684 Ga0495606_0043636 3300046507 Bacteria 2988
685 Ga0495608_0002876 3300046511 Bacteria 12326
686 Ga0495608_0046266 3300046511 Bacteria 2896
687 Ga0495608_0224764 3300046511 Bacteria 1177
688 Ga0495610_0050549 3300046512 Bacteria 2029
689 Ga0495618_0009642 3300046514 Bacteria 5830
690 Ga0495618_0035976 3300046514 Bacteria 3107
691 Ga0495618_0066415 3300046514 Bacteria 2293
692 Ga0495628_0009755 3300046516 Bacteria 8185
693 Ga0495630_0026624 3300046517 Bacteria 4283
694 Ga0495630_0060767 3300046517 Bacteria 2837
695 Ga0495631_0005680 3300046518 Bacteria 6509
696 Ga0495632_0015036 3300046519 Bacteria 4354
697 Ga0495648_0001373 3300046524 Bacteria 23995
698 Ga0495648_0042914 3300046524 Bacteria 2841
699 Ga0495648_0071291 3300046524 Bacteria 2015
700 Ga0495663_0032864 3300046525 Bacteria 1547
701 Ga0495666_0067701 3300046526 Bacteria 1701
702 Ga0495652_0076709 3300046529 Bacteria 2772
703 Ga0495652_0090139 3300046529 Bacteria 2509
704 Ga0495652_0104274 3300046529 Bacteria 2294
705 Ga0495652_0158158 3300046529 Bacteria 1762
706 Ga0495654_0048470 3300046530 Bacteria 2084
707 Ga0495665_0006186 3300046531 Bacteria 6465
708 Ga0495665_0131920 3300046531 Bacteria 1308
709 Ga0495640_0002595 3300046533 Bacteria 14526
710 Ga0495586_0079707 3300046535 Bacteria 1798
711 Ga0495587_0197223 3300046536 Bacteria 1139
712 Ga0495597_0103842 3300046542 Bacteria 1196
713 Ga0495622_0034428 3300046557 Bacteria 2362
714 Ga0495622_0132899 3300046557 Bacteria 1132
715 Ga0495667_0034851 3300046559 Bacteria 3366
716 Ga0495668_0022434 3300046616 Bacteria 3608
717 Ga0495634_0001583 3300046642 Bacteria 19998
718 Ga0495634_0061661 3300046642 Bacteria 2492
719 Ga0495625_0069908 3300046660 Bacteria 2466
720 Ga0495625_0127525 3300046660 Bacteria 1726
721 Ga0495625_0145977 3300046660 Bacteria 1593
722 Ga0495625_0150911 3300046660 Bacteria 1562
723 Ga0495625_0205758 3300046660 Bacteria 1296
724 Ga0495635_0000436 3300046663 Bacteria 26341
725 Ga0495635_0051959 3300046663 Bacteria 2823
726 Ga0495635_0224503 3300046663 Bacteria 1270
727 Ga0495635_0229304 3300046663 Bacteria 1255
728 Ga0495635_0272705 3300046663 Bacteria 1137
729 Ga0495661_0020469 3300046665 Bacteria 4318
730 Ga0495588_0183087 3300046674 Bacteria 1107
731 Ga0495657_0028186 3300046675 Bacteria 3953
732 Ga0495657_0053230 3300046675 Bacteria 2709
733 Ga0495657_0058184 3300046675 Bacteria 2567
734 Ga0495657_0193184 3300046675 Bacteria 1243
735 Ga0495599_0042775 3300046678 Bacteria 2843
736 Ga0495599_0209926 3300046678 Bacteria 1194
737 Ga0495623_0056660 3300046679 Bacteria 2467
738 Ga0495623_0097772 3300046679 Bacteria 1793
739 Ga0495623_0184015 3300046679 Bacteria 1211
740 Ga0495646_0005491 3300046680 Bacteria 8015
741 Ga0495647_0011285 3300046681 Bacteria 3060
742 Ga0495658_0003203 3300046683 Bacteria 8153
743 Ga0495669_0000650 3300046684 Bacteria 15146
744 Ga0495613_0007707 3300046689 Bacteria 8008
745 Ga0495613_0332423 3300046689 Bacteria 1047
746 Ga0495624_0023168 3300046690 Bacteria 4096
747 Ga0495624_0040628 3300046690 Bacteria 2978
748 Ga0495624_0082181 3300046690 Bacteria 1994
749 Ga0495649_0036062 3300046694 Bacteria 2718
750 Ga0495581_0003127 3300047315 Bacteria 9472
751 Ga0495581_0019323 3300047315 Bacteria 3954
752 Ga0495604_0006866 3300047317 Bacteria 9024
753 Ga0495604_0025855 3300047317 Bacteria 4675
754 Ga0495604_0027516 3300047317 Bacteria 4521
755 Ga0495604_0290784 3300047317 Bacteria 1100
756 Ga0495674_0008459 3300047319 Bacteria 9804
757 Ga0495674_0069954 3300047319 Bacteria 3034
758 Ga0495674_0093019 3300047319 Bacteria 2573
759 Ga0495674_0208714 3300047319 Bacteria 1618
760 Ga0495672_0133076 3300047320 Bacteria 1306
761 Ga0495672_0137431 3300047320 Bacteria 1280
762 Ga0495676_0027208 3300047321 Bacteria 4908
763 Ga0495676_0146496 3300047321 Bacteria 1686
764 Ga0495680_0001711 3300047322 Bacteria 23324
765 Ga0495680_0009863 3300047322 Bacteria 8560
766 Ga0495687_024676 3300047443 Bacteria 2854
767 Ga0495687_080788 3300047443 Bacteria 1274
768 Ga0495675_0005291 3300047444 Bacteria 7859
769 Ga0495675_0148817 3300047444 Bacteria 1447
770 Ga0495675_0267562 3300047444 Bacteria 1022
771 Ga0495673_0051615 3300047469 Bacteria 1800
772 Ga0495673_0079470 3300047469 Bacteria 1361
773 Ga0495681_0001771 3300047470 Bacteria 15902
774 Ga0495686_0015184 3300047472 Bacteria 5273
775 Ga0495686_0046169 3300047472 Bacteria 2755
776 Ga0495686_0060792 3300047472 Bacteria 2348
777 Ga0495686_0215198 3300047472 Bacteria 1096
778 Ga0495593_0000439 3300047673 Bacteria 23237
779 Ga0495593_0011115 3300047673 Bacteria 5179
780 Ga0495602_0009113 3300048088 Bacteria 10332
781 Ga0495602_0112361 3300048088 Bacteria 2211
782 Ga0496100_0239829 3300048903 Bacteria 1337
783 Ga0496100_0361047 3300048903 Bacteria 1099
784 Ga0496101_0230194 3300048904 Bacteria 1440
785 Ga0496101_0389923 3300048904 Bacteria 1096
786 Ga0496102_0001771 3300048905 Bacteria 18745
787 Ga0496102_0236815 3300048905 Bacteria 1721
788 Ga0496103_0110315 3300048906 Bacteria 1747
789 Ga0496104_0009950 3300048907 Bacteria 8486
790 Ga0496104_0020613 3300048907 Bacteria 6045
791 Ga0496104_0048391 3300048907 Bacteria 4009
792 Ga0496104_0136187 3300048907 Bacteria 2360
793 Ga0496104_0183454 3300048907 Bacteria 2003
794 Ga0496105_0009060 3300048908 Bacteria 7765
795 Ga0496105_0011039 3300048908 Bacteria 7120
796 Ga0496105_0030405 3300048908 Bacteria 4425
797 Ga0496105_0050186 3300048908 Bacteria 3446
798 Ga0496105_0078455 3300048908 Bacteria 2726
799 Ga0496105_0265527 3300048908 Bacteria 1387
800 Ga0496106_0009997 3300048909 Bacteria 7007
801 Ga0496106_0024362 3300048909 Bacteria 4499
802 Ga0496106_0075303 3300048909 Bacteria 2585
803 Ga0496106_0080447 3300048909 Bacteria 2502
804 Ga0496106_0144906 3300048909 Bacteria 1870
805 Ga0496107_0036192 3300048910 Bacteria 3540
806 Ga0496107_0081293 3300048910 Bacteria 2363
807 Ga0496107_0087790 3300048910 Bacteria 2270
808 Ga0496107_0156403 3300048910 Bacteria 1688
809 Ga0496107_0250797 3300048910 Bacteria 1317
810 Ga0496107_0295121 3300048910 Bacteria 1206
811 Ga0496107_0360167 3300048910 Bacteria 1082
812 Ga0496108_0006149 3300048911 Bacteria 9711
813 Ga0496108_0052308 3300048911 Bacteria 3422
814 Ga0496108_0066703 3300048911 Bacteria 3035
815 Ga0496108_0171015 3300048911 Bacteria 1880
816 Ga0496108_0460371 3300048911 Bacteria 1111
817 Ga0496109_0003373 3300048912 Bacteria 13363
818 Ga0496109_0031880 3300048912 Bacteria 4734
819 Ga0496109_0067050 3300048912 Bacteria 3287
820 Ga0496109_0328347 3300048912 Bacteria 1444
821 Ga0496110_0004493 3300048913 Bacteria 10817
822 Ga0496110_0055465 3300048913 Bacteria 3487
823 Ga0496110_0060878 3300048913 Bacteria 3331
824 Ga0496110_0111575 3300048913 Bacteria 2458
825 Ga0496110_0229981 3300048913 Bacteria 1686
826 Ga0496110_0266126 3300048913 Bacteria 1560
827 Ga0496110_0349744 3300048913 Bacteria 1346
828 Ga0496111_0029145 3300048914 Bacteria 3919
829 Ga0496111_0039869 3300048914 Bacteria 3370
830 Ga0496111_0108886 3300048914 Bacteria 2040
831 Ga0496111_0239188 3300048914 Bacteria 1348
832 Ga0496111_0251845 3300048914 Bacteria 1311
833 Ga0496112_0000017 3300048915 Bacteria 191284
834 Ga0496112_0013582 3300048915 Bacteria 7524
835 Ga0496112_0017643 3300048915 Bacteria 6713
836 Ga0496112_0019263 3300048915 Bacteria 6437
837 Ga0496112_0023520 3300048915 Bacteria 5888
838 Ga0496112_0137365 3300048915 Bacteria 2414
839 Ga0496112_0258947 3300048915 Bacteria 1689
840 Ga0496113_0011007 3300048916 Bacteria 6011
841 Ga0496113_0031143 3300048916 Bacteria 3868
842 Ga0496113_0071067 3300048916 Bacteria 2647
843 Ga0496113_0098584 3300048916 Bacteria 2262
844 Ga0496113_0111346 3300048916 Bacteria 2131
845 Ga0496113_0117920 3300048916 Bacteria 2073
846 Ga0496114_0011547 3300048917 Bacteria 7058
847 Ga0496114_0075593 3300048917 Bacteria 2837
848 Ga0496114_0266637 3300048917 Bacteria 1509
849 Ga0496115_0000535 3300048918 Bacteria 29580
850 Ga0496115_0002841 3300048918 Bacteria 12459
851 Ga0496115_0019252 3300048918 Bacteria 5251
852 Ga0496115_0034965 3300048918 Bacteria 3973
853 Ga0496115_0281783 3300048918 Bacteria 1364
854 Ga0496115_0323774 3300048918 Bacteria 1260
855 Ga0496116_0003125 3300048919 Bacteria 16633
856 Ga0496116_0040044 3300048919 Bacteria 3231
857 Ga0496117_0030138 3300048920 Bacteria 4169
858 Ga0496117_0035196 3300048920 Bacteria 3762
859 Ga0496117_0040628 3300048920 Bacteria 3418
860 Ga0496117_0118917 3300048920 Bacteria 1628
861 Ga0496117_0208330 3300048920 Bacteria 1098
862 Ga0496118_0003407 3300048921 Bacteria 20095
863 Ga0496118_0046295 3300048921 Bacteria 3386
864 Ga0496118_0069280 3300048921 Bacteria 2556
865 Ga0496118_0088763 3300048921 Bacteria 2137
866 Ga0496119_0001101 3300048922 Bacteria 34050
867 Ga0496119_0007752 3300048922 Bacteria 9586
868 Ga0496119_0008841 3300048922 Bacteria 8759
869 Ga0496119_0103668 3300048922 Bacteria 1593
870 Ga0496119_0117286 3300048922 Bacteria 1468
871 Ga0496119_0167292 3300048922 Bacteria 1164
872 Ga0496119_0177755 3300048922 Bacteria 1119
873 Ga0496120_0001458 3300048923 Bacteria 28286
874 Ga0496120_0009210 3300048923 Bacteria 7032
875 Ga0496120_0073827 3300048923 Bacteria 1865
876 Ga0496120_0138924 3300048923 Bacteria 1235
877 Ga0496121_0000230 3300048924 Bacteria 120616
878 Ga0496121_0004694 3300048924 Bacteria 18101
879 Ga0496121_0017764 3300048924 Bacteria 7233
880 Ga0496121_0024355 3300048924 Bacteria 5791
881 Ga0496121_0041666 3300048924 Bacteria 4010
882 Ga0496121_0080840 3300048924 Bacteria 2574
883 Ga0496121_0091769 3300048924 Bacteria 2370
884 Ga0496121_0125237 3300048924 Bacteria 1933
885 Ga0496121_0169240 3300048924 Bacteria 1589
886 Ga0496121_0192443 3300048924 Bacteria 1461
887 Ga0496122_0030277 3300048925 Bacteria 4540
888 Ga0496122_0038492 3300048925 Bacteria 3831
889 Ga0496122_0073006 3300048925 Bacteria 2436
890 Ga0496122_0125370 3300048925 Bacteria 1645
891 Ga0496123_0037892 3300048926 Bacteria 3398
892 Ga0496123_0041691 3300048926 Bacteria 3177
893 Ga0496124_0025798 3300048927 Bacteria 5313
894 Ga0496124_0027163 3300048927 Bacteria 5143
895 Ga0496124_0133515 3300048927 Bacteria 1968
896 Ga0496125_0000040 3300048928 Bacteria 314478
897 Ga0496125_0004755 3300048928 Bacteria 15477
898 Ga0496125_0022192 3300048928 Bacteria 5899
899 Ga0496125_0070258 3300048928 Bacteria 2742
900 Ga0496125_0089522 3300048928 Bacteria 2314
901 Ga0496125_0165961 3300048928 Bacteria 1492
902 Ga0496125_0197085 3300048928 Bacteria 1323
903 Ga0496125_0252256 3300048928 Bacteria 1112
904 Ga0496126_0002483 3300048929 Bacteria 24817
905 Ga0496126_0005712 3300048929 Bacteria 14100
906 Ga0496126_0012513 3300048929 Bacteria 8686
907 Ga0496126_0019903 3300048929 Bacteria 6598
908 Ga0496126_0024496 3300048929 Bacteria 5826
909 Ga0496126_0026298 3300048929 Bacteria 5582
910 Ga0496126_0037757 3300048929 Bacteria 4503
911 Ga0496126_0082588 3300048929 Bacteria 2838
912 Ga0496126_0102216 3300048929 Bacteria 2506
913 Ga0496126_0113178 3300048929 Bacteria 2362
914 Ga0496126_0209858 3300048929 Bacteria 1640
915 Ga0495682_0026404 3300049460 Bacteria 2156
916 Ga0495682_0046817 3300049460 Bacteria 1578
917 Ga0501031_0000007 3300049568 Bacteria 166008
918 Ga0501031_0008668 3300049568 Bacteria 6613
919 Ga0501031_0029381 3300049568 Bacteria 3585
920 Ga0501031_0153083 3300049568 Bacteria 1507
921 Ga0501032_0000007 3300049569 Bacteria 253881
922 Ga0501032_0000107 3300049569 Bacteria 71122
923 Ga0501032_0003811 3300049569 Bacteria 11447
924 Ga0501032_0256784 3300049569 Bacteria 1134
925 Ga0501033_0000040 3300049570 Bacteria 142586
926 Ga0501033_0000144 3300049570 Bacteria 68553
927 Ga0501033_0000311 3300049570 Bacteria 46039
928 Ga0501033_0000377 3300049570 Bacteria 42799
929 Ga0501033_0009009 3300049570 Bacteria 7699
930 Ga0501033_0024192 3300049570 Bacteria 4582
931 Ga0501033_0123389 3300049570 Bacteria 1878
932 Ga0501033_0240288 3300049570 Bacteria 1285
933 Ga0501033_0258130 3300049570 Bacteria 1234
934 Ga0501034_0000029 3300049571 Bacteria 253881
935 Ga0501034_0000039 3300049571 Bacteria 237357
936 Ga0501034_0000340 3300049571 Bacteria 81287
937 Ga0501034_0000412 3300049571 Bacteria 71925
938 Ga0501034_0042626 3300049571 Bacteria 4594
939 Ga0501034_0056930 3300049571 Bacteria 3932
940 Ga0501034_0062003 3300049571 Bacteria 3754
941 Ga0501034_0083900 3300049571 Bacteria 3188
942 Ga0501034_0159669 3300049571 Bacteria 2226
943 Ga0501034_0224874 3300049571 Bacteria 1828
944 Ga0501034_0260170 3300049571 Bacteria 1678
945 Ga0501036_0000004 3300049572 Bacteria 253881
946 Ga0501036_0000007 3300049572 Bacteria 240500
947 Ga0501036_0000127 3300049572 Bacteria 48559
948 Ga0501036_0017468 3300049572 Bacteria 5998
949 Ga0501037_0000004 3300049573 Bacteria 253989
950 Ga0501037_0000025 3300049573 Bacteria 143276
951 Ga0501037_0000066 3300049573 Bacteria 96723
952 Ga0501037_0000198 3300049573 Bacteria 54028
953 Ga0501037_0178247 3300049573 Bacteria 1509
954 Ga0501038_0000005 3300049574 Bacteria 253881
955 Ga0501038_0000026 3300049574 Bacteria 146493
956 Ga0501038_0000342 3300049574 Bacteria 40148
957 Ga0501038_0048255 3300049574 Bacteria 3685
958 Ga0501039_0000005 3300049575 Bacteria 295471
959 Ga0501039_0000009 3300049575 Bacteria 253881
960 Ga0501039_0000840 3300049575 Bacteria 22181
961 Ga0501039_0128660 3300049575 Bacteria 1987
962 Ga0501039_0205172 3300049575 Bacteria 1550
963 Ga0501040_0000754 3300049576 Bacteria 20093
964 Ga0501043_0000036 3300049579 Bacteria 132959
965 Ga0501043_0000100 3300049579 Bacteria 79167
966 Ga0501043_0000120 3300049579 Bacteria 72670
967 Ga0501043_0000836 3300049579 Bacteria 27366
968 Ga0501043_0050992 3300049579 Bacteria 3253
969 Ga0501043_0056514 3300049579 Bacteria 3083
970 Ga0501043_0141832 3300049579 Bacteria 1881
971 Ga0501046_0000359 3300049580 Bacteria 45929
972 Ga0501046_0002399 3300049580 Bacteria 17586
973 Ga0501046_0062699 3300049580 Bacteria 2904
974 Ga0501046_0164346 3300049580 Bacteria 1668
975 Ga0501047_0000209 3300049581 Bacteria 70658
976 Ga0501047_0000379 3300049581 Bacteria 50147
977 Ga0501047_0000895 3300049581 Bacteria 30440
978 Ga0501047_0007647 3300049581 Bacteria 10175
979 Ga0501047_0022062 3300049581 Bacteria 6116
980 Ga0501047_0117808 3300049581 Bacteria 2537
981 Ga0501047_0209162 3300049581 Bacteria 1810
982 Ga0501048_0000352 3300049582 Bacteria 31854
983 Ga0501048_0004356 3300049582 Bacteria 10775
984 Ga0501067_0000025 3300049583 Bacteria 91481
985 Ga0501067_0048682 3300049583 Bacteria 2350
986 Ga0501067_0160307 3300049583 Bacteria 1253
987 Ga0501068_0000801 3300049584 Bacteria 16289
988 Ga0501068_0001230 3300049584 Bacteria 13601
989 Ga0501068_0024081 3300049584 Bacteria 3573
990 Ga0501069_0000020 3300049585 Bacteria 122595
991 Ga0501069_0001694 3300049585 Bacteria 10972
992 Ga0501069_0016353 3300049585 Bacteria 3984
993 Ga0501070_0000174 3300049586 Bacteria 59663
994 Ga0501070_0002185 3300049586 Bacteria 17207
995 Ga0501070_0005683 3300049586 Bacteria 10634
996 Ga0501070_0011186 3300049586 Bacteria 7576
997 Ga0501070_0069472 3300049586 Bacteria 2916
998 Ga0501070_0135263 3300049586 Bacteria 2035
999 Ga0501070_0176217 3300049586 Bacteria 1760
1000 Ga0501071_0017012 3300049587 Bacteria 5007
1001 Ga0501072_0149146 3300049588 Bacteria 1865
1002 Ga0501073_0000070 3300049589 Bacteria 63026
1003 Ga0501073_0000091 3300049589 Bacteria 57029
1004 Ga0501073_0015856 3300049589 Bacteria 5461
1005 Ga0501073_0021242 3300049589 Bacteria 4679
1006 Ga0501073_0035474 3300049589 Bacteria 3545
1007 Ga0501074_0000015 3300049590 Bacteria 79939
1008 Ga0501074_0000489 3300049590 Bacteria 24170
1009 Ga0501074_0001218 3300049590 Bacteria 16946
1010 Ga0501074_0120763 3300049590 Bacteria 1874
1011 Ga0501075_0045965 3300049591 Bacteria 3279
1012 Ga0501076_0118741 3300049592 Bacteria 2141
1013 Ga0501079_0096719 3300049741 Bacteria 2289
1014 Ga0501080_0000132 3300049742 Bacteria 52967
1015 Ga0501080_0000321 3300049742 Bacteria 36637
1016 Ga0501080_0026275 3300049742 Bacteria 5410
1017 Ga0501080_0080954 3300049742 Bacteria 3018
1018 Ga0501080_0118362 3300049742 Bacteria 2456
1019 Ga0501080_0146807 3300049742 Bacteria 2180
1020 Ga0501080_0252213 3300049742 Bacteria 1609
1021 Ga0501081_0124769 3300049743 Bacteria 1836
1022 Ga0501083_0000284 3300049744 Bacteria 32169
1023 Ga0501083_0151276 3300049744 Bacteria 1519
1024 Ga0501083_0193412 3300049744 Bacteria 1328
1025 Ga0501035_0000014 3300049822 Bacteria 253874
1026 Ga0501035_0000016 3300049822 Bacteria 243412
1027 Ga0501035_0000070 3300049822 Bacteria 127442
1028 Ga0501035_0000346 3300049822 Bacteria 53542
1029 Ga0501035_0001251 3300049822 Bacteria 26410
1030 Ga0501035_0001605 3300049822 Bacteria 22866
1031 Ga0501035_0011180 3300049822 Bacteria 8313
1032 Ga0501035_0025723 3300049822 Bacteria 5395
1033 Ga0501035_0225697 3300049822 Bacteria 1598
1034 Ga0501035_0361460 3300049822 Bacteria 1213
1035 Ga0501044_0000012 3300049823 Bacteria 253881
1036 Ga0501044_0000037 3300049823 Bacteria 161924
1037 Ga0501044_0000274 3300049823 Bacteria 65668
1038 Ga0501044_0000383 3300049823 Bacteria 54973
1039 Ga0501044_0024200 3300049823 Bacteria 6451
1040 Ga0501044_0057358 3300049823 Bacteria 3996
1041 Ga0501044_0066220 3300049823 Bacteria 3684
1042 Ga0501044_0090497 3300049823 Bacteria 3087
1043 Ga0501044_0102592 3300049823 Bacteria 2876
1044 Ga0501044_0158683 3300049823 Bacteria 2240
1045 Ga0501044_0202591 3300049823 Bacteria 1942
1046 Ga0501045_0020164 3300049824 Bacteria 4760
1047 nmdc:mga03683_19105_c1 3300050489 Bacteria 2612
1048 nmdc:mga03683_48412_c1 3300050489 Bacteria 1766
1049 nmdc:mga03n38_121304_c1 3300050490 Bacteria 1285
1050 nmdc:mga03n38_2341_c1 3300050490 Bacteria 5824
1051 nmdc:mga03n38_84717_c1 3300050490 Bacteria 1497
1052 nmdc:mga00v17_29763_c1 3300050491 Bacteria 3206
1053 nmdc:mga00v17_60502_c1 3300050491 Bacteria 2326
1054 nmdc:mga0yw44_247562_c1 3300050492 Bacteria 1186
1055 nmdc:mga0yw44_72110_c1 3300050492 Bacteria 2146
1056 nmdc:mga06z11_101586_c1 3300050494 Bacteria 1579
1057 nmdc:mga06z11_119861_c1 3300050494 Bacteria 1467
1058 nmdc:mga06z11_246042_c1 3300050494 Bacteria 1052
1059 nmdc:mga06z11_4265_c1 3300050494 Bacteria 5612
1060 nmdc:mga06z11_78986_c2 3300050494 Bacteria 1425
1061 nmdc:mga04h51_1143_c1 3300050495 Bacteria 6129
1062 nmdc:mga07m45_38017_c1 3300050496 Bacteria 2685
1063 nmdc:mga07m45_745_c1 3300050496 Bacteria 13914
1064 nmdc:mga05p37_196560_c1 3300050507 Bacteria 2445
1065 nmdc:mga09592_18338_c1 3300050508 Bacteria 5739
1066 nmdc:mga0qj67_76787_c1 3300050509 Bacteria 2672
1067 nmdc:mga06r32_1860_c1 3300050510 Bacteria 18800
1068 nmdc:mga0n895_44891_c1 3300050512 Bacteria 4310
1069 nmdc:mga0rr50_459721_c1 3300050513 Bacteria 1079
1070 nmdc:mga08x19_102727_c1 3300050514 Bacteria 1898
1071 nmdc:mga0sz30_1713_c1 3300050516 Bacteria 7785
1072 nmdc:mga0sz30_23321_c1 3300050516 Bacteria 2516
1073 nmdc:mga0sz30_24928_c1 3300050516 Bacteria 2444
1074 nmdc:mga0sz30_45346_c1 3300050516 Bacteria 1854
1075 Ga0495601_0158215 3300053077 Bacteria 1480
1076 Ga0495601_0256864 3300053077 Bacteria 1141
1077 Ga0500635_0075124 3300053080 Bacteria 1205
1078 Ga0495595_0006301 3300053084 Bacteria 4832
1079 Ga0495595_0053818 3300053084 Bacteria 1870
1080 Ga0500578_0168169 3300053086 Bacteria 1357
1081 Ga0500643_000456 3300053087 Bacteria 30270
1082 Ga0500646_0008495 3300053090 Bacteria 2626
1083 Ga0500651_0069381 3300053093 Bacteria 2194
1084 Ga0500566_0000370 3300053094 Bacteria 24642
1085 Ga0500566_0006011 3300053094 Bacteria 7218
1086 Ga0500566_0006917 3300053094 Bacteria 6718
1087 Ga0500566_0040773 3300053094 Bacteria 2684
1088 Ga0500640_013671 3300053095 Bacteria 3364
1089 Ga0500641_0002674 3300053096 Bacteria 6295
1090 Ga0500641_0027454 3300053096 Bacteria 2216
1091 Ga0500650_0000365 3300053098 Bacteria 10988
1092 Ga0500650_0036142 3300053098 Bacteria 2266
1093 Ga0500554_004225 3300053102 Bacteria 3024
1094 Ga0500555_003144 3300053103 Bacteria 4710
1095 Ga0500556_0044111 3300053104 Bacteria 1586
1096 Ga0500557_000003 3300053105 Bacteria 228429
1097 Ga0500569_021582 3300053109 Bacteria 1704
1098 Ga0500572_000024 3300053111 Bacteria 47391
1099 Ga0500595_000537 3300053119 Bacteria 22809
1100 Ga0500595_003301 3300053119 Bacteria 7598
1101 Ga0500595_009837 3300053119 Bacteria 3838
1102 Ga0500595_016895 3300053119 Bacteria 2708
1103 Ga0500595_022156 3300053119 Bacteria 2255
1104 Ga0500608_000807 3300053122 Bacteria 11372
1105 Ga0500608_001300 3300053122 Bacteria 8888
1106 Ga0500608_099345 3300053122 Bacteria 1350
1107 Ga0500618_000334 3300053125 Bacteria 33962
1108 Ga0500642_0000019 3300053130 Bacteria 159944
1109 Ga0500642_0000252 3300053130 Bacteria 20158
1110 Ga0500655_005108 3300053133 Bacteria 2364
1111 Ga0500559_0001011 3300053136 Bacteria 17309
1112 Ga0500559_0003877 3300053136 Bacteria 7232
1113 Ga0500568_0001665 3300053139 Bacteria 13926
1114 Ga0500577_0000833 3300053142 Bacteria 7986
1115 Ga0500586_000414 3300053145 Bacteria 8543
1116 Ga0500590_000050 3300053148 Bacteria 28213
1117 Ga0500590_017662 3300053148 Bacteria 3688
1118 Ga0500590_047558 3300053148 Bacteria 2189
1119 Ga0500603_000391 3300053150 Bacteria 11472
1120 Ga0500603_000801 3300053150 Bacteria 7516
1121 Ga0500604_0001275 3300053151 Bacteria 7050
1122 Ga0500604_0059581 3300053151 Bacteria 1196
1123 Ga0500616_0000041 3300053153 Bacteria 359328
1124 Ga0500616_0000210 3300053153 Bacteria 94120
1125 Ga0500616_0046158 3300053153 Bacteria 2317
1126 Ga0500620_000042 3300053155 Bacteria 23446
1127 Ga0500622_0002498 3300053156 Bacteria 13232
1128 Ga0500627_0029367 3300053158 Bacteria 2293
1129 Ga0500627_0069753 3300053158 Bacteria 1556
1130 Ga0500630_000112 3300053159 Bacteria 26672
1131 Ga0500634_0033049 3300053161 Bacteria 2820
1132 Ga0500638_047219 3300053162 Bacteria 2085
1133 Ga0500638_068958 3300053162 Bacteria 1692
1134 Ga0500639_000040 3300053163 Bacteria 63516
1135 Ga0500636_0000365 3300053177 Bacteria 24884
1136 Ga0500636_0012982 3300053177 Bacteria 4887
1137 Ga0500636_0036809 3300053177 Bacteria 2895
1138 Ga0500636_0064889 3300053177 Bacteria 2126
1139 Ga0500637_0000042 3300053178 Bacteria 46215
1140 Ga0500637_0002167 3300053178 Bacteria 8637
1141 Ga0500570_082598 3300053724 Bacteria 1439
1142 Ga0500625_009292 3300053729 Bacteria 4380
1143 Ga0500645_039063 3300053730 Bacteria 1407
1144 Ga0500596_000794 3300053735 Bacteria 6229
1145 Ga0500599_007283 3300053736 Bacteria 1421
1146 Ga0500601_000203 3300053737 Bacteria 12048
1147 Ga0501084_0104186 3300054114 Bacteria 2383
1148 Ga0500661_000056 3300055283 Bacteria 17736
1149 Ga0500661_015268 3300055283 Bacteria 1378
1150 Ga0501082_0040063 3300060353 Bacteria 4042
1151 Ga0530510_0057533 3300061734 Bacteria 2809

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006944 Ga0099823_1024506 Ga0099823_10245065 265
2 3300025915 Ga0207693_10188687 Ga0207693_101886872 272
3 iso_pu_bacteria 8019629233 8019633319 289
4 iso_pu_bacteria 2876406927 2876407709 290
5 3300049571 Ga0501034_0056930 Ga0501034_0056930_23_922 299
6 3300053737 Ga0500601_000203 Ga0500601_000203_5969_6952 303
7 3300035725 Ga0373947_0025283 Ga0373947_0025283_10_933 306
8 3300037466 Ga0395898_0211039 Ga0395898_0211039_221_1204 306
9 3300045976 Ga0466967_0211131 Ga0466967_0211131_901_1824 306
10 3300046476 Ga0495662_0083343 Ga0495662_0083343_21_944 306
11 3300046678 Ga0495599_0209926 Ga0495599_0209926_19_942 306
12 3300047444 Ga0495675_0267562 Ga0495675_0267562_78_1001 306
13 3300048904 Ga0496101_0389923 Ga0496101_0389923_157_1080 306
14 3300048922 Ga0496119_0177755 Ga0496119_0177755_180_1103 306
15 3300046529 Ga0495652_0158158 Ga0495652_0158158_49_1032 307
16 iso_pu_bacteria 8016511872 8016520679 308
17 3300042157 Ga0439458_0013895 Ga0439458_0013895_799_1782 310
18 3300006177 Ga0075362_10024903 Ga0075362_100249031 311
19 3300047320 Ga0495672_0137431 Ga0495672_0137431_196_1179 311
20 3300050489 nmdc:mga03683_19105_c1 nmdc:mga03683_19105_c1_1462_2445 311
21 iso_pu_bacteria 2876761206 2876766224 311
22 3300007788 Ga0099795_10047078 Ga0099795_100470782 312
23 3300027512 Ga0209179_1013166 Ga0209179_10131661 312
24 3300036401 Ga0373937_0028281 Ga0373937_0028281_3820_4803 312
25 3300049586 Ga0501070_0135263 Ga0501070_0135263_37_975 312
26 3300050494 nmdc:mga06z11_119861_c1 nmdc:mga06z11_119861_c1_519_1457 312
27 3300031250 Ga0265331_10008950 Ga0265331_100089505 315
28 3300031711 Ga0265314_10070042 Ga0265314_100700422 315
29 3300031712 Ga0265342_10042218 Ga0265342_100422183 315
30 3300046455 Ga0495603_0050966 Ga0495603_0050966_449_1405 317
31 3300048929 Ga0496126_0019903 Ga0496126_0019903_1017_2000 317
32 iso_pu_bacteria 2885342637 2885350578 317
33 3300035695 Ga0373927_0017091 Ga0373927_0017091_2374_3339 320
34 3300048917 Ga0496114_0266637 Ga0496114_0266637_429_1394 320
35 iso_pu_bacteria 2503198000 2503198697 322
36 iso_pu_bacteria 2507262055 2507507680 322
37 iso_pu_bacteria 2508501009 2508541796 322
38 iso_pu_bacteria 2508501042 2508692656 322
39 iso_pu_bacteria 2508501122 2509111107 322
40 iso_pu_bacteria 2508501128 2509149317 322
41 iso_pu_bacteria 2510065059 2510315015 322
42 iso_pu_bacteria 2510917030 2511197977 322
43 iso_pu_bacteria 2511231028 2511400924 322
44 iso_pu_bacteria 2512875024 2512962102 322
45 iso_pu_bacteria 2513237090 2513607902 322
46 iso_pu_bacteria 2513237092 2513628413 322
47 iso_pu_bacteria 2513237094 2513642969 322
48 iso_pu_bacteria 2513237095 2513647497 322
49 iso_pu_bacteria 2513237096 2513654072 322
50 iso_pu_bacteria 2513237098 2513679253 322
51 iso_pu_bacteria 2513237101 2513698087 322
52 iso_pu_bacteria 2513237104 2513719465 322
53 iso_pu_bacteria 2513237137 2513856824 322
54 iso_pu_bacteria 2513237139 2513878505 322
55 iso_pu_bacteria 2513237141 2513891269 322
56 iso_pu_bacteria 2513237145 2513918412 322
57 iso_pu_bacteria 2513237161 2514009448 322
58 iso_pu_bacteria 2513237162 2514024326 322
59 iso_pu_bacteria 2513237164 2514037202 322
60 iso_pu_bacteria 2513237305 2514421707 322
61 iso_pu_bacteria 2515154112 2515626062 322
62 iso_pu_bacteria 2515154114 2515646152 322
63 iso_pu_bacteria 2515154116 2515654730 322
64 iso_pu_bacteria 2516653077 2517040513 322
65 iso_pu_bacteria 2517093001 2517104141 322
66 iso_pu_bacteria 2517287029 2517411265 322
67 iso_pu_bacteria 2517572143 2517891354 322
68 iso_pu_bacteria 2519899620 2520378830 322
69 iso_pu_bacteria 2524023205 2524436294 322
70 iso_pu_bacteria 2524023210 2524468463 322
71 iso_pu_bacteria 2524023228 2524538460 322
72 iso_pu_bacteria 2528768022 2528848998 322
73 iso_pu_bacteria 2558860100 2558861119 322
74 iso_pu_bacteria 2582581316 2585332647 322
75 iso_pu_bacteria 2582581866 2585394946 322
76 iso_pu_bacteria 2585427590 2585824976 322
77 iso_pu_bacteria 2585427633 2585993168 322
78 iso_pu_bacteria 2599185301 2599939489 322
79 iso_pu_bacteria 2599185352 2600193850 322
80 iso_pu_bacteria 2602042107 2603860915 322
81 iso_pu_bacteria 2615840698 2616552956 322
82 iso_pu_bacteria 2617270735 2617346782 322
83 iso_pu_bacteria 2617270741 2617372711 322
84 iso_pu_bacteria 2617270742 2617381272 322
85 iso_pu_bacteria 2643221547 2643757944 322
86 iso_pu_bacteria 2643221557 2643805291 322
87 iso_pu_bacteria 2643221599 2644005370 322
88 iso_pu_bacteria 2643221610 2644064135 322
89 iso_pu_bacteria 2643221618 2644105330 322
90 iso_pu_bacteria 2643221626 2644147297 322
91 iso_pu_bacteria 2643221636 2644200670 322
92 iso_pu_bacteria 2643221651 2644291297 322
93 iso_pu_bacteria 2643221655 2644309817 322
94 iso_pu_bacteria 2643221659 2644333332 322
95 iso_pu_bacteria 2643221668 2644375741 322
96 iso_pu_bacteria 2643221675 2644415967 322
97 iso_pu_bacteria 2643221680 2644449008 322
98 iso_pu_bacteria 2643221698 2644543475 322
99 iso_pu_bacteria 2643221712 2644614390 322
100 iso_pu_bacteria 2643221723 2644674214 322
101 iso_pu_bacteria 2643221726 2644686468 322
102 iso_pu_bacteria 2657244999 2657685568 322
103 iso_pu_bacteria 2667528174 2671114629 322
104 iso_pu_bacteria 2667528175 2671118866 322
105 iso_pu_bacteria 2687453392 2688595985 322
106 iso_pu_bacteria 2690316117 2692319262 322
107 iso_pu_bacteria 2693429783 2694632799 322
108 iso_pu_bacteria 2693429784 2694639472 322
109 iso_pu_bacteria 2718217927 2719389855 322
110 iso_pu_bacteria 2718218423 2721403494 322
111 iso_pu_bacteria 2721755556 2723030455 322
112 iso_pu_bacteria 2721755684 2723564817 322
113 iso_pu_bacteria 2721755686 2723578132 322
114 iso_pu_bacteria 2721755755 2723843701 322
115 iso_pu_bacteria 2721755809 2724035070 322
116 iso_pu_bacteria 2728368998 2728750066 322
117 iso_pu_bacteria 2728368998 2728754014 322
118 iso_pu_bacteria 2728369352 2730110988 322
119 iso_pu_bacteria 2738543024 2739305594 322
120 iso_pu_bacteria 2744054633 2745080751 322
121 iso_pu_bacteria 2744054633 2745082613 322
122 iso_pu_bacteria 2775507266 2778174592 322
123 iso_pu_bacteria 2791355123 2792747194 322
124 iso_pu_bacteria 2791355196 2793065225 322
125 iso_pu_bacteria 2791355197 2793066722 322
126 iso_pu_bacteria 2791355199 2793080654 322
127 iso_pu_bacteria 2791355261 2793331291 322
128 iso_pu_bacteria 2791355263 2793344447 322
129 iso_pu_bacteria 2791355266 2793360053 322
130 iso_pu_bacteria 2791355267 2793367392 322
131 iso_pu_bacteria 2802429268 2804755187 322
132 iso_pu_bacteria 2802429603 2805919071 322
133 iso_pu_bacteria 2802429634 2806055854 322
134 iso_pu_bacteria 2802429635 2806061302 322
135 iso_pu_bacteria 2802429636 2806065765 322
136 iso_pu_bacteria 2816332527 2818236534 322
137 iso_pu_bacteria 2824600985 2824605713 322
138 iso_pu_bacteria 2824609381 2824611724 322
139 iso_pu_bacteria 2824617872 2824620392 322
140 iso_pu_bacteria 2824626560 2824628560 322
141 iso_pu_bacteria 2824635225 2824639088 322
142 iso_pu_bacteria 2824644064 2824649553 322
143 iso_pu_bacteria 2824653114 2824658215 322
144 iso_pu_bacteria 2824661429 2824666470 322
145 iso_pu_bacteria 2824671348 2824674137 322
146 iso_pu_bacteria 2824679649 2824685665 322
147 iso_pu_bacteria 2824687955 2824691978 322
148 iso_pu_bacteria 2824696289 2824701126 322
149 iso_pu_bacteria 2824704595 2824710247 322
150 iso_pu_bacteria 2824714736 2824720680 322
151 iso_pu_bacteria 2824723954 2824730942 322
152 iso_pu_bacteria 2824732956 2824735842 322
153 iso_pu_bacteria 2824746037 2824750089 322
154 iso_pu_bacteria 2824753945 2824755965 322
155 iso_pu_bacteria 2824763712 2824767503 322
156 iso_pu_bacteria 2824773399 2824775142 322
157 iso_pu_bacteria 2838029111 2838032564 322
158 iso_pu_bacteria 2838042994 2838047581 322
159 iso_pu_bacteria 2838122688 2838128809 322
160 iso_pu_bacteria 2840878972 2840881695 322
161 iso_pu_bacteria 2841760612 2841766398 322
162 iso_pu_bacteria 2841941048 2841945039 322
163 iso_pu_bacteria 2841949485 2841953460 322
164 iso_pu_bacteria 2841957949 2841959708 322
165 iso_pu_bacteria 2841966195 2841972063 322
166 iso_pu_bacteria 2841974524 2841978189 322
167 iso_pu_bacteria 2841983080 2841986184 322
168 iso_pu_bacteria 2842038055 2842040907 322
169 iso_pu_bacteria 2842045827 2842046148 322
170 iso_pu_bacteria 2842341865 2842345732 322
171 iso_pu_bacteria 2842475841 2842479296 322
172 iso_pu_bacteria 2842482326 2842485625 322
173 iso_pu_bacteria 2842502639 2842506545 322
174 iso_pu_bacteria 2842509118 2842515068 322
175 iso_pu_bacteria 2844002411 2844008707 322
176 iso_pu_bacteria 2844009547 2844010811 322
177 iso_pu_bacteria 2844104063 2844106165 322
178 iso_pu_bacteria 2844163670 2844166537 322
179 iso_pu_bacteria 2844315083 2844320005 322
180 iso_pu_bacteria 2847417321 2847422229 322
181 iso_pu_bacteria 2847930680 2847938317 322
182 iso_pu_bacteria 2847939898 2847947723 322
183 iso_pu_bacteria 2848992105 2848998272 322
184 iso_pu_bacteria 2849076700 2849078416 322
185 iso_pu_bacteria 2851182111 2851186666 322
186 iso_pu_bacteria 2851246043 2851246521 322
187 iso_pu_bacteria 2856320880 2856322160 322
188 iso_pu_bacteria 2856328259 2856332531 322
189 iso_pu_bacteria 2856334872 2856338463 322
190 iso_pu_bacteria 2856349417 2856355114 322
191 iso_pu_bacteria 2856364286 2856365541 322
192 iso_pu_bacteria 2857367948 2857369761 322
193 iso_pu_bacteria 2857509624 2857511302 322
194 iso_pu_bacteria 2857516855 2857523887 322
195 iso_pu_bacteria 2857524615 2857524633 322
196 iso_pu_bacteria 2869169390 2869170494 322
197 iso_pu_bacteria 2869234852 2869239438 322
198 iso_pu_bacteria 2869242130 2869249464 322
199 iso_pu_bacteria 2869256925 2869262908 322
200 iso_pu_bacteria 2869271264 2869277225 322
201 iso_pu_bacteria 2869278585 2869279018 322
202 iso_pu_bacteria 2869278585 2869284744 322
203 iso_pu_bacteria 2869285874 2869287016 322
204 iso_pu_bacteria 2871429161 2871434322 322
205 iso_pu_bacteria 2871435913 2871437928 322
206 iso_pu_bacteria 2871451962 2871454338 322
207 iso_pu_bacteria 2871481445 2871486562 322
208 iso_pu_bacteria 2871488783 2871492547 322
209 iso_pu_bacteria 2874109183 2874111300 322
210 iso_pu_bacteria 2874116593 2874119132 322
211 iso_pu_bacteria 2874139085 2874142935 322
212 iso_pu_bacteria 2874146452 2874147457 322
213 iso_pu_bacteria 2874155637 2874156463 322
214 iso_pu_bacteria 2874162495 2874165913 322
215 iso_pu_bacteria 2874168670 2874172453 322
216 iso_pu_bacteria 2874590934 2874598790 322
217 iso_pu_bacteria 2874604998 2874607390 322
218 iso_pu_bacteria 2874612657 2874614590 322
219 iso_pu_bacteria 2874620515 2874628346 322
220 iso_pu_bacteria 2874628541 2874635023 322
221 iso_pu_bacteria 2874645413 2874652246 322
222 iso_pu_bacteria 2876369609 2876371235 322
223 iso_pu_bacteria 2876377896 2876381839 322
224 iso_pu_bacteria 2876386047 2876390242 322
225 iso_pu_bacteria 2876399893 2876400112 322
226 iso_pu_bacteria 2876413966 2876414651 322
227 iso_pu_bacteria 2876420981 2876427681 322
228 iso_pu_bacteria 2876761206 2876765276 322
229 iso_pu_bacteria 2876771140 2876778829 322
230 iso_pu_bacteria 2876808645 2876814619 322
231 iso_pu_bacteria 2876818435 2876824276 322
232 iso_pu_bacteria 2878730984 2878732153 322
233 iso_pu_bacteria 2878738818 2878740995 322
234 iso_pu_bacteria 2878738818 2878745848 322
235 iso_pu_bacteria 2878745973 2878747197 322
236 iso_pu_bacteria 2878753008 2878758429 322
237 iso_pu_bacteria 2878774303 2878774470 322
238 iso_pu_bacteria 2878781027 2878784650 322
239 iso_pu_bacteria 2879074833 2879082622 322
240 iso_pu_bacteria 2879083081 2879086097 322
241 iso_pu_bacteria 2879099564 2879107115 322
242 iso_pu_bacteria 2879110137 2879114700 322
243 iso_pu_bacteria 2879127579 2879131539 322
244 iso_pu_bacteria 2879142872 2879147985 322
245 iso_pu_bacteria 2881147464 2881154226 322
246 iso_pu_bacteria 2881155292 2881158008 322
247 iso_pu_bacteria 2881161766 2881163294 322
248 iso_pu_bacteria 2881364244 2881371477 322
249 iso_pu_bacteria 2881665667 2881666560 322
250 iso_pu_bacteria 2881845957 2881850983 322
251 iso_pu_bacteria 2881853255 2881856911 322
252 iso_pu_bacteria 2881861095 2881866803 322
253 iso_pu_bacteria 2882912400 2882912913 322
254 iso_pu_bacteria 2885318864 2885323745 322
255 iso_pu_bacteria 2885350715 2885351991 322
256 iso_pu_bacteria 2885366525 2885370233 322
257 iso_pu_bacteria 2885374607 2885374991 322
258 iso_pu_bacteria 2885383462 2885384044 322
259 iso_pu_bacteria 2885409591 2885410280 322
260 iso_pu_bacteria 2888337043 2888343400 322
261 iso_pu_bacteria 2888378607 2888385434 322
262 iso_pu_bacteria 2888388044 2888392799 322
263 iso_pu_bacteria 2888419890 2888425868 322
264 iso_pu_bacteria 2889033259 2889038033 322
265 iso_pu_bacteria 2893066018 2893069154 322
266 iso_pu_bacteria 2898795034 2898795429 322
267 iso_pu_bacteria 2903492973 2903496722 322
268 iso_pu_bacteria 2903513507 2903519249 322
269 iso_pu_bacteria 2903727486 2903730320 322
270 iso_pu_bacteria 2903748898 2903755315 322
271 iso_pu_bacteria 2903768456 2903769712 322
272 iso_pu_bacteria 2904666416 2904674035 322
273 iso_pu_bacteria 2904690495 2904691222 322
274 iso_pu_bacteria 2904699407 2904701308 322
275 iso_pu_bacteria 2904711408 2904711990 322
276 iso_pu_bacteria 2906308376 2906309369 322
277 iso_pu_bacteria 2906321335 2906327019 322
278 iso_pu_bacteria 2906386501 2906390459 322
279 iso_pu_bacteria 2906401398 2906405745 322
280 iso_pu_bacteria 2906408224 2906412546 322
281 iso_pu_bacteria 2906427513 2906433675 322
282 iso_pu_bacteria 2906602504 2906604745 322
283 iso_pu_bacteria 2906610324 2906616540 322
284 iso_pu_bacteria 2906626472 2906627327 322
285 iso_pu_bacteria 2906635258 2906635313 322
286 iso_pu_bacteria 2906643746 2906648862 322
287 iso_pu_bacteria 2906660503 2906666858 322
288 iso_pu_bacteria 2908739725 2908741708 322
289 iso_pu_bacteria 2908756301 2908759137 322
290 iso_pu_bacteria 2908775508 2908781154 322
291 iso_pu_bacteria 2913295892 2913299984 322
292 iso_pu_bacteria 2919073203 2919078515 322
293 iso_pu_bacteria 2919408235 2919413356 322
294 iso_pu_bacteria 2922151315 2922156921 322
295 iso_pu_bacteria 2922172374 2922175696 322
296 iso_pu_bacteria 2922178524 2922181182 322
297 iso_pu_bacteria 2922361189 2922366032 322
298 iso_pu_bacteria 2922368715 2922372424 322
299 iso_pu_bacteria 2922386360 2922387367 322
300 iso_pu_bacteria 2922393267 2922397088 322
301 iso_pu_bacteria 2922425934 2922431440 322
302 iso_pu_bacteria 2924710171 2924714927 322
303 iso_pu_bacteria 2924718760 2924723530 322
304 iso_pu_bacteria 2924733363 2924734817 322
305 iso_pu_bacteria 2924741084 2924742272 322
306 iso_pu_bacteria 2924748358 2924748904 322
307 iso_pu_bacteria 2924776078 2924778596 322
308 iso_pu_bacteria 2924776078 2924784247 322
309 iso_pu_bacteria 2924784321 2924784526 322
310 iso_pu_bacteria 2929615660 2929621006 322
311 iso_pu_bacteria 2929624759 2929626163 322
312 iso_pu_bacteria 2932784394 2932784958 322
313 iso_pu_bacteria 2932794094 2932795164 322
314 iso_pu_bacteria 2932801729 2932805692 322
315 iso_pu_bacteria 2932809354 2932809990 322
316 iso_pu_bacteria 2932818245 2932818267 322
317 iso_pu_bacteria 2932828146 2932828795 322
318 iso_pu_bacteria 2933577622 2933583124 322
319 iso_pu_bacteria 2935608549 2935609810 322
320 iso_pu_bacteria 2935616580 2935619785 322
321 iso_pu_bacteria 2935630451 2935634036 322
322 iso_pu_bacteria 2935638405 2935638766 322
323 iso_pu_bacteria 2935648319 2935652160 322
324 iso_pu_bacteria 2935656913 2935659867 322
325 iso_pu_bacteria 2935665750 2935666383 322
326 iso_pu_bacteria 2935675223 2935676571 322
327 iso_pu_bacteria 2935684952 2935684954 322
328 iso_pu_bacteria 2935694250 2935694651 322
329 iso_pu_bacteria 2935703347 2935703772 322
330 iso_pu_bacteria 2935713505 2935713507 322
331 iso_pu_bacteria 2935722832 2935724127 322
332 iso_pu_bacteria 2935732158 2935733515 322
333 iso_pu_bacteria 2935741537 2935742894 322
334 iso_pu_bacteria 2935750917 2935750919 322
335 iso_pu_bacteria 2935760218 2935760550 322
336 iso_pu_bacteria 2935769743 2935771960 322
337 iso_pu_bacteria 2935777560 2935784324 322
338 iso_pu_bacteria 2935785616 2935787652 322
339 iso_pu_bacteria 2935793552 2935796284 322
340 iso_pu_bacteria 2935801545 2935801909 322
341 iso_pu_bacteria 2935810662 2935810680 322
342 iso_pu_bacteria 2935819856 2935822971 322
343 iso_pu_bacteria 2935827899 2935828260 322
344 iso_pu_bacteria 2935837841 2935842464 322
345 iso_pu_bacteria 2935847175 2935848553 322
346 iso_pu_bacteria 2935855204 2935857900 322
347 iso_pu_bacteria 2935864058 2935868758 322
348 iso_pu_bacteria 2935873716 2935874173 322
349 iso_pu_bacteria 2935883170 2935883938 322
350 iso_pu_bacteria 2935908558 2935909639 322
351 iso_pu_bacteria 2935916978 2935917364 322
352 iso_pu_bacteria 2935926038 2935927120 322
353 iso_pu_bacteria 2935934488 2935937036 322
354 iso_pu_bacteria 2935942939 2935944661 322
355 iso_pu_bacteria 2935951376 2935953098 322
356 iso_pu_bacteria 2935959822 2935966599 322
357 iso_pu_bacteria 2935967501 2935969938 322
358 iso_pu_bacteria 2935975950 2935980229 322
359 iso_pu_bacteria 2935984226 2935987011 322
360 iso_pu_bacteria 2935992306 2935992902 322
361 iso_pu_bacteria 2936002035 2936002815 322
362 iso_pu_bacteria 2936011229 2936014283 322
363 iso_pu_bacteria 2936019824 2936023877 322
364 iso_pu_bacteria 2936028420 2936031520 322
365 iso_pu_bacteria 2936037263 2936037900 322
366 iso_pu_bacteria 2936046547 2936049389 322
367 iso_pu_bacteria 2936055302 2936062139 322
368 iso_pu_bacteria 2936381700 2936384463 322
369 iso_pu_bacteria 2937813078 2937813728 322
370 iso_pu_bacteria 2937843397 2937845035 322
371 iso_pu_bacteria 2937848649 2937848839 322
372 iso_pu_bacteria 2937861824 2937867764 322
373 iso_pu_bacteria 2937877337 2937878769 322
374 iso_pu_bacteria 2937972304 2937974450 322
375 iso_pu_bacteria 2937980651 2937983285 322
376 iso_pu_bacteria 2938014810 2938022336 322
377 iso_pu_bacteria 2940556831 2940558278 322
378 iso_pu_bacteria 2941499720 2941502592 322
379 iso_pu_bacteria 2941507105 2941510661 322
380 iso_pu_bacteria 2941515067 2941518045 322
381 iso_pu_bacteria 2941523033 2941527084 322
382 iso_pu_bacteria 2941531003 2941531190 322
383 iso_pu_bacteria 2941538514 2941542513 322
384 iso_pu_bacteria 2952252522 2952255351 322
385 iso_pu_bacteria 2958034702 2958041401 322
386 iso_pu_bacteria 2958041894 2958042375 322
387 iso_pu_bacteria 2958041894 2958048520 322
388 iso_pu_bacteria 2958041894 2958058275 322
389 iso_pu_bacteria 2958064165 2958065222 322
390 iso_pu_bacteria 2958084443 2958085920 322
391 iso_pu_bacteria 2958092219 2958097307 322
392 iso_pu_bacteria 2958108152 2958111820 322
393 iso_pu_bacteria 2958122699 2958124033 322
394 iso_pu_bacteria 2958130278 2958131415 322
395 iso_pu_bacteria 2958137437 2958139621 322
396 iso_pu_bacteria 2958144490 2958146972 322
397 iso_pu_bacteria 2958158011 2958158804 322
398 iso_pu_bacteria 2958179912 2958181240 322
399 iso_pu_bacteria 2961077736 2961079078 322
400 iso_pu_bacteria 2961127735 2961133613 322
401 iso_pu_bacteria 2961136820 2961137375 322
402 iso_pu_bacteria 2961170736 2961173378 322
403 iso_pu_bacteria 2961183825 2961184251 322
404 iso_pu_bacteria 2965025482 2965029979 322
405 iso_pu_bacteria 2965032056 2965037083 322
406 iso_pu_bacteria 2965047637 2965054627 322
407 iso_pu_bacteria 2965102966 2965103158 322
408 iso_pu_bacteria 2965110997 2965111365 322
409 iso_pu_bacteria 2967996073 2967998548 322
410 iso_pu_bacteria 2968003550 2968006026 322
411 iso_pu_bacteria 2968016561 2968022921 322
412 iso_pu_bacteria 2968117919 2968121655 322
413 iso_pu_bacteria 2968138860 2968142659 322
414 iso_pu_bacteria 2970469710 2970475506 322
415 iso_pu_bacteria 2970489779 2970492047 322
416 iso_pu_bacteria 2970503327 2970505971 322
417 iso_pu_bacteria 2970510686 2970513165 322
418 iso_pu_bacteria 2970532167 2970534378 322
419 iso_pu_bacteria 2970547951 2970553279 322
420 iso_pu_bacteria 2970593180 2970593612 322
421 iso_pu_bacteria 2970593180 2970599355 322
422 iso_pu_bacteria 2970619444 2970625486 322
423 iso_pu_bacteria 2970627176 2970632670 322
424 iso_pu_bacteria 2977821940 2977826962 322
425 iso_pu_bacteria 2977828996 2977836884 322
426 iso_pu_bacteria 2977843712 2977843880 322
427 iso_pu_bacteria 2977851361 2977856713 322
428 iso_pu_bacteria 2977864932 2977867751 322
429 iso_pu_bacteria 2977872689 2977876633 322
430 iso_pu_bacteria 2977898635 2977904206 322
431 iso_pu_bacteria 2977907340 2977907989 322
432 iso_pu_bacteria 2977922695 2977925469 322
433 iso_pu_bacteria 2977935797 2977941098 322
434 iso_pu_bacteria 2977957713 2977960594 322
435 iso_pu_bacteria 2979764755 2979767002 322
436 iso_pu_bacteria 2979772303 2979775848 322
437 iso_pu_bacteria 2979793036 2979794610 322
438 iso_pu_bacteria 2979808191 2979810692 322
439 iso_pu_bacteria 2987645492 2987646222 322
440 iso_pu_bacteria 2987673487 2987677341 322
441 iso_pu_bacteria 2989349275 2989354481 322
442 iso_pu_bacteria 2996348954 2996355884 322
443 iso_pu_bacteria 2996386984 2996387051 322
444 iso_pu_bacteria 3000135777 3000137352 322
445 iso_pu_bacteria 3004167301 3004173259 322
446 iso_pu_bacteria 3004211236 3004217003 322
447 iso_pu_bacteria 3004218560 3004225404 322
448 iso_pu_bacteria 3004232784 3004235065 322
449 iso_pu_bacteria 3004239961 3004242256 322
450 iso_pu_bacteria 3004248173 3004253673 322
451 iso_pu_bacteria 3004268573 3004271785 322
452 iso_pu_bacteria 3004275668 3004282310 322
453 iso_pu_bacteria 3004289098 3004293706 322
454 iso_pu_bacteria 3004334049 3004337292 322
455 iso_pu_bacteria 3005452660 3005457599 322
456 iso_pu_bacteria 3005474847 3005481233 322
457 iso_pu_bacteria 3005483717 3005484812 322
458 iso_pu_bacteria 3005506211 3005508450 322
459 iso_pu_bacteria 3005587118 3005588047 322
460 iso_pu_bacteria 3005594810 3005600296 322
461 iso_pu_bacteria 3005710791 3005715790 322
462 iso_pu_bacteria 3005718088 3005723146 322
463 iso_pu_bacteria 643692032 643823865 322
464 iso_pu_bacteria 649633066 649870553 322
465 iso_pu_bacteria 8002285264 8002289714 322
466 iso_pu_bacteria 8003570095 8003574891 322
467 iso_pu_bacteria 8004300914 8004301825 322
468 iso_pu_bacteria 8004312739 8004319500 322
469 iso_pu_bacteria 8004374579 8004379945 322
470 iso_pu_bacteria 8004387939 8004390434 322
471 iso_pu_bacteria 8004640170 8004642558 322
472 iso_pu_bacteria 8004695233 8004696347 322
473 iso_pu_bacteria 8004714634 8004715627 322
474 iso_pu_bacteria 8004727605 8004727872 322
475 iso_pu_bacteria 8005258706 8005260488 322
476 iso_pu_bacteria 8005275841 8005275978 322
477 iso_pu_bacteria 8005282627 8005286279 322
478 iso_pu_bacteria 8005301065 8005301696 322
479 iso_pu_bacteria 8005382845 8005383353 322
480 iso_pu_bacteria 8005395548 8005398947 322
481 iso_pu_bacteria 8005682033 8005683620 322
482 iso_pu_bacteria 8005695170 8005695441 322
483 iso_pu_bacteria 8006926726 8006927959 322
484 iso_pu_bacteria 8006933436 8006939476 322
485 iso_pu_bacteria 8006964411 8006972134 322
486 iso_pu_bacteria 8006973647 8006979226 322
487 iso_pu_bacteria 8006984368 8006984411 322
488 iso_pu_bacteria 8006994254 8007001345 322
489 iso_pu_bacteria 8016522445 8016528704 322
490 iso_pu_bacteria 8016530956 8016533885 322
491 iso_pu_bacteria 8016539877 8016547107 322
492 iso_pu_bacteria 8016548790 8016555014 322
493 iso_pu_bacteria 8016557553 8016563383 322
494 iso_pu_bacteria 8016566248 8016572221 322
495 iso_pu_bacteria 8016575299 8016576410 322
496 iso_pu_bacteria 8016583857 8016594315 322
497 iso_pu_bacteria 8016595262 8016601134 322
498 iso_pu_bacteria 8016613128 8016615590 322
499 iso_pu_bacteria 8017057580 8017064904 322
500 iso_pu_bacteria 8018127388 8018128504 322
501 iso_pu_bacteria 8018163183 8018163385 322
502 iso_pu_bacteria 8018176218 8018180862 322
503 iso_pu_bacteria 8019530166 8019533654 322
504 iso_pu_bacteria 8019538911 8019546011 322
505 iso_pu_bacteria 8019547302 8019552709 322
506 iso_pu_bacteria 8019555841 8019565355 322
507 iso_pu_bacteria 8019565922 8019575454 322
508 iso_pu_bacteria 8019576017 8019584280 322
509 iso_pu_bacteria 8019586578 8019592048 322
510 iso_pu_bacteria 8019597564 8019599235 322
511 iso_pu_bacteria 8019608314 8019609123 322
512 iso_pu_bacteria 8019619141 8019619796 322
513 iso_pu_bacteria 8019648815 8019649351 322
514 iso_pu_bacteria 8019659431 8019661193 322
515 iso_pu_bacteria 8019668869 8019670744 322
516 iso_pu_bacteria 8019678201 8019685460 322
517 iso_pu_bacteria 8019687851 8019691049 322
518 iso_pu_bacteria 8055742211 8055745131 322
519 iso_pu_bacteria 8056375014 8056381797 322
520 iso_pu_bacteria 8056673599 8056681089 322
521 iso_pu_bacteria 8056681323 8056684736 322
522 iso_pu_bacteria 8056689827 8056693080 322
523 iso_pu_bacteria 8056967851 8056975088 322
524 iso_pu_bacteria 8057160832 8057163668 322
525 iso_pu_bacteria 8057529695 8057531285 322
526 3300021384 Ga0213876_10089360 Ga0213876_100893602 324
527 3300049571 Ga0501034_0062003 Ga0501034_0062003_343_1317 324
528 3300049589 Ga0501073_0035474 Ga0501073_0035474_572_1546 324
529 3300049742 Ga0501080_0118362 Ga0501080_0118362_1273_2247 324
530 3300039062 Ga0400483_189090 Ga0400483_189090_185_1162 325
531 3300001979 JGI24740J21852_10008285 JGI24740J21852_100082853 326
532 3300002704 JGI25155J39150_1000046 JGI25155J39150_100004628 326
533 3300002705 JGI25156J39149_1000070 JGI25156J39149_100007050 326
534 3300002705 JGI25156J39149_1009007 JGI25156J39149_10090072 326
535 3300002737 JGI25162J39368_1000247 JGI25162J39368_100024716 326
536 3300002737 JGI25162J39368_1000735 JGI25162J39368_100073519 326
537 3300002738 JGI25154J39366_1000092 JGI25154J39366_100009228 326
538 3300002741 JGI25157J39369_1000087 JGI25157J39369_100008729 326
539 3300002741 JGI25157J39369_1000175 JGI25157J39369_100017536 326
540 3300002987 JGI25159J45721_1000030 JGI25159J45721_100003053 326
541 3300003187 JGI25151J46595_10048693 JGI25151J46595_100486932 326
542 3300003203 JGI25406J46586_10000214 JGI25406J46586_1000021413 326
543 3300003214 JGI25165J46597_1000020 JGI25165J46597_1000020279 326
544 3300003214 JGI25165J46597_1000237 JGI25165J46597_100023760 326
545 3300003214 JGI25165J46597_1000412 JGI25165J46597_100041230 326
546 3300003214 JGI25165J46597_1005141 JGI25165J46597_10051411 326
547 3300003215 JGI25153J46596_10000151 JGI25153J46596_1000015160 326
548 3300003215 JGI25153J46596_10003908 JGI25153J46596_100039082 326
549 3300003215 JGI25153J46596_10005616 JGI25153J46596_100056162 326
550 3300003354 JGI25160J50197_1000075 JGI25160J50197_100007553 326
551 3300003354 JGI25160J50197_1003595 JGI25160J50197_10035956 326
552 3300003354 JGI25160J50197_1024708 JGI25160J50197_10247082 326
553 3300003354 JGI25160J50197_1025086 JGI25160J50197_10250862 326
554 3300003374 JGI25161J50226_1000316 JGI25161J50226_10003164 326
555 3300003659 JGI25404J52841_10002699 JGI25404J52841_100026993 326
556 3300003752 Ga0055539_1008676 Ga0055539_10086761 326
557 3300003762 Ga0055542_1000841 Ga0055542_100084121 326
558 3300003763 Ga0055529_1007252 Ga0055529_10072522 326
559 3300003771 Ga0055526_1005688 Ga0055526_10056882 326
560 3300003771 Ga0055526_1029564 Ga0055526_10295641 326
561 3300003775 Ga0055524_1000960 Ga0055524_100096016 326
562 3300003781 Ga0055536_1003695 Ga0055536_10036954 326
563 3300003792 Ga0055540_1000131 Ga0055540_100013137 326
564 3300003794 Ga0055531_10014237 Ga0055531_100142372 326
565 3300004625 Ga0055543_1003338 Ga0055543_10033382 326
566 3300005262 Ga0065165_1000048 Ga0065165_100004875 326
567 3300005262 Ga0065165_1000206 Ga0065165_100020653 326
568 3300005262 Ga0065165_1000582 Ga0065165_10005826 326
569 3300005262 Ga0065165_1002074 Ga0065165_10020748 326
570 3300005262 Ga0065165_1002220 Ga0065165_100222010 326
571 3300005262 Ga0065165_1005485 Ga0065165_10054856 326
572 3300005290 Ga0065712_10099907 Ga0065712_100999072 326
573 3300005329 Ga0070683_100052860 Ga0070683_1000528602 326
574 3300005330 Ga0070690_100103442 Ga0070690_1001034422 326
575 3300005330 Ga0070690_100212356 Ga0070690_1002123561 326
576 3300005334 Ga0068869_100129353 Ga0068869_1001293531 326
577 3300005336 Ga0070680_100052018 Ga0070680_1000520183 326
578 3300005336 Ga0070680_100075104 Ga0070680_1000751043 326
579 3300005336 Ga0070680_100131570 Ga0070680_1001315702 326
580 3300005337 Ga0070682_100409483 Ga0070682_1004094831 326
581 3300005339 Ga0070660_100051646 Ga0070660_1000516461 326
582 3300005339 Ga0070660_100206106 Ga0070660_1002061061 326
583 3300005344 Ga0070661_100232344 Ga0070661_1002323441 326
584 3300005347 Ga0070668_100151197 Ga0070668_1001511972 326
585 3300005355 Ga0070671_100068387 Ga0070671_1000683873 326
586 3300005356 Ga0070674_100027518 Ga0070674_1000275184 326
587 3300005356 Ga0070674_100086602 Ga0070674_1000866021 326
588 3300005356 Ga0070674_100201329 Ga0070674_1002013292 326
589 3300005365 Ga0070688_100060270 Ga0070688_1000602702 326
590 3300005366 Ga0070659_100012688 Ga0070659_1000126883 326
591 3300005366 Ga0070659_100053918 Ga0070659_1000539182 326
592 3300005367 Ga0070667_100188613 Ga0070667_1001886132 326
593 3300005434 Ga0070709_10000203 Ga0070709_1000020324 326
594 3300005434 Ga0070709_10004227 Ga0070709_100042275 326
595 3300005434 Ga0070709_10004390 Ga0070709_100043902 326
596 3300005434 Ga0070709_10065310 Ga0070709_100653102 326
597 3300005435 Ga0070714_100065966 Ga0070714_1000659662 326
598 3300005435 Ga0070714_100149564 Ga0070714_1001495642 326
599 3300005436 Ga0070713_100001761 Ga0070713_1000017615 326
600 3300005436 Ga0070713_100010384 Ga0070713_1000103847 326
601 3300005436 Ga0070713_100016592 Ga0070713_1000165922 326
602 3300005436 Ga0070713_100183503 Ga0070713_1001835032 326
603 3300005437 Ga0070710_10002045 Ga0070710_100020458 326
604 3300005439 Ga0070711_100001730 Ga0070711_1000017304 326
605 3300005439 Ga0070711_100006659 Ga0070711_1000066592 326
606 3300005439 Ga0070711_100011938 Ga0070711_1000119384 326
607 3300005439 Ga0070711_100014917 Ga0070711_1000149174 326
608 3300005439 Ga0070711_100019115 Ga0070711_1000191151 326
609 3300005445 Ga0070708_100109740 Ga0070708_1001097403 326
610 3300005455 Ga0070663_100076740 Ga0070663_1000767401 326
611 3300005457 Ga0070662_100365092 Ga0070662_1003650921 326
612 3300005458 Ga0070681_10003273 Ga0070681_1000327312 326
613 3300005458 Ga0070681_10025087 Ga0070681_100250872 326
614 3300005458 Ga0070681_10065024 Ga0070681_100650243 326
615 3300005467 Ga0070706_100156571 Ga0070706_1001565712 326
616 3300005468 Ga0070707_100176291 Ga0070707_1001762912 326
617 3300005530 Ga0070679_100017482 Ga0070679_1000174823 326
618 3300005530 Ga0070679_100024100 Ga0070679_1000241006 326
619 3300005530 Ga0070679_100174677 Ga0070679_1001746772 326
620 3300005535 Ga0070684_100013567 Ga0070684_1000135676 326
621 3300005535 Ga0070684_100089906 Ga0070684_1000899062 326
622 3300005535 Ga0070684_100094373 Ga0070684_1000943732 326
623 3300005535 Ga0070684_100285812 Ga0070684_1002858122 326
624 3300005536 Ga0070697_100106656 Ga0070697_1001066562 326
625 3300005539 Ga0068853_100009540 Ga0068853_1000095408 326
626 3300005539 Ga0068853_100040363 Ga0068853_1000403632 326
627 3300005539 Ga0068853_100416381 Ga0068853_1004163811 326
628 3300005548 Ga0070665_100014994 Ga0070665_1000149945 326
629 3300005548 Ga0070665_100552780 Ga0070665_1005527801 326
630 3300005563 Ga0068855_100018899 Ga0068855_1000188994 326
631 3300005563 Ga0068855_100067952 Ga0068855_1000679525 326
632 3300005563 Ga0068855_100114327 Ga0068855_1001143272 326
633 3300005563 Ga0068855_100151551 Ga0068855_1001515513 326
634 3300005563 Ga0068855_100184319 Ga0068855_1001843193 326
635 3300005563 Ga0068855_100386568 Ga0068855_1003865682 326
636 3300005563 Ga0068855_100419655 Ga0068855_1004196552 326
637 3300005563 Ga0068855_100480299 Ga0068855_1004802991 326
638 3300005564 Ga0070664_100283719 Ga0070664_1002837192 326
639 3300005577 Ga0068857_100016047 Ga0068857_1000160476 326
640 3300005578 Ga0068854_100192480 Ga0068854_1001924802 326
641 3300005578 Ga0068854_100207275 Ga0068854_1002072751 326
642 3300005614 Ga0068856_100003888 Ga0068856_10000388813 326
643 3300005614 Ga0068856_100055216 Ga0068856_1000552163 326
644 3300005614 Ga0068856_100068625 Ga0068856_1000686252 326
645 3300005614 Ga0068856_100230817 Ga0068856_1002308172 326
646 3300005615 Ga0070702_100045764 Ga0070702_1000457642 326
647 3300005616 Ga0068852_100011984 Ga0068852_1000119843 326
648 3300005616 Ga0068852_100032466 Ga0068852_1000324664 326
649 3300005616 Ga0068852_100213007 Ga0068852_1002130072 326
650 3300005617 Ga0068859_100160460 Ga0068859_1001604602 326
651 3300005617 Ga0068859_100163980 Ga0068859_1001639802 326
652 3300005618 Ga0068864_100384391 Ga0068864_1003843912 326
653 3300005618 Ga0068864_100544067 Ga0068864_1005440671 326
654 3300005834 Ga0068851_10004825 Ga0068851_100048254 326
655 3300005841 Ga0068863_100315590 Ga0068863_1003155902 326
656 3300005842 Ga0068858_100228037 Ga0068858_1002280372 326
657 3300005843 Ga0068860_100000081 Ga0068860_10000008191 326
658 3300005843 Ga0068860_100081543 Ga0068860_1000815432 326
659 3300005843 Ga0068860_100100065 Ga0068860_1001000653 326
660 3300005843 Ga0068860_100134124 Ga0068860_1001341242 326
661 3300005844 Ga0068862_100103763 Ga0068862_1001037632 326
662 3300005844 Ga0068862_100213910 Ga0068862_1002139102 326
663 3300005937 Ga0081455_10001734 Ga0081455_100017342 326
664 3300005937 Ga0081455_10013417 Ga0081455_100134172 326
665 3300005937 Ga0081455_10015026 Ga0081455_100150268 326
666 3300005937 Ga0081455_10028177 Ga0081455_100281772 326
667 3300005937 Ga0081455_10056973 Ga0081455_100569732 326
668 3300005937 Ga0081455_10120310 Ga0081455_101203102 326
669 3300005983 Ga0081540_1003965 Ga0081540_100396511 326
670 3300005983 Ga0081540_1006422 Ga0081540_10064227 326
671 3300005983 Ga0081540_1007697 Ga0081540_10076972 326
672 3300005983 Ga0081540_1011844 Ga0081540_10118443 326
673 3300005983 Ga0081540_1012349 Ga0081540_10123494 326
674 3300005983 Ga0081540_1013491 Ga0081540_10134913 326
675 3300005983 Ga0081540_1014236 Ga0081540_10142363 326
676 3300005983 Ga0081540_1018818 Ga0081540_10188185 326
677 3300005985 Ga0081539_10000768 Ga0081539_1000076839 326
678 3300005985 Ga0081539_10001470 Ga0081539_100014703 326
679 3300006028 Ga0070717_10001267 Ga0070717_100012675 326
680 3300006028 Ga0070717_10106472 Ga0070717_101064722 326
681 3300006028 Ga0070717_10115762 Ga0070717_101157622 326
682 3300006038 Ga0075365_10086145 Ga0075365_100861452 326
683 3300006038 Ga0075365_10103698 Ga0075365_101036982 326
684 3300006042 Ga0075368_10001363 Ga0075368_100013633 326
685 3300006042 Ga0075368_10021695 Ga0075368_100216952 326
686 3300006042 Ga0075368_10057252 Ga0075368_100572522 326
687 3300006048 Ga0075363_100013881 Ga0075363_1000138814 326
688 3300006048 Ga0075363_100067582 Ga0075363_1000675822 326
689 3300006048 Ga0075363_100077073 Ga0075363_1000770732 326
690 3300006051 Ga0075364_10060783 Ga0075364_100607832 326
691 3300006051 Ga0075364_10145166 Ga0075364_101451662 326
692 3300006051 Ga0075364_10251643 Ga0075364_102516432 326
693 3300006163 Ga0070715_10005933 Ga0070715_100059333 326
694 3300006163 Ga0070715_10121468 Ga0070715_101214681 326
695 3300006173 Ga0070716_100002732 Ga0070716_1000027323 326
696 3300006175 Ga0070712_100006733 Ga0070712_1000067337 326
697 3300006175 Ga0070712_100055550 Ga0070712_1000555502 326
698 3300006175 Ga0070712_100074402 Ga0070712_1000744022 326
699 3300006175 Ga0070712_100085459 Ga0070712_1000854592 326
700 3300006175 Ga0070712_100200603 Ga0070712_1002006032 326
701 3300006177 Ga0075362_10040701 Ga0075362_100407012 326
702 3300006177 Ga0075362_10056901 Ga0075362_100569011 326
703 3300006177 Ga0075362_10065700 Ga0075362_100657002 326
704 3300006178 Ga0075367_10007415 Ga0075367_100074151 326
705 3300006178 Ga0075367_10081807 Ga0075367_100818072 326
706 3300006186 Ga0075369_10035267 Ga0075369_100352672 326
707 3300006186 Ga0075369_10055915 Ga0075369_100559152 326
708 3300006186 Ga0075369_10080657 Ga0075369_100806572 326
709 3300006195 Ga0075366_10072981 Ga0075366_100729811 326
710 3300006237 Ga0097621_100315787 Ga0097621_1003157872 326
711 3300006353 Ga0075370_10013567 Ga0075370_100135674 326
712 3300006353 Ga0075370_10109286 Ga0075370_101092862 326
713 3300006844 Ga0075428_100424997 Ga0075428_1004249972 326
714 3300006847 Ga0075431_100002184 Ga0075431_10000218411 326
715 3300006871 Ga0075434_100066744 Ga0075434_1000667443 326
716 3300006880 Ga0075429_100020728 Ga0075429_1000207281 326
717 3300006914 Ga0075436_100101586 Ga0075436_1001015862 326
718 3300006931 Ga0097620_100160446 Ga0097620_1001604462 326
719 3300006931 Ga0097620_100163987 Ga0097620_1001639873 326
720 3300006941 Ga0099825_1032134 Ga0099825_10321342 326
721 3300006942 Ga0099824_1007408 Ga0099824_10074089 326
722 3300006942 Ga0099824_1023175 Ga0099824_10231753 326
723 3300006943 Ga0099822_1018218 Ga0099822_10182187 326
724 3300007076 Ga0075435_100249788 Ga0075435_1002497881 326
725 3300009093 Ga0105240_10008768 Ga0105240_100087684 326
726 3300009093 Ga0105240_10034221 Ga0105240_100342213 326
727 3300009093 Ga0105240_10076136 Ga0105240_100761362 326
728 3300009093 Ga0105240_10120101 Ga0105240_101201012 326
729 3300009093 Ga0105240_10129667 Ga0105240_101296672 326
730 3300009093 Ga0105240_10206609 Ga0105240_102066092 326
731 3300009093 Ga0105240_10255829 Ga0105240_102558292 326
732 3300009098 Ga0105245_10063788 Ga0105245_100637883 326
733 3300009098 Ga0105245_10098072 Ga0105245_100980722 326
734 3300009101 Ga0105247_10026143 Ga0105247_100261434 326
735 3300009101 Ga0105247_10091007 Ga0105247_100910072 326
736 3300009101 Ga0105247_10116887 Ga0105247_101168872 326
737 3300009147 Ga0114129_10069546 Ga0114129_100695466 326
738 3300009174 Ga0105241_10028779 Ga0105241_100287792 326
739 3300009174 Ga0105241_10035078 Ga0105241_100350784 326
740 3300009174 Ga0105241_10265431 Ga0105241_102654311 326
741 3300009176 Ga0105242_10262412 Ga0105242_102624122 326
742 3300009177 Ga0105248_10374305 Ga0105248_103743051 326
743 3300009545 Ga0105237_10004427 Ga0105237_1000442714 326
744 3300009545 Ga0105237_10047513 Ga0105237_100475134 326
745 3300009545 Ga0105237_10133855 Ga0105237_101338551 326
746 3300009545 Ga0105237_10263849 Ga0105237_102638492 326
747 3300009545 Ga0105237_10388095 Ga0105237_103880952 326
748 3300009545 Ga0105237_10389256 Ga0105237_103892562 326
749 3300009545 Ga0105237_10510928 Ga0105237_105109282 326
750 3300009551 Ga0105238_10017402 Ga0105238_100174024 326
751 3300009551 Ga0105238_10081432 Ga0105238_100814323 326
752 3300009551 Ga0105238_10105713 Ga0105238_101057132 326
753 3300009551 Ga0105238_10193087 Ga0105238_101930872 326
754 3300009553 Ga0105249_10206780 Ga0105249_102067802 326
755 3300010159 Ga0099796_10014810 Ga0099796_100148102 326
756 3300010375 Ga0105239_10017021 Ga0105239_100170218 326
757 3300010375 Ga0105239_10063018 Ga0105239_100630182 326
758 3300010375 Ga0105239_10083385 Ga0105239_100833852 326
759 3300010375 Ga0105239_10092409 Ga0105239_100924094 326
760 3300010375 Ga0105239_10132432 Ga0105239_101324322 326
761 3300010375 Ga0105239_10139240 Ga0105239_101392402 326
762 3300010375 Ga0105239_10684333 Ga0105239_106843332 326
763 3300011119 Ga0105246_10132761 Ga0105246_101327612 326
764 3300011119 Ga0105246_10202766 Ga0105246_102027661 326
765 3300011119 Ga0105246_10224999 Ga0105246_102249992 326
766 3300011119 Ga0105246_10270163 Ga0105246_102701631 326
767 3300013102 Ga0157371_10075245 Ga0157371_100752452 326
768 3300013104 Ga0157370_10014947 Ga0157370_100149478 326
769 3300013104 Ga0157370_10025078 Ga0157370_100250785 326
770 3300013105 Ga0157369_10012270 Ga0157369_100122702 326
771 3300013105 Ga0157369_10021190 Ga0157369_100211904 326
772 3300013105 Ga0157369_10151314 Ga0157369_101513142 326
773 3300013105 Ga0157369_10187272 Ga0157369_101872723 326
774 3300013105 Ga0157369_10227813 Ga0157369_102278132 326
775 3300013296 Ga0157374_10200703 Ga0157374_102007031 326
776 3300013297 Ga0157378_10009041 Ga0157378_100090418 326
777 3300013297 Ga0157378_10345420 Ga0157378_103454201 326
778 3300013306 Ga0163162_10088250 Ga0163162_100882505 326
779 3300013306 Ga0163162_10317092 Ga0163162_103170921 326
780 3300013308 Ga0157375_10047518 Ga0157375_100475182 326
781 3300013308 Ga0157375_10189822 Ga0157375_101898222 326
782 3300013308 Ga0157375_10197290 Ga0157375_101972902 326
783 3300014325 Ga0163163_10008215 Ga0163163_1000821510 326
784 3300014325 Ga0163163_10011315 Ga0163163_100113154 326
785 3300014325 Ga0163163_10179953 Ga0163163_101799531 326
786 3300014325 Ga0163163_10232184 Ga0163163_102321841 326
787 3300014325 Ga0163163_10414029 Ga0163163_104140292 326
788 3300014326 Ga0157380_10141045 Ga0157380_101410452 326
789 3300014497 Ga0182008_10006828 Ga0182008_100068282 326
790 3300014745 Ga0157377_10191485 Ga0157377_101914852 326
791 3300014968 Ga0157379_10100048 Ga0157379_101000481 326
792 3300014969 Ga0157376_10347565 Ga0157376_103475651 326
793 3300017792 Ga0163161_10149601 Ga0163161_101496012 326
794 3300017792 Ga0163161_10196512 Ga0163161_101965123 326
795 3300017792 Ga0163161_10205589 Ga0163161_102055892 326
796 3300021320 Ga0214544_1001813 Ga0214544_100181317 326
797 3300021320 Ga0214544_1032568 Ga0214544_10325682 326
798 3300021321 Ga0214542_1001236 Ga0214542_100123622 326
799 3300021321 Ga0214542_1028629 Ga0214542_10286292 326
800 3300021321 Ga0214542_1039400 Ga0214542_10394002 326
801 3300021324 Ga0214545_1000924 Ga0214545_100092423 326
802 3300021324 Ga0214545_1023651 Ga0214545_10236513 326
803 3300021324 Ga0214545_1027979 Ga0214545_10279792 326
804 3300021327 Ga0214543_1003531 Ga0214543_100353121 326
805 3300021327 Ga0214543_1024471 Ga0214543_10244711 326
806 3300021327 Ga0214543_1034461 Ga0214543_10344612 326
807 3300021327 Ga0214543_1035893 Ga0214543_10358932 326
808 3300021384 Ga0213876_10000520 Ga0213876_100005206 326
809 3300021384 Ga0213876_10001886 Ga0213876_100018862 326
810 3300021384 Ga0213876_10008410 Ga0213876_100084105 326
811 3300021384 Ga0213876_10020027 Ga0213876_100200274 326
812 3300025206 Ga0209435_100059 Ga0209435_10005950 326
813 3300025208 Ga0209436_100823 Ga0209436_1008239 326
814 3300025230 Ga0209563_101384 Ga0209563_1013842 326
815 3300025230 Ga0209563_102893 Ga0209563_1028934 326
816 3300025233 Ga0209437_100042 Ga0209437_100042369 326
817 3300025233 Ga0209437_100062 Ga0209437_10006246 326
818 3300025246 Ga0209646_1000179 Ga0209646_100017928 326
819 3300025246 Ga0209646_1011629 Ga0209646_10116292 326
820 3300025250 Ga0209026_1000005 Ga0209026_1000005550 326
821 3300025250 Ga0209026_1000212 Ga0209026_100021228 326
822 3300025253 Ga0209677_106293 Ga0209677_1062933 326
823 3300025254 Ga0209148_1000136 Ga0209148_1000136125 326
824 3300025254 Ga0209148_1000180 Ga0209148_100018096 326
825 3300025256 Ga0209759_1000111 Ga0209759_100011183 326
826 3300025256 Ga0209759_1000246 Ga0209759_100024628 326
827 3300025261 Ga0209233_1000047 Ga0209233_100004756 326
828 3300025261 Ga0209233_1000054 Ga0209233_1000054292 326
829 3300025261 Ga0209233_1000082 Ga0209233_100008246 326
830 3300025261 Ga0209233_1010707 Ga0209233_10107072 326
831 3300025263 Ga0209565_1009385 Ga0209565_10093852 326
832 3300025272 Ga0209455_1000170 Ga0209455_10001706 326
833 3300025272 Ga0209455_1003748 Ga0209455_10037485 326
834 3300025273 Ga0209673_1000642 Ga0209673_100064224 326
835 3300025284 Ga0209130_1000071 Ga0209130_100007157 326
836 3300025284 Ga0209130_1000154 Ga0209130_100015455 326
837 3300025292 Ga0209676_1004026 Ga0209676_10040266 326
838 3300025294 Ga0209025_1000032 Ga0209025_1000032341 326
839 3300025294 Ga0209025_1002646 Ga0209025_10026468 326
840 3300025295 Ga0209564_1000025 Ga0209564_1000025438 326
841 3300025295 Ga0209564_1000385 Ga0209564_100038571 326
842 3300025295 Ga0209564_1017303 Ga0209564_10173032 326
843 3300025295 Ga0209564_1023087 Ga0209564_10230872 326
844 3300025297 Ga0209758_1000011 Ga0209758_1000011302 326
845 3300025297 Ga0209758_1000120 Ga0209758_100012089 326
846 3300025297 Ga0209758_1001210 Ga0209758_100121024 326
847 3300025297 Ga0209758_1004569 Ga0209758_10045698 326
848 3300025297 Ga0209758_1008059 Ga0209758_10080594 326
849 3300025297 Ga0209758_1015568 Ga0209758_10155683 326
850 3300025297 Ga0209758_1029522 Ga0209758_10295221 326
851 3300025298 Ga0209050_1005957 Ga0209050_10059575 326
852 3300025299 Ga0209256_1000073 Ga0209256_1000073200 326
853 3300025299 Ga0209256_1000907 Ga0209256_100090715 326
854 3300025299 Ga0209256_1005155 Ga0209256_10051552 326
855 3300025302 Ga0207426_1000286 Ga0207426_100028655 326
856 3300025302 Ga0207426_1000572 Ga0207426_100057228 326
857 3300025302 Ga0207426_1001763 Ga0207426_10017638 326
858 3300025302 Ga0207426_1039826 Ga0207426_10398262 326
859 3300025303 Ga0209051_1000038 Ga0209051_1000038266 326
860 3300025303 Ga0209051_1002477 Ga0209051_100247712 326
861 3300025304 Ga0209257_1003099 Ga0209257_100309910 326
862 3300025304 Ga0209257_1009764 Ga0209257_10097644 326
863 3300025304 Ga0209257_1013498 Ga0209257_10134982 326
864 3300025304 Ga0209257_1035619 Ga0209257_10356192 326
865 3300025898 Ga0207692_10058851 Ga0207692_100588512 326
866 3300025898 Ga0207692_10065222 Ga0207692_100652221 326
867 3300025899 Ga0207642_10105860 Ga0207642_101058602 326
868 3300025900 Ga0207710_10014873 Ga0207710_100148734 326
869 3300025900 Ga0207710_10016392 Ga0207710_100163923 326
870 3300025901 Ga0207688_10021360 Ga0207688_100213602 326
871 3300025904 Ga0207647_10035646 Ga0207647_100356462 326
872 3300025906 Ga0207699_10002275 Ga0207699_100022758 326
873 3300025906 Ga0207699_10008564 Ga0207699_100085642 326
874 3300025906 Ga0207699_10056061 Ga0207699_100560612 326
875 3300025906 Ga0207699_10167145 Ga0207699_101671452 326
876 3300025909 Ga0207705_10191644 Ga0207705_101916442 326
877 3300025910 Ga0207684_10294696 Ga0207684_102946962 326
878 3300025910 Ga0207684_10302188 Ga0207684_103021882 326
879 3300025911 Ga0207654_10033726 Ga0207654_100337263 326
880 3300025911 Ga0207654_10036096 Ga0207654_100360963 326
881 3300025911 Ga0207654_10086640 Ga0207654_100866402 326
882 3300025912 Ga0207707_10000419 Ga0207707_1000041932 326
883 3300025912 Ga0207707_10002705 Ga0207707_100027055 326
884 3300025912 Ga0207707_10002868 Ga0207707_100028683 326
885 3300025912 Ga0207707_10045918 Ga0207707_100459182 326
886 3300025913 Ga0207695_10000008 Ga0207695_10000008786 326
887 3300025913 Ga0207695_10152018 Ga0207695_101520182 326
888 3300025913 Ga0207695_10180414 Ga0207695_101804143 326
889 3300025914 Ga0207671_10008982 Ga0207671_100089828 326
890 3300025914 Ga0207671_10034078 Ga0207671_100340782 326
891 3300025914 Ga0207671_10059255 Ga0207671_100592553 326
892 3300025914 Ga0207671_10061259 Ga0207671_100612591 326
893 3300025914 Ga0207671_10088306 Ga0207671_100883063 326
894 3300025914 Ga0207671_10156832 Ga0207671_101568322 326
895 3300025914 Ga0207671_10170665 Ga0207671_101706652 326
896 3300025915 Ga0207693_10013446 Ga0207693_100134463 326
897 3300025915 Ga0207693_10019720 Ga0207693_100197205 326
898 3300025915 Ga0207693_10033602 Ga0207693_100336023 326
899 3300025915 Ga0207693_10228159 Ga0207693_102281592 326
900 3300025916 Ga0207663_10000249 Ga0207663_100002492 326
901 3300025916 Ga0207663_10002050 Ga0207663_100020504 326
902 3300025916 Ga0207663_10007087 Ga0207663_100070874 326
903 3300025916 Ga0207663_10067281 Ga0207663_100672811 326
904 3300025917 Ga0207660_10106711 Ga0207660_101067112 326
905 3300025919 Ga0207657_10026743 Ga0207657_100267435 326
906 3300025919 Ga0207657_10188524 Ga0207657_101885242 326
907 3300025919 Ga0207657_10262314 Ga0207657_102623142 326
908 3300025920 Ga0207649_10039488 Ga0207649_100394883 326
909 3300025920 Ga0207649_10084927 Ga0207649_100849271 326
910 3300025920 Ga0207649_10151437 Ga0207649_101514372 326
911 3300025921 Ga0207652_10001690 Ga0207652_1000169014 326
912 3300025921 Ga0207652_10011695 Ga0207652_100116953 326
913 3300025921 Ga0207652_10048077 Ga0207652_100480771 326
914 3300025922 Ga0207646_10238573 Ga0207646_102385731 326
915 3300025924 Ga0207694_10027290 Ga0207694_100272903 326
916 3300025924 Ga0207694_10068409 Ga0207694_100684093 326
917 3300025924 Ga0207694_10191173 Ga0207694_101911732 326
918 3300025924 Ga0207694_10245057 Ga0207694_102450571 326
919 3300025924 Ga0207694_10324959 Ga0207694_103249592 326
920 3300025924 Ga0207694_10327683 Ga0207694_103276832 326
921 3300025925 Ga0207650_10303663 Ga0207650_103036632 326
922 3300025926 Ga0207659_10098980 Ga0207659_100989802 326
923 3300025928 Ga0207700_10035637 Ga0207700_100356374 326
924 3300025928 Ga0207700_10047104 Ga0207700_100471043 326
925 3300025928 Ga0207700_10136610 Ga0207700_101366101 326
926 3300025929 Ga0207664_10029904 Ga0207664_100299044 326
927 3300025929 Ga0207664_10071647 Ga0207664_100716471 326
928 3300025932 Ga0207690_10030753 Ga0207690_100307534 326
929 3300025933 Ga0207706_10275897 Ga0207706_102758972 326
930 3300025935 Ga0207709_10074401 Ga0207709_100744012 326
931 3300025936 Ga0207670_10053842 Ga0207670_100538423 326
932 3300025936 Ga0207670_10420066 Ga0207670_104200661 326
933 3300025937 Ga0207669_10183380 Ga0207669_101833802 326
934 3300025938 Ga0207704_10175967 Ga0207704_101759671 326
935 3300025939 Ga0207665_10001320 Ga0207665_1000132016 326
936 3300025939 Ga0207665_10001972 Ga0207665_100019725 326
937 3300025941 Ga0207711_10043240 Ga0207711_100432402 326
938 3300025942 Ga0207689_10044019 Ga0207689_100440191 326
939 3300025942 Ga0207689_10088660 Ga0207689_100886603 326
940 3300025944 Ga0207661_10001270 Ga0207661_100012707 326
941 3300025944 Ga0207661_10008213 Ga0207661_100082136 326
942 3300025944 Ga0207661_10264831 Ga0207661_102648312 326
943 3300025945 Ga0207679_10069235 Ga0207679_100692352 326
944 3300025945 Ga0207679_10286765 Ga0207679_102867652 326
945 3300025949 Ga0207667_10002017 Ga0207667_1000201711 326
946 3300025949 Ga0207667_10124956 Ga0207667_101249563 326
947 3300025949 Ga0207667_10134592 Ga0207667_101345923 326
948 3300025949 Ga0207667_10209954 Ga0207667_102099541 326
949 3300025960 Ga0207651_10125014 Ga0207651_101250142 326
950 3300025961 Ga0207712_10312704 Ga0207712_103127042 326
951 3300025972 Ga0207668_10050204 Ga0207668_100502041 326
952 3300025972 Ga0207668_10245334 Ga0207668_102453341 326
953 3300025981 Ga0207640_10148313 Ga0207640_101483132 326
954 3300025981 Ga0207640_10189558 Ga0207640_101895582 326
955 3300025981 Ga0207640_10274661 Ga0207640_102746611 326
956 3300025986 Ga0207658_10150957 Ga0207658_101509571 326
957 3300025986 Ga0207658_10211814 Ga0207658_102118142 326
958 3300025986 Ga0207658_10218779 Ga0207658_102187792 326
959 3300026023 Ga0207677_10073275 Ga0207677_100732752 326
960 3300026035 Ga0207703_10136925 Ga0207703_101369252 326
961 3300026041 Ga0207639_10006277 Ga0207639_100062777 326
962 3300026041 Ga0207639_10035603 Ga0207639_100356034 326
963 3300026041 Ga0207639_10379100 Ga0207639_103791002 326
964 3300026067 Ga0207678_10060137 Ga0207678_100601372 326
965 3300026067 Ga0207678_10061454 Ga0207678_100614541 326
966 3300026067 Ga0207678_10067879 Ga0207678_100678792 326
967 3300026067 Ga0207678_10072014 Ga0207678_100720142 326
968 3300026075 Ga0207708_10115077 Ga0207708_101150771 326
969 3300026078 Ga0207702_10000548 Ga0207702_1000054831 326
970 3300026078 Ga0207702_10019097 Ga0207702_100190976 326
971 3300026078 Ga0207702_10049458 Ga0207702_100494582 326
972 3300026078 Ga0207702_10098547 Ga0207702_100985472 326
973 3300026078 Ga0207702_10248491 Ga0207702_102484911 326
974 3300026088 Ga0207641_10036305 Ga0207641_100363053 326
975 3300026095 Ga0207676_10271343 Ga0207676_102713432 326
976 3300026116 Ga0207674_10010575 Ga0207674_100105752 326
977 3300026116 Ga0207674_10226613 Ga0207674_102266132 326
978 3300026118 Ga0207675_100112829 Ga0207675_1001128293 326
979 3300026118 Ga0207675_100114354 Ga0207675_1001143542 326
980 3300026118 Ga0207675_100130814 Ga0207675_1001308142 326
981 3300026118 Ga0207675_100218893 Ga0207675_1002188932 326
982 3300026121 Ga0207683_10021694 Ga0207683_100216944 326
983 3300026121 Ga0207683_10033936 Ga0207683_100339364 326
984 3300026121 Ga0207683_10040045 Ga0207683_100400453 326
985 3300026121 Ga0207683_10124367 Ga0207683_101243673 326
986 3300026121 Ga0207683_10222480 Ga0207683_102224802 326
987 3300026142 Ga0207698_10012367 Ga0207698_100123674 326
988 3300026142 Ga0207698_10034409 Ga0207698_100344094 326
989 3300026142 Ga0207698_10071611 Ga0207698_100716112 326
990 3300026142 Ga0207698_10288218 Ga0207698_102882182 326
991 3300026142 Ga0207698_10326389 Ga0207698_103263892 326
992 3300027296 Ga0209389_1000080 Ga0209389_100008023 326
993 3300027296 Ga0209389_1000115 Ga0209389_100011529 326
994 3300027357 Ga0209589_1000014 Ga0209589_1000014169 326
995 3300027357 Ga0209589_1000033 Ga0209589_100003329 326
996 3300027361 Ga0209489_100014 Ga0209489_100014169 326
997 3300027361 Ga0209489_100027 Ga0209489_100027130 326
998 3300027361 Ga0209489_100040 Ga0209489_100040121 326
999 3300027363 Ga0209700_100022 Ga0209700_100022163 326
1000 3300027363 Ga0209700_100024 Ga0209700_100024169 326
1001 3300027671 Ga0209588_1009865 Ga0209588_10098653 326
1002 3300027866 Ga0209813_10000555 Ga0209813_100005556 326
1003 3300028379 Ga0268266_10011262 Ga0268266_100112628 326
1004 3300028379 Ga0268266_10162564 Ga0268266_101625642 326
1005 3300028379 Ga0268266_10173266 Ga0268266_101732661 326
1006 3300028379 Ga0268266_10207318 Ga0268266_102073182 326
1007 3300028379 Ga0268266_10222593 Ga0268266_102225932 326
1008 3300028379 Ga0268266_10290155 Ga0268266_102901551 326
1009 3300028380 Ga0268265_10063828 Ga0268265_100638281 326
1010 3300028380 Ga0268265_10110095 Ga0268265_101100952 326
1011 3300028380 Ga0268265_10319263 Ga0268265_103192632 326
1012 3300028380 Ga0268265_10460809 Ga0268265_104608091 326
1013 3300028381 Ga0268264_10000048 Ga0268264_1000004886 326
1014 3300028381 Ga0268264_10140130 Ga0268264_101401302 326
1015 3300028577 Ga0265318_10021190 Ga0265318_100211902 326
1016 3300028786 Ga0307517_10000634 Ga0307517_1000063444 326
1017 3300028786 Ga0307517_10039620 Ga0307517_100396203 326
1018 3300028794 Ga0307515_10000130 Ga0307515_1000013049 326
1019 3300028794 Ga0307515_10000375 Ga0307515_1000037577 326
1020 3300028794 Ga0307515_10006012 Ga0307515_1000601213 326
1021 3300028794 Ga0307515_10011208 Ga0307515_1001120814 326
1022 3300031238 Ga0265332_10072944 Ga0265332_100729441 326
1023 3300031242 Ga0265329_10010852 Ga0265329_100108523 326
1024 3300031247 Ga0265340_10000942 Ga0265340_1000094215 326
1025 3300031247 Ga0265340_10062324 Ga0265340_100623242 326
1026 3300031249 Ga0265339_10003224 Ga0265339_100032246 326
1027 3300031249 Ga0265339_10004321 Ga0265339_100043217 326
1028 3300031249 Ga0265339_10139606 Ga0265339_101396061 326
1029 3300031250 Ga0265331_10005402 Ga0265331_100054023 326
1030 3300031456 Ga0307513_10000335 Ga0307513_1000033512 326
1031 3300031456 Ga0307513_10020103 Ga0307513_100201032 326
1032 3300031507 Ga0307509_10005537 Ga0307509_1000553714 326
1033 3300031616 Ga0307508_10000032 Ga0307508_1000003277 326
1034 3300031665 Ga0316575_10027004 Ga0316575_100270041 326
1035 3300031711 Ga0265314_10004266 Ga0265314_100042664 326
1036 3300031711 Ga0265314_10206222 Ga0265314_102062222 326
1037 3300031712 Ga0265342_10000245 Ga0265342_1000024528 326
1038 3300031730 Ga0307516_10005934 Ga0307516_100059345 326
1039 3300031730 Ga0307516_10010247 Ga0307516_100102479 326
1040 3300031730 Ga0307516_10039539 Ga0307516_100395394 326
1041 3300031730 Ga0307516_10107771 Ga0307516_101077713 326
1042 3300031730 Ga0307516_10290617 Ga0307516_102906172 326
1043 3300031731 Ga0307405_10124851 Ga0307405_101248512 326
1044 3300031903 Ga0307407_10110918 Ga0307407_101109182 326
1045 3300031911 Ga0307412_10148803 Ga0307412_101488032 326
1046 3300031995 Ga0307409_100018896 Ga0307409_1000188963 326
1047 3300032004 Ga0307414_10015462 Ga0307414_100154622 326
1048 3300032126 Ga0307415_100080075 Ga0307415_1000800752 326
1049 3300032126 Ga0307415_100154121 Ga0307415_1001541212 326
1050 3300032133 Ga0316583_10000299 Ga0316583_1000029912 326
1051 3300033179 Ga0307507_10011278 Ga0307507_100112789 326
1052 3300033180 Ga0307510_10016157 Ga0307510_100161574 326
1053 3300033180 Ga0307510_10033062 Ga0307510_100330624 326
1054 3300033180 Ga0307510_10079195 Ga0307510_100791951 326
1055 3300033180 Ga0307510_10192031 Ga0307510_101920312 326
1056 3300033442 Ga0315911_1000002 Ga0315911_1000002151 326
1057 3300034818 Ga0373950_0007558 Ga0373950_0007558_670_1650 326
1058 3300035111 Ga0373923_0018497 Ga0373923_0018497_1566_2549 326
1059 3300035111 Ga0373923_0023017 Ga0373923_0023017_143_1126 326
1060 3300035116 Ga0373945_0007554 Ga0373945_0007554_711_1694 326
1061 3300035118 Ga0373954_0000645 Ga0373954_0000645_11806_12789 326
1062 3300035118 Ga0373954_0089346 Ga0373954_0089346_179_1162 326
1063 3300035119 Ga0373956_0005180 Ga0373956_0005180_4212_5195 326
1064 3300035120 Ga0373957_0001340 Ga0373957_0001340_4077_5060 326
1065 3300035120 Ga0373957_0074282 Ga0373957_0074282_165_1148 326
1066 3300035170 Ga0373943_0044140 Ga0373943_0044140_555_1538 326
1067 3300035170 Ga0373943_0046304 Ga0373943_0046304_1009_1992 326
1068 3300035171 Ga0373946_0017066 Ga0373946_0017066_1009_1992 326
1069 3300035171 Ga0373946_0024016 Ga0373946_0024016_627_1607 326
1070 3300035171 Ga0373946_0137953 Ga0373946_0137953_87_1070 326
1071 3300035172 Ga0373955_0114878 Ga0373955_0114878_181_1164 326
1072 3300035410 Ga0373924_0073578 Ga0373924_0073578_281_1264 326
1073 3300035410 Ga0373924_0076719 Ga0373924_0076719_104_1087 326
1074 3300035691 Ga0373931_0002187 Ga0373931_0002187_6636_7682 326
1075 3300035692 Ga0373935_0012923 Ga0373935_0012923_3100_4083 326
1076 3300035692 Ga0373935_0054823 Ga0373935_0054823_402_1385 326
1077 3300035692 Ga0373935_0063455 Ga0373935_0063455_808_1791 326
1078 3300035695 Ga0373927_0000177 Ga0373927_0000177_42495_43475 326
1079 3300035695 Ga0373927_0013220 Ga0373927_0013220_4481_5464 326
1080 3300035724 Ga0373933_0000182 Ga0373933_0000182_18522_19505 326
1081 3300035724 Ga0373933_0003690 Ga0373933_0003690_297_1280 326
1082 3300035724 Ga0373933_0112009 Ga0373933_0112009_592_1575 326
1083 3300035725 Ga0373947_0028707 Ga0373947_0028707_955_1938 326
1084 3300035725 Ga0373947_0057990 Ga0373947_0057990_575_1555 326
1085 3300035725 Ga0373947_0071426 Ga0373947_0071426_908_1891 326
1086 3300035725 Ga0373947_0103986 Ga0373947_0103986_604_1587 326
1087 3300036401 Ga0373937_0013771 Ga0373937_0013771_3338_4321 326
1088 3300036401 Ga0373937_0033145 Ga0373937_0033145_2840_3823 326
1089 3300037068 Ga0373925_0000912 Ga0373925_0000912_20046_21026 326
1090 3300037068 Ga0373925_0021953 Ga0373925_0021953_1558_2541 326
1091 3300037068 Ga0373925_0108321 Ga0373925_0108321_1075_2058 326
1092 3300037312 Ga0395899_0038352 Ga0395899_0038352_612_1595 326
1093 3300037312 Ga0395899_0083732 Ga0395899_0083732_81_1064 326
1094 3300037418 Ga0395900_0001029 Ga0395900_0001029_13276_14259 326
1095 3300037418 Ga0395900_0004780 Ga0395900_0004780_11985_12965 326
1096 3300037418 Ga0395900_0017080 Ga0395900_0017080_4664_5647 326
1097 3300037466 Ga0395898_0002778 Ga0395898_0002778_12879_13862 326
1098 3300037466 Ga0395898_0022553 Ga0395898_0022553_907_1890 326
1099 3300037466 Ga0395898_0169433 Ga0395898_0169433_399_1382 326
1100 3300037466 Ga0395898_0179146 Ga0395898_0179146_376_1359 326
1101 3300037471 Ga0395905_0002254 Ga0395905_0002254_2060_3040 326
1102 3300037471 Ga0395905_0006562 Ga0395905_0006562_10062_11042 326
1103 3300037471 Ga0395905_0136044 Ga0395905_0136044_213_1193 326
1104 3300037471 Ga0395905_0198854 Ga0395905_0198854_324_1307 326
1105 3300037471 Ga0395905_0229979 Ga0395905_0229979_315_1298 326
1106 3300037853 Ga0436364_0341704 Ga0436364_0341704_4942_5922 326
1107 3300038443 Ga0395901_0014425 Ga0395901_0014425_2641_3621 326
1108 3300038443 Ga0395901_0031413 Ga0395901_0031413_1843_2826 326
1109 3300038443 Ga0395901_0044477 Ga0395901_0044477_3481_4464 326
1110 3300038443 Ga0395901_0052460 Ga0395901_0052460_2314_3297 326
1111 3300038443 Ga0395901_0158660 Ga0395901_0158660_1082_2095 326
1112 3300038443 Ga0395901_0386583 Ga0395901_0386583_284_1267 326
1113 3300038443 Ga0395901_0548932 Ga0395901_0548932_112_1092 326
1114 3300039062 Ga0400483_059947 Ga0400483_059947_1251_2234 326
1115 3300039062 Ga0400483_121196 Ga0400483_121196_1028_2008 326
1116 3300039062 Ga0400483_179252 Ga0400483_179252_1216_2196 326
1117 3300039062 Ga0400483_225275 Ga0400483_225275_772_1752 326
1118 3300039062 Ga0400483_291972 Ga0400483_291972_345_1328 326
1119 3300039437 Ga0436365_0229539 Ga0436365_0229539_2147_3130 326
1120 3300039437 Ga0436365_0459631 Ga0436365_0459631_12841_13821 326
1121 3300039437 Ga0436365_0745092 Ga0436365_0745092_340_1323 326
1122 3300039437 Ga0436365_0982014 Ga0436365_0982014_1089_2072 326
1123 3300039437 Ga0436365_1142591 Ga0436365_1142591_91_1074 326
1124 3300039437 Ga0436365_1590122 Ga0436365_1590122_16379_17359 326
1125 3300039438 Ga0436360_0768015 Ga0436360_0768015_88_1071 326
1126 3300039438 Ga0436360_1204026 Ga0436360_1204026_92_1075 326
1127 3300039447 Ga0436361_0665242 Ga0436361_0665242_1478_2461 326
1128 3300039450 Ga0436363_0725193 Ga0436363_0725193_30_1013 326
1129 3300039450 Ga0436363_1172772 Ga0436363_1172772_5744_6724 326
1130 3300039453 Ga0436362_0413279 Ga0436362_0413279_2592_3674 326
1131 3300039453 Ga0436362_1155470 Ga0436362_1155470_2271_3251 326
1132 3300041486 Ga0451807_1061003 Ga0451807_1061003_240_1223 326
1133 3300041491 Ga0451833_0369965 Ga0451833_0369965_14003_14983 326
1134 3300041494 Ga0451837_0964406 Ga0451837_0964406_297_1277 326
1135 3300041496 Ga0451839_0063950 Ga0451839_0063950_14019_14999 326
1136 3300041501 Ga0451845_0249129 Ga0451845_0249129_14019_14999 326
1137 3300041503 Ga0451847_0341155 Ga0451847_0341155_14019_14999 326
1138 3300041507 Ga0451851_1180298 Ga0451851_1180298_13922_14902 326
1139 3300041511 Ga0451855_0392051 Ga0451855_0392051_1976_2956 326
1140 3300041512 Ga0451853_2474193 Ga0451853_2474193_7551_8531 326
1141 3300044658 Ga0466972_0000172 Ga0466972_0000172_44835_45818 326
1142 3300044683 Ga0466965_0005988 Ga0466965_0005988_1393_2373 326
1143 3300044684 Ga0466966_0000128 Ga0466966_0000128_21758_22741 326
1144 3300044684 Ga0466966_0074228 Ga0466966_0074228_84_1064 326
1145 3300044684 Ga0466966_0103222 Ga0466966_0103222_494_1477 326
1146 3300044693 Ga0466961_0000236 Ga0466961_0000236_16620_17603 326
1147 3300044694 Ga0466963_0000255 Ga0466963_0000255_20041_21021 326
1148 3300044694 Ga0466963_0200354 Ga0466963_0200354_118_1098 326
1149 3300044735 Ga0466968_0010295 Ga0466968_0010295_911_1894 326
1150 3300044765 Ga0466970_0000134 Ga0466970_0000134_7046_8026 326
1151 3300044765 Ga0466970_0088464 Ga0466970_0088464_16_999 326
1152 3300045976 Ga0466967_0091577 Ga0466967_0091577_1089_2072 326
1153 3300045976 Ga0466967_0099398 Ga0466967_0099398_1218_2201 326
1154 3300045976 Ga0466967_0132211 Ga0466967_0132211_974_1957 326
1155 3300046454 Ga0495592_0039287 Ga0495592_0039287_556_1539 326
1156 3300046454 Ga0495592_0072650 Ga0495592_0072650_1018_2001 326
1157 3300046455 Ga0495603_0000217 Ga0495603_0000217_27399_28382 326
1158 3300046455 Ga0495603_0039310 Ga0495603_0039310_88_1071 326
1159 3300046457 Ga0495590_0050349 Ga0495590_0050349_183_1166 326
1160 3300046459 Ga0495629_0000373 Ga0495629_0000373_2534_3517 326
1161 3300046459 Ga0495629_0000862 Ga0495629_0000862_10595_11578 326
1162 3300046459 Ga0495629_0021438 Ga0495629_0021438_1618_2598 326
1163 3300046459 Ga0495629_0179830 Ga0495629_0179830_76_1059 326
1164 3300046460 Ga0495638_0004887 Ga0495638_0004887_6673_7653 326
1165 3300046460 Ga0495638_0005277 Ga0495638_0005277_617_1600 326
1166 3300046460 Ga0495638_0007591 Ga0495638_0007591_2902_3885 326
1167 3300046460 Ga0495638_0031312 Ga0495638_0031312_32_1015 326
1168 3300046460 Ga0495638_0035964 Ga0495638_0035964_1907_2890 326
1169 3300046460 Ga0495638_0036703 Ga0495638_0036703_769_1749 326
1170 3300046460 Ga0495638_0041257 Ga0495638_0041257_918_1898 326
1171 3300046461 Ga0495641_0019640 Ga0495641_0019640_1537_2520 326
1172 3300046461 Ga0495641_0048799 Ga0495641_0048799_729_1712 326
1173 3300046462 Ga0495651_0007091 Ga0495651_0007091_131_1114 326
1174 3300046462 Ga0495651_0019146 Ga0495651_0019146_1033_2016 326
1175 3300046463 Ga0495653_0218377 Ga0495653_0218377_159_1142 326
1176 3300046463 Ga0495653_0255541 Ga0495653_0255541_92_1075 326
1177 3300046463 Ga0495653_0270068 Ga0495653_0270068_40_1023 326
1178 3300046472 Ga0495580_0006588 Ga0495580_0006588_7988_8971 326
1179 3300046472 Ga0495580_0059540 Ga0495580_0059540_1017_2000 326
1180 3300046473 Ga0495582_0006572 Ga0495582_0006572_5339_6322 326
1181 3300046473 Ga0495582_0036743 Ga0495582_0036743_396_1379 326
1182 3300046474 Ga0495605_0046230 Ga0495605_0046230_447_1430 326
1183 3300046475 Ga0495639_0000544 Ga0495639_0000544_11560_12543 326
1184 3300046475 Ga0495639_0038283 Ga0495639_0038283_903_1886 326
1185 3300046475 Ga0495639_0059296 Ga0495639_0059296_704_1684 326
1186 3300046476 Ga0495662_0045498 Ga0495662_0045498_159_1142 326
1187 3300046476 Ga0495662_0123647 Ga0495662_0123647_148_1131 326
1188 3300046477 Ga0495664_0001505 Ga0495664_0001505_1334_2317 326
1189 3300046477 Ga0495664_0019029 Ga0495664_0019029_901_1884 326
1190 3300046477 Ga0495664_0034156 Ga0495664_0034156_243_1226 326
1191 3300046477 Ga0495664_0039921 Ga0495664_0039921_409_1392 326
1192 3300046477 Ga0495664_0089999 Ga0495664_0089999_763_1746 326
1193 3300046477 Ga0495664_0098203 Ga0495664_0098203_88_1071 326
1194 3300046491 Ga0495584_0124283 Ga0495584_0124283_55_1038 326
1195 3300046492 Ga0495585_0033769 Ga0495585_0033769_349_1332 326
1196 3300046507 Ga0495606_0043636 Ga0495606_0043636_106_1089 326
1197 3300046511 Ga0495608_0002876 Ga0495608_0002876_4235_5218 326
1198 3300046511 Ga0495608_0046266 Ga0495608_0046266_1136_2119 326
1199 3300046511 Ga0495608_0224764 Ga0495608_0224764_86_1069 326
1200 3300046512 Ga0495610_0050549 Ga0495610_0050549_425_1408 326
1201 3300046514 Ga0495618_0009642 Ga0495618_0009642_566_1549 326
1202 3300046514 Ga0495618_0035976 Ga0495618_0035976_673_1656 326
1203 3300046514 Ga0495618_0066415 Ga0495618_0066415_996_1979 326
1204 3300046516 Ga0495628_0009755 Ga0495628_0009755_2568_3551 326
1205 3300046517 Ga0495630_0026624 Ga0495630_0026624_2910_3893 326
1206 3300046517 Ga0495630_0060767 Ga0495630_0060767_123_1106 326
1207 3300046518 Ga0495631_0005680 Ga0495631_0005680_3343_4323 326
1208 3300046519 Ga0495632_0015036 Ga0495632_0015036_928_1908 326
1209 3300046524 Ga0495648_0001373 Ga0495648_0001373_13398_14378 326
1210 3300046524 Ga0495648_0042914 Ga0495648_0042914_178_1161 326
1211 3300046524 Ga0495648_0071291 Ga0495648_0071291_920_1900 326
1212 3300046525 Ga0495663_0032864 Ga0495663_0032864_65_1048 326
1213 3300046526 Ga0495666_0067701 Ga0495666_0067701_674_1657 326
1214 3300046529 Ga0495652_0076709 Ga0495652_0076709_73_1056 326
1215 3300046529 Ga0495652_0090139 Ga0495652_0090139_787_1770 326
1216 3300046529 Ga0495652_0104274 Ga0495652_0104274_553_1536 326
1217 3300046530 Ga0495654_0048470 Ga0495654_0048470_228_1211 326
1218 3300046531 Ga0495665_0006186 Ga0495665_0006186_5343_6326 326
1219 3300046531 Ga0495665_0131920 Ga0495665_0131920_109_1092 326
1220 3300046533 Ga0495640_0002595 Ga0495640_0002595_3327_4310 326
1221 3300046535 Ga0495586_0079707 Ga0495586_0079707_268_1251 326
1222 3300046536 Ga0495587_0197223 Ga0495587_0197223_66_1049 326
1223 3300046542 Ga0495597_0103842 Ga0495597_0103842_12_992 326
1224 3300046557 Ga0495622_0034428 Ga0495622_0034428_706_1689 326
1225 3300046557 Ga0495622_0132899 Ga0495622_0132899_38_1021 326
1226 3300046559 Ga0495667_0034851 Ga0495667_0034851_774_1757 326
1227 3300046616 Ga0495668_0022434 Ga0495668_0022434_959_1939 326
1228 3300046642 Ga0495634_0001583 Ga0495634_0001583_901_1884 326
1229 3300046642 Ga0495634_0061661 Ga0495634_0061661_1411_2394 326
1230 3300046660 Ga0495625_0069908 Ga0495625_0069908_1416_2396 326
1231 3300046660 Ga0495625_0127525 Ga0495625_0127525_468_1451 326
1232 3300046660 Ga0495625_0145977 Ga0495625_0145977_548_1531 326
1233 3300046660 Ga0495625_0150911 Ga0495625_0150911_58_1041 326
1234 3300046660 Ga0495625_0205758 Ga0495625_0205758_101_1084 326
1235 3300046663 Ga0495635_0000436 Ga0495635_0000436_4718_5701 326
1236 3300046663 Ga0495635_0051959 Ga0495635_0051959_1521_2504 326
1237 3300046663 Ga0495635_0224503 Ga0495635_0224503_118_1098 326
1238 3300046663 Ga0495635_0229304 Ga0495635_0229304_101_1084 326
1239 3300046663 Ga0495635_0272705 Ga0495635_0272705_32_1015 326
1240 3300046665 Ga0495661_0020469 Ga0495661_0020469_2543_3526 326
1241 3300046674 Ga0495588_0183087 Ga0495588_0183087_46_1029 326
1242 3300046675 Ga0495657_0028186 Ga0495657_0028186_1884_2867 326
1243 3300046675 Ga0495657_0053230 Ga0495657_0053230_1536_2519 326
1244 3300046675 Ga0495657_0058184 Ga0495657_0058184_759_1742 326
1245 3300046675 Ga0495657_0193184 Ga0495657_0193184_138_1121 326
1246 3300046678 Ga0495599_0042775 Ga0495599_0042775_1806_2789 326
1247 3300046679 Ga0495623_0056660 Ga0495623_0056660_1339_2322 326
1248 3300046679 Ga0495623_0097772 Ga0495623_0097772_786_1769 326
1249 3300046679 Ga0495623_0184015 Ga0495623_0184015_55_1038 326
1250 3300046680 Ga0495646_0005491 Ga0495646_0005491_3486_4469 326
1251 3300046681 Ga0495647_0011285 Ga0495647_0011285_994_1977 326
1252 3300046683 Ga0495658_0003203 Ga0495658_0003203_5529_6512 326
1253 3300046684 Ga0495669_0000650 Ga0495669_0000650_3404_4387 326
1254 3300046689 Ga0495613_0007707 Ga0495613_0007707_6954_7937 326
1255 3300046689 Ga0495613_0332423 Ga0495613_0332423_26_1009 326
1256 3300046690 Ga0495624_0023168 Ga0495624_0023168_944_1927 326
1257 3300046690 Ga0495624_0040628 Ga0495624_0040628_228_1211 326
1258 3300046690 Ga0495624_0082181 Ga0495624_0082181_90_1073 326
1259 3300046694 Ga0495649_0036062 Ga0495649_0036062_1566_2549 326
1260 3300047315 Ga0495581_0003127 Ga0495581_0003127_7050_8033 326
1261 3300047315 Ga0495581_0019323 Ga0495581_0019323_1789_2772 326
1262 3300047317 Ga0495604_0006866 Ga0495604_0006866_3093_4076 326
1263 3300047317 Ga0495604_0025855 Ga0495604_0025855_2691_3674 326
1264 3300047317 Ga0495604_0027516 Ga0495604_0027516_3318_4301 326
1265 3300047317 Ga0495604_0290784 Ga0495604_0290784_34_1017 326
1266 3300047319 Ga0495674_0008459 Ga0495674_0008459_974_1957 326
1267 3300047319 Ga0495674_0069954 Ga0495674_0069954_714_1697 326
1268 3300047319 Ga0495674_0093019 Ga0495674_0093019_1470_2453 326
1269 3300047319 Ga0495674_0208714 Ga0495674_0208714_244_1227 326
1270 3300047320 Ga0495672_0133076 Ga0495672_0133076_13_1089 326
1271 3300047321 Ga0495676_0027208 Ga0495676_0027208_3819_4802 326
1272 3300047321 Ga0495676_0146496 Ga0495676_0146496_15_998 326
1273 3300047322 Ga0495680_0001711 Ga0495680_0001711_1342_2325 326
1274 3300047322 Ga0495680_0009863 Ga0495680_0009863_4772_5755 326
1275 3300047443 Ga0495687_024676 Ga0495687_024676_63_1043 326
1276 3300047443 Ga0495687_080788 Ga0495687_080788_258_1241 326
1277 3300047444 Ga0495675_0005291 Ga0495675_0005291_2118_3101 326
1278 3300047444 Ga0495675_0148817 Ga0495675_0148817_308_1291 326
1279 3300047469 Ga0495673_0051615 Ga0495673_0051615_178_1197 326
1280 3300047469 Ga0495673_0079470 Ga0495673_0079470_232_1215 326
1281 3300047470 Ga0495681_0001771 Ga0495681_0001771_3336_4316 326
1282 3300047472 Ga0495686_0015184 Ga0495686_0015184_2125_3108 326
1283 3300047472 Ga0495686_0046169 Ga0495686_0046169_1605_2588 326
1284 3300047472 Ga0495686_0060792 Ga0495686_0060792_816_1799 326
1285 3300047472 Ga0495686_0215198 Ga0495686_0215198_75_1058 326
1286 3300047673 Ga0495593_0000439 Ga0495593_0000439_1373_2356 326
1287 3300047673 Ga0495593_0011115 Ga0495593_0011115_1923_2906 326
1288 3300048088 Ga0495602_0009113 Ga0495602_0009113_5148_6131 326
1289 3300048088 Ga0495602_0112361 Ga0495602_0112361_921_1904 326
1290 3300048903 Ga0496100_0239829 Ga0496100_0239829_311_1294 326
1291 3300048903 Ga0496100_0361047 Ga0496100_0361047_96_1079 326
1292 3300048904 Ga0496101_0230194 Ga0496101_0230194_443_1426 326
1293 3300048905 Ga0496102_0001771 Ga0496102_0001771_7452_8435 326
1294 3300048905 Ga0496102_0236815 Ga0496102_0236815_720_1703 326
1295 3300048906 Ga0496103_0110315 Ga0496103_0110315_511_1494 326
1296 3300048907 Ga0496104_0009950 Ga0496104_0009950_565_1545 326
1297 3300048907 Ga0496104_0020613 Ga0496104_0020613_1689_2672 326
1298 3300048907 Ga0496104_0048391 Ga0496104_0048391_173_1156 326
1299 3300048907 Ga0496104_0136187 Ga0496104_0136187_978_1961 326
1300 3300048907 Ga0496104_0183454 Ga0496104_0183454_999_1982 326
1301 3300048908 Ga0496105_0009060 Ga0496105_0009060_6042_7022 326
1302 3300048908 Ga0496105_0011039 Ga0496105_0011039_904_1887 326
1303 3300048908 Ga0496105_0030405 Ga0496105_0030405_2520_3503 326
1304 3300048908 Ga0496105_0050186 Ga0496105_0050186_1459_2442 326
1305 3300048908 Ga0496105_0078455 Ga0496105_0078455_523_1569 326
1306 3300048908 Ga0496105_0265527 Ga0496105_0265527_111_1094 326
1307 3300048909 Ga0496106_0009997 Ga0496106_0009997_3893_4876 326
1308 3300048909 Ga0496106_0024362 Ga0496106_0024362_628_1611 326
1309 3300048909 Ga0496106_0075303 Ga0496106_0075303_206_1189 326
1310 3300048909 Ga0496106_0080447 Ga0496106_0080447_195_1178 326
1311 3300048909 Ga0496106_0144906 Ga0496106_0144906_858_1841 326
1312 3300048910 Ga0496107_0036192 Ga0496107_0036192_1751_2734 326
1313 3300048910 Ga0496107_0081293 Ga0496107_0081293_841_1824 326
1314 3300048910 Ga0496107_0087790 Ga0496107_0087790_256_1239 326
1315 3300048910 Ga0496107_0156403 Ga0496107_0156403_236_1219 326
1316 3300048910 Ga0496107_0250797 Ga0496107_0250797_113_1096 326
1317 3300048910 Ga0496107_0295121 Ga0496107_0295121_202_1185 326
1318 3300048910 Ga0496107_0360167 Ga0496107_0360167_35_1018 326
1319 3300048911 Ga0496108_0006149 Ga0496108_0006149_4644_5624 326
1320 3300048911 Ga0496108_0052308 Ga0496108_0052308_214_1197 326
1321 3300048911 Ga0496108_0066703 Ga0496108_0066703_1350_2396 326
1322 3300048911 Ga0496108_0171015 Ga0496108_0171015_770_1750 326
1323 3300048911 Ga0496108_0460371 Ga0496108_0460371_33_1016 326
1324 3300048912 Ga0496109_0003373 Ga0496109_0003373_3973_4953 326
1325 3300048912 Ga0496109_0031880 Ga0496109_0031880_812_1795 326
1326 3300048912 Ga0496109_0067050 Ga0496109_0067050_1722_2768 326
1327 3300048912 Ga0496109_0328347 Ga0496109_0328347_123_1106 326
1328 3300048913 Ga0496110_0004493 Ga0496110_0004493_8269_9315 326
1329 3300048913 Ga0496110_0055465 Ga0496110_0055465_2202_3185 326
1330 3300048913 Ga0496110_0060878 Ga0496110_0060878_2002_2985 326
1331 3300048913 Ga0496110_0111575 Ga0496110_0111575_398_1381 326
1332 3300048913 Ga0496110_0229981 Ga0496110_0229981_25_1008 326
1333 3300048913 Ga0496110_0266126 Ga0496110_0266126_216_1196 326
1334 3300048913 Ga0496110_0349744 Ga0496110_0349744_327_1310 326
1335 3300048914 Ga0496111_0029145 Ga0496111_0029145_1975_2958 326
1336 3300048914 Ga0496111_0039869 Ga0496111_0039869_333_1316 326
1337 3300048914 Ga0496111_0108886 Ga0496111_0108886_322_1305 326
1338 3300048914 Ga0496111_0239188 Ga0496111_0239188_169_1215 326
1339 3300048914 Ga0496111_0251845 Ga0496111_0251845_135_1115 326
1340 3300048915 Ga0496112_0000017 Ga0496112_0000017_134086_135069 326
1341 3300048915 Ga0496112_0013582 Ga0496112_0013582_4698_5681 326
1342 3300048915 Ga0496112_0017643 Ga0496112_0017643_5054_6037 326
1343 3300048915 Ga0496112_0019263 Ga0496112_0019263_849_1832 326
1344 3300048915 Ga0496112_0023520 Ga0496112_0023520_3372_4418 326
1345 3300048915 Ga0496112_0137365 Ga0496112_0137365_93_1073 326
1346 3300048915 Ga0496112_0258947 Ga0496112_0258947_89_1072 326
1347 3300048916 Ga0496113_0011007 Ga0496113_0011007_62_1042 326
1348 3300048916 Ga0496113_0031143 Ga0496113_0031143_433_1479 326
1349 3300048916 Ga0496113_0071067 Ga0496113_0071067_1559_2542 326
1350 3300048916 Ga0496113_0098584 Ga0496113_0098584_337_1320 326
1351 3300048916 Ga0496113_0111346 Ga0496113_0111346_1060_2043 326
1352 3300048916 Ga0496113_0117920 Ga0496113_0117920_304_1287 326
1353 3300048917 Ga0496114_0011547 Ga0496114_0011547_3042_4088 326
1354 3300048917 Ga0496114_0075593 Ga0496114_0075593_401_1384 326
1355 3300048918 Ga0496115_0000535 Ga0496115_0000535_26500_27483 326
1356 3300048918 Ga0496115_0002841 Ga0496115_0002841_794_1840 326
1357 3300048918 Ga0496115_0019252 Ga0496115_0019252_4170_5150 326
1358 3300048918 Ga0496115_0034965 Ga0496115_0034965_2362_3345 326
1359 3300048918 Ga0496115_0281783 Ga0496115_0281783_172_1155 326
1360 3300048918 Ga0496115_0323774 Ga0496115_0323774_184_1167 326
1361 3300048919 Ga0496116_0003125 Ga0496116_0003125_10966_11949 326
1362 3300048919 Ga0496116_0040044 Ga0496116_0040044_1324_2307 326
1363 3300048920 Ga0496117_0030138 Ga0496117_0030138_3155_4138 326
1364 3300048920 Ga0496117_0035196 Ga0496117_0035196_920_1903 326
1365 3300048920 Ga0496117_0040628 Ga0496117_0040628_539_1519 326
1366 3300048920 Ga0496117_0118917 Ga0496117_0118917_32_1015 326
1367 3300048920 Ga0496117_0208330 Ga0496117_0208330_62_1045 326
1368 3300048921 Ga0496118_0003407 Ga0496118_0003407_12871_13854 326
1369 3300048921 Ga0496118_0046295 Ga0496118_0046295_140_1123 326
1370 3300048921 Ga0496118_0069280 Ga0496118_0069280_1275_2258 326
1371 3300048921 Ga0496118_0088763 Ga0496118_0088763_579_1559 326
1372 3300048922 Ga0496119_0001101 Ga0496119_0001101_26007_26987 326
1373 3300048922 Ga0496119_0007752 Ga0496119_0007752_990_1973 326
1374 3300048922 Ga0496119_0008841 Ga0496119_0008841_3831_4811 326
1375 3300048922 Ga0496119_0103668 Ga0496119_0103668_200_1183 326
1376 3300048922 Ga0496119_0117286 Ga0496119_0117286_11_991 326
1377 3300048922 Ga0496119_0167292 Ga0496119_0167292_150_1133 326
1378 3300048923 Ga0496120_0001458 Ga0496120_0001458_21468_22448 326
1379 3300048923 Ga0496120_0009210 Ga0496120_0009210_410_1390 326
1380 3300048923 Ga0496120_0073827 Ga0496120_0073827_704_1684 326
1381 3300048923 Ga0496120_0138924 Ga0496120_0138924_130_1113 326
1382 3300048924 Ga0496121_0000230 Ga0496121_0000230_71970_72953 326
1383 3300048924 Ga0496121_0004694 Ga0496121_0004694_10581_11564 326
1384 3300048924 Ga0496121_0017764 Ga0496121_0017764_5666_6649 326
1385 3300048924 Ga0496121_0024355 Ga0496121_0024355_1676_2659 326
1386 3300048924 Ga0496121_0041666 Ga0496121_0041666_2898_3878 326
1387 3300048924 Ga0496121_0080840 Ga0496121_0080840_511_1494 326
1388 3300048924 Ga0496121_0091769 Ga0496121_0091769_1121_2104 326
1389 3300048924 Ga0496121_0125237 Ga0496121_0125237_179_1189 326
1390 3300048924 Ga0496121_0169240 Ga0496121_0169240_465_1448 326
1391 3300048924 Ga0496121_0192443 Ga0496121_0192443_212_1195 326
1392 3300048925 Ga0496122_0030277 Ga0496122_0030277_2449_3429 326
1393 3300048925 Ga0496122_0038492 Ga0496122_0038492_915_1898 326
1394 3300048925 Ga0496122_0073006 Ga0496122_0073006_941_1924 326
1395 3300048925 Ga0496122_0125370 Ga0496122_0125370_182_1165 326
1396 3300048926 Ga0496123_0037892 Ga0496123_0037892_2169_3149 326
1397 3300048926 Ga0496123_0041691 Ga0496123_0041691_265_1248 326
1398 3300048927 Ga0496124_0025798 Ga0496124_0025798_161_1141 326
1399 3300048927 Ga0496124_0027163 Ga0496124_0027163_1487_2470 326
1400 3300048927 Ga0496124_0133515 Ga0496124_0133515_550_1530 326
1401 3300048928 Ga0496125_0000040 Ga0496125_0000040_16403_17386 326
1402 3300048928 Ga0496125_0004755 Ga0496125_0004755_10346_11329 326
1403 3300048928 Ga0496125_0022192 Ga0496125_0022192_2658_3641 326
1404 3300048928 Ga0496125_0070258 Ga0496125_0070258_1676_2659 326
1405 3300048928 Ga0496125_0089522 Ga0496125_0089522_691_1674 326
1406 3300048928 Ga0496125_0165961 Ga0496125_0165961_189_1172 326
1407 3300048928 Ga0496125_0197085 Ga0496125_0197085_214_1197 326
1408 3300048928 Ga0496125_0252256 Ga0496125_0252256_89_1072 326
1409 3300048929 Ga0496126_0002483 Ga0496126_0002483_3543_4526 326
1410 3300048929 Ga0496126_0005712 Ga0496126_0005712_43_1026 326
1411 3300048929 Ga0496126_0012513 Ga0496126_0012513_960_1943 326
1412 3300048929 Ga0496126_0024496 Ga0496126_0024496_4761_5741 326
1413 3300048929 Ga0496126_0026298 Ga0496126_0026298_4429_5412 326
1414 3300048929 Ga0496126_0037757 Ga0496126_0037757_3433_4416 326
1415 3300048929 Ga0496126_0082588 Ga0496126_0082588_1385_2368 326
1416 3300048929 Ga0496126_0102216 Ga0496126_0102216_295_1275 326
1417 3300048929 Ga0496126_0113178 Ga0496126_0113178_407_1390 326
1418 3300048929 Ga0496126_0209858 Ga0496126_0209858_354_1337 326
1419 3300049460 Ga0495682_0026404 Ga0495682_0026404_869_1852 326
1420 3300049460 Ga0495682_0046817 Ga0495682_0046817_506_1486 326
1421 3300049568 Ga0501031_0000007 Ga0501031_0000007_126216_127196 326
1422 3300049568 Ga0501031_0008668 Ga0501031_0008668_4402_5385 326
1423 3300049568 Ga0501031_0029381 Ga0501031_0029381_2468_3451 326
1424 3300049568 Ga0501031_0153083 Ga0501031_0153083_465_1445 326
1425 3300049569 Ga0501032_0000007 Ga0501032_0000007_38813_39793 326
1426 3300049569 Ga0501032_0000107 Ga0501032_0000107_46545_47528 326
1427 3300049569 Ga0501032_0003811 Ga0501032_0003811_10279_11259 326
1428 3300049569 Ga0501032_0256784 Ga0501032_0256784_20_1000 326
1429 3300049570 Ga0501033_0000040 Ga0501033_0000040_102794_103774 326
1430 3300049570 Ga0501033_0000144 Ga0501033_0000144_33325_34308 326
1431 3300049570 Ga0501033_0000311 Ga0501033_0000311_11614_12597 326
1432 3300049570 Ga0501033_0000377 Ga0501033_0000377_15068_16048 326
1433 3300049570 Ga0501033_0009009 Ga0501033_0009009_3619_4599 326
1434 3300049570 Ga0501033_0024192 Ga0501033_0024192_440_1420 326
1435 3300049570 Ga0501033_0123389 Ga0501033_0123389_697_1677 326
1436 3300049570 Ga0501033_0240288 Ga0501033_0240288_164_1144 326
1437 3300049570 Ga0501033_0258130 Ga0501033_0258130_50_1033 326
1438 3300049571 Ga0501034_0000029 Ga0501034_0000029_214089_215069 326
1439 3300049571 Ga0501034_0000039 Ga0501034_0000039_223058_224041 326
1440 3300049571 Ga0501034_0000340 Ga0501034_0000340_47634_48614 326
1441 3300049571 Ga0501034_0000412 Ga0501034_0000412_32918_33901 326
1442 3300049571 Ga0501034_0042626 Ga0501034_0042626_1635_2615 326
1443 3300049571 Ga0501034_0083900 Ga0501034_0083900_489_1469 326
1444 3300049571 Ga0501034_0159669 Ga0501034_0159669_97_1077 326
1445 3300049571 Ga0501034_0224874 Ga0501034_0224874_393_1373 326
1446 3300049571 Ga0501034_0260170 Ga0501034_0260170_155_1135 326
1447 3300049572 Ga0501036_0000004 Ga0501036_0000004_214089_215069 326
1448 3300049572 Ga0501036_0000007 Ga0501036_0000007_143618_144601 326
1449 3300049572 Ga0501036_0000127 Ga0501036_0000127_13448_14431 326
1450 3300049572 Ga0501036_0017468 Ga0501036_0017468_1789_2769 326
1451 3300049573 Ga0501037_0000004 Ga0501037_0000004_38813_39793 326
1452 3300049573 Ga0501037_0000025 Ga0501037_0000025_125627_126610 326
1453 3300049573 Ga0501037_0000066 Ga0501037_0000066_37857_38840 326
1454 3300049573 Ga0501037_0000198 Ga0501037_0000198_38882_39862 326
1455 3300049573 Ga0501037_0178247 Ga0501037_0178247_242_1222 326
1456 3300049574 Ga0501038_0000005 Ga0501038_0000005_214089_215069 326
1457 3300049574 Ga0501038_0000026 Ga0501038_0000026_3913_4896 326
1458 3300049574 Ga0501038_0000342 Ga0501038_0000342_34550_35533 326
1459 3300049574 Ga0501038_0048255 Ga0501038_0048255_1030_2010 326
1460 3300049575 Ga0501039_0000005 Ga0501039_0000005_107590_108573 326
1461 3300049575 Ga0501039_0000009 Ga0501039_0000009_214089_215069 326
1462 3300049575 Ga0501039_0000840 Ga0501039_0000840_5571_6554 326
1463 3300049575 Ga0501039_0128660 Ga0501039_0128660_289_1269 326
1464 3300049575 Ga0501039_0205172 Ga0501039_0205172_544_1524 326
1465 3300049576 Ga0501040_0000754 Ga0501040_0000754_6603_7583 326
1466 3300049579 Ga0501043_0000036 Ga0501043_0000036_47796_48779 326
1467 3300049579 Ga0501043_0000100 Ga0501043_0000100_69989_70969 326
1468 3300049579 Ga0501043_0000120 Ga0501043_0000120_31430_32413 326
1469 3300049579 Ga0501043_0000836 Ga0501043_0000836_10511_11491 326
1470 3300049579 Ga0501043_0050992 Ga0501043_0050992_259_1239 326
1471 3300049579 Ga0501043_0056514 Ga0501043_0056514_1766_2746 326
1472 3300049579 Ga0501043_0141832 Ga0501043_0141832_456_1436 326
1473 3300049580 Ga0501046_0000359 Ga0501046_0000359_13467_14450 326
1474 3300049580 Ga0501046_0002399 Ga0501046_0002399_10354_11337 326
1475 3300049580 Ga0501046_0062699 Ga0501046_0062699_155_1138 326
1476 3300049580 Ga0501046_0164346 Ga0501046_0164346_433_1413 326
1477 3300049581 Ga0501047_0000209 Ga0501047_0000209_66320_67303 326
1478 3300049581 Ga0501047_0000379 Ga0501047_0000379_3403_4386 326
1479 3300049581 Ga0501047_0000895 Ga0501047_0000895_3473_4453 326
1480 3300049581 Ga0501047_0007647 Ga0501047_0007647_2827_3807 326
1481 3300049581 Ga0501047_0022062 Ga0501047_0022062_2723_3706 326
1482 3300049581 Ga0501047_0117808 Ga0501047_0117808_1344_2324 326
1483 3300049581 Ga0501047_0209162 Ga0501047_0209162_619_1602 326
1484 3300049582 Ga0501048_0000352 Ga0501048_0000352_21606_22589 326
1485 3300049582 Ga0501048_0004356 Ga0501048_0004356_7770_8753 326
1486 3300049583 Ga0501067_0000025 Ga0501067_0000025_12030_13013 326
1487 3300049583 Ga0501067_0048682 Ga0501067_0048682_102_1085 326
1488 3300049583 Ga0501067_0160307 Ga0501067_0160307_136_1119 326
1489 3300049584 Ga0501068_0000801 Ga0501068_0000801_7899_8882 326
1490 3300049584 Ga0501068_0001230 Ga0501068_0001230_11000_11983 326
1491 3300049584 Ga0501068_0024081 Ga0501068_0024081_1485_2465 326
1492 3300049585 Ga0501069_0000020 Ga0501069_0000020_37094_38074 326
1493 3300049585 Ga0501069_0001694 Ga0501069_0001694_9609_10592 326
1494 3300049585 Ga0501069_0016353 Ga0501069_0016353_19_1002 326
1495 3300049586 Ga0501070_0000174 Ga0501070_0000174_16046_17026 326
1496 3300049586 Ga0501070_0002185 Ga0501070_0002185_6243_7226 326
1497 3300049586 Ga0501070_0005683 Ga0501070_0005683_7411_8391 326
1498 3300049586 Ga0501070_0011186 Ga0501070_0011186_3929_4909 326
1499 3300049586 Ga0501070_0069472 Ga0501070_0069472_937_1917 326
1500 3300049586 Ga0501070_0176217 Ga0501070_0176217_662_1642 326
1501 3300049587 Ga0501071_0017012 Ga0501071_0017012_3646_4626 326
1502 3300049588 Ga0501072_0149146 Ga0501072_0149146_548_1528 326
1503 3300049589 Ga0501073_0000070 Ga0501073_0000070_55536_56519 326
1504 3300049589 Ga0501073_0000091 Ga0501073_0000091_12805_13788 326
1505 3300049589 Ga0501073_0015856 Ga0501073_0015856_2682_3662 326
1506 3300049589 Ga0501073_0021242 Ga0501073_0021242_734_1714 326
1507 3300049590 Ga0501074_0000015 Ga0501074_0000015_39249_40229 326
1508 3300049590 Ga0501074_0000489 Ga0501074_0000489_11733_12716 326
1509 3300049590 Ga0501074_0001218 Ga0501074_0001218_10569_11552 326
1510 3300049590 Ga0501074_0120763 Ga0501074_0120763_429_1409 326
1511 3300049591 Ga0501075_0045965 Ga0501075_0045965_1643_2668 326
1512 3300049592 Ga0501076_0118741 Ga0501076_0118741_980_2005 326
1513 3300049741 Ga0501079_0096719 Ga0501079_0096719_989_2014 326
1514 3300049742 Ga0501080_0000132 Ga0501080_0000132_5564_6547 326
1515 3300049742 Ga0501080_0000321 Ga0501080_0000321_24606_25589 326
1516 3300049742 Ga0501080_0026275 Ga0501080_0026275_1540_2523 326
1517 3300049742 Ga0501080_0080954 Ga0501080_0080954_1640_2632 326
1518 3300049742 Ga0501080_0146807 Ga0501080_0146807_433_1413 326
1519 3300049742 Ga0501080_0252213 Ga0501080_0252213_333_1313 326
1520 3300049743 Ga0501081_0124769 Ga0501081_0124769_360_1385 326
1521 3300049744 Ga0501083_0000284 Ga0501083_0000284_24024_25007 326
1522 3300049744 Ga0501083_0151276 Ga0501083_0151276_276_1256 326
1523 3300049744 Ga0501083_0193412 Ga0501083_0193412_263_1249 326
1524 3300049822 Ga0501035_0000014 Ga0501035_0000014_214089_215069 326
1525 3300049822 Ga0501035_0000016 Ga0501035_0000016_49573_50556 326
1526 3300049822 Ga0501035_0000070 Ga0501035_0000070_84522_85502 326
1527 3300049822 Ga0501035_0000346 Ga0501035_0000346_23234_24214 326
1528 3300049822 Ga0501035_0001251 Ga0501035_0001251_23234_24217 326
1529 3300049822 Ga0501035_0001605 Ga0501035_0001605_11876_12856 326
1530 3300049822 Ga0501035_0011180 Ga0501035_0011180_356_1336 326
1531 3300049822 Ga0501035_0025723 Ga0501035_0025723_1665_2645 326
1532 3300049822 Ga0501035_0225697 Ga0501035_0225697_33_1013 326
1533 3300049822 Ga0501035_0361460 Ga0501035_0361460_80_1063 326
1534 3300049823 Ga0501044_0000012 Ga0501044_0000012_38813_39793 326
1535 3300049823 Ga0501044_0000037 Ga0501044_0000037_77170_78150 326
1536 3300049823 Ga0501044_0000274 Ga0501044_0000274_47988_48971 326
1537 3300049823 Ga0501044_0000383 Ga0501044_0000383_20157_21140 326
1538 3300049823 Ga0501044_0024200 Ga0501044_0024200_478_1458 326
1539 3300049823 Ga0501044_0057358 Ga0501044_0057358_1673_2653 326
1540 3300049823 Ga0501044_0066220 Ga0501044_0066220_1594_2574 326
1541 3300049823 Ga0501044_0090497 Ga0501044_0090497_164_1147 326
1542 3300049823 Ga0501044_0102592 Ga0501044_0102592_1116_2096 326
1543 3300049823 Ga0501044_0158683 Ga0501044_0158683_378_1361 326
1544 3300049823 Ga0501044_0202591 Ga0501044_0202591_738_1718 326
1545 3300049824 Ga0501045_0020164 Ga0501045_0020164_2058_3041 326
1546 3300050489 nmdc:mga03683_48412_c1 nmdc:mga03683_48412_c1_149_1129 326
1547 3300050490 nmdc:mga03n38_121304_c1 nmdc:mga03n38_121304_c1_18_998 326
1548 3300050490 nmdc:mga03n38_2341_c1 nmdc:mga03n38_2341_c1_4007_4990 326
1549 3300050490 nmdc:mga03n38_84717_c1 nmdc:mga03n38_84717_c1_162_1145 326
1550 3300050491 nmdc:mga00v17_29763_c1 nmdc:mga00v17_29763_c1_1227_2210 326
1551 3300050491 nmdc:mga00v17_60502_c1 nmdc:mga00v17_60502_c1_762_1745 326
1552 3300050492 nmdc:mga0yw44_247562_c1 nmdc:mga0yw44_247562_c1_161_1144 326
1553 3300050492 nmdc:mga0yw44_72110_c1 nmdc:mga0yw44_72110_c1_31_1014 326
1554 3300050494 nmdc:mga06z11_101586_c1 nmdc:mga06z11_101586_c1_148_1131 326
1555 3300050494 nmdc:mga06z11_246042_c1 nmdc:mga06z11_246042_c1_24_1007 326
1556 3300050494 nmdc:mga06z11_4265_c1 nmdc:mga06z11_4265_c1_257_1240 326
1557 3300050494 nmdc:mga06z11_78986_c2 nmdc:mga06z11_78986_c2_103_1086 326
1558 3300050495 nmdc:mga04h51_1143_c1 nmdc:mga04h51_1143_c1_1296_2279 326
1559 3300050496 nmdc:mga07m45_38017_c1 nmdc:mga07m45_38017_c1_1331_2314 326
1560 3300050496 nmdc:mga07m45_745_c1 nmdc:mga07m45_745_c1_7262_8245 326
1561 3300050507 nmdc:mga05p37_196560_c1 nmdc:mga05p37_196560_c1_1357_2340 326
1562 3300050508 nmdc:mga09592_18338_c1 nmdc:mga09592_18338_c1_229_1212 326
1563 3300050509 nmdc:mga0qj67_76787_c1 nmdc:mga0qj67_76787_c1_185_1168 326
1564 3300050510 nmdc:mga06r32_1860_c1 nmdc:mga06r32_1860_c1_8625_9608 326
1565 3300050512 nmdc:mga0n895_44891_c1 nmdc:mga0n895_44891_c1_1555_2538 326
1566 3300050513 nmdc:mga0rr50_459721_c1 nmdc:mga0rr50_459721_c1_80_1063 326
1567 3300050514 nmdc:mga08x19_102727_c1 nmdc:mga08x19_102727_c1_270_1253 326
1568 3300050516 nmdc:mga0sz30_1713_c1 nmdc:mga0sz30_1713_c1_5680_6660 326
1569 3300050516 nmdc:mga0sz30_23321_c1 nmdc:mga0sz30_23321_c1_1240_2220 326
1570 3300050516 nmdc:mga0sz30_24928_c1 nmdc:mga0sz30_24928_c1_910_1893 326
1571 3300050516 nmdc:mga0sz30_45346_c1 nmdc:mga0sz30_45346_c1_601_1584 326
1572 3300053077 Ga0495601_0158215 Ga0495601_0158215_268_1251 326
1573 3300053077 Ga0495601_0256864 Ga0495601_0256864_115_1098 326
1574 3300053080 Ga0500635_0075124 Ga0500635_0075124_84_1067 326
1575 3300053084 Ga0495595_0006301 Ga0495595_0006301_3337_4320 326
1576 3300053084 Ga0495595_0053818 Ga0495595_0053818_577_1560 326
1577 3300053086 Ga0500578_0168169 Ga0500578_0168169_92_1075 326
1578 3300053087 Ga0500643_000456 Ga0500643_000456_14927_15910 326
1579 3300053090 Ga0500646_0008495 Ga0500646_0008495_1267_2250 326
1580 3300053093 Ga0500651_0069381 Ga0500651_0069381_186_1169 326
1581 3300053094 Ga0500566_0000370 Ga0500566_0000370_9698_10681 326
1582 3300053094 Ga0500566_0006011 Ga0500566_0006011_3320_4303 326
1583 3300053094 Ga0500566_0006917 Ga0500566_0006917_955_1938 326
1584 3300053094 Ga0500566_0040773 Ga0500566_0040773_1023_2006 326
1585 3300053095 Ga0500640_013671 Ga0500640_013671_1388_2371 326
1586 3300053096 Ga0500641_0002674 Ga0500641_0002674_3267_4250 326
1587 3300053096 Ga0500641_0027454 Ga0500641_0027454_1024_2007 326
1588 3300053098 Ga0500650_0000365 Ga0500650_0000365_7121_8104 326
1589 3300053098 Ga0500650_0036142 Ga0500650_0036142_1155_2138 326
1590 3300053102 Ga0500554_004225 Ga0500554_004225_1988_2971 326
1591 3300053103 Ga0500555_003144 Ga0500555_003144_703_1686 326
1592 3300053104 Ga0500556_0044111 Ga0500556_0044111_180_1163 326
1593 3300053105 Ga0500557_000003 Ga0500557_000003_12149_13132 326
1594 3300053109 Ga0500569_021582 Ga0500569_021582_610_1593 326
1595 3300053111 Ga0500572_000024 Ga0500572_000024_6970_7953 326
1596 3300053119 Ga0500595_000537 Ga0500595_000537_1168_2151 326
1597 3300053119 Ga0500595_003301 Ga0500595_003301_105_1088 326
1598 3300053119 Ga0500595_009837 Ga0500595_009837_71_1054 326
1599 3300053119 Ga0500595_016895 Ga0500595_016895_674_1657 326
1600 3300053119 Ga0500595_022156 Ga0500595_022156_1252_2235 326
1601 3300053122 Ga0500608_000807 Ga0500608_000807_1003_1986 326
1602 3300053122 Ga0500608_001300 Ga0500608_001300_4329_5312 326
1603 3300053122 Ga0500608_099345 Ga0500608_099345_48_1028 326
1604 3300053125 Ga0500618_000334 Ga0500618_000334_13662_14642 326
1605 3300053130 Ga0500642_0000019 Ga0500642_0000019_141115_142098 326
1606 3300053130 Ga0500642_0000252 Ga0500642_0000252_14026_15009 326
1607 3300053133 Ga0500655_005108 Ga0500655_005108_1263_2246 326
1608 3300053136 Ga0500559_0001011 Ga0500559_0001011_6912_7895 326
1609 3300053136 Ga0500559_0003877 Ga0500559_0003877_724_1707 326
1610 3300053139 Ga0500568_0001665 Ga0500568_0001665_5060_6043 326
1611 3300053142 Ga0500577_0000833 Ga0500577_0000833_206_1189 326
1612 3300053145 Ga0500586_000414 Ga0500586_000414_4385_5368 326
1613 3300053148 Ga0500590_000050 Ga0500590_000050_705_1685 326
1614 3300053148 Ga0500590_017662 Ga0500590_017662_28_1011 326
1615 3300053148 Ga0500590_047558 Ga0500590_047558_1099_2082 326
1616 3300053150 Ga0500603_000391 Ga0500603_000391_41_1024 326
1617 3300053150 Ga0500603_000801 Ga0500603_000801_3423_4406 326
1618 3300053151 Ga0500604_0001275 Ga0500604_0001275_5728_6711 326
1619 3300053151 Ga0500604_0059581 Ga0500604_0059581_171_1154 326
1620 3300053153 Ga0500616_0000041 Ga0500616_0000041_10589_11572 326
1621 3300053153 Ga0500616_0000210 Ga0500616_0000210_43806_44786 326
1622 3300053153 Ga0500616_0046158 Ga0500616_0046158_935_1915 326
1623 3300053155 Ga0500620_000042 Ga0500620_000042_4551_5531 326
1624 3300053156 Ga0500622_0002498 Ga0500622_0002498_2567_3550 326
1625 3300053158 Ga0500627_0029367 Ga0500627_0029367_143_1126 326
1626 3300053158 Ga0500627_0069753 Ga0500627_0069753_259_1239 326
1627 3300053159 Ga0500630_000112 Ga0500630_000112_15373_16356 326
1628 3300053161 Ga0500634_0033049 Ga0500634_0033049_990_1973 326
1629 3300053162 Ga0500638_047219 Ga0500638_047219_47_1093 326
1630 3300053162 Ga0500638_068958 Ga0500638_068958_40_1023 326
1631 3300053163 Ga0500639_000040 Ga0500639_000040_30135_31118 326
1632 3300053177 Ga0500636_0000365 Ga0500636_0000365_10083_11066 326
1633 3300053177 Ga0500636_0012982 Ga0500636_0012982_3703_4686 326
1634 3300053177 Ga0500636_0036809 Ga0500636_0036809_209_1189 326
1635 3300053177 Ga0500636_0064889 Ga0500636_0064889_357_1337 326
1636 3300053178 Ga0500637_0000042 Ga0500637_0000042_11468_12451 326
1637 3300053178 Ga0500637_0002167 Ga0500637_0002167_7572_8555 326
1638 3300053724 Ga0500570_082598 Ga0500570_082598_367_1350 326
1639 3300053729 Ga0500625_009292 Ga0500625_009292_1819_2802 326
1640 3300053730 Ga0500645_039063 Ga0500645_039063_20_1003 326
1641 3300053735 Ga0500596_000794 Ga0500596_000794_2979_3962 326
1642 3300053736 Ga0500599_007283 Ga0500599_007283_397_1380 326
1643 3300054114 Ga0501084_0104186 Ga0501084_0104186_204_1184 326
1644 3300055283 Ga0500661_000056 Ga0500661_000056_5496_6479 326
1645 3300055283 Ga0500661_015268 Ga0500661_015268_68_1051 326
1646 3300060353 Ga0501082_0040063 Ga0501082_0040063_2153_3178 326
1647 3300061734 Ga0530510_0057533 Ga0530510_0057533_902_1927 326
1648 iso_pu_bacteria 2513237102 2513705469 326

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

49

157

0.96

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

181

299

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4z6o-assembly1.cif.gz_B structure of h200e variant of homoprotocatechuate 2,3-dioxygenase from b.fuscum in complex with hpca at 1.63 ang resolution 0.9339 3 320
4z6v-assembly1.cif.gz_B structure of h200q variant of homoprotocatechuate 2,3-dioxygenase from b.fuscum in complex with 4-nitrocatechol at 1.37 ang resolution 0.9319 2 320
5bwg-assembly1.cif.gz_D structure of h200c variant of homoprotocatechuate 2,3-dioxygenase from b.fuscum at 1.75 ang resolution 0.9313 2 320
4z6q-assembly1.cif.gz_B structure of h200n variant of homoprotocatechuate 2,3-dioxygenase from b.fuscum in complex with hpca at 1.57 ang resolution 0.9308 2 320
4ghh-assembly1.cif.gz_A structure of homoprotocatechuate 2,3-dioxygenase from b.fuscum in complex with 4-nitrocatechol at 1.55 ang resolution 0.9286 3 320
ID Description Score Start End Superfamily
1mpyD01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9379 13 130 3.10.180.10
1q0cA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9271 148 307 3.10.180.10
3b59D01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9256 12 127 3.10.180.10
1f1yA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9255 148 286 3.10.180.10
5zszA01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9238 14 133 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A440FXN8-F1-model_v4 deleted 0.9917 1 186
AF-A0A5R2N7E1-F1-model_v4 3,4-dihydroxyphenylacetate 2,3-dioxygenase 0.9912 1 175 GO:0004462
GO:0046872
GO:0051213
AF-A0A5R2N7E1-F1-model_v4 3,4-dihydroxyphenylacetate 2,3-dioxygenase 0.9856 1 175 GO:0004462
GO:0046872
GO:0051213
AF-A0A350AGD8-F1-model_v4 3,4-dihydroxyphenylacetate 2,3-dioxygenase 0.9818 1 243 GO:0004462
GO:0046872
GO:0051213
AF-A0A440FXN8-F1-model_v4 deleted 0.9812 1 186

Feature Viewer

pLDDT pTM Quality
90.04 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map