F495185
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1646 | 892 | 3292 | 334 |
Family's Representative Sequence
| Representative Sequence | 3300035398|Ga0316574_0095850|Ga0316574_0095850_383_1393 |
| Length | 336 |
| Sequence | MAVKVAISGFGRIGRNILRAIAESKRDDLQVVAINDLGSAKDNAHLFKYDSVHGTYHGTVAVDGDQMDVGLAAPVRVLAERDPSKLPWGDMGVDIVMECTGIFTDKDKASAHLDAGAKRVLVSAPASGADLTVVYGVNHDKLTGDHKVVSNASCTTNCLAPVAKVVNDLCGLQQGFMTTIHAYTSDQRLQDQAHKDMRRARAAALSMIPTSTGAAKAVGLVLPELNGRLDGTAIRVPTPNVSVVDLKFLPGRETSVEEVNEAMKKAAAGPLKGVLSVTDEPLVSIDFNHSPYSSNFDLTQTQIVDGKLVRVLSWYDNEWGFSNRMSDTAIAMAKLI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 5 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 7 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 8 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 9 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 10 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 11 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 12 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 13 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 14 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 15 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 16 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 17 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 18 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 19 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 20 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 21 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 22 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 23 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 24 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 25 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 26 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 27 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 28 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 29 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 30 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 31 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 32 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 33 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 34 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 35 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 36 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 37 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 38 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 39 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 40 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 41 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 42 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 43 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 44 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 51 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 55 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 57 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 68 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 84 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 85 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 86 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 89 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 90 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 92 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 94 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 95 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 99 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 100 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 102 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 103 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 104 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 106 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 107 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 108 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 109 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 110 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 111 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 112 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 113 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 114 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 115 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 116 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 117 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 118 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 120 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 121 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 122 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 123 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 124 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 125 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 126 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 127 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 128 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 129 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 130 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 131 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 132 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 134 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 135 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 136 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 137 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 138 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 139 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 140 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 141 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 142 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 144 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 145 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 161 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 162 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 163 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 165 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 166 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 167 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 183 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 184 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 185 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 186 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 187 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 189 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 190 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 191 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 192 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 193 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 196 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 199 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 202 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 204 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 276 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 279 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 281 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 285 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 286 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 287 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 288 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 289 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 290 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 291 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 292 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 293 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 294 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 295 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 296 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 297 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 298 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 299 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 300 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 301 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 302 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 303 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 304 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 305 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 306 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 307 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 308 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 309 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 310 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 311 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 312 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 313 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 314 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 315 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 316 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 317 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 318 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 319 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 320 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 321 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 322 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 323 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 324 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 325 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 326 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 327 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 328 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 329 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 330 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 331 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 332 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 333 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 334 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 335 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 336 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 337 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 338 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 339 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 340 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 341 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 342 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 343 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 344 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 345 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 346 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 347 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 348 | 3300041502 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT | Metatranscriptome | Unclassified |
| 349 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 350 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 351 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 352 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 353 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 354 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 355 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 356 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 357 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 428 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 429 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 430 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 431 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 432 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 433 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 434 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 435 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 436 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 437 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 438 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 439 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 440 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 441 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 442 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 443 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 444 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 445 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 446 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 447 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 448 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 449 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 450 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 451 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 452 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 453 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 454 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 458 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 459 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 460 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 461 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 462 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 463 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 464 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 465 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 466 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 467 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 468 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 469 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 470 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 471 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 472 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 473 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 474 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 475 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 476 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 477 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 478 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 479 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 480 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 481 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 482 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 483 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 484 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 485 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 486 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 487 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 488 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 489 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 490 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 491 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 492 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 493 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 494 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 495 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 496 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 497 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 498 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 499 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 500 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 501 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 502 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 503 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 506 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 509 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 510 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 511 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 512 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 513 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 514 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 515 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 516 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 517 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 518 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 519 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 520 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 521 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 522 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 523 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 524 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 525 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 526 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 527 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 528 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 529 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 530 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 531 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 532 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 533 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 534 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 535 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 536 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 537 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 538 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 539 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 540 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 541 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 542 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 543 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 544 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 545 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 546 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 547 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 548 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 549 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 550 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 551 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 552 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 553 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 554 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 555 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 556 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 557 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 558 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 559 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 560 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 561 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 562 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 563 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 564 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 565 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 566 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 567 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 568 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 569 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 570 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 571 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 572 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 573 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 574 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 575 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 576 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 577 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 578 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 579 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 580 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 581 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 582 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 583 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 584 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 585 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 586 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 587 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 588 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 589 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 590 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 591 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 592 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 593 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 594 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 595 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 596 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 597 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 598 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 599 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 600 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 601 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 602 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 603 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 604 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 605 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 606 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 607 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 608 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 609 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 610 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 611 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 612 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 613 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 614 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 615 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 616 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 617 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 618 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 619 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 620 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 621 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 622 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 623 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 624 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 625 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 626 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 627 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 628 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 629 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 630 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 631 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 632 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 633 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 634 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 635 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 636 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 637 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 638 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 639 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 640 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 641 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 642 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 643 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 644 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 645 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 646 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 647 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 648 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 649 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 650 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 651 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 652 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 653 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 654 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 655 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 656 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 657 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 658 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 659 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 660 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 661 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 662 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 663 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 664 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 665 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 666 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 667 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 668 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 669 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 670 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 671 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 672 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 673 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 674 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 675 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 676 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 677 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 678 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 679 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 680 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 681 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 682 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 683 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 684 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 685 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 686 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 687 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 688 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 689 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 690 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 691 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 692 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 693 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 694 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 695 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 696 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 697 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 698 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 699 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 700 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 701 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 702 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 703 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 704 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 705 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 706 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 707 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 708 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 709 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 710 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 711 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 712 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 713 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 714 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 715 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 716 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 717 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 718 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 719 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 720 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 721 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 722 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 723 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 724 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 725 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 726 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 727 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 728 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 729 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 730 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 731 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 732 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 733 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 734 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 735 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 736 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 737 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 738 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 739 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 740 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 741 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 742 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 743 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 744 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 745 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 746 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 747 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 748 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 749 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 750 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 751 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 752 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 753 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 754 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 755 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 756 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 757 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 758 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 759 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 760 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 761 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 762 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 763 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 764 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 765 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 766 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 767 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 768 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 769 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 770 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 771 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 772 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 773 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 774 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 775 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 776 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 777 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 778 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 779 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 780 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 781 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 782 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 783 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 784 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 785 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 786 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 787 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 788 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 789 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 790 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 791 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 792 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 793 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 794 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 795 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 796 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 797 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 798 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 799 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 800 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 801 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 802 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 803 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 804 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 805 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 806 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 807 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 808 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 809 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 810 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 811 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 812 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 813 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 814 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 815 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 816 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 817 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 818 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 819 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 820 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 821 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 822 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 823 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 824 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 825 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 826 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 827 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 828 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 829 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 830 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 831 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 832 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 833 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 834 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 835 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 836 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 837 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 838 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 839 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 840 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 841 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 842 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 843 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 844 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 845 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 846 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 847 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 848 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 849 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 850 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 851 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 852 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 853 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 854 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 855 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 856 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 857 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 858 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 859 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 860 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 861 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 862 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 863 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 864 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 865 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 866 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 867 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 868 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 869 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 870 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 871 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 872 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 873 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 874 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 875 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 876 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 877 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 878 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 879 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 880 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 881 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 882 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 883 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 884 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 885 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 886 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 887 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 888 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 889 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 890 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 891 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 892 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 77.58 |
| Metatranscriptomes | 0.67 |
| Isolates | 21.75 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.57 |
| Nodule | 17.62 |
| Rhizoplane | 4.98 |
| Rhizosphere | 62.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0316574_0095850 | 3300035398 | Bacteria | 1896 |
| 2 | 2214772993 | 2209111006 | Bacteria | 11650 |
| 3 | ARcpr5oldR_c000025 | 3300000041 | Bacteria | 30356 |
| 4 | ARSoilYngRDRAFT_c00011 | 3300000042 | Bacteria | 28426 |
| 5 | ARcpr5yngRDRAFT_c000021 | 3300000043 | Bacteria | 25699 |
| 6 | ARSoilOldRDRAFT_c000046 | 3300000044 | Bacteria | 25757 |
| 7 | ARCol0oldRDRAFT_c00097 | 3300000045 | Bacteria | 7456 |
| 8 | LJQas_1005843 | 3300000549 | Bacteria | 1547 |
| 9 | ARCol0yngRDRAFT_1000010 | 3300000652 | Bacteria | 42356 |
| 10 | JGI24752J21851_1003212 | 3300001976 | Bacteria | 2154 |
| 11 | JGI24746J21847_1000905 | 3300001977 | Bacteria | 4639 |
| 12 | JGI24740J21852_10001241 | 3300001979 | Bacteria | 11542 |
| 13 | JGI24739J22299_10004523 | 3300001989 | Bacteria | 5317 |
| 14 | JGI24739J22299_10012297 | 3300001989 | Bacteria | 3143 |
| 15 | JGI24737J22298_10001098 | 3300001990 | Bacteria | 9510 |
| 16 | JGI24737J22298_10017842 | 3300001990 | Bacteria | 2282 |
| 17 | JGI24750J21931_1000013 | 3300002070 | Bacteria | 21590 |
| 18 | JGI24750J21931_1000484 | 3300002070 | Bacteria | 6277 |
| 19 | JGI24750J21931_1004132 | 3300002070 | Bacteria | 1751 |
| 20 | JGI24745J21846_1000026 | 3300002073 | Bacteria | 9559 |
| 21 | JGI24748J21848_1000355 | 3300002074 | Bacteria | 5281 |
| 22 | JGI24738J21930_10000790 | 3300002075 | Bacteria | 9067 |
| 23 | JGI24744J21845_10011141 | 3300002077 | Bacteria | 1841 |
| 24 | JGI24035J26624_1000074 | 3300002126 | Bacteria | 8140 |
| 25 | JGI24033J26618_1001377 | 3300002155 | Bacteria | 2406 |
| 26 | JGI24034J26672_10001130 | 3300002239 | Bacteria | 3481 |
| 27 | JGI24742J22300_10000012 | 3300002244 | Bacteria | 29909 |
| 28 | JGI25155J39150_1000007 | 3300002704 | Bacteria | 238857 |
| 29 | JGI25156J39149_1000066 | 3300002705 | Bacteria | 82816 |
| 30 | JGI25154J39366_1000035 | 3300002738 | Bacteria | 172224 |
| 31 | JGI25158J39367_1000064 | 3300002739 | Bacteria | 23622 |
| 32 | JGI25157J39369_1000036 | 3300002741 | Bacteria | 133671 |
| 33 | JGI25157J39369_1000197 | 3300002741 | Bacteria | 51019 |
| 34 | JGI25157J39369_1005446 | 3300002741 | Bacteria | 2075 |
| 35 | JGI25152J39213_1001126 | 3300002773 | Bacteria | 12451 |
| 36 | JGI25159J45721_1000451 | 3300002987 | Bacteria | 19016 |
| 37 | JGI25406J46586_10000061 | 3300003203 | Bacteria | 49973 |
| 38 | JGI25153J46596_10009150 | 3300003215 | Bacteria | 4640 |
| 39 | JGI25160J50197_1004816 | 3300003354 | Bacteria | 5756 |
| 40 | JGI25161J50226_1000211 | 3300003374 | Bacteria | 37205 |
| 41 | Ga0055524_1003572 | 3300003775 | Bacteria | 7498 |
| 42 | Ga0055524_1011564 | 3300003775 | Bacteria | 3446 |
| 43 | Ga0055536_1022432 | 3300003781 | Bacteria | 1885 |
| 44 | Ga0055528_1000375 | 3300003790 | Bacteria | 36352 |
| 45 | Ga0055540_1001299 | 3300003792 | Bacteria | 15107 |
| 46 | Ga0055540_1004698 | 3300003792 | Bacteria | 6050 |
| 47 | Ga0055543_1000328 | 3300004625 | Bacteria | 32632 |
| 48 | Ga0065165_1004744 | 3300005262 | Bacteria | 8139 |
| 49 | Ga0065165_1004908 | 3300005262 | Bacteria | 7901 |
| 50 | Ga0065712_10007605 | 3300005290 | Bacteria | 6525 |
| 51 | Ga0065712_10090719 | 3300005290 | Bacteria | 2407 |
| 52 | Ga0065712_10110789 | 3300005290 | Bacteria | 1830 |
| 53 | Ga0065715_10000810 | 3300005293 | Bacteria | 12489 |
| 54 | Ga0065715_10187168 | 3300005293 | Bacteria | 1433 |
| 55 | Ga0065707_10090602 | 3300005295 | Bacteria | 4108 |
| 56 | Ga0070658_10208985 | 3300005327 | Bacteria | 1648 |
| 57 | Ga0070676_10000008 | 3300005328 | Bacteria | 68426 |
| 58 | Ga0070676_10082980 | 3300005328 | Bacteria | 1948 |
| 59 | Ga0070683_100000442 | 3300005329 | Bacteria | 28808 |
| 60 | Ga0070683_100031874 | 3300005329 | Bacteria | 4796 |
| 61 | Ga0070683_100185045 | 3300005329 | Bacteria | 1977 |
| 62 | Ga0070690_100004858 | 3300005330 | Bacteria | 7506 |
| 63 | Ga0070690_100020553 | 3300005330 | Bacteria | 4023 |
| 64 | Ga0070670_100012561 | 3300005331 | Bacteria | 7250 |
| 65 | Ga0070677_10000100 | 3300005333 | Bacteria | 28234 |
| 66 | Ga0068869_100000008 | 3300005334 | Bacteria | 78682 |
| 67 | Ga0070666_10005228 | 3300005335 | Bacteria | 7948 |
| 68 | Ga0070666_10025504 | 3300005335 | Bacteria | 3854 |
| 69 | Ga0070666_10064263 | 3300005335 | Bacteria | 2489 |
| 70 | Ga0070666_10120916 | 3300005335 | Bacteria | 1816 |
| 71 | Ga0070680_100001645 | 3300005336 | Bacteria | 16330 |
| 72 | Ga0070680_100071572 | 3300005336 | Bacteria | 2849 |
| 73 | Ga0070682_100000217 | 3300005337 | Bacteria | 42442 |
| 74 | Ga0070682_100132869 | 3300005337 | Bacteria | 1686 |
| 75 | Ga0068868_100000521 | 3300005338 | Bacteria | 25775 |
| 76 | Ga0068868_100015942 | 3300005338 | Bacteria | 5570 |
| 77 | Ga0068868_100162839 | 3300005338 | Bacteria | 1843 |
| 78 | Ga0070660_100000962 | 3300005339 | Bacteria | 19264 |
| 79 | Ga0070660_100012282 | 3300005339 | Bacteria | 6112 |
| 80 | Ga0070660_100062961 | 3300005339 | Bacteria | 2883 |
| 81 | Ga0070689_100000092 | 3300005340 | Bacteria | 52157 |
| 82 | Ga0070689_100037958 | 3300005340 | Bacteria | 3684 |
| 83 | Ga0070689_100089729 | 3300005340 | Bacteria | 2421 |
| 84 | Ga0070689_100136944 | 3300005340 | Bacteria | 1967 |
| 85 | Ga0070689_100188277 | 3300005340 | Bacteria | 1679 |
| 86 | Ga0070691_10000193 | 3300005341 | Bacteria | 20349 |
| 87 | Ga0070691_10010038 | 3300005341 | Bacteria | 4315 |
| 88 | Ga0070687_100000292 | 3300005343 | Bacteria | 16906 |
| 89 | Ga0070687_100015395 | 3300005343 | Bacteria | 3458 |
| 90 | Ga0070661_100001156 | 3300005344 | Bacteria | 18590 |
| 91 | Ga0070692_10002125 | 3300005345 | Bacteria | 7580 |
| 92 | Ga0070668_100000463 | 3300005347 | Bacteria | 26870 |
| 93 | Ga0070669_100009511 | 3300005353 | Bacteria | 6923 |
| 94 | Ga0070669_100046638 | 3300005353 | Bacteria | 3160 |
| 95 | Ga0070675_100000032 | 3300005354 | Bacteria | 97014 |
| 96 | Ga0070675_100028829 | 3300005354 | Bacteria | 4471 |
| 97 | Ga0070671_100019617 | 3300005355 | Bacteria | 5505 |
| 98 | Ga0070671_100046825 | 3300005355 | Bacteria | 3596 |
| 99 | Ga0070671_100098212 | 3300005355 | Bacteria | 2456 |
| 100 | Ga0070674_100000070 | 3300005356 | Bacteria | 47062 |
| 101 | Ga0070674_100303887 | 3300005356 | Bacteria | 1273 |
| 102 | Ga0070673_100000122 | 3300005364 | Bacteria | 36106 |
| 103 | Ga0070673_100006774 | 3300005364 | Bacteria | 7479 |
| 104 | Ga0070673_100008361 | 3300005364 | Bacteria | 6878 |
| 105 | Ga0070673_100229526 | 3300005364 | Bacteria | 1610 |
| 106 | Ga0070673_100272581 | 3300005364 | Bacteria | 1482 |
| 107 | Ga0070688_100000062 | 3300005365 | Bacteria | 52780 |
| 108 | Ga0070688_100025910 | 3300005365 | Bacteria | 3477 |
| 109 | Ga0070688_100058063 | 3300005365 | Bacteria | 2435 |
| 110 | Ga0070659_100003490 | 3300005366 | Bacteria | 11191 |
| 111 | Ga0070659_100094038 | 3300005366 | Bacteria | 2406 |
| 112 | Ga0070659_100098126 | 3300005366 | Bacteria | 2355 |
| 113 | Ga0070667_100002274 | 3300005367 | Bacteria | 16906 |
| 114 | Ga0070667_100083916 | 3300005367 | Bacteria | 2730 |
| 115 | Ga0070709_10003313 | 3300005434 | Bacteria | 8667 |
| 116 | Ga0070709_10008277 | 3300005434 | Bacteria | 5711 |
| 117 | Ga0070709_10057181 | 3300005434 | Bacteria | 2469 |
| 118 | Ga0070714_100233750 | 3300005435 | Bacteria | 1694 |
| 119 | Ga0070713_100017447 | 3300005436 | Bacteria | 5429 |
| 120 | Ga0070713_100032360 | 3300005436 | Bacteria | 4176 |
| 121 | Ga0070713_100118146 | 3300005436 | Bacteria | 2321 |
| 122 | Ga0070713_100372803 | 3300005436 | Bacteria | 1328 |
| 123 | Ga0070710_10004852 | 3300005437 | Bacteria | 6361 |
| 124 | Ga0070710_10018721 | 3300005437 | Bacteria | 3567 |
| 125 | Ga0070710_10019737 | 3300005437 | Bacteria | 3488 |
| 126 | Ga0070710_10132150 | 3300005437 | Bacteria | 1523 |
| 127 | Ga0070701_10000030 | 3300005438 | Bacteria | 35788 |
| 128 | Ga0070711_100000630 | 3300005439 | Bacteria | 18413 |
| 129 | Ga0070711_100011160 | 3300005439 | Bacteria | 5572 |
| 130 | Ga0070711_100020259 | 3300005439 | Bacteria | 4283 |
| 131 | Ga0070711_100032137 | 3300005439 | Bacteria | 3488 |
| 132 | Ga0070705_100037303 | 3300005440 | Bacteria | 2740 |
| 133 | Ga0070700_100001800 | 3300005441 | Bacteria | 10813 |
| 134 | Ga0070700_100040001 | 3300005441 | Bacteria | 2868 |
| 135 | Ga0070700_100061028 | 3300005441 | Bacteria | 2378 |
| 136 | Ga0070694_100001327 | 3300005444 | Bacteria | 14410 |
| 137 | Ga0070708_100022682 | 3300005445 | Bacteria | 5327 |
| 138 | Ga0070708_100089370 | 3300005445 | Bacteria | 2803 |
| 139 | Ga0070708_100114929 | 3300005445 | Bacteria | 2477 |
| 140 | Ga0070663_100004939 | 3300005455 | Bacteria | 7874 |
| 141 | Ga0070663_100014811 | 3300005455 | Bacteria | 5013 |
| 142 | Ga0070663_100017579 | 3300005455 | Bacteria | 4670 |
| 143 | Ga0070663_100059293 | 3300005455 | Bacteria | 2751 |
| 144 | Ga0070663_100072592 | 3300005455 | Bacteria | 2508 |
| 145 | Ga0070663_100124570 | 3300005455 | Bacteria | 1950 |
| 146 | Ga0070663_100179724 | 3300005455 | Bacteria | 1640 |
| 147 | Ga0070678_100000054 | 3300005456 | Bacteria | 40372 |
| 148 | Ga0070678_100006773 | 3300005456 | Bacteria | 6751 |
| 149 | Ga0070678_100416976 | 3300005456 | Bacteria | 1169 |
| 150 | Ga0070662_100029675 | 3300005457 | Bacteria | 3818 |
| 151 | Ga0070662_100144551 | 3300005457 | Bacteria | 1846 |
| 152 | Ga0070681_10000284 | 3300005458 | Bacteria | 40778 |
| 153 | Ga0070681_10019669 | 3300005458 | Bacteria | 6762 |
| 154 | Ga0070681_10076781 | 3300005458 | Bacteria | 3298 |
| 155 | Ga0070681_10332227 | 3300005458 | Bacteria | 1430 |
| 156 | Ga0070681_10490527 | 3300005458 | Bacteria | 1141 |
| 157 | Ga0068867_100000073 | 3300005459 | Bacteria | 61471 |
| 158 | Ga0068867_100186374 | 3300005459 | Bacteria | 1653 |
| 159 | Ga0070685_10050153 | 3300005466 | Bacteria | 2410 |
| 160 | Ga0070707_100090495 | 3300005468 | Bacteria | 2961 |
| 161 | Ga0070699_100332533 | 3300005518 | Bacteria | 1367 |
| 162 | Ga0070679_100006931 | 3300005530 | Bacteria | 10571 |
| 163 | Ga0070679_100099240 | 3300005530 | Bacteria | 2899 |
| 164 | Ga0070684_100000022 | 3300005535 | Bacteria | 128353 |
| 165 | Ga0070684_100026341 | 3300005535 | Bacteria | 4897 |
| 166 | Ga0070684_100114453 | 3300005535 | Bacteria | 2421 |
| 167 | Ga0070684_100151892 | 3300005535 | Bacteria | 2098 |
| 168 | Ga0070684_100200295 | 3300005535 | Bacteria | 1818 |
| 169 | Ga0070684_100517824 | 3300005535 | Bacteria | 1105 |
| 170 | Ga0070697_100223843 | 3300005536 | Bacteria | 1604 |
| 171 | Ga0068853_100000820 | 3300005539 | Bacteria | 21708 |
| 172 | Ga0068853_100006375 | 3300005539 | Bacteria | 9371 |
| 173 | Ga0068853_100016781 | 3300005539 | Bacteria | 6032 |
| 174 | Ga0068853_100054719 | 3300005539 | Bacteria | 3440 |
| 175 | Ga0068853_100178045 | 3300005539 | Bacteria | 1927 |
| 176 | Ga0068853_100271544 | 3300005539 | Bacteria | 1562 |
| 177 | Ga0070672_100000012 | 3300005543 | Bacteria | 78125 |
| 178 | Ga0070672_100165557 | 3300005543 | Bacteria | 1836 |
| 179 | Ga0070686_100000087 | 3300005544 | Bacteria | 64591 |
| 180 | Ga0070686_100009191 | 3300005544 | Bacteria | 5546 |
| 181 | Ga0070686_100097563 | 3300005544 | Bacteria | 1979 |
| 182 | Ga0070695_100013698 | 3300005545 | Bacteria | 4874 |
| 183 | Ga0070695_100044896 | 3300005545 | Bacteria | 2815 |
| 184 | Ga0070695_100227561 | 3300005545 | Bacteria | 1346 |
| 185 | Ga0070696_100024101 | 3300005546 | Bacteria | 4136 |
| 186 | Ga0070696_100107464 | 3300005546 | Bacteria | 2007 |
| 187 | Ga0070693_100007106 | 3300005547 | Bacteria | 5457 |
| 188 | Ga0070693_100033679 | 3300005547 | Bacteria | 2830 |
| 189 | Ga0070665_100002168 | 3300005548 | Bacteria | 21900 |
| 190 | Ga0070665_100009158 | 3300005548 | Bacteria | 10027 |
| 191 | Ga0070665_100054836 | 3300005548 | Bacteria | 3997 |
| 192 | Ga0070665_100094590 | 3300005548 | Bacteria | 2993 |
| 193 | Ga0070665_100208987 | 3300005548 | Bacteria | 1952 |
| 194 | Ga0070704_100015624 | 3300005549 | Bacteria | 4774 |
| 195 | Ga0070704_100270224 | 3300005549 | Bacteria | 1404 |
| 196 | Ga0068855_100013715 | 3300005563 | Bacteria | 9770 |
| 197 | Ga0068855_100034558 | 3300005563 | Bacteria | 6027 |
| 198 | Ga0068855_100148336 | 3300005563 | Bacteria | 2668 |
| 199 | Ga0070664_100000102 | 3300005564 | Bacteria | 54873 |
| 200 | Ga0068857_100000069 | 3300005577 | Bacteria | 58801 |
| 201 | Ga0068857_100000859 | 3300005577 | Bacteria | 22784 |
| 202 | Ga0068854_100000215 | 3300005578 | Bacteria | 38919 |
| 203 | Ga0068854_100042575 | 3300005578 | Bacteria | 3215 |
| 204 | Ga0068856_100000214 | 3300005614 | Bacteria | 62372 |
| 205 | Ga0068856_100005749 | 3300005614 | Bacteria | 12218 |
| 206 | Ga0068856_100015547 | 3300005614 | Bacteria | 7356 |
| 207 | Ga0068856_100115885 | 3300005614 | Bacteria | 2680 |
| 208 | Ga0070702_100000418 | 3300005615 | Bacteria | 15156 |
| 209 | Ga0070702_100009245 | 3300005615 | Bacteria | 4816 |
| 210 | Ga0068852_100000269 | 3300005616 | Bacteria | 34734 |
| 211 | Ga0068852_100035262 | 3300005616 | Bacteria | 4171 |
| 212 | Ga0068852_100588173 | 3300005616 | Bacteria | 1116 |
| 213 | Ga0068859_100003063 | 3300005617 | Bacteria | 16943 |
| 214 | Ga0068859_100352934 | 3300005617 | Bacteria | 1566 |
| 215 | Ga0068864_100001591 | 3300005618 | Bacteria | 18696 |
| 216 | Ga0068866_10000150 | 3300005718 | Bacteria | 31741 |
| 217 | Ga0068861_100007600 | 3300005719 | Bacteria | 7438 |
| 218 | Ga0068861_100301277 | 3300005719 | Bacteria | 1388 |
| 219 | Ga0068870_10000001 | 3300005840 | Bacteria | 97513 |
| 220 | Ga0068863_100010203 | 3300005841 | Bacteria | 9133 |
| 221 | Ga0068863_100141036 | 3300005841 | Bacteria | 2303 |
| 222 | Ga0068863_100246587 | 3300005841 | Bacteria | 1725 |
| 223 | Ga0068858_100001238 | 3300005842 | Bacteria | 26382 |
| 224 | Ga0068860_100002196 | 3300005843 | Bacteria | 20522 |
| 225 | Ga0068860_100002790 | 3300005843 | Bacteria | 18164 |
| 226 | Ga0068860_100080264 | 3300005843 | Bacteria | 3102 |
| 227 | Ga0068862_100000304 | 3300005844 | Bacteria | 53990 |
| 228 | Ga0068862_100016948 | 3300005844 | Bacteria | 6064 |
| 229 | Ga0081455_10000124 | 3300005937 | Bacteria | 89174 |
| 230 | Ga0081455_10007243 | 3300005937 | Bacteria | 11711 |
| 231 | Ga0081455_10095333 | 3300005937 | Bacteria | 2402 |
| 232 | Ga0081538_10022322 | 3300005981 | Bacteria | 4588 |
| 233 | Ga0081539_10000942 | 3300005985 | Bacteria | 54492 |
| 234 | Ga0081539_10000950 | 3300005985 | Bacteria | 54335 |
| 235 | Ga0081539_10015421 | 3300005985 | Bacteria | 5555 |
| 236 | Ga0070717_10000580 | 3300006028 | Bacteria | 23328 |
| 237 | Ga0070717_10000673 | 3300006028 | Bacteria | 21982 |
| 238 | Ga0070717_10012410 | 3300006028 | Bacteria | 6497 |
| 239 | Ga0070717_10058332 | 3300006028 | Bacteria | 3192 |
| 240 | Ga0070717_10152078 | 3300006028 | Bacteria | 2003 |
| 241 | Ga0075365_10009764 | 3300006038 | Bacteria | 5545 |
| 242 | Ga0075365_10014389 | 3300006038 | Bacteria | 4758 |
| 243 | Ga0075365_10015198 | 3300006038 | Bacteria | 4650 |
| 244 | Ga0075365_10103890 | 3300006038 | Bacteria | 1948 |
| 245 | Ga0075365_10151027 | 3300006038 | Bacteria | 1616 |
| 246 | Ga0075368_10000514 | 3300006042 | Bacteria | 11538 |
| 247 | Ga0075368_10008426 | 3300006042 | Bacteria | 3672 |
| 248 | Ga0075368_10009212 | 3300006042 | Bacteria | 3547 |
| 249 | Ga0075368_10017057 | 3300006042 | Bacteria | 2713 |
| 250 | Ga0075363_100009613 | 3300006048 | Bacteria | 4552 |
| 251 | Ga0075363_100013871 | 3300006048 | Bacteria | 3922 |
| 252 | Ga0075363_100021691 | 3300006048 | Bacteria | 3239 |
| 253 | Ga0075363_100136887 | 3300006048 | Bacteria | 1377 |
| 254 | Ga0075364_10050071 | 3300006051 | Bacteria | 2726 |
| 255 | Ga0075364_10053351 | 3300006051 | Bacteria | 2643 |
| 256 | Ga0075364_10138910 | 3300006051 | Bacteria | 1633 |
| 257 | Ga0075432_10005138 | 3300006058 | Bacteria | 4459 |
| 258 | Ga0070715_10000687 | 3300006163 | Bacteria | 9066 |
| 259 | Ga0070715_10004382 | 3300006163 | Bacteria | 4624 |
| 260 | Ga0070716_100003594 | 3300006173 | Bacteria | 7328 |
| 261 | Ga0070716_100003703 | 3300006173 | Bacteria | 7236 |
| 262 | Ga0070716_100045269 | 3300006173 | Bacteria | 2469 |
| 263 | Ga0070712_100002316 | 3300006175 | Bacteria | 11735 |
| 264 | Ga0070712_100014590 | 3300006175 | Bacteria | 5043 |
| 265 | Ga0070712_100122520 | 3300006175 | Bacteria | 1958 |
| 266 | Ga0075362_10000033 | 3300006177 | Bacteria | 50782 |
| 267 | Ga0075362_10015455 | 3300006177 | Bacteria | 3105 |
| 268 | Ga0075367_10000094 | 3300006178 | Bacteria | 24410 |
| 269 | Ga0075367_10001182 | 3300006178 | Bacteria | 10953 |
| 270 | Ga0075367_10012710 | 3300006178 | Bacteria | 4502 |
| 271 | Ga0075367_10054506 | 3300006178 | Bacteria | 2371 |
| 272 | Ga0075367_10064366 | 3300006178 | Bacteria | 2193 |
| 273 | Ga0075369_10018490 | 3300006186 | Bacteria | 2838 |
| 274 | Ga0075369_10031756 | 3300006186 | Bacteria | 2231 |
| 275 | Ga0075427_10000195 | 3300006194 | Bacteria | 6119 |
| 276 | Ga0075366_10000058 | 3300006195 | Bacteria | 40618 |
| 277 | Ga0075366_10037458 | 3300006195 | Bacteria | 2864 |
| 278 | Ga0075366_10130292 | 3300006195 | Bacteria | 1518 |
| 279 | Ga0097621_100001871 | 3300006237 | Bacteria | 14412 |
| 280 | Ga0097621_100041280 | 3300006237 | Bacteria | 3713 |
| 281 | Ga0075370_10000017 | 3300006353 | Bacteria | 60451 |
| 282 | Ga0075370_10005269 | 3300006353 | Bacteria | 6404 |
| 283 | Ga0075370_10105522 | 3300006353 | Bacteria | 1633 |
| 284 | Ga0068871_100000007 | 3300006358 | Bacteria | 115829 |
| 285 | Ga0068871_100036433 | 3300006358 | Bacteria | 3917 |
| 286 | Ga0068871_100081538 | 3300006358 | Bacteria | 2680 |
| 287 | Ga0068871_100082082 | 3300006358 | Bacteria | 2672 |
| 288 | Ga0075430_100008800 | 3300006846 | Bacteria | 8520 |
| 289 | Ga0075430_100014321 | 3300006846 | Bacteria | 6759 |
| 290 | Ga0075431_100216548 | 3300006847 | Bacteria | 1954 |
| 291 | Ga0075433_10012955 | 3300006852 | Bacteria | 6760 |
| 292 | Ga0075433_10061991 | 3300006852 | Bacteria | 3275 |
| 293 | Ga0075434_100000210 | 3300006871 | Bacteria | 39685 |
| 294 | Ga0075434_100000421 | 3300006871 | Bacteria | 31416 |
| 295 | Ga0075434_100021620 | 3300006871 | Bacteria | 6256 |
| 296 | Ga0075434_100079189 | 3300006871 | Bacteria | 3282 |
| 297 | Ga0075429_100101449 | 3300006880 | Bacteria | 2512 |
| 298 | Ga0068865_100003045 | 3300006881 | Bacteria | 10022 |
| 299 | Ga0068865_100020700 | 3300006881 | Bacteria | 4269 |
| 300 | Ga0068865_100077038 | 3300006881 | Bacteria | 2382 |
| 301 | Ga0075436_100048519 | 3300006914 | Bacteria | 2929 |
| 302 | Ga0097620_100003063 | 3300006931 | Bacteria | 16943 |
| 303 | Ga0097620_100352910 | 3300006931 | Bacteria | 1566 |
| 304 | Ga0099826_10007048 | 3300006948 | Bacteria | 8251 |
| 305 | Ga0099826_10028867 | 3300006948 | Bacteria | 4051 |
| 306 | Ga0075435_100048505 | 3300007076 | Bacteria | 3412 |
| 307 | Ga0075435_100180690 | 3300007076 | Bacteria | 1783 |
| 308 | Ga0105251_10013627 | 3300009011 | Bacteria | 4540 |
| 309 | Ga0105244_10019657 | 3300009036 | Bacteria | 3764 |
| 310 | Ga0105250_10064689 | 3300009092 | Bacteria | 1473 |
| 311 | Ga0105240_10003029 | 3300009093 | Bacteria | 26432 |
| 312 | Ga0105240_10049388 | 3300009093 | Bacteria | 5310 |
| 313 | Ga0111539_10000241 | 3300009094 | Bacteria | 65476 |
| 314 | Ga0111539_10004570 | 3300009094 | Bacteria | 18089 |
| 315 | Ga0111539_10070961 | 3300009094 | Bacteria | 4111 |
| 316 | Ga0111539_10135881 | 3300009094 | Bacteria | 2879 |
| 317 | Ga0105245_10000801 | 3300009098 | Bacteria | 28541 |
| 318 | Ga0105245_10003072 | 3300009098 | Bacteria | 14945 |
| 319 | Ga0105245_10030710 | 3300009098 | Bacteria | 4752 |
| 320 | Ga0105247_10004748 | 3300009101 | Bacteria | 8653 |
| 321 | Ga0105247_10094059 | 3300009101 | Bacteria | 1906 |
| 322 | Ga0105247_10160323 | 3300009101 | Bacteria | 1489 |
| 323 | Ga0114129_10773858 | 3300009147 | Bacteria | 1227 |
| 324 | Ga0105243_10008450 | 3300009148 | Bacteria | 7905 |
| 325 | Ga0105243_10011070 | 3300009148 | Bacteria | 6824 |
| 326 | Ga0105243_10111752 | 3300009148 | Bacteria | 2288 |
| 327 | Ga0105241_10008483 | 3300009174 | Bacteria | 7556 |
| 328 | Ga0105241_10261664 | 3300009174 | Bacteria | 1470 |
| 329 | Ga0105242_10001026 | 3300009176 | Bacteria | 21975 |
| 330 | Ga0105242_10022111 | 3300009176 | Bacteria | 4997 |
| 331 | Ga0105242_10029851 | 3300009176 | Bacteria | 4351 |
| 332 | Ga0105248_10001294 | 3300009177 | Bacteria | 27861 |
| 333 | Ga0105248_10077985 | 3300009177 | Bacteria | 3725 |
| 334 | Ga0105248_10178563 | 3300009177 | Bacteria | 2393 |
| 335 | Ga0105237_10017910 | 3300009545 | Bacteria | 7341 |
| 336 | Ga0105237_10035878 | 3300009545 | Bacteria | 5016 |
| 337 | Ga0105237_10056759 | 3300009545 | Bacteria | 3918 |
| 338 | Ga0105238_10015395 | 3300009551 | Bacteria | 7740 |
| 339 | Ga0105238_10205797 | 3300009551 | Bacteria | 1944 |
| 340 | Ga0105238_10257327 | 3300009551 | Bacteria | 1725 |
| 341 | Ga0105249_10000318 | 3300009553 | Bacteria | 48726 |
| 342 | Ga0105249_10091463 | 3300009553 | Bacteria | 2847 |
| 343 | Ga0123341_1000014 | 3300009765 | Bacteria | 91980 |
| 344 | Ga0123342_1023821 | 3300009766 | Bacteria | 3916 |
| 345 | Ga0105028_107499 | 3300009993 | Bacteria | 1140 |
| 346 | Ga0105239_10001966 | 3300010375 | Bacteria | 26740 |
| 347 | Ga0105239_10014516 | 3300010375 | Bacteria | 8739 |
| 348 | Ga0105239_10064546 | 3300010375 | Bacteria | 4019 |
| 349 | Ga0157325_1000593 | 3300012485 | Bacteria | 1492 |
| 350 | Ga0157341_1000378 | 3300012494 | Bacteria | 2189 |
| 351 | Ga0157345_1003304 | 3300012498 | Bacteria | 1174 |
| 352 | Ga0157373_10005714 | 3300013100 | Bacteria | 9321 |
| 353 | Ga0157371_10000002 | 3300013102 | Bacteria | 665040 |
| 354 | Ga0157371_10006511 | 3300013102 | Bacteria | 9617 |
| 355 | Ga0157370_10000246 | 3300013104 | Bacteria | 69424 |
| 356 | Ga0157369_10001922 | 3300013105 | Bacteria | 25071 |
| 357 | Ga0157369_10313793 | 3300013105 | Bacteria | 1630 |
| 358 | Ga0157374_10004984 | 3300013296 | Bacteria | 11140 |
| 359 | Ga0157374_10203519 | 3300013296 | Bacteria | 1939 |
| 360 | Ga0157378_10002119 | 3300013297 | Bacteria | 17649 |
| 361 | Ga0157378_10029322 | 3300013297 | Bacteria | 4858 |
| 362 | Ga0157378_10259760 | 3300013297 | Bacteria | 1666 |
| 363 | Ga0157378_10439018 | 3300013297 | Bacteria | 1293 |
| 364 | Ga0163162_10000416 | 3300013306 | Bacteria | 39159 |
| 365 | Ga0157372_10068690 | 3300013307 | Bacteria | 3984 |
| 366 | Ga0157372_10138256 | 3300013307 | Bacteria | 2806 |
| 367 | Ga0157375_10000571 | 3300013308 | Bacteria | 32965 |
| 368 | Ga0157375_10080768 | 3300013308 | Bacteria | 3290 |
| 369 | Ga0157375_10268094 | 3300013308 | Bacteria | 1869 |
| 370 | Ga0157375_10296683 | 3300013308 | Bacteria | 1780 |
| 371 | Ga0163163_10000673 | 3300014325 | Bacteria | 29212 |
| 372 | Ga0163163_10036260 | 3300014325 | Bacteria | 4790 |
| 373 | Ga0163163_10101226 | 3300014325 | Bacteria | 2903 |
| 374 | Ga0163163_10171559 | 3300014325 | Bacteria | 2216 |
| 375 | Ga0163163_10531914 | 3300014325 | Bacteria | 1238 |
| 376 | Ga0157380_10000115 | 3300014326 | Bacteria | 44247 |
| 377 | Ga0157377_10000086 | 3300014745 | Bacteria | 69604 |
| 378 | Ga0157379_10003187 | 3300014968 | Bacteria | 13897 |
| 379 | Ga0157379_10155762 | 3300014968 | Bacteria | 2061 |
| 380 | Ga0157376_10000253 | 3300014969 | Bacteria | 36981 |
| 381 | Ga0157376_10106694 | 3300014969 | Bacteria | 2458 |
| 382 | Ga0163161_10000920 | 3300017792 | Bacteria | 22717 |
| 383 | Ga0206356_10536735 | 3300020070 | Bacteria | 2869 |
| 384 | Ga0206350_11580286 | 3300020080 | Bacteria | 1752 |
| 385 | Ga0206350_11586057 | 3300020080 | Bacteria | 1981 |
| 386 | Ga0213876_10017170 | 3300021384 | Bacteria | 3822 |
| 387 | Ga0213876_10071469 | 3300021384 | Bacteria | 1833 |
| 388 | Ga0224712_10023711 | 3300022467 | Bacteria | 2134 |
| 389 | Ga0224712_10035954 | 3300022467 | Bacteria | 1832 |
| 390 | Ga0209435_100005 | 3300025206 | Bacteria | 573745 |
| 391 | Ga0209436_100027 | 3300025208 | Bacteria | 87534 |
| 392 | Ga0207425_1003001 | 3300025245 | Bacteria | 5624 |
| 393 | Ga0209646_1000011 | 3300025246 | Bacteria | 573745 |
| 394 | Ga0209026_1000008 | 3300025250 | Bacteria | 573745 |
| 395 | Ga0209026_1000041 | 3300025250 | Bacteria | 275745 |
| 396 | Ga0209759_1000004 | 3300025256 | Bacteria | 573745 |
| 397 | Ga0209759_1000280 | 3300025256 | Bacteria | 71873 |
| 398 | Ga0209129_1000473 | 3300025258 | Bacteria | 29481 |
| 399 | Ga0209129_1001033 | 3300025258 | Bacteria | 16529 |
| 400 | Ga0209129_1004322 | 3300025258 | Bacteria | 5622 |
| 401 | Ga0207666_1000007 | 3300025271 | Bacteria | 49628 |
| 402 | Ga0209455_1012807 | 3300025272 | Bacteria | 1984 |
| 403 | Ga0209673_1000037 | 3300025273 | Bacteria | 313804 |
| 404 | Ga0209130_1000030 | 3300025284 | Bacteria | 323323 |
| 405 | Ga0207673_1000390 | 3300025290 | Bacteria | 4450 |
| 406 | Ga0209675_1010227 | 3300025291 | Bacteria | 3222 |
| 407 | Ga0209676_1000089 | 3300025292 | Bacteria | 260196 |
| 408 | Ga0209676_1017817 | 3300025292 | Bacteria | 2499 |
| 409 | Ga0209025_1000255 | 3300025294 | Bacteria | 125764 |
| 410 | Ga0209025_1010020 | 3300025294 | Bacteria | 6491 |
| 411 | Ga0209564_1005953 | 3300025295 | Bacteria | 6752 |
| 412 | Ga0209758_1001044 | 3300025297 | Bacteria | 36272 |
| 413 | Ga0209758_1001658 | 3300025297 | Bacteria | 25232 |
| 414 | Ga0209758_1002926 | 3300025297 | Bacteria | 16452 |
| 415 | Ga0209256_1000979 | 3300025299 | Bacteria | 34325 |
| 416 | Ga0209256_1011568 | 3300025299 | Bacteria | 3509 |
| 417 | Ga0207426_1000047 | 3300025302 | Bacteria | 417011 |
| 418 | Ga0209051_1001326 | 3300025303 | Bacteria | 21586 |
| 419 | Ga0209257_1005895 | 3300025304 | Bacteria | 8254 |
| 420 | Ga0209257_1016134 | 3300025304 | Bacteria | 3046 |
| 421 | Ga0207697_10000083 | 3300025315 | Bacteria | 41914 |
| 422 | Ga0207697_10002626 | 3300025315 | Bacteria | 9244 |
| 423 | Ga0207682_10000002 | 3300025893 | Bacteria | 132580 |
| 424 | Ga0207682_10002152 | 3300025893 | Bacteria | 8934 |
| 425 | Ga0207692_10000961 | 3300025898 | Bacteria | 10484 |
| 426 | Ga0207692_10006269 | 3300025898 | Bacteria | 4820 |
| 427 | Ga0207692_10025380 | 3300025898 | Bacteria | 2767 |
| 428 | Ga0207642_10044243 | 3300025899 | Bacteria | 1969 |
| 429 | Ga0207642_10141900 | 3300025899 | Bacteria | 1268 |
| 430 | Ga0207710_10009324 | 3300025900 | Bacteria | 4131 |
| 431 | Ga0207710_10042160 | 3300025900 | Bacteria | 2026 |
| 432 | Ga0207688_10000102 | 3300025901 | Bacteria | 33857 |
| 433 | Ga0207680_10108725 | 3300025903 | Bacteria | 1794 |
| 434 | Ga0207680_10300556 | 3300025903 | Bacteria | 1119 |
| 435 | Ga0207647_10002077 | 3300025904 | Bacteria | 15320 |
| 436 | Ga0207647_10012505 | 3300025904 | Bacteria | 5907 |
| 437 | Ga0207685_10034188 | 3300025905 | Bacteria | 1845 |
| 438 | Ga0207685_10047203 | 3300025905 | Bacteria | 1643 |
| 439 | Ga0207699_10001084 | 3300025906 | Bacteria | 12844 |
| 440 | Ga0207699_10017204 | 3300025906 | Bacteria | 3799 |
| 441 | Ga0207699_10036297 | 3300025906 | Bacteria | 2809 |
| 442 | Ga0207699_10108732 | 3300025906 | Bacteria | 1773 |
| 443 | Ga0207645_10000026 | 3300025907 | Bacteria | 97025 |
| 444 | Ga0207645_10013020 | 3300025907 | Bacteria | 5620 |
| 445 | Ga0207643_10000003 | 3300025908 | Bacteria | 207506 |
| 446 | Ga0207705_10069331 | 3300025909 | Bacteria | 2554 |
| 447 | Ga0207684_10216660 | 3300025910 | Bacteria | 1652 |
| 448 | Ga0207654_10000446 | 3300025911 | Bacteria | 23584 |
| 449 | Ga0207654_10023803 | 3300025911 | Bacteria | 3286 |
| 450 | Ga0207707_10000915 | 3300025912 | Bacteria | 28718 |
| 451 | Ga0207707_10005780 | 3300025912 | Bacteria | 10814 |
| 452 | Ga0207707_10008611 | 3300025912 | Bacteria | 8848 |
| 453 | Ga0207707_10049361 | 3300025912 | Bacteria | 3666 |
| 454 | Ga0207707_10126732 | 3300025912 | Bacteria | 2233 |
| 455 | Ga0207707_10268717 | 3300025912 | Bacteria | 1478 |
| 456 | Ga0207707_10364185 | 3300025912 | Bacteria | 1244 |
| 457 | Ga0207695_10000343 | 3300025913 | Bacteria | 107739 |
| 458 | Ga0207695_10032281 | 3300025913 | Bacteria | 5732 |
| 459 | Ga0207671_10019670 | 3300025914 | Bacteria | 5157 |
| 460 | Ga0207671_10109418 | 3300025914 | Bacteria | 2101 |
| 461 | Ga0207671_10132090 | 3300025914 | Bacteria | 1917 |
| 462 | Ga0207671_10306597 | 3300025914 | Bacteria | 1255 |
| 463 | Ga0207693_10001056 | 3300025915 | Bacteria | 24634 |
| 464 | Ga0207693_10002909 | 3300025915 | Bacteria | 14824 |
| 465 | Ga0207693_10005106 | 3300025915 | Bacteria | 11004 |
| 466 | Ga0207663_10000274 | 3300025916 | Bacteria | 22378 |
| 467 | Ga0207663_10015670 | 3300025916 | Bacteria | 4188 |
| 468 | Ga0207663_10019351 | 3300025916 | Bacteria | 3834 |
| 469 | Ga0207663_10031939 | 3300025916 | Bacteria | 3121 |
| 470 | Ga0207663_10046550 | 3300025916 | Bacteria | 2673 |
| 471 | Ga0207663_10064818 | 3300025916 | Bacteria | 2333 |
| 472 | Ga0207660_10000070 | 3300025917 | Bacteria | 53365 |
| 473 | Ga0207660_10165236 | 3300025917 | Bacteria | 1710 |
| 474 | Ga0207662_10000297 | 3300025918 | Bacteria | 22884 |
| 475 | Ga0207662_10024049 | 3300025918 | Bacteria | 3505 |
| 476 | Ga0207657_10000840 | 3300025919 | Bacteria | 32484 |
| 477 | Ga0207657_10012080 | 3300025919 | Bacteria | 8536 |
| 478 | Ga0207657_10043719 | 3300025919 | Bacteria | 3944 |
| 479 | Ga0207657_10254291 | 3300025919 | Bacteria | 1400 |
| 480 | Ga0207649_10000054 | 3300025920 | Bacteria | 103258 |
| 481 | Ga0207649_10077345 | 3300025920 | Bacteria | 2144 |
| 482 | Ga0207652_10000059 | 3300025921 | Bacteria | 113599 |
| 483 | Ga0207652_10023605 | 3300025921 | Bacteria | 5096 |
| 484 | Ga0207652_10042066 | 3300025921 | Bacteria | 3887 |
| 485 | Ga0207652_10160138 | 3300025921 | Bacteria | 2018 |
| 486 | Ga0207652_10179672 | 3300025921 | Bacteria | 1901 |
| 487 | Ga0207652_10337463 | 3300025921 | Bacteria | 1360 |
| 488 | Ga0207681_10000118 | 3300025923 | Bacteria | 66554 |
| 489 | Ga0207681_10009906 | 3300025923 | Bacteria | 5831 |
| 490 | Ga0207694_10000136 | 3300025924 | Bacteria | 74908 |
| 491 | Ga0207694_10021745 | 3300025924 | Bacteria | 4861 |
| 492 | Ga0207694_10192704 | 3300025924 | Bacteria | 1656 |
| 493 | Ga0207694_10341004 | 3300025924 | Bacteria | 1239 |
| 494 | Ga0207659_10000015 | 3300025926 | Bacteria | 168475 |
| 495 | Ga0207659_10099537 | 3300025926 | Bacteria | 2189 |
| 496 | Ga0207687_10000050 | 3300025927 | Bacteria | 93290 |
| 497 | Ga0207687_10002145 | 3300025927 | Bacteria | 13448 |
| 498 | Ga0207687_10015596 | 3300025927 | Bacteria | 4985 |
| 499 | Ga0207687_10016045 | 3300025927 | Bacteria | 4916 |
| 500 | Ga0207687_10199566 | 3300025927 | Bacteria | 1563 |
| 501 | Ga0207700_10001567 | 3300025928 | Bacteria | 12973 |
| 502 | Ga0207700_10013014 | 3300025928 | Bacteria | 5393 |
| 503 | Ga0207700_10017266 | 3300025928 | Bacteria | 4817 |
| 504 | Ga0207700_10061388 | 3300025928 | Bacteria | 2850 |
| 505 | Ga0207664_10000795 | 3300025929 | Bacteria | 21314 |
| 506 | Ga0207664_10013721 | 3300025929 | Bacteria | 5827 |
| 507 | Ga0207664_10024515 | 3300025929 | Bacteria | 4534 |
| 508 | Ga0207664_10516375 | 3300025929 | Bacteria | 1070 |
| 509 | Ga0207644_10010053 | 3300025931 | Bacteria | 6229 |
| 510 | Ga0207644_10016159 | 3300025931 | Bacteria | 5021 |
| 511 | Ga0207644_10156266 | 3300025931 | Bacteria | 1769 |
| 512 | Ga0207690_10000146 | 3300025932 | Bacteria | 56554 |
| 513 | Ga0207690_10040654 | 3300025932 | Bacteria | 3041 |
| 514 | Ga0207706_10001170 | 3300025933 | Bacteria | 26622 |
| 515 | Ga0207706_10039134 | 3300025933 | Bacteria | 4204 |
| 516 | Ga0207706_10051076 | 3300025933 | Bacteria | 3652 |
| 517 | Ga0207706_10063883 | 3300025933 | Bacteria | 3241 |
| 518 | Ga0207706_10084816 | 3300025933 | Bacteria | 2785 |
| 519 | Ga0207686_10000256 | 3300025934 | Bacteria | 40403 |
| 520 | Ga0207686_10017361 | 3300025934 | Bacteria | 4055 |
| 521 | Ga0207686_10225615 | 3300025934 | Bacteria | 1355 |
| 522 | Ga0207709_10000081 | 3300025935 | Bacteria | 164427 |
| 523 | Ga0207709_10028842 | 3300025935 | Bacteria | 3212 |
| 524 | Ga0207670_10000073 | 3300025936 | Bacteria | 70848 |
| 525 | Ga0207670_10031416 | 3300025936 | Bacteria | 3403 |
| 526 | Ga0207670_10116648 | 3300025936 | Bacteria | 1933 |
| 527 | Ga0207670_10198557 | 3300025936 | Bacteria | 1522 |
| 528 | Ga0207669_10000008 | 3300025937 | Bacteria | 168213 |
| 529 | Ga0207704_10000031 | 3300025938 | Bacteria | 111710 |
| 530 | Ga0207704_10100525 | 3300025938 | Bacteria | 1926 |
| 531 | Ga0207665_10001785 | 3300025939 | Bacteria | 14483 |
| 532 | Ga0207665_10287420 | 3300025939 | Bacteria | 1225 |
| 533 | Ga0207691_10000251 | 3300025940 | Bacteria | 53184 |
| 534 | Ga0207691_10003899 | 3300025940 | Bacteria | 14490 |
| 535 | Ga0207691_10019452 | 3300025940 | Bacteria | 6424 |
| 536 | Ga0207711_10000478 | 3300025941 | Bacteria | 41339 |
| 537 | Ga0207711_10053792 | 3300025941 | Bacteria | 3453 |
| 538 | Ga0207689_10000040 | 3300025942 | Bacteria | 93271 |
| 539 | Ga0207661_10000474 | 3300025944 | Bacteria | 25977 |
| 540 | Ga0207661_10009245 | 3300025944 | Bacteria | 7061 |
| 541 | Ga0207661_10032176 | 3300025944 | Bacteria | 4060 |
| 542 | Ga0207661_10199928 | 3300025944 | Bacteria | 1756 |
| 543 | Ga0207679_10000014 | 3300025945 | Bacteria | 275841 |
| 544 | Ga0207679_10033347 | 3300025945 | Bacteria | 3622 |
| 545 | Ga0207667_10007058 | 3300025949 | Bacteria | 13573 |
| 546 | Ga0207667_10015138 | 3300025949 | Bacteria | 8771 |
| 547 | Ga0207667_10016134 | 3300025949 | Bacteria | 8448 |
| 548 | Ga0207667_10021163 | 3300025949 | Bacteria | 7212 |
| 549 | Ga0207651_10000317 | 3300025960 | Bacteria | 20700 |
| 550 | Ga0207651_10004930 | 3300025960 | Bacteria | 6811 |
| 551 | Ga0207651_10024053 | 3300025960 | Bacteria | 3760 |
| 552 | Ga0207651_10134937 | 3300025960 | Bacteria | 1896 |
| 553 | Ga0207712_10000777 | 3300025961 | Bacteria | 23783 |
| 554 | Ga0207712_10028119 | 3300025961 | Bacteria | 3759 |
| 555 | Ga0207712_10063145 | 3300025961 | Bacteria | 2636 |
| 556 | Ga0207668_10000037 | 3300025972 | Bacteria | 115995 |
| 557 | Ga0207668_10047449 | 3300025972 | Bacteria | 2941 |
| 558 | Ga0207668_10381967 | 3300025972 | Bacteria | 1186 |
| 559 | Ga0207640_10000444 | 3300025981 | Bacteria | 25172 |
| 560 | Ga0207640_10008462 | 3300025981 | Bacteria | 5717 |
| 561 | Ga0207640_10242906 | 3300025981 | Bacteria | 1392 |
| 562 | Ga0207658_10001424 | 3300025986 | Bacteria | 18664 |
| 563 | Ga0207658_10068384 | 3300025986 | Bacteria | 2680 |
| 564 | Ga0207677_10000644 | 3300026023 | Bacteria | 20970 |
| 565 | Ga0207703_10006289 | 3300026035 | Bacteria | 9495 |
| 566 | Ga0207703_10037457 | 3300026035 | Bacteria | 3863 |
| 567 | Ga0207703_10047188 | 3300026035 | Bacteria | 3472 |
| 568 | Ga0207703_10202929 | 3300026035 | Bacteria | 1763 |
| 569 | Ga0207639_10001125 | 3300026041 | Bacteria | 18174 |
| 570 | Ga0207639_10200661 | 3300026041 | Bacteria | 1710 |
| 571 | Ga0207639_10275770 | 3300026041 | Bacteria | 1477 |
| 572 | Ga0207639_10308420 | 3300026041 | Bacteria | 1401 |
| 573 | Ga0207678_10000733 | 3300026067 | Bacteria | 30024 |
| 574 | Ga0207678_10011487 | 3300026067 | Bacteria | 7777 |
| 575 | Ga0207678_10037394 | 3300026067 | Bacteria | 4221 |
| 576 | Ga0207678_10056682 | 3300026067 | Bacteria | 3373 |
| 577 | Ga0207678_10084239 | 3300026067 | Bacteria | 2719 |
| 578 | Ga0207678_10092114 | 3300026067 | Bacteria | 2591 |
| 579 | Ga0207678_10304548 | 3300026067 | Bacteria | 1370 |
| 580 | Ga0207708_10000368 | 3300026075 | Bacteria | 35276 |
| 581 | Ga0207708_10102704 | 3300026075 | Bacteria | 2213 |
| 582 | Ga0207708_10137873 | 3300026075 | Bacteria | 1912 |
| 583 | Ga0207708_10344312 | 3300026075 | Bacteria | 1221 |
| 584 | Ga0207702_10000006 | 3300026078 | Bacteria | 346370 |
| 585 | Ga0207702_10001585 | 3300026078 | Bacteria | 22527 |
| 586 | Ga0207702_10006198 | 3300026078 | Bacteria | 10339 |
| 587 | Ga0207702_10105924 | 3300026078 | Bacteria | 2491 |
| 588 | Ga0207702_10134084 | 3300026078 | Bacteria | 2232 |
| 589 | Ga0207702_10205016 | 3300026078 | Bacteria | 1830 |
| 590 | Ga0207641_10000272 | 3300026088 | Bacteria | 65806 |
| 591 | Ga0207648_10000516 | 3300026089 | Bacteria | 43204 |
| 592 | Ga0207676_10001948 | 3300026095 | Bacteria | 15047 |
| 593 | Ga0207676_10011986 | 3300026095 | Bacteria | 6203 |
| 594 | Ga0207676_10109088 | 3300026095 | Bacteria | 2312 |
| 595 | Ga0207674_10000555 | 3300026116 | Bacteria | 48860 |
| 596 | Ga0207674_10010489 | 3300026116 | Bacteria | 10488 |
| 597 | Ga0207674_10085545 | 3300026116 | Bacteria | 3148 |
| 598 | Ga0207675_100000404 | 3300026118 | Bacteria | 41500 |
| 599 | Ga0207675_100015706 | 3300026118 | Bacteria | 7062 |
| 600 | Ga0207675_100121919 | 3300026118 | Bacteria | 2468 |
| 601 | Ga0207675_100529937 | 3300026118 | Bacteria | 1175 |
| 602 | Ga0207683_10000002 | 3300026121 | Bacteria | 258441 |
| 603 | Ga0207683_10000604 | 3300026121 | Bacteria | 33136 |
| 604 | Ga0207683_10013200 | 3300026121 | Bacteria | 7047 |
| 605 | Ga0207683_10094882 | 3300026121 | Bacteria | 2659 |
| 606 | Ga0207698_10000161 | 3300026142 | Bacteria | 43014 |
| 607 | Ga0209371_1003111 | 3300027312 | Bacteria | 8454 |
| 608 | Ga0209981_1009065 | 3300027378 | Bacteria | 1358 |
| 609 | Ga0209982_1003813 | 3300027552 | Bacteria | 2154 |
| 610 | Ga0210002_1000129 | 3300027617 | Bacteria | 11732 |
| 611 | Ga0210002_1015742 | 3300027617 | Bacteria | 1193 |
| 612 | Ga0209282_1002848 | 3300027666 | Bacteria | 10137 |
| 613 | Ga0209966_1002955 | 3300027695 | Bacteria | 2848 |
| 614 | Ga0209998_10001707 | 3300027717 | Bacteria | 5239 |
| 615 | Ga0209998_10002315 | 3300027717 | Bacteria | 4403 |
| 616 | Ga0209813_10000083 | 3300027866 | Bacteria | 34743 |
| 617 | Ga0209813_10000290 | 3300027866 | Bacteria | 14003 |
| 618 | Ga0209813_10003140 | 3300027866 | Bacteria | 3842 |
| 619 | Ga0209813_10023718 | 3300027866 | Bacteria | 1747 |
| 620 | Ga0209974_10006626 | 3300027876 | Bacteria | 4030 |
| 621 | Ga0207428_10000011 | 3300027907 | Bacteria | 354388 |
| 622 | Ga0207428_10000046 | 3300027907 | Bacteria | 191032 |
| 623 | Ga0207428_10000243 | 3300027907 | Bacteria | 74403 |
| 624 | Ga0207428_10000528 | 3300027907 | Bacteria | 45643 |
| 625 | Ga0207428_10201795 | 3300027907 | Bacteria | 1496 |
| 626 | Ga0268266_10008059 | 3300028379 | Bacteria | 9415 |
| 627 | Ga0268266_10013020 | 3300028379 | Bacteria | 7170 |
| 628 | Ga0268266_10029581 | 3300028379 | Bacteria | 4656 |
| 629 | Ga0268266_10033998 | 3300028379 | Bacteria | 4333 |
| 630 | Ga0268266_10039941 | 3300028379 | Bacteria | 3998 |
| 631 | Ga0268266_10116545 | 3300028379 | Bacteria | 2373 |
| 632 | Ga0268266_10224435 | 3300028379 | Bacteria | 1728 |
| 633 | Ga0268266_10345042 | 3300028379 | Bacteria | 1398 |
| 634 | Ga0268265_10000476 | 3300028380 | Bacteria | 42108 |
| 635 | Ga0268265_10119494 | 3300028380 | Bacteria | 2168 |
| 636 | Ga0268264_10001522 | 3300028381 | Bacteria | 21594 |
| 637 | Ga0268264_10001990 | 3300028381 | Bacteria | 18364 |
| 638 | Ga0268264_10085770 | 3300028381 | Bacteria | 2704 |
| 639 | Ga0268264_10307864 | 3300028381 | Bacteria | 1494 |
| 640 | Ga0265318_10038810 | 3300028577 | Bacteria | 1819 |
| 641 | Ga0265318_10077429 | 3300028577 | Bacteria | 1229 |
| 642 | Ga0307517_10003697 | 3300028786 | Bacteria | 23771 |
| 643 | Ga0307515_10030919 | 3300028794 | Bacteria | 8960 |
| 644 | Ga0268256_1012181 | 3300030500 | Bacteria | 2674 |
| 645 | Ga0265330_10035468 | 3300031235 | Bacteria | 2225 |
| 646 | Ga0265330_10071854 | 3300031235 | Bacteria | 1497 |
| 647 | Ga0265328_10007797 | 3300031239 | Bacteria | 4449 |
| 648 | Ga0265325_10013127 | 3300031241 | Bacteria | 4721 |
| 649 | Ga0265329_10010306 | 3300031242 | Bacteria | 3438 |
| 650 | Ga0265340_10000591 | 3300031247 | Bacteria | 20142 |
| 651 | Ga0265340_10056622 | 3300031247 | Bacteria | 1885 |
| 652 | Ga0265340_10153960 | 3300031247 | Bacteria | 1047 |
| 653 | Ga0265339_10007606 | 3300031249 | Bacteria | 6982 |
| 654 | Ga0265339_10031863 | 3300031249 | Bacteria | 2976 |
| 655 | Ga0265339_10044250 | 3300031249 | Bacteria | 2457 |
| 656 | Ga0265331_10004247 | 3300031250 | Bacteria | 8972 |
| 657 | Ga0265331_10034148 | 3300031250 | Bacteria | 2511 |
| 658 | Ga0265331_10104705 | 3300031250 | Bacteria | 1300 |
| 659 | Ga0307509_10183095 | 3300031507 | Bacteria | 1957 |
| 660 | Ga0307509_10314563 | 3300031507 | Bacteria | 1306 |
| 661 | Ga0307408_100011770 | 3300031548 | Bacteria | 5786 |
| 662 | Ga0265313_10003665 | 3300031595 | Bacteria | 12285 |
| 663 | Ga0265313_10025679 | 3300031595 | Bacteria | 3115 |
| 664 | Ga0265313_10031928 | 3300031595 | Bacteria | 2695 |
| 665 | Ga0265313_10043034 | 3300031595 | Bacteria | 2214 |
| 666 | Ga0307508_10000012 | 3300031616 | Bacteria | 243167 |
| 667 | Ga0307508_10026843 | 3300031616 | Bacteria | 5217 |
| 668 | Ga0316576_10052520 | 3300031727 | Bacteria | 2968 |
| 669 | Ga0307516_10078690 | 3300031730 | Bacteria | 3143 |
| 670 | Ga0307406_10109041 | 3300031901 | Bacteria | 1902 |
| 671 | Ga0307414_10081837 | 3300032004 | Bacteria | 2366 |
| 672 | Ga0307415_100304210 | 3300032126 | Bacteria | 1322 |
| 673 | Ga0307507_10008246 | 3300033179 | Bacteria | 14551 |
| 674 | Ga0307510_10090238 | 3300033180 | Bacteria | 2912 |
| 675 | Ga0373930_0000029 | 3300034816 | Bacteria | 12941 |
| 676 | Ga0373930_0016918 | 3300034816 | Bacteria | 1384 |
| 677 | Ga0373948_0000456 | 3300034817 | Bacteria | 5093 |
| 678 | Ga0373948_0002914 | 3300034817 | Bacteria | 2582 |
| 679 | Ga0373950_0002464 | 3300034818 | Bacteria | 2545 |
| 680 | Ga0373950_0025434 | 3300034818 | Bacteria | 1069 |
| 681 | Ga0373959_0000650 | 3300034820 | Bacteria | 5972 |
| 682 | Ga0373938_0000070 | 3300034957 | Bacteria | 13548 |
| 683 | Ga0373938_0026291 | 3300034957 | Bacteria | 1217 |
| 684 | Ga0373926_0004276 | 3300035083 | Bacteria | 4671 |
| 685 | Ga0373928_0001986 | 3300035084 | Bacteria | 3982 |
| 686 | Ga0373929_0000468 | 3300035085 | Bacteria | 7715 |
| 687 | Ga0373934_0007043 | 3300035086 | Bacteria | 4172 |
| 688 | Ga0373934_0040665 | 3300035086 | Bacteria | 1834 |
| 689 | Ga0373949_0002572 | 3300035090 | Bacteria | 4607 |
| 690 | Ga0373951_0001808 | 3300035091 | Bacteria | 5547 |
| 691 | Ga0373952_0006538 | 3300035092 | Bacteria | 2156 |
| 692 | Ga0373952_0015118 | 3300035092 | Bacteria | 1555 |
| 693 | Ga0373923_0020925 | 3300035111 | Bacteria | 2548 |
| 694 | Ga0373923_0020927 | 3300035111 | Bacteria | 2548 |
| 695 | Ga0373932_0000208 | 3300035112 | Bacteria | 17216 |
| 696 | Ga0373932_0046868 | 3300035112 | Bacteria | 1269 |
| 697 | Ga0373936_0000626 | 3300035113 | Bacteria | 12227 |
| 698 | Ga0373939_0079777 | 3300035114 | Bacteria | 1084 |
| 699 | Ga0373941_0000926 | 3300035115 | Bacteria | 6047 |
| 700 | Ga0373941_0009756 | 3300035115 | Bacteria | 2426 |
| 701 | Ga0373945_0014152 | 3300035116 | Bacteria | 2669 |
| 702 | Ga0373953_0008179 | 3300035117 | Bacteria | 3541 |
| 703 | Ga0373953_0014407 | 3300035117 | Bacteria | 2843 |
| 704 | Ga0373953_0019316 | 3300035117 | Bacteria | 2534 |
| 705 | Ga0373954_0010431 | 3300035118 | Bacteria | 4100 |
| 706 | Ga0373954_0029460 | 3300035118 | Bacteria | 2527 |
| 707 | Ga0373954_0048212 | 3300035118 | Bacteria | 1995 |
| 708 | Ga0373956_0002974 | 3300035119 | Bacteria | 6863 |
| 709 | Ga0373956_0025777 | 3300035119 | Bacteria | 2543 |
| 710 | Ga0373956_0115687 | 3300035119 | Bacteria | 1250 |
| 711 | Ga0373957_0001098 | 3300035120 | Bacteria | 7158 |
| 712 | Ga0373957_0029743 | 3300035120 | Bacteria | 1997 |
| 713 | Ga0373957_0069364 | 3300035120 | Bacteria | 1376 |
| 714 | Ga0373960_0000295 | 3300035121 | Bacteria | 9499 |
| 715 | Ga0373960_0002031 | 3300035121 | Bacteria | 4552 |
| 716 | Ga0373943_0065550 | 3300035170 | Bacteria | 1826 |
| 717 | Ga0373946_0008942 | 3300035171 | Bacteria | 3682 |
| 718 | Ga0373946_0011594 | 3300035171 | Bacteria | 3292 |
| 719 | Ga0373955_0001515 | 3300035172 | Bacteria | 9917 |
| 720 | Ga0373955_0011995 | 3300035172 | Bacteria | 4153 |
| 721 | Ga0373955_0014469 | 3300035172 | Bacteria | 3839 |
| 722 | Ga0373942_0000210 | 3300035207 | Bacteria | 15189 |
| 723 | Ga0373962_0001251 | 3300035242 | Bacteria | 5962 |
| 724 | Ga0373962_0039684 | 3300035242 | Bacteria | 1322 |
| 725 | Ga0316574_0016912 | 3300035398 | Bacteria | 4257 |
| 726 | Ga0373924_0053476 | 3300035410 | Bacteria | 1677 |
| 727 | Ga0373924_0055660 | 3300035410 | Bacteria | 1646 |
| 728 | Ga0373924_0089141 | 3300035410 | Bacteria | 1318 |
| 729 | Ga0373931_0000081 | 3300035691 | Bacteria | 44696 |
| 730 | Ga0373931_0000704 | 3300035691 | Bacteria | 13840 |
| 731 | Ga0373931_0037654 | 3300035691 | Bacteria | 2525 |
| 732 | Ga0373931_0063118 | 3300035691 | Bacteria | 2001 |
| 733 | Ga0373935_0000150 | 3300035692 | Bacteria | 32035 |
| 734 | Ga0373935_0062219 | 3300035692 | Bacteria | 2390 |
| 735 | Ga0373935_0178587 | 3300035692 | Bacteria | 1456 |
| 736 | Ga0373927_0000046 | 3300035695 | Bacteria | 88401 |
| 737 | Ga0373927_0006298 | 3300035695 | Bacteria | 8092 |
| 738 | Ga0373927_0010430 | 3300035695 | Bacteria | 6194 |
| 739 | Ga0373927_0053378 | 3300035695 | Bacteria | 2615 |
| 740 | Ga0373933_0000026 | 3300035724 | Bacteria | 90309 |
| 741 | Ga0373933_0078461 | 3300035724 | Bacteria | 2020 |
| 742 | Ga0373947_0001546 | 3300035725 | Bacteria | 14110 |
| 743 | Ga0373947_0010765 | 3300035725 | Bacteria | 5248 |
| 744 | Ga0373947_0075394 | 3300035725 | Bacteria | 2077 |
| 745 | Ga0373937_0008776 | 3300036401 | Bacteria | 8773 |
| 746 | Ga0373937_0036359 | 3300036401 | Bacteria | 4487 |
| 747 | Ga0373937_0065027 | 3300036401 | Bacteria | 3356 |
| 748 | Ga0373937_0078347 | 3300036401 | Bacteria | 3054 |
| 749 | Ga0373937_0121472 | 3300036401 | Bacteria | 2434 |
| 750 | Ga0373937_0143680 | 3300036401 | Bacteria | 2233 |
| 751 | Ga0373925_0002696 | 3300037068 | Bacteria | 14084 |
| 752 | Ga0373925_0059565 | 3300037068 | Bacteria | 2864 |
| 753 | Ga0373925_0064165 | 3300037068 | Bacteria | 2764 |
| 754 | Ga0373925_0084355 | 3300037068 | Bacteria | 2421 |
| 755 | Ga0373925_0126683 | 3300037068 | Bacteria | 1987 |
| 756 | Ga0373925_0143702 | 3300037068 | Bacteria | 1869 |
| 757 | Ga0373925_0177906 | 3300037068 | Bacteria | 1682 |
| 758 | Ga0373925_0209890 | 3300037068 | Bacteria | 1551 |
| 759 | Ga0395900_0050037 | 3300037418 | Bacteria | 4305 |
| 760 | Ga0395900_0056032 | 3300037418 | Bacteria | 4058 |
| 761 | Ga0395898_0031545 | 3300037466 | Bacteria | 5294 |
| 762 | Ga0395898_0176278 | 3300037466 | Bacteria | 2043 |
| 763 | Ga0436364_1559478 | 3300037853 | Bacteria | 2396 |
| 764 | Ga0395901_0148801 | 3300038443 | Bacteria | 2461 |
| 765 | Ga0395901_0219919 | 3300038443 | Bacteria | 1985 |
| 766 | Ga0436365_0317546 | 3300039437 | Bacteria | 1349 |
| 767 | Ga0436365_1039862 | 3300039437 | Bacteria | 3651 |
| 768 | Ga0436363_1290357 | 3300039450 | Bacteria | 2129 |
| 769 | Ga0451846_46569 | 3300041502 | Bacteria | 3087 |
| 770 | Ga0451855_1209298 | 3300041511 | Bacteria | 1128 |
| 771 | Ga0451853_0214194 | 3300041512 | Bacteria | 5103 |
| 772 | Ga0439463_006751 | 3300042016 | Bacteria | 2838 |
| 773 | Ga0439434_0021545 | 3300042435 | Bacteria | 1937 |
| 774 | Ga0466961_0174753 | 3300044693 | Bacteria | 1335 |
| 775 | Ga0466963_0091441 | 3300044694 | Bacteria | 2073 |
| 776 | Ga0453684_0073915 | 3300044712 | Bacteria | 4295 |
| 777 | Ga0451576_0018612 | 3300045051 | Bacteria | 7602 |
| 778 | Ga0451576_0045272 | 3300045051 | Bacteria | 4635 |
| 779 | Ga0495617_007274 | 3300046452 | Bacteria | 3850 |
| 780 | Ga0495592_0001895 | 3300046454 | Bacteria | 14746 |
| 781 | Ga0495592_0015850 | 3300046454 | Bacteria | 5717 |
| 782 | Ga0495592_0035747 | 3300046454 | Bacteria | 3743 |
| 783 | Ga0495592_0050556 | 3300046454 | Bacteria | 3088 |
| 784 | Ga0495603_0000136 | 3300046455 | Bacteria | 36367 |
| 785 | Ga0495603_0072623 | 3300046455 | Bacteria | 2021 |
| 786 | Ga0495629_0000182 | 3300046459 | Bacteria | 56655 |
| 787 | Ga0495629_0000448 | 3300046459 | Bacteria | 34268 |
| 788 | Ga0495629_0091194 | 3300046459 | Bacteria | 2126 |
| 789 | Ga0495638_0154874 | 3300046460 | Bacteria | 1326 |
| 790 | Ga0495641_0005083 | 3300046461 | Bacteria | 9041 |
| 791 | Ga0495641_0026201 | 3300046461 | Bacteria | 2848 |
| 792 | Ga0495641_0073382 | 3300046461 | Bacteria | 1535 |
| 793 | Ga0495641_0113525 | 3300046461 | Bacteria | 1209 |
| 794 | Ga0495651_0003639 | 3300046462 | Bacteria | 11802 |
| 795 | Ga0495651_0016160 | 3300046462 | Bacteria | 5780 |
| 796 | Ga0495651_0041772 | 3300046462 | Bacteria | 3561 |
| 797 | Ga0495651_0094021 | 3300046462 | Bacteria | 2244 |
| 798 | Ga0495653_0001478 | 3300046463 | Bacteria | 18332 |
| 799 | Ga0495653_0046802 | 3300046463 | Bacteria | 3348 |
| 800 | Ga0495580_0000235 | 3300046472 | Bacteria | 43597 |
| 801 | Ga0495580_0012185 | 3300046472 | Bacteria | 6608 |
| 802 | Ga0495582_0000357 | 3300046473 | Bacteria | 24964 |
| 803 | Ga0495582_0012756 | 3300046473 | Bacteria | 4630 |
| 804 | Ga0495582_0035879 | 3300046473 | Bacteria | 2727 |
| 805 | Ga0495639_0000047 | 3300046475 | Bacteria | 53940 |
| 806 | Ga0495662_0000129 | 3300046476 | Bacteria | 28435 |
| 807 | Ga0495662_0011278 | 3300046476 | Bacteria | 4369 |
| 808 | Ga0495662_0018119 | 3300046476 | Bacteria | 3406 |
| 809 | Ga0495664_0004106 | 3300046477 | Bacteria | 7949 |
| 810 | Ga0495664_0014176 | 3300046477 | Bacteria | 4516 |
| 811 | Ga0495664_0014348 | 3300046477 | Bacteria | 4490 |
| 812 | Ga0495664_0016235 | 3300046477 | Bacteria | 4240 |
| 813 | Ga0495664_0040882 | 3300046477 | Bacteria | 2742 |
| 814 | Ga0495584_0022415 | 3300046491 | Bacteria | 3205 |
| 815 | Ga0495584_0053978 | 3300046491 | Bacteria | 2022 |
| 816 | Ga0495584_0097490 | 3300046491 | Bacteria | 1485 |
| 817 | Ga0495585_0002406 | 3300046492 | Bacteria | 13400 |
| 818 | Ga0495594_0000464 | 3300046499 | Bacteria | 20682 |
| 819 | Ga0495594_0025323 | 3300046499 | Bacteria | 3189 |
| 820 | Ga0495594_0026696 | 3300046499 | Bacteria | 3109 |
| 821 | Ga0495607_0015659 | 3300046501 | Bacteria | 4910 |
| 822 | Ga0495606_0005081 | 3300046507 | Bacteria | 12801 |
| 823 | Ga0495608_0075118 | 3300046511 | Bacteria | 2202 |
| 824 | Ga0495608_0076185 | 3300046511 | Bacteria | 2185 |
| 825 | Ga0495608_0076792 | 3300046511 | Bacteria | 2174 |
| 826 | Ga0495616_0133385 | 3300046513 | Bacteria | 1136 |
| 827 | Ga0495618_0044289 | 3300046514 | Bacteria | 2807 |
| 828 | Ga0495618_0073190 | 3300046514 | Bacteria | 2181 |
| 829 | Ga0495618_0078271 | 3300046514 | Bacteria | 2107 |
| 830 | Ga0495620_0062137 | 3300046515 | Bacteria | 1552 |
| 831 | Ga0495628_0006013 | 3300046516 | Bacteria | 10616 |
| 832 | Ga0495628_0023433 | 3300046516 | Bacteria | 5068 |
| 833 | Ga0495628_0207229 | 3300046516 | Bacteria | 1475 |
| 834 | Ga0495630_0000501 | 3300046517 | Bacteria | 29017 |
| 835 | Ga0495630_0023036 | 3300046517 | Bacteria | 4601 |
| 836 | Ga0495630_0264284 | 3300046517 | Bacteria | 1314 |
| 837 | Ga0495632_0053408 | 3300046519 | Bacteria | 1984 |
| 838 | Ga0495644_0007902 | 3300046523 | Bacteria | 4095 |
| 839 | Ga0495648_0002081 | 3300046524 | Bacteria | 18931 |
| 840 | Ga0495666_0012697 | 3300046526 | Bacteria | 4197 |
| 841 | Ga0495666_0019714 | 3300046526 | Bacteria | 3344 |
| 842 | Ga0495652_0007988 | 3300046529 | Bacteria | 9705 |
| 843 | Ga0495652_0055838 | 3300046529 | Bacteria | 3356 |
| 844 | Ga0495652_0078955 | 3300046529 | Bacteria | 2723 |
| 845 | Ga0495652_0093683 | 3300046529 | Bacteria | 2451 |
| 846 | Ga0495665_0000230 | 3300046531 | Bacteria | 28132 |
| 847 | Ga0495665_0017331 | 3300046531 | Bacteria | 3874 |
| 848 | Ga0495665_0120296 | 3300046531 | Bacteria | 1375 |
| 849 | Ga0495640_0000178 | 3300046533 | Bacteria | 41951 |
| 850 | Ga0495640_0010630 | 3300046533 | Bacteria | 7101 |
| 851 | Ga0495640_0024841 | 3300046533 | Bacteria | 4353 |
| 852 | Ga0495640_0045870 | 3300046533 | Bacteria | 3031 |
| 853 | Ga0495586_0127390 | 3300046535 | Bacteria | 1424 |
| 854 | Ga0495587_0002711 | 3300046536 | Bacteria | 11824 |
| 855 | Ga0495587_0034023 | 3300046536 | Bacteria | 3074 |
| 856 | Ga0495587_0034435 | 3300046536 | Bacteria | 3054 |
| 857 | Ga0495609_0055458 | 3300046538 | Bacteria | 1758 |
| 858 | Ga0495621_0001814 | 3300046539 | Bacteria | 5614 |
| 859 | Ga0495621_0035579 | 3300046539 | Bacteria | 1725 |
| 860 | Ga0495597_0042259 | 3300046542 | Bacteria | 2033 |
| 861 | Ga0495645_0021563 | 3300046543 | Bacteria | 4654 |
| 862 | Ga0495645_0022818 | 3300046543 | Bacteria | 4529 |
| 863 | Ga0495622_0041671 | 3300046557 | Bacteria | 2135 |
| 864 | Ga0495667_0001312 | 3300046559 | Bacteria | 16320 |
| 865 | Ga0495667_0005667 | 3300046559 | Bacteria | 8450 |
| 866 | Ga0495667_0008306 | 3300046559 | Bacteria | 7037 |
| 867 | Ga0495667_0081157 | 3300046559 | Bacteria | 2108 |
| 868 | Ga0495667_0101513 | 3300046559 | Bacteria | 1861 |
| 869 | Ga0495656_0003299 | 3300046615 | Bacteria | 5446 |
| 870 | Ga0495668_0068546 | 3300046616 | Bacteria | 1951 |
| 871 | Ga0495668_0115477 | 3300046616 | Bacteria | 1468 |
| 872 | Ga0495634_0000680 | 3300046642 | Bacteria | 33027 |
| 873 | Ga0495634_0018249 | 3300046642 | Bacteria | 4996 |
| 874 | Ga0495611_0009169 | 3300046648 | Bacteria | 4179 |
| 875 | Ga0495625_0025675 | 3300046660 | Bacteria | 4465 |
| 876 | Ga0495625_0098654 | 3300046660 | Bacteria | 2009 |
| 877 | Ga0495635_0000838 | 3300046663 | Bacteria | 20104 |
| 878 | Ga0495635_0001125 | 3300046663 | Bacteria | 17794 |
| 879 | Ga0495635_0002189 | 3300046663 | Bacteria | 13290 |
| 880 | Ga0495635_0028070 | 3300046663 | Bacteria | 3912 |
| 881 | Ga0495635_0033969 | 3300046663 | Bacteria | 3538 |
| 882 | Ga0495635_0052626 | 3300046663 | Bacteria | 2804 |
| 883 | Ga0495659_0005560 | 3300046664 | Bacteria | 3966 |
| 884 | Ga0495659_0021940 | 3300046664 | Bacteria | 2155 |
| 885 | Ga0495661_0106265 | 3300046665 | Bacteria | 1571 |
| 886 | Ga0495588_0002925 | 3300046674 | Bacteria | 7370 |
| 887 | Ga0495588_0004961 | 3300046674 | Bacteria | 5907 |
| 888 | Ga0495588_0005562 | 3300046674 | Bacteria | 5615 |
| 889 | Ga0495588_0018416 | 3300046674 | Bacteria | 3404 |
| 890 | Ga0495588_0086330 | 3300046674 | Bacteria | 1641 |
| 891 | Ga0495599_0039773 | 3300046678 | Bacteria | 2954 |
| 892 | Ga0495599_0075781 | 3300046678 | Bacteria | 2100 |
| 893 | Ga0495599_0101715 | 3300046678 | Bacteria | 1791 |
| 894 | Ga0495599_0104399 | 3300046678 | Bacteria | 1765 |
| 895 | Ga0495623_0001957 | 3300046679 | Bacteria | 13828 |
| 896 | Ga0495646_0006971 | 3300046680 | Bacteria | 7176 |
| 897 | Ga0495646_0007674 | 3300046680 | Bacteria | 6856 |
| 898 | Ga0495646_0021061 | 3300046680 | Bacteria | 4121 |
| 899 | Ga0495646_0026044 | 3300046680 | Bacteria | 3673 |
| 900 | Ga0495647_0000171 | 3300046681 | Bacteria | 17186 |
| 901 | Ga0495647_0036449 | 3300046681 | Bacteria | 1851 |
| 902 | Ga0495647_0038535 | 3300046681 | Bacteria | 1807 |
| 903 | Ga0495658_0000062 | 3300046683 | Bacteria | 55335 |
| 904 | Ga0495658_0003963 | 3300046683 | Bacteria | 7300 |
| 905 | Ga0495658_0011623 | 3300046683 | Bacteria | 4434 |
| 906 | Ga0495613_0006197 | 3300046689 | Bacteria | 8949 |
| 907 | Ga0495613_0008760 | 3300046689 | Bacteria | 7503 |
| 908 | Ga0495613_0016392 | 3300046689 | Bacteria | 5520 |
| 909 | Ga0495613_0069764 | 3300046689 | Bacteria | 2562 |
| 910 | Ga0495613_0151521 | 3300046689 | Bacteria | 1653 |
| 911 | Ga0495624_0000361 | 3300046690 | Bacteria | 36052 |
| 912 | Ga0495624_0015889 | 3300046690 | Bacteria | 5070 |
| 913 | Ga0495624_0024874 | 3300046690 | Bacteria | 3939 |
| 914 | Ga0495670_0001263 | 3300046691 | Bacteria | 12379 |
| 915 | Ga0495589_0043138 | 3300046794 | Bacteria | 2246 |
| 916 | Ga0495600_0000776 | 3300046809 | Bacteria | 16861 |
| 917 | Ga0495600_0042482 | 3300046809 | Bacteria | 2964 |
| 918 | Ga0495600_0054516 | 3300046809 | Bacteria | 2611 |
| 919 | Ga0495581_0000006 | 3300047315 | Bacteria | 77433 |
| 920 | Ga0495581_0129976 | 3300047315 | Bacteria | 1467 |
| 921 | Ga0495581_0141787 | 3300047315 | Bacteria | 1402 |
| 922 | Ga0495604_0008160 | 3300047317 | Bacteria | 8288 |
| 923 | Ga0495604_0016032 | 3300047317 | Bacteria | 5984 |
| 924 | Ga0495604_0099631 | 3300047317 | Bacteria | 2138 |
| 925 | Ga0495674_0000380 | 3300047319 | Bacteria | 39781 |
| 926 | Ga0495674_0009717 | 3300047319 | Bacteria | 9133 |
| 927 | Ga0495674_0056470 | 3300047319 | Bacteria | 3438 |
| 928 | Ga0495674_0102156 | 3300047319 | Bacteria | 2438 |
| 929 | Ga0495674_0106007 | 3300047319 | Bacteria | 2387 |
| 930 | Ga0495672_0009744 | 3300047320 | Bacteria | 6924 |
| 931 | Ga0495672_0021807 | 3300047320 | Bacteria | 4172 |
| 932 | Ga0495676_0051834 | 3300047321 | Bacteria | 3279 |
| 933 | Ga0495676_0287181 | 3300047321 | Bacteria | 1112 |
| 934 | Ga0495680_0005450 | 3300047322 | Bacteria | 11973 |
| 935 | Ga0495680_0008238 | 3300047322 | Bacteria | 9496 |
| 936 | Ga0495675_0004525 | 3300047444 | Bacteria | 8429 |
| 937 | Ga0495675_0007735 | 3300047444 | Bacteria | 6630 |
| 938 | Ga0495684_0000101 | 3300047471 | Bacteria | 60317 |
| 939 | Ga0495684_0006082 | 3300047471 | Bacteria | 9387 |
| 940 | Ga0495684_0019497 | 3300047471 | Bacteria | 5224 |
| 941 | Ga0495686_0046544 | 3300047472 | Bacteria | 2741 |
| 942 | Ga0495686_0144020 | 3300047472 | Bacteria | 1404 |
| 943 | Ga0495593_0000129 | 3300047673 | Bacteria | 36555 |
| 944 | Ga0495593_0004354 | 3300047673 | Bacteria | 8426 |
| 945 | Ga0495593_0012341 | 3300047673 | Bacteria | 4882 |
| 946 | Ga0495602_0004530 | 3300048088 | Bacteria | 14499 |
| 947 | Ga0495602_0032021 | 3300048088 | Bacteria | 4957 |
| 948 | Ga0495614_0019615 | 3300048089 | Bacteria | 2926 |
| 949 | Ga0496100_0000297 | 3300048903 | Bacteria | 24690 |
| 950 | Ga0496100_0066314 | 3300048903 | Bacteria | 2394 |
| 951 | Ga0496101_0000061 | 3300048904 | Bacteria | 127480 |
| 952 | Ga0496101_0001222 | 3300048904 | Bacteria | 15380 |
| 953 | Ga0496101_0015279 | 3300048904 | Bacteria | 5169 |
| 954 | Ga0496101_0078430 | 3300048904 | Bacteria | 2436 |
| 955 | Ga0496102_0000516 | 3300048905 | Bacteria | 42168 |
| 956 | Ga0496102_0015726 | 3300048905 | Bacteria | 6592 |
| 957 | Ga0496102_0020099 | 3300048905 | Bacteria | 5894 |
| 958 | Ga0496102_0056390 | 3300048905 | Bacteria | 3584 |
| 959 | Ga0496102_0086303 | 3300048905 | Bacteria | 2898 |
| 960 | Ga0496102_0174177 | 3300048905 | Bacteria | 2025 |
| 961 | Ga0496102_0244402 | 3300048905 | Bacteria | 1692 |
| 962 | Ga0496102_0255113 | 3300048905 | Bacteria | 1653 |
| 963 | Ga0496103_0007287 | 3300048906 | Bacteria | 6592 |
| 964 | Ga0496104_0026144 | 3300048907 | Bacteria | 5385 |
| 965 | Ga0496104_0043693 | 3300048907 | Bacteria | 4208 |
| 966 | Ga0496104_0070262 | 3300048907 | Bacteria | 3328 |
| 967 | Ga0496104_0084419 | 3300048907 | Bacteria | 3030 |
| 968 | Ga0496104_0099524 | 3300048907 | Bacteria | 2783 |
| 969 | Ga0496104_0381296 | 3300048907 | Bacteria | 1322 |
| 970 | Ga0496105_0018252 | 3300048908 | Bacteria | 5633 |
| 971 | Ga0496105_0046141 | 3300048908 | Bacteria | 3596 |
| 972 | Ga0496105_0059913 | 3300048908 | Bacteria | 3141 |
| 973 | Ga0496105_0094067 | 3300048908 | Bacteria | 2475 |
| 974 | Ga0496106_0000690 | 3300048909 | Bacteria | 24224 |
| 975 | Ga0496106_0004749 | 3300048909 | Bacteria | 10050 |
| 976 | Ga0496106_0014549 | 3300048909 | Bacteria | 5814 |
| 977 | Ga0496106_0039893 | 3300048909 | Bacteria | 3515 |
| 978 | Ga0496106_0050026 | 3300048909 | Bacteria | 3149 |
| 979 | Ga0496106_0056914 | 3300048909 | Bacteria | 2956 |
| 980 | Ga0496106_0084280 | 3300048909 | Bacteria | 2445 |
| 981 | Ga0496106_0232783 | 3300048909 | Bacteria | 1471 |
| 982 | Ga0496107_0000308 | 3300048910 | Bacteria | 26232 |
| 983 | Ga0496107_0002940 | 3300048910 | Bacteria | 11273 |
| 984 | Ga0496107_0022548 | 3300048910 | Bacteria | 4449 |
| 985 | Ga0496107_0047503 | 3300048910 | Bacteria | 3091 |
| 986 | Ga0496108_0001212 | 3300048911 | Bacteria | 20220 |
| 987 | Ga0496108_0001769 | 3300048911 | Bacteria | 17206 |
| 988 | Ga0496108_0005567 | 3300048911 | Bacteria | 10190 |
| 989 | Ga0496108_0080557 | 3300048911 | Bacteria | 2758 |
| 990 | Ga0496108_0460058 | 3300048911 | Bacteria | 1111 |
| 991 | Ga0496109_0000530 | 3300048912 | Bacteria | 32282 |
| 992 | Ga0496109_0000928 | 3300048912 | Bacteria | 24278 |
| 993 | Ga0496109_0002514 | 3300048912 | Bacteria | 15376 |
| 994 | Ga0496109_0058647 | 3300048912 | Bacteria | 3516 |
| 995 | Ga0496109_0091579 | 3300048912 | Bacteria | 2812 |
| 996 | Ga0496109_0241931 | 3300048912 | Bacteria | 1698 |
| 997 | Ga0496110_0020945 | 3300048913 | Bacteria | 5524 |
| 998 | Ga0496110_0025171 | 3300048913 | Bacteria | 5083 |
| 999 | Ga0496110_0039419 | 3300048913 | Bacteria | 4113 |
| 1000 | Ga0496110_0049472 | 3300048913 | Bacteria | 3688 |
| 1001 | Ga0496110_0114052 | 3300048913 | Bacteria | 2431 |
| 1002 | Ga0496110_0141474 | 3300048913 | Bacteria | 2175 |
| 1003 | Ga0496110_0290169 | 3300048913 | Bacteria | 1490 |
| 1004 | Ga0496111_0005963 | 3300048914 | Bacteria | 7863 |
| 1005 | Ga0496111_0014004 | 3300048914 | Bacteria | 5468 |
| 1006 | Ga0496112_0000029 | 3300048915 | Bacteria | 122291 |
| 1007 | Ga0496112_0002053 | 3300048915 | Bacteria | 15963 |
| 1008 | Ga0496112_0022716 | 3300048915 | Bacteria | 5983 |
| 1009 | Ga0496112_0038268 | 3300048915 | Bacteria | 4683 |
| 1010 | Ga0496112_0109524 | 3300048915 | Bacteria | 2732 |
| 1011 | Ga0496112_0544642 | 3300048915 | Bacteria | 1094 |
| 1012 | Ga0496113_0000122 | 3300048916 | Bacteria | 33708 |
| 1013 | Ga0496113_0030089 | 3300048916 | Bacteria | 3927 |
| 1014 | Ga0496113_0049390 | 3300048916 | Bacteria | 3132 |
| 1015 | Ga0496113_0055120 | 3300048916 | Bacteria | 2979 |
| 1016 | Ga0496113_0168131 | 3300048916 | Bacteria | 1736 |
| 1017 | Ga0496114_0002170 | 3300048917 | Bacteria | 14938 |
| 1018 | Ga0496114_0513896 | 3300048917 | Bacteria | 1059 |
| 1019 | Ga0496115_0010562 | 3300048918 | Bacteria | 6904 |
| 1020 | Ga0496115_0022185 | 3300048918 | Bacteria | 4915 |
| 1021 | Ga0496115_0028962 | 3300048918 | Bacteria | 4345 |
| 1022 | Ga0496115_0059068 | 3300048918 | Bacteria | 3087 |
| 1023 | Ga0496115_0124807 | 3300048918 | Bacteria | 2120 |
| 1024 | Ga0496115_0143772 | 3300048918 | Bacteria | 1968 |
| 1025 | Ga0496116_0068461 | 3300048919 | Bacteria | 2261 |
| 1026 | Ga0496117_0000052 | 3300048920 | Bacteria | 280463 |
| 1027 | Ga0496117_0025706 | 3300048920 | Bacteria | 4622 |
| 1028 | Ga0496117_0054886 | 3300048920 | Bacteria | 2788 |
| 1029 | Ga0496118_0000709 | 3300048921 | Bacteria | 53670 |
| 1030 | Ga0496119_0019638 | 3300048922 | Bacteria | 4964 |
| 1031 | Ga0496119_0135929 | 3300048922 | Bacteria | 1333 |
| 1032 | Ga0496120_0000019 | 3300048923 | Bacteria | 260115 |
| 1033 | Ga0496120_0006319 | 3300048923 | Bacteria | 9121 |
| 1034 | Ga0496121_0000003 | 3300048924 | Bacteria | 1191431 |
| 1035 | Ga0496121_0000265 | 3300048924 | Bacteria | 109251 |
| 1036 | Ga0496121_0001149 | 3300048924 | Bacteria | 46424 |
| 1037 | Ga0496121_0011060 | 3300048924 | Bacteria | 10072 |
| 1038 | Ga0496121_0011669 | 3300048924 | Bacteria | 9712 |
| 1039 | Ga0496121_0033989 | 3300048924 | Bacteria | 4600 |
| 1040 | Ga0496121_0034284 | 3300048924 | Bacteria | 4571 |
| 1041 | Ga0496121_0044665 | 3300048924 | Bacteria | 3818 |
| 1042 | Ga0496121_0058309 | 3300048924 | Bacteria | 3193 |
| 1043 | Ga0496121_0124365 | 3300048924 | Bacteria | 1942 |
| 1044 | Ga0496121_0130628 | 3300048924 | Bacteria | 1880 |
| 1045 | Ga0496122_0000053 | 3300048925 | Bacteria | 260120 |
| 1046 | Ga0496123_0000038 | 3300048926 | Bacteria | 260120 |
| 1047 | Ga0496124_0000139 | 3300048927 | Bacteria | 149873 |
| 1048 | Ga0496124_0001146 | 3300048927 | Bacteria | 41561 |
| 1049 | Ga0496124_0006736 | 3300048927 | Bacteria | 12422 |
| 1050 | Ga0496124_0203521 | 3300048927 | Bacteria | 1503 |
| 1051 | Ga0496125_0000170 | 3300048928 | Bacteria | 145369 |
| 1052 | Ga0496125_0039828 | 3300048928 | Bacteria | 4040 |
| 1053 | Ga0496125_0086798 | 3300048928 | Bacteria | 2365 |
| 1054 | Ga0496125_0208477 | 3300048928 | Bacteria | 1271 |
| 1055 | Ga0496126_0007573 | 3300048929 | Bacteria | 11867 |
| 1056 | Ga0496126_0144509 | 3300048929 | Bacteria | 2044 |
| 1057 | Ga0495678_070814 | 3300049459 | Bacteria | 1279 |
| 1058 | Ga0501031_0000141 | 3300049568 | Bacteria | 40452 |
| 1059 | Ga0501031_0000891 | 3300049568 | Bacteria | 18008 |
| 1060 | Ga0501031_0066820 | 3300049568 | Bacteria | 2342 |
| 1061 | Ga0501031_0279214 | 3300049568 | Bacteria | 1084 |
| 1062 | Ga0501032_0000044 | 3300049569 | Bacteria | 110899 |
| 1063 | Ga0501032_0000301 | 3300049569 | Bacteria | 41571 |
| 1064 | Ga0501032_0007000 | 3300049569 | Bacteria | 8270 |
| 1065 | Ga0501032_0013677 | 3300049569 | Bacteria | 5764 |
| 1066 | Ga0501032_0020334 | 3300049569 | Bacteria | 4625 |
| 1067 | Ga0501032_0144240 | 3300049569 | Bacteria | 1568 |
| 1068 | Ga0501033_0000052 | 3300049570 | Bacteria | 110545 |
| 1069 | Ga0501033_0000207 | 3300049570 | Bacteria | 56200 |
| 1070 | Ga0501033_0011287 | 3300049570 | Bacteria | 6839 |
| 1071 | Ga0501033_0034080 | 3300049570 | Bacteria | 3820 |
| 1072 | Ga0501033_0037395 | 3300049570 | Bacteria | 3633 |
| 1073 | Ga0501033_0311197 | 3300049570 | Bacteria | 1107 |
| 1074 | Ga0501034_0000212 | 3300049571 | Bacteria | 110795 |
| 1075 | Ga0501034_0000715 | 3300049571 | Bacteria | 50444 |
| 1076 | Ga0501034_0046718 | 3300049571 | Bacteria | 4374 |
| 1077 | Ga0501034_0048417 | 3300049571 | Bacteria | 4289 |
| 1078 | Ga0501034_0127828 | 3300049571 | Bacteria | 2526 |
| 1079 | Ga0501034_0174502 | 3300049571 | Bacteria | 2116 |
| 1080 | Ga0501036_0000022 | 3300049572 | Bacteria | 111251 |
| 1081 | Ga0501036_0000043 | 3300049572 | Bacteria | 79310 |
| 1082 | Ga0501036_0006071 | 3300049572 | Bacteria | 9801 |
| 1083 | Ga0501036_0019013 | 3300049572 | Bacteria | 5763 |
| 1084 | Ga0501036_0051317 | 3300049572 | Bacteria | 3492 |
| 1085 | Ga0501036_0068219 | 3300049572 | Bacteria | 3009 |
| 1086 | Ga0501037_0000052 | 3300049573 | Bacteria | 110932 |
| 1087 | Ga0501037_0000263 | 3300049573 | Bacteria | 45324 |
| 1088 | Ga0501037_0000334 | 3300049573 | Bacteria | 39895 |
| 1089 | Ga0501038_0000044 | 3300049574 | Bacteria | 110876 |
| 1090 | Ga0501038_0000131 | 3300049574 | Bacteria | 63880 |
| 1091 | Ga0501038_0006199 | 3300049574 | Bacteria | 11061 |
| 1092 | Ga0501038_0013266 | 3300049574 | Bacteria | 7514 |
| 1093 | Ga0501038_0061236 | 3300049574 | Bacteria | 3219 |
| 1094 | Ga0501039_0000042 | 3300049575 | Bacteria | 113008 |
| 1095 | Ga0501039_0000106 | 3300049575 | Bacteria | 56453 |
| 1096 | Ga0501039_0012857 | 3300049575 | Bacteria | 6400 |
| 1097 | Ga0501039_0052858 | 3300049575 | Bacteria | 3142 |
| 1098 | Ga0501039_0076835 | 3300049575 | Bacteria | 2596 |
| 1099 | Ga0501039_0197258 | 3300049575 | Bacteria | 1582 |
| 1100 | Ga0501040_0001439 | 3300049576 | Bacteria | 15073 |
| 1101 | Ga0501040_0008487 | 3300049576 | Bacteria | 6670 |
| 1102 | Ga0501041_0162943 | 3300049577 | Bacteria | 1394 |
| 1103 | Ga0501042_0041907 | 3300049578 | Bacteria | 3256 |
| 1104 | Ga0501042_0042227 | 3300049578 | Bacteria | 3245 |
| 1105 | Ga0501042_0139073 | 3300049578 | Bacteria | 1750 |
| 1106 | Ga0501043_0000054 | 3300049579 | Bacteria | 105924 |
| 1107 | Ga0501043_0000074 | 3300049579 | Bacteria | 87396 |
| 1108 | Ga0501043_0010375 | 3300049579 | Bacteria | 7301 |
| 1109 | Ga0501043_0020610 | 3300049579 | Bacteria | 5172 |
| 1110 | Ga0501043_0033107 | 3300049579 | Bacteria | 4065 |
| 1111 | Ga0501043_0035799 | 3300049579 | Bacteria | 3905 |
| 1112 | Ga0501043_0048766 | 3300049579 | Bacteria | 3328 |
| 1113 | Ga0501043_0050854 | 3300049579 | Bacteria | 3257 |
| 1114 | Ga0501046_0000074 | 3300049580 | Bacteria | 104319 |
| 1115 | Ga0501046_0005430 | 3300049580 | Bacteria | 11391 |
| 1116 | Ga0501046_0020680 | 3300049580 | Bacteria | 5441 |
| 1117 | Ga0501046_0079562 | 3300049580 | Bacteria | 2533 |
| 1118 | Ga0501047_0000247 | 3300049581 | Bacteria | 64318 |
| 1119 | Ga0501047_0000301 | 3300049581 | Bacteria | 56886 |
| 1120 | Ga0501047_0126914 | 3300049581 | Bacteria | 2431 |
| 1121 | Ga0501047_0144915 | 3300049581 | Bacteria | 2252 |
| 1122 | Ga0501047_0172420 | 3300049581 | Bacteria | 2032 |
| 1123 | Ga0501048_0000738 | 3300049582 | Bacteria | 23971 |
| 1124 | Ga0501048_0027450 | 3300049582 | Bacteria | 4136 |
| 1125 | Ga0501048_0084729 | 3300049582 | Bacteria | 2235 |
| 1126 | Ga0501067_0000669 | 3300049583 | Bacteria | 18444 |
| 1127 | Ga0501067_0038123 | 3300049583 | Bacteria | 2669 |
| 1128 | Ga0501067_0061079 | 3300049583 | Bacteria | 2086 |
| 1129 | Ga0501067_0098537 | 3300049583 | Bacteria | 1623 |
| 1130 | Ga0501068_0003978 | 3300049584 | Bacteria | 8041 |
| 1131 | Ga0501069_0001738 | 3300049585 | Bacteria | 10869 |
| 1132 | Ga0501070_0011820 | 3300049586 | Bacteria | 7370 |
| 1133 | Ga0501070_0021638 | 3300049586 | Bacteria | 5393 |
| 1134 | Ga0501070_0022479 | 3300049586 | Bacteria | 5282 |
| 1135 | Ga0501070_0045389 | 3300049586 | Bacteria | 3654 |
| 1136 | Ga0501070_0070113 | 3300049586 | Bacteria | 2902 |
| 1137 | Ga0501070_0097224 | 3300049586 | Bacteria | 2436 |
| 1138 | Ga0501070_0271656 | 3300049586 | Bacteria | 1384 |
| 1139 | Ga0501072_0003050 | 3300049588 | Bacteria | 12634 |
| 1140 | Ga0501072_0089520 | 3300049588 | Bacteria | 2443 |
| 1141 | Ga0501073_0000287 | 3300049589 | Bacteria | 33235 |
| 1142 | Ga0501073_0001905 | 3300049589 | Bacteria | 15550 |
| 1143 | Ga0501074_0000657 | 3300049590 | Bacteria | 21574 |
| 1144 | Ga0501074_0008715 | 3300049590 | Bacteria | 7350 |
| 1145 | Ga0501074_0061641 | 3300049590 | Bacteria | 2702 |
| 1146 | Ga0501074_0066795 | 3300049590 | Bacteria | 2586 |
| 1147 | Ga0501074_0121804 | 3300049590 | Bacteria | 1865 |
| 1148 | Ga0501074_0215672 | 3300049590 | Bacteria | 1367 |
| 1149 | Ga0501076_0061043 | 3300049592 | Bacteria | 3000 |
| 1150 | Ga0501211_001780 | 3300049658 | Bacteria | 2296 |
| 1151 | Ga0501079_0011966 | 3300049741 | Bacteria | 6622 |
| 1152 | Ga0501079_0232205 | 3300049741 | Bacteria | 1441 |
| 1153 | Ga0501080_0001211 | 3300049742 | Bacteria | 21422 |
| 1154 | Ga0501080_0028354 | 3300049742 | Bacteria | 5208 |
| 1155 | Ga0501080_0078495 | 3300049742 | Bacteria | 3070 |
| 1156 | Ga0501080_0189631 | 3300049742 | Bacteria | 1889 |
| 1157 | Ga0501080_0471445 | 3300049742 | Bacteria | 1124 |
| 1158 | Ga0501081_0064474 | 3300049743 | Bacteria | 2545 |
| 1159 | Ga0501083_0001289 | 3300049744 | Bacteria | 16957 |
| 1160 | Ga0501083_0017102 | 3300049744 | Bacteria | 5059 |
| 1161 | Ga0501035_0000095 | 3300049822 | Bacteria | 110735 |
| 1162 | Ga0501035_0000484 | 3300049822 | Bacteria | 44772 |
| 1163 | Ga0501035_0002159 | 3300049822 | Bacteria | 19522 |
| 1164 | Ga0501035_0008707 | 3300049822 | Bacteria | 9449 |
| 1165 | Ga0501035_0015132 | 3300049822 | Bacteria | 7120 |
| 1166 | Ga0501035_0074337 | 3300049822 | Bacteria | 3006 |
| 1167 | Ga0501044_0000091 | 3300049823 | Bacteria | 111251 |
| 1168 | Ga0501044_0000667 | 3300049823 | Bacteria | 41447 |
| 1169 | Ga0501044_0010408 | 3300049823 | Bacteria | 10092 |
| 1170 | Ga0501044_0022920 | 3300049823 | Bacteria | 6649 |
| 1171 | Ga0501044_0035929 | 3300049823 | Bacteria | 5185 |
| 1172 | Ga0501044_0059155 | 3300049823 | Bacteria | 3927 |
| 1173 | Ga0501044_0071244 | 3300049823 | Bacteria | 3535 |
| 1174 | Ga0501044_0144428 | 3300049823 | Bacteria | 2366 |
| 1175 | Ga0501044_0229735 | 3300049823 | Bacteria | 1803 |
| 1176 | Ga0501045_0020082 | 3300049824 | Bacteria | 4769 |
| 1177 | Ga0501045_0027102 | 3300049824 | Bacteria | 4126 |
| 1178 | nmdc:mga03683_244_c1 | 3300050489 | Bacteria | 17015 |
| 1179 | nmdc:mga03683_3298_c1 | 3300050489 | Bacteria | 5185 |
| 1180 | nmdc:mga03683_366_c1 | 3300050489 | Bacteria | 13036 |
| 1181 | nmdc:mga03683_58051_c1 | 3300050489 | Bacteria | 1630 |
| 1182 | nmdc:mga03n38_270_c1 | 3300050490 | Bacteria | 12310 |
| 1183 | nmdc:mga03n38_28603_c1 | 3300050490 | Bacteria | 2325 |
| 1184 | nmdc:mga03n38_8007_c1 | 3300050490 | Bacteria | 3770 |
| 1185 | nmdc:mga00v17_107792_c1 | 3300050491 | Bacteria | 1765 |
| 1186 | nmdc:mga00v17_55_c1 | 3300050491 | Bacteria | 72029 |
| 1187 | nmdc:mga00v17_67909_c1 | 3300050491 | Bacteria | 2203 |
| 1188 | nmdc:mga00v17_90606_c1 | 3300050491 | Bacteria | 1920 |
| 1189 | nmdc:mga00v17_92367_c1 | 3300050491 | Bacteria | 1903 |
| 1190 | nmdc:mga0yw44_21423_c1 | 3300050492 | Bacteria | 3605 |
| 1191 | nmdc:mga0yw44_25940_c1 | 3300050492 | Bacteria | 3341 |
| 1192 | nmdc:mga0yw44_56882_c1 | 3300050492 | Bacteria | 2385 |
| 1193 | nmdc:mga0yw44_96611_c1 | 3300050492 | Bacteria | 1876 |
| 1194 | nmdc:mga0k408_5503_c1 | 3300050493 | Bacteria | 6743 |
| 1195 | nmdc:mga0k408_7_c1 | 3300050493 | Bacteria | 164270 |
| 1196 | nmdc:mga06z11_148247_c1 | 3300050494 | Bacteria | 1332 |
| 1197 | nmdc:mga06z11_4631_c1 | 3300050494 | Bacteria | 5427 |
| 1198 | nmdc:mga06z11_60093_c1 | 3300050494 | Bacteria | 1978 |
| 1199 | nmdc:mga06z11_6169_c1 | 3300050494 | Bacteria | 4857 |
| 1200 | nmdc:mga06z11_9_c1 | 3300050494 | Bacteria | 109982 |
| 1201 | nmdc:mga04h51_12_c1 | 3300050495 | Bacteria | 83117 |
| 1202 | nmdc:mga04h51_225_c1 | 3300050495 | Bacteria | 15118 |
| 1203 | nmdc:mga04h51_5734_c1 | 3300050495 | Bacteria | 3180 |
| 1204 | nmdc:mga07m45_15264_c1 | 3300050496 | Bacteria | 4101 |
| 1205 | nmdc:mga07m45_3_c1 | 3300050496 | Bacteria | 421414 |
| 1206 | nmdc:mga07m45_4_c1 | 3300050496 | Bacteria | 409607 |
| 1207 | nmdc:mga07m45_54310_c1 | 3300050496 | Bacteria | 2264 |
| 1208 | nmdc:mga07m45_84947_c2 | 3300050496 | Bacteria | 1580 |
| 1209 | nmdc:mga07m45_8904_c1 | 3300050496 | Bacteria | 5182 |
| 1210 | nmdc:mga05p37_3518_c1 | 3300050507 | Bacteria | 18302 |
| 1211 | nmdc:mga05p37_37170_c1 | 3300050507 | Bacteria | 5971 |
| 1212 | nmdc:mga09592_2329_c1 | 3300050508 | Bacteria | 15331 |
| 1213 | nmdc:mga0qj67_103_c1 | 3300050509 | Bacteria | 56674 |
| 1214 | nmdc:mga0qj67_655_c1 | 3300050509 | Bacteria | 23866 |
| 1215 | nmdc:mga06r32_13402_c1 | 3300050510 | Bacteria | 7424 |
| 1216 | nmdc:mga08y16_1572_c1 | 3300050511 | Bacteria | 23057 |
| 1217 | nmdc:mga08y16_337239_c1 | 3300050511 | Bacteria | 1550 |
| 1218 | nmdc:mga08y16_74572_c1 | 3300050511 | Bacteria | 3536 |
| 1219 | nmdc:mga0n895_104674_c1 | 3300050512 | Bacteria | 2842 |
| 1220 | nmdc:mga0n895_1438_c1 | 3300050512 | Bacteria | 17803 |
| 1221 | nmdc:mga0n895_27420_c1 | 3300050512 | Bacteria | 5412 |
| 1222 | nmdc:mga0n895_5378_c1 | 3300050512 | Bacteria | 10685 |
| 1223 | nmdc:mga0n895_7229_c1 | 3300050512 | Bacteria | 9508 |
| 1224 | nmdc:mga0rr50_108888_c1 | 3300050513 | Bacteria | 2190 |
| 1225 | nmdc:mga0rr50_109439_c1 | 3300050513 | Bacteria | 2184 |
| 1226 | nmdc:mga0rr50_56019_c1 | 3300050513 | Bacteria | 2944 |
| 1227 | nmdc:mga0a205_51064_c1 | 3300050515 | Bacteria | 3992 |
| 1228 | nmdc:mga0sz30_32_c1 | 3300050516 | Bacteria | 54057 |
| 1229 | nmdc:mga0sz30_425_c1 | 3300050516 | Bacteria | 15950 |
| 1230 | Ga0495601_0001725 | 3300053077 | Bacteria | 12088 |
| 1231 | Ga0495601_0002113 | 3300053077 | Bacteria | 11184 |
| 1232 | Ga0495601_0037839 | 3300053077 | Bacteria | 3016 |
| 1233 | Ga0495601_0066576 | 3300053077 | Bacteria | 2293 |
| 1234 | Ga0495601_0113687 | 3300053077 | Bacteria | 1755 |
| 1235 | Ga0495612_0002354 | 3300053078 | Bacteria | 7783 |
| 1236 | Ga0495612_0002553 | 3300053078 | Bacteria | 7508 |
| 1237 | Ga0495612_0014479 | 3300053078 | Bacteria | 3171 |
| 1238 | Ga0500635_0006560 | 3300053080 | Bacteria | 3115 |
| 1239 | Ga0495595_0010295 | 3300053084 | Bacteria | 3884 |
| 1240 | Ga0495595_0069315 | 3300053084 | Bacteria | 1664 |
| 1241 | Ga0495619_0000992 | 3300053085 | Bacteria | 18628 |
| 1242 | Ga0495619_0004603 | 3300053085 | Bacteria | 8805 |
| 1243 | Ga0495619_0176079 | 3300053085 | Bacteria | 1479 |
| 1244 | Ga0500643_018712 | 3300053087 | Bacteria | 2293 |
| 1245 | Ga0500643_024110 | 3300053087 | Bacteria | 1936 |
| 1246 | Ga0500647_0041554 | 3300053091 | Bacteria | 2206 |
| 1247 | Ga0500583_0028000 | 3300053092 | Bacteria | 2439 |
| 1248 | Ga0500651_0002902 | 3300053093 | Bacteria | 9217 |
| 1249 | Ga0500566_0026250 | 3300053094 | Bacteria | 3410 |
| 1250 | Ga0500641_0001073 | 3300053096 | Bacteria | 9743 |
| 1251 | Ga0500554_019071 | 3300053102 | Bacteria | 1862 |
| 1252 | Ga0500562_038733 | 3300053108 | Bacteria | 1266 |
| 1253 | Ga0500572_000446 | 3300053111 | Bacteria | 14429 |
| 1254 | Ga0500595_000262 | 3300053119 | Bacteria | 34880 |
| 1255 | Ga0500595_002787 | 3300053119 | Bacteria | 8419 |
| 1256 | Ga0500595_017382 | 3300053119 | Bacteria | 2656 |
| 1257 | Ga0500607_000048 | 3300053121 | Bacteria | 82363 |
| 1258 | Ga0500607_011224 | 3300053121 | Bacteria | 5302 |
| 1259 | Ga0500652_000019 | 3300053131 | Bacteria | 120149 |
| 1260 | Ga0500559_0000103 | 3300053136 | Bacteria | 66422 |
| 1261 | Ga0500559_0001130 | 3300053136 | Bacteria | 16070 |
| 1262 | Ga0500559_0003016 | 3300053136 | Bacteria | 8424 |
| 1263 | Ga0500568_0010565 | 3300053139 | Bacteria | 4313 |
| 1264 | Ga0500568_0084030 | 3300053139 | Bacteria | 1206 |
| 1265 | Ga0500603_000157 | 3300053150 | Bacteria | 16876 |
| 1266 | Ga0500616_0000046 | 3300053153 | Bacteria | 333409 |
| 1267 | Ga0500622_0005284 | 3300053156 | Bacteria | 7793 |
| 1268 | Ga0500627_0065853 | 3300053158 | Bacteria | 1599 |
| 1269 | Ga0500627_0130154 | 3300053158 | Bacteria | 1136 |
| 1270 | Ga0500634_0032954 | 3300053161 | Bacteria | 2824 |
| 1271 | Ga0500636_0000005 | 3300053177 | Bacteria | 197561 |
| 1272 | Ga0500637_0008800 | 3300053178 | Bacteria | 5109 |
| 1273 | Ga0500637_0010141 | 3300053178 | Bacteria | 4826 |
| 1274 | Ga0500637_0067957 | 3300053178 | Bacteria | 2047 |
| 1275 | Ga0500637_0092542 | 3300053178 | Bacteria | 1752 |
| 1276 | Ga0500645_028070 | 3300053730 | Bacteria | 1705 |
| 1277 | Ga0501084_0016960 | 3300054114 | Bacteria | 6053 |
| 1278 | Ga0501084_0026556 | 3300054114 | Bacteria | 4833 |
| 1279 | Ga0501084_0220410 | 3300054114 | Bacteria | 1601 |
| 1280 | Ga0587082_022046 | 3300059504 | Bacteria | 1045 |
| 1281 | Ga0587083_0021410 | 3300059505 | Bacteria | 1201 |
| 1282 | Ga0587083_0027968 | 3300059505 | Bacteria | 1100 |
| 1283 | Ga0587090_000544 | 3300059510 | Bacteria | 3229 |
| 1284 | Ga0587067_013279 | 3300059640 | Bacteria | 1301 |
| 1285 | Ga0501082_0028479 | 3300060353 | Bacteria | 4812 |
| 1286 | Ga0501082_0089704 | 3300060353 | Bacteria | 2654 |
| 1287 | Ga0501082_0129046 | 3300060353 | Bacteria | 2194 |
| 1288 | Ga0501082_0242474 | 3300060353 | Bacteria | 1568 |
| 1289 | 2509142277 | 2508501127 | Bacteria | 7037543 |
| 1290 | 2509148238 | 2508501128 | Bacteria | 8613869 |
| 1291 | 2509369982 | 2509276018 | Bacteria | 6910194 |
| 1292 | 2509394361 | 2509276022 | Bacteria | 6200534 |
| 1293 | 2510134726 | 2510065019 | Bacteria | 6903379 |
| 1294 | 2510317946 | 2510065059 | Bacteria | 6847884 |
| 1295 | 2510896075 | 2510461076 | Bacteria | 8618824 |
| 1296 | 2511200178 | 2510917030 | Bacteria | 7460662 |
| 1297 | 2512037184 | 2511231221 | Bacteria | 6846400 |
| 1298 | 2513573223 | 2513237084 | Bacteria | 7231967 |
| 1299 | 2513599112 | 2513237088 | Bacteria | 6927906 |
| 1300 | 2513610246 | 2513237090 | Bacteria | 7096802 |
| 1301 | 2513631436 | 2513237093 | Bacteria | 7545552 |
| 1302 | 2513638220 | 2513237094 | Bacteria | 8789602 |
| 1303 | 2513867547 | 2513237138 | Bacteria | 7368160 |
| 1304 | 2514023739 | 2513237162 | Bacteria | 7468464 |
| 1305 | 2514417748 | 2513237305 | Bacteria | 7293571 |
| 1306 | 2515113815 | 2515075009 | Bacteria | 7288508 |
| 1307 | 2515656898 | 2515154116 | Bacteria | 7552979 |
| 1308 | 2517037428 | 2516653077 | Bacteria | 7555578 |
| 1309 | 2517410624 | 2517287029 | Bacteria | 6905599 |
| 1310 | 2524465366 | 2524023210 | Bacteria | 9029266 |
| 1311 | 2524610809 | 2524023250 | Bacteria | 5457705 |
| 1312 | 2535519555 | 2534681796 | Bacteria | 7146037 |
| 1313 | 2537876430 | 2537561587 | Bacteria | 5425293 |
| 1314 | 2554245220 | 2554235003 | Bacteria | 5877155 |
| 1315 | 2559296950 | 2558860242 | Bacteria | 5568029 |
| 1316 | 2585224908 | 2582581298 | Bacteria | 7315509 |
| 1317 | 2585392334 | 2582581866 | Bacteria | 6859583 |
| 1318 | 2585541131 | 2585427528 | Bacteria | 6842387 |
| 1319 | 2585547464 | 2585427529 | Bacteria | 7395659 |
| 1320 | 2585839894 | 2585427593 | Bacteria | 7141551 |
| 1321 | 2585845211 | 2585427594 | Bacteria | 6180594 |
| 1322 | 2588514045 | 2588253730 | Bacteria | 6881675 |
| 1323 | 2597811521 | 2597489875 | Bacteria | 7010078 |
| 1324 | 2599604640 | 2599185210 | Bacteria | 5624189 |
| 1325 | 2599722510 | 2599185236 | Bacteria | 6875203 |
| 1326 | 2599941000 | 2599185301 | Bacteria | 6161860 |
| 1327 | 2600373747 | 2600254933 | Bacteria | 4750527 |
| 1328 | 2601611203 | 2600255279 | Bacteria | 5605316 |
| 1329 | 2601747976 | 2600255308 | Bacteria | 5611129 |
| 1330 | 2616295445 | 2615840624 | Bacteria | 6557588 |
| 1331 | 2643916944 | 2643221582 | Bacteria | 5804683 |
| 1332 | 2644289930 | 2643221651 | Bacteria | 4798932 |
| 1333 | 2644496285 | 2643221688 | Bacteria | 5260751 |
| 1334 | 2644521192 | 2643221693 | Bacteria | 5513853 |
| 1335 | 2688596709 | 2687453392 | Bacteria | 6880454 |
| 1336 | 2694634113 | 2693429783 | Bacteria | 7019804 |
| 1337 | 2694638449 | 2693429784 | Bacteria | 7241525 |
| 1338 | 2719182493 | 2718217882 | Bacteria | 6556348 |
| 1339 | 2719666797 | 2718217997 | Bacteria | 6740740 |
| 1340 | 2719733212 | 2718218009 | Bacteria | 6478651 |
| 1341 | 2720493217 | 2718218199 | Bacteria | 6740745 |
| 1342 | 2720614692 | 2718218232 | Bacteria | 6720332 |
| 1343 | 2720632793 | 2718218235 | Bacteria | 6630699 |
| 1344 | 2720776517 | 2718218269 | Bacteria | 6906114 |
| 1345 | 2721148606 | 2718218363 | Bacteria | 6524337 |
| 1346 | 2721165420 | 2718218366 | Bacteria | 6425255 |
| 1347 | 2722841590 | 2721755514 | Bacteria | 6424414 |
| 1348 | 2723028105 | 2721755556 | Bacteria | 6745503 |
| 1349 | 2723561736 | 2721755684 | Bacteria | 6859907 |
| 1350 | 2723568365 | 2721755685 | Bacteria | 6704835 |
| 1351 | 2723573812 | 2721755686 | Bacteria | 7343952 |
| 1352 | 2724045968 | 2721755810 | Bacteria | 6479005 |
| 1353 | 2724091124 | 2721755819 | Bacteria | 6906405 |
| 1354 | 2724105630 | 2721755822 | Bacteria | 6726041 |
| 1355 | 2724111458 | 2721755823 | Bacteria | 6752556 |
| 1356 | 2725947713 | 2724679232 | Bacteria | 7646494 |
| 1357 | 2730109041 | 2728369352 | Bacteria | 6745171 |
| 1358 | 2730165728 | 2728369365 | Bacteria | 6555560 |
| 1359 | 2738800572 | 2738541293 | Bacteria | 7065685 |
| 1360 | 2756674120 | 2756170246 | Bacteria | 7451806 |
| 1361 | 2778175902 | 2775507266 | Bacteria | 7392367 |
| 1362 | 2792750578 | 2791355123 | Bacteria | 8049106 |
| 1363 | 2793313172 | 2791355259 | Bacteria | 7254731 |
| 1364 | 2793319833 | 2791355260 | Bacteria | 6598818 |
| 1365 | 2793343793 | 2791355263 | Bacteria | 6872478 |
| 1366 | 2793347265 | 2791355264 | Bacteria | 6429314 |
| 1367 | 2793362940 | 2791355266 | Bacteria | 7116587 |
| 1368 | 2806044671 | 2802429633 | Bacteria | 7341974 |
| 1369 | 2806052871 | 2802429634 | Bacteria | 7083200 |
| 1370 | 2806059171 | 2802429635 | Bacteria | 7650140 |
| 1371 | 2806068166 | 2802429636 | Bacteria | 7597525 |
| 1372 | 2806074286 | 2802429637 | Bacteria | 7067217 |
| 1373 | 2808989090 | 2808606387 | Bacteria | 5697198 |
| 1374 | 2819685569 | 2818991461 | Bacteria | 7026071 |
| 1375 | 2838018993 | 2838016132 | Bacteria | 6577831 |
| 1376 | 2838024407 | 2838022645 | Bacteria | 6494267 |
| 1377 | 2838046365 | 2838042994 | Bacteria | 6046894 |
| 1378 | 2838051290 | 2838048938 | Bacteria | 6044578 |
| 1379 | 2838063733 | 2838061910 | Bacteria | 6794874 |
| 1380 | 2838074301 | 2838068647 | Bacteria | 6208656 |
| 1381 | 2838678243 | 2838675328 | Bacteria | 4909118 |
| 1382 | 2838716851 | 2838714209 | Bacteria | 5525906 |
| 1383 | 2838722539 | 2838719591 | Bacteria | 5523910 |
| 1384 | 2838727600 | 2838724970 | Bacteria | 4908691 |
| 1385 | 2841737138 | 2841734538 | Bacteria | 6784580 |
| 1386 | 2841849206 | 2841846520 | Bacteria | 5345850 |
| 1387 | 2841861723 | 2841859092 | Bacteria | 5436171 |
| 1388 | 2842128045 | 2842124991 | Bacteria | 5346824 |
| 1389 | 2842133136 | 2842130223 | Bacteria | 4909145 |
| 1390 | 2842155130 | 2842152218 | Bacteria | 4908957 |
| 1391 | 2842173629 | 2842170452 | Bacteria | 5525737 |
| 1392 | 2842178751 | 2842175837 | Bacteria | 4908771 |
| 1393 | 2842189958 | 2842187318 | Bacteria | 5524014 |
| 1394 | 2842197791 | 2842192696 | Bacteria | 6147454 |
| 1395 | 2842199950 | 2842198810 | Bacteria | 6608673 |
| 1396 | 2842214272 | 2842211629 | Bacteria | 5523832 |
| 1397 | 2842226991 | 2842224351 | Bacteria | 5524473 |
| 1398 | 2842266499 | 2842264693 | Bacteria | 6472963 |
| 1399 | 2842316192 | 2842311132 | Bacteria | 6616990 |
| 1400 | 2842398645 | 2842395702 | Bacteria | 6780583 |
| 1401 | 2842427925 | 2842422224 | Bacteria | 6239196 |
| 1402 | 2842429818 | 2842428310 | Bacteria | 6767288 |
| 1403 | 2842436522 | 2842434925 | Bacteria | 6502746 |
| 1404 | 2842444225 | 2842441272 | Bacteria | 6769273 |
| 1405 | 2842464239 | 2842462802 | Bacteria | 6588055 |
| 1406 | 2842470851 | 2842469257 | Bacteria | 6752936 |
| 1407 | 2842518011 | 2842515876 | Bacteria | 5436280 |
| 1408 | 2844009361 | 2844002411 | Bacteria | 7168230 |
| 1409 | 2844011961 | 2844009547 | Bacteria | 6728125 |
| 1410 | 2847674473 | 2847670302 | Bacteria | 6165597 |
| 1411 | 2847690602 | 2847686936 | Bacteria | 6278406 |
| 1412 | 2854900344 | 2854896431 | Bacteria | 5869725 |
| 1413 | 2854913154 | 2854911287 | Bacteria | 5582813 |
| 1414 | 2854920175 | 2854916844 | Bacteria | 5725939 |
| 1415 | 2856317611 | 2856314179 | Bacteria | 6477897 |
| 1416 | 2856329581 | 2856328259 | Bacteria | 6528202 |
| 1417 | 2856338212 | 2856334872 | Bacteria | 7037011 |
| 1418 | 2856349055 | 2856342000 | Bacteria | 7176905 |
| 1419 | 2856352974 | 2856349417 | Bacteria | 6230045 |
| 1420 | 2856366585 | 2856364286 | Bacteria | 6939991 |
| 1421 | 2857356735 | 2857349434 | Bacteria | 7926032 |
| 1422 | 2857371542 | 2857367948 | Bacteria | 6965560 |
| 1423 | 2869163659 | 2869162929 | Bacteria | 6399702 |
| 1424 | 2869171003 | 2869169390 | Bacteria | 6659796 |
| 1425 | 2869239641 | 2869234852 | Bacteria | 6654993 |
| 1426 | 2869245912 | 2869242130 | Bacteria | 6609239 |
| 1427 | 2869251180 | 2869249662 | Bacteria | 6868783 |
| 1428 | 2869263252 | 2869256925 | Bacteria | 6981691 |
| 1429 | 2869265431 | 2869264136 | Bacteria | 6880765 |
| 1430 | 2869275538 | 2869271264 | Bacteria | 6908218 |
| 1431 | 2869288004 | 2869285874 | Bacteria | 6901219 |
| 1432 | 2871429891 | 2871429161 | Bacteria | 6547891 |
| 1433 | 2871438790 | 2871435913 | Bacteria | 6880295 |
| 1434 | 2871451027 | 2871444079 | Bacteria | 6423508 |
| 1435 | 2871453408 | 2871451962 | Bacteria | 7336357 |
| 1436 | 2871462177 | 2871459585 | Bacteria | 6866887 |
| 1437 | 2871468439 | 2871466892 | Bacteria | 6923287 |
| 1438 | 2871478594 | 2871474448 | Bacteria | 6806570 |
| 1439 | 2871489178 | 2871488783 | Bacteria | 6929816 |
| 1440 | 2874106685 | 2874102143 | Bacteria | 6342645 |
| 1441 | 2874113372 | 2874109183 | Bacteria | 6517025 |
| 1442 | 2874120158 | 2874116593 | Bacteria | 6674494 |
| 1443 | 2874128664 | 2874123672 | Bacteria | 7238285 |
| 1444 | 2874131993 | 2874131515 | Bacteria | 6820270 |
| 1445 | 2874151637 | 2874146452 | Bacteria | 7533118 |
| 1446 | 2874159269 | 2874155637 | Bacteria | 6724144 |
| 1447 | 2874166794 | 2874162495 | Bacteria | 6174670 |
| 1448 | 2874175883 | 2874168670 | Bacteria | 8062617 |
| 1449 | 2876370363 | 2876369609 | Bacteria | 6807521 |
| 1450 | 2876380052 | 2876377896 | Bacteria | 6565995 |
| 1451 | 2876391491 | 2876386047 | Bacteria | 6698674 |
| 1452 | 2876406220 | 2876399893 | Bacteria | 6927900 |
| 1453 | 2876412621 | 2876406927 | Bacteria | 6191900 |
| 1454 | 2876417688 | 2876413966 | Bacteria | 6831344 |
| 1455 | 2876427550 | 2876420981 | Bacteria | 6687741 |
| 1456 | 2878038669 | 2878035449 | Bacteria | 6555736 |
| 1457 | 2878749515 | 2878745973 | Bacteria | 6867388 |
| 1458 | 2878754652 | 2878753008 | Bacteria | 6922523 |
| 1459 | 2878779015 | 2878774303 | Bacteria | 6108671 |
| 1460 | 2878786369 | 2878781027 | Bacteria | 6834456 |
| 1461 | 2878795973 | 2878788777 | Bacteria | 6567085 |
| 1462 | 2881149255 | 2881147464 | Bacteria | 7779814 |
| 1463 | 2881160492 | 2881155292 | Bacteria | 6461656 |
| 1464 | 2881856419 | 2881853255 | Bacteria | 6698367 |
| 1465 | 2881861930 | 2881861095 | Bacteria | 7128710 |
| 1466 | 2882638248 | 2882632389 | Bacteria | 8154593 |
| 1467 | 2882915012 | 2882912400 | Bacteria | 6801539 |
| 1468 | 2885313400 | 2885312484 | Bacteria | 6415165 |
| 1469 | 2885321391 | 2885318864 | Bacteria | 6729568 |
| 1470 | 2885344564 | 2885342637 | Bacteria | 7011821 |
| 1471 | 2885351520 | 2885350715 | Bacteria | 6787678 |
| 1472 | 2885386200 | 2885383462 | Bacteria | 9473874 |
| 1473 | 2888345095 | 2888343758 | Bacteria | 6611049 |
| 1474 | 2888354301 | 2888350351 | Bacteria | 7372807 |
| 1475 | 2889018937 | 2889016732 | Bacteria | 6700763 |
| 1476 | 2894653973 | 2894652903 | Bacteria | 4587256 |
| 1477 | 2899792811 | 2899792073 | Bacteria | 4926588 |
| 1478 | 2899845452 | 2899845264 | Bacteria | 5672268 |
| 1479 | 2903493745 | 2903492973 | Bacteria | 13473544 |
| 1480 | 2903495865 | 2903492973 | Bacteria | 13473544 |
| 1481 | 2903518931 | 2903513507 | Bacteria | 6344008 |
| 1482 | 2906310553 | 2906308376 | Bacteria | 6841989 |
| 1483 | 2906324617 | 2906321335 | Bacteria | 6579571 |
| 1484 | 2906333417 | 2906328253 | Bacteria | 6585166 |
| 1485 | 2906365626 | 2906363423 | Bacteria | 6856682 |
| 1486 | 2906372863 | 2906370794 | Bacteria | 6881062 |
| 1487 | 2906393511 | 2906386501 | Bacteria | 5977019 |
| 1488 | 2906398274 | 2906393657 | Bacteria | 6790866 |
| 1489 | 2906406069 | 2906401398 | Bacteria | 6693206 |
| 1490 | 2906411610 | 2906408224 | Bacteria | 6162342 |
| 1491 | 2906417676 | 2906414383 | Bacteria | 6580790 |
| 1492 | 2906428659 | 2906427513 | Bacteria | 6375796 |
| 1493 | 2915654232 | 2915650412 | Bacteria | 4288180 |
| 1494 | 2919117042 | 2919114240 | Bacteria | 5700270 |
| 1495 | 2922131232 | 2922130491 | Bacteria | 7173936 |
| 1496 | 2922151535 | 2922151315 | Bacteria | 6902399 |
| 1497 | 2922163744 | 2922158528 | Bacteria | 6573167 |
| 1498 | 2922174749 | 2922172374 | Bacteria | 6167644 |
| 1499 | 2922182238 | 2922178524 | Bacteria | 6025201 |
| 1500 | 2922190125 | 2922185730 | Bacteria | 7113964 |
| 1501 | 2923558897 | 2923556063 | Bacteria | 6793593 |
| 1502 | 2924716296 | 2924710171 | Bacteria | 6752351 |
| 1503 | 2924728264 | 2924726620 | Bacteria | 6271473 |
| 1504 | 2924738374 | 2924733363 | Bacteria | 7574837 |
| 1505 | 2924747257 | 2924741084 | Bacteria | 6661321 |
| 1506 | 2924748475 | 2924748358 | Bacteria | 6154725 |
| 1507 | 2924760621 | 2924754689 | Bacteria | 6774424 |
| 1508 | 2924768370 | 2924762789 | Bacteria | 6561353 |
| 1509 | 2924790317 | 2924784321 | Bacteria | 7416538 |
| 1510 | 2926758555 | 2926754445 | Bacteria | 5964435 |
| 1511 | 2926763913 | 2926760298 | Bacteria | 5505990 |
| 1512 | 2929141303 | 2929138655 | Bacteria | 5810547 |
| 1513 | 2933009491 | 2933006813 | Bacteria | 4912075 |
| 1514 | 2933013640 | 2933011516 | Bacteria | 5439334 |
| 1515 | 2933598118 | 2933594066 | Bacteria | 5594265 |
| 1516 | 2933604757 | 2933599457 | Bacteria | 5858799 |
| 1517 | 2936382153 | 2936381700 | Bacteria | 7006523 |
| 1518 | 2937817381 | 2937813078 | Bacteria | 7783518 |
| 1519 | 2937828236 | 2937822353 | Bacteria | 7290551 |
| 1520 | 2937837383 | 2937836603 | Bacteria | 6811263 |
| 1521 | 2937863224 | 2937861824 | Bacteria | 6660327 |
| 1522 | 2937876936 | 2937868953 | Bacteria | 6639878 |
| 1523 | 2937895561 | 2937891427 | Bacteria | 6357007 |
| 1524 | 2937985789 | 2937980651 | Bacteria | 6517427 |
| 1525 | 2958073417 | 2958071322 | Bacteria | 6815895 |
| 1526 | 2958105368 | 2958100919 | Bacteria | 6800575 |
| 1527 | 2958110929 | 2958108152 | Bacteria | 6681128 |
| 1528 | 2958116017 | 2958115193 | Bacteria | 6923548 |
| 1529 | 2958124350 | 2958122699 | Bacteria | 7280457 |
| 1530 | 2958132407 | 2958130278 | Bacteria | 6897202 |
| 1531 | 2958141470 | 2958137437 | Bacteria | 6050276 |
| 1532 | 2958163673 | 2958158011 | Bacteria | 6058449 |
| 1533 | 2958178318 | 2958172287 | Bacteria | 6716688 |
| 1534 | 2958182221 | 2958179912 | Bacteria | 6874908 |
| 1535 | 2961080065 | 2961077736 | Bacteria | 7079850 |
| 1536 | 2961134563 | 2961127735 | Bacteria | 7196641 |
| 1537 | 2961141699 | 2961136820 | Bacteria | 6775228 |
| 1538 | 2961171254 | 2961170736 | Bacteria | 7072258 |
| 1539 | 2961183891 | 2961183825 | Bacteria | 6688536 |
| 1540 | 2965025534 | 2965025482 | Bacteria | 6532201 |
| 1541 | 2965036531 | 2965032056 | Bacteria | 6887443 |
| 1542 | 2965046410 | 2965040258 | Bacteria | 6855979 |
| 1543 | 2965049161 | 2965047637 | Bacteria | 6623551 |
| 1544 | 2965062359 | 2965062239 | Bacteria | 7412989 |
| 1545 | 2965089302 | 2965089291 | Bacteria | 6866420 |
| 1546 | 2965103618 | 2965102966 | Bacteria | 6800987 |
| 1547 | 2967996241 | 2967996073 | Bacteria | 6787468 |
| 1548 | 2968004476 | 2968003550 | Bacteria | 6929263 |
| 1549 | 2968091567 | 2968091066 | Bacteria | 6052692 |
| 1550 | 2968097449 | 2968097103 | Bacteria | 6107094 |
| 1551 | 2968123383 | 2968117919 | Bacteria | 6536078 |
| 1552 | 2968133463 | 2968128360 | Bacteria | 6270294 |
| 1553 | 2968145308 | 2968138860 | Bacteria | 6605449 |
| 1554 | 2970491244 | 2970489779 | Bacteria | 6517260 |
| 1555 | 2970503851 | 2970503327 | Bacteria | 7099517 |
| 1556 | 2970514458 | 2970510686 | Bacteria | 7006402 |
| 1557 | 2970526825 | 2970524798 | Bacteria | 6840927 |
| 1558 | 2970539899 | 2970532167 | Bacteria | 6553173 |
| 1559 | 2970542961 | 2970540015 | Bacteria | 6977556 |
| 1560 | 2970551264 | 2970547951 | Bacteria | 6931819 |
| 1561 | 2970625870 | 2970619444 | Bacteria | 6986144 |
| 1562 | 2970631649 | 2970627176 | Bacteria | 6680862 |
| 1563 | 2977823869 | 2977821940 | Bacteria | 6906439 |
| 1564 | 2977831051 | 2977828996 | Bacteria | 7007971 |
| 1565 | 2977847667 | 2977843712 | Bacteria | 6753583 |
| 1566 | 2977856305 | 2977851361 | Bacteria | 6694324 |
| 1567 | 2977863159 | 2977858184 | Bacteria | 6215359 |
| 1568 | 2977871143 | 2977864932 | Bacteria | 7534097 |
| 1569 | 2977874734 | 2977872689 | Bacteria | 7270173 |
| 1570 | 2977903947 | 2977898635 | Bacteria | 6675551 |
| 1571 | 2977913077 | 2977907340 | Bacteria | 6577984 |
| 1572 | 2977922127 | 2977915119 | Bacteria | 6829656 |
| 1573 | 2977935874 | 2977935797 | Bacteria | 6252826 |
| 1574 | 2977942939 | 2977942078 | Bacteria | 7570577 |
| 1575 | 2977952707 | 2977950692 | Bacteria | 6893264 |
| 1576 | 2977958859 | 2977957713 | Bacteria | 6877875 |
| 1577 | 2977974643 | 2977971508 | Bacteria | 7472917 |
| 1578 | 2979090989 | 2979089926 | Bacteria | 5670289 |
| 1579 | 2979096515 | 2979095461 | Bacteria | 5669583 |
| 1580 | 2979711911 | 2979710463 | Bacteria | 6785254 |
| 1581 | 2979748617 | 2979742915 | Bacteria | 7301278 |
| 1582 | 2979769509 | 2979764755 | Bacteria | 6610066 |
| 1583 | 2979775628 | 2979772303 | Bacteria | 6618277 |
| 1584 | 2979783307 | 2979779861 | Bacteria | 6219781 |
| 1585 | 2979794520 | 2979793036 | Bacteria | 6808957 |
| 1586 | 2979808484 | 2979808191 | Bacteria | 7179355 |
| 1587 | 2987644016 | 2987636660 | Bacteria | 8088555 |
| 1588 | 2987647838 | 2987645492 | Bacteria | 6117018 |
| 1589 | 2987671656 | 2987666974 | Bacteria | 6509233 |
| 1590 | 2987680420 | 2987673487 | Bacteria | 6884027 |
| 1591 | 2996339922 | 2996336353 | Bacteria | 5511628 |
| 1592 | 2996343843 | 2996341866 | Bacteria | 6643098 |
| 1593 | 2996390465 | 2996386984 | Bacteria | 6978667 |
| 1594 | 2996890537 | 2996887358 | Bacteria | 5795980 |
| 1595 | 2996895929 | 2996893221 | Bacteria | 5823108 |
| 1596 | 3004174064 | 3004167301 | Bacteria | 8330599 |
| 1597 | 3004200374 | 3004195979 | Bacteria | 6776956 |
| 1598 | 3004208165 | 3004203850 | Bacteria | 7307914 |
| 1599 | 3004217568 | 3004211236 | Bacteria | 7417683 |
| 1600 | 3004219915 | 3004218560 | Bacteria | 7421728 |
| 1601 | 3004234667 | 3004232784 | Bacteria | 6662140 |
| 1602 | 3004241665 | 3004239961 | Bacteria | 6892290 |
| 1603 | 3004273844 | 3004268573 | Bacteria | 7043476 |
| 1604 | 3005415611 | 3005409236 | Bacteria | 7188837 |
| 1605 | 3005449157 | 3005445848 | Bacteria | 6906074 |
| 1606 | 649871264 | 649633066 | Bacteria | 6690028 |
| 1607 | 650843370 | 650716007 | Bacteria | 5573770 |
| 1608 | 8003572967 | 8003570095 | Bacteria | 5747666 |
| 1609 | 8004303373 | 8004300914 | Bacteria | 6132239 |
| 1610 | 8004366216 | 8004361976 | Bacteria | 6858373 |
| 1611 | 8004376232 | 8004374579 | Bacteria | 6898112 |
| 1612 | 8004389791 | 8004387939 | Bacteria | 7049250 |
| 1613 | 8004400573 | 8004395343 | Bacteria | 6620908 |
| 1614 | 8004450923 | 8004445564 | Bacteria | 6322258 |
| 1615 | 8004635015 | 8004633249 | Bacteria | 6723080 |
| 1616 | 8004645655 | 8004640170 | Bacteria | 6723001 |
| 1617 | 8004696880 | 8004695233 | Bacteria | 6731676 |
| 1618 | 8004704383 | 8004703790 | Bacteria | 8006957 |
| 1619 | 8004718188 | 8004714634 | Bacteria | 6776161 |
| 1620 | 8004729944 | 8004727605 | Bacteria | 6643904 |
| 1621 | 8005264344 | 8005258706 | Bacteria | 6184835 |
| 1622 | 8005288872 | 8005282627 | Bacteria | 6675747 |
| 1623 | 8005306790 | 8005301065 | Bacteria | 6614431 |
| 1624 | 8005325064 | 8005321885 | Bacteria | 5795980 |
| 1625 | 8005434237 | 8005430974 | Bacteria | 6689030 |
| 1626 | 8005464502 | 8005460587 | Bacteria | 7157962 |
| 1627 | 8005501543 | 8005497431 | Bacteria | 6477605 |
| 1628 | 8005547252 | 8005542996 | Bacteria | 7077758 |
| 1629 | 8005558501 | 8005556819 | Bacteria | 6908598 |
| 1630 | 8005566655 | 8005563573 | Bacteria | 7153261 |
| 1631 | 8005575057 | 8005570704 | Bacteria | 6957481 |
| 1632 | 8005622905 | 8005619151 | Bacteria | 7030230 |
| 1633 | 8005631795 | 8005626139 | Bacteria | 6534237 |
| 1634 | 8005672964 | 8005668836 | Bacteria | 6953162 |
| 1635 | 8005693514 | 8005688590 | Bacteria | 6610080 |
| 1636 | 8005700730 | 8005695170 | Bacteria | 6912330 |
| 1637 | 8006992999 | 8006984368 | Bacteria | 9651211 |
| 1638 | 8018133728 | 8018127388 | Bacteria | 7351159 |
| 1639 | 8018170099 | 8018163183 | Bacteria | 7277977 |
| 1640 | 8024481666 | 8024479707 | Bacteria | 6954785 |
| 1641 | 8054463373 | 8054460903 | Bacteria | 4872905 |
| 1642 | 8055618671 | 8055617313 | Bacteria | 7548464 |
| 1643 | 8056675331 | 8056673599 | Bacteria | 7871253 |
| 1644 | 8056692063 | 8056689827 | Bacteria | 6712655 |
| 1645 | 8057577508 | 8057575449 | Bacteria | 7367519 |
| 1646 | 8057876705 | 8057874678 | Bacteria | 7494653 |
| 1647 | Ga0316574_0095850 | |||
| 1648 | 2214772993 | |||
| 1649 | ARcpr5oldR_c000025 | |||
| 1650 | ARSoilYngRDRAFT_c00011 | |||
| 1651 | ARcpr5yngRDRAFT_c000021 | |||
| 1652 | ARSoilOldRDRAFT_c000046 | |||
| 1653 | ARCol0oldRDRAFT_c00097 | |||
| 1654 | LJQas_1005843 | |||
| 1655 | ARCol0yngRDRAFT_1000010 | |||
| 1656 | JGI24752J21851_1003212 | |||
| 1657 | JGI24746J21847_1000905 | |||
| 1658 | JGI24740J21852_10001241 | |||
| 1659 | JGI24739J22299_10004523 | |||
| 1660 | JGI24739J22299_10012297 | |||
| 1661 | JGI24737J22298_10001098 | |||
| 1662 | JGI24737J22298_10017842 | |||
| 1663 | JGI24750J21931_1000013 | |||
| 1664 | JGI24750J21931_1000484 | |||
| 1665 | JGI24750J21931_1004132 | |||
| 1666 | JGI24745J21846_1000026 | |||
| 1667 | JGI24748J21848_1000355 | |||
| 1668 | JGI24738J21930_10000790 | |||
| 1669 | JGI24744J21845_10011141 | |||
| 1670 | JGI24035J26624_1000074 | |||
| 1671 | JGI24033J26618_1001377 | |||
| 1672 | JGI24034J26672_10001130 | |||
| 1673 | JGI24742J22300_10000012 | |||
| 1674 | JGI25155J39150_1000007 | |||
| 1675 | JGI25156J39149_1000066 | |||
| 1676 | JGI25154J39366_1000035 | |||
| 1677 | JGI25158J39367_1000064 | |||
| 1678 | JGI25157J39369_1000036 | |||
| 1679 | JGI25157J39369_1000197 | |||
| 1680 | JGI25157J39369_1005446 | |||
| 1681 | JGI25152J39213_1001126 | |||
| 1682 | JGI25159J45721_1000451 | |||
| 1683 | JGI25406J46586_10000061 | |||
| 1684 | JGI25153J46596_10009150 | |||
| 1685 | JGI25160J50197_1004816 | |||
| 1686 | JGI25161J50226_1000211 | |||
| 1687 | Ga0055524_1003572 | |||
| 1688 | Ga0055524_1011564 | |||
| 1689 | Ga0055536_1022432 | |||
| 1690 | Ga0055528_1000375 | |||
| 1691 | Ga0055540_1001299 | |||
| 1692 | Ga0055540_1004698 | |||
| 1693 | Ga0055543_1000328 | |||
| 1694 | Ga0065165_1004744 | |||
| 1695 | Ga0065165_1004908 | |||
| 1696 | Ga0065712_10007605 | |||
| 1697 | Ga0065712_10090719 | |||
| 1698 | Ga0065712_10110789 | |||
| 1699 | Ga0065715_10000810 | |||
| 1700 | Ga0065715_10187168 | |||
| 1701 | Ga0065707_10090602 | |||
| 1702 | Ga0070658_10208985 | |||
| 1703 | Ga0070676_10000008 | |||
| 1704 | Ga0070676_10082980 | |||
| 1705 | Ga0070683_100000442 | |||
| 1706 | Ga0070683_100031874 | |||
| 1707 | Ga0070683_100185045 | |||
| 1708 | Ga0070690_100004858 | |||
| 1709 | Ga0070690_100020553 | |||
| 1710 | Ga0070670_100012561 | |||
| 1711 | Ga0070677_10000100 | |||
| 1712 | Ga0068869_100000008 | |||
| 1713 | Ga0070666_10005228 | |||
| 1714 | Ga0070666_10025504 | |||
| 1715 | Ga0070666_10064263 | |||
| 1716 | Ga0070666_10120916 | |||
| 1717 | Ga0070680_100001645 | |||
| 1718 | Ga0070680_100071572 | |||
| 1719 | Ga0070682_100000217 | |||
| 1720 | Ga0070682_100132869 | |||
| 1721 | Ga0068868_100000521 | |||
| 1722 | Ga0068868_100015942 | |||
| 1723 | Ga0068868_100162839 | |||
| 1724 | Ga0070660_100000962 | |||
| 1725 | Ga0070660_100012282 | |||
| 1726 | Ga0070660_100062961 | |||
| 1727 | Ga0070689_100000092 | |||
| 1728 | Ga0070689_100037958 | |||
| 1729 | Ga0070689_100089729 | |||
| 1730 | Ga0070689_100136944 | |||
| 1731 | Ga0070689_100188277 | |||
| 1732 | Ga0070691_10000193 | |||
| 1733 | Ga0070691_10010038 | |||
| 1734 | Ga0070687_100000292 | |||
| 1735 | Ga0070687_100015395 | |||
| 1736 | Ga0070661_100001156 | |||
| 1737 | Ga0070692_10002125 | |||
| 1738 | Ga0070668_100000463 | |||
| 1739 | Ga0070669_100009511 | |||
| 1740 | Ga0070669_100046638 | |||
| 1741 | Ga0070675_100000032 | |||
| 1742 | Ga0070675_100028829 | |||
| 1743 | Ga0070671_100019617 | |||
| 1744 | Ga0070671_100046825 | |||
| 1745 | Ga0070671_100098212 | |||
| 1746 | Ga0070674_100000070 | |||
| 1747 | Ga0070674_100303887 | |||
| 1748 | Ga0070673_100000122 | |||
| 1749 | Ga0070673_100006774 | |||
| 1750 | Ga0070673_100008361 | |||
| 1751 | Ga0070673_100229526 | |||
| 1752 | Ga0070673_100272581 | |||
| 1753 | Ga0070688_100000062 | |||
| 1754 | Ga0070688_100025910 | |||
| 1755 | Ga0070688_100058063 | |||
| 1756 | Ga0070659_100003490 | |||
| 1757 | Ga0070659_100094038 | |||
| 1758 | Ga0070659_100098126 | |||
| 1759 | Ga0070667_100002274 | |||
| 1760 | Ga0070667_100083916 | |||
| 1761 | Ga0070709_10003313 | |||
| 1762 | Ga0070709_10008277 | |||
| 1763 | Ga0070709_10057181 | |||
| 1764 | Ga0070714_100233750 | |||
| 1765 | Ga0070713_100017447 | |||
| 1766 | Ga0070713_100032360 | |||
| 1767 | Ga0070713_100118146 | |||
| 1768 | Ga0070713_100372803 | |||
| 1769 | Ga0070710_10004852 | |||
| 1770 | Ga0070710_10018721 | |||
| 1771 | Ga0070710_10019737 | |||
| 1772 | Ga0070710_10132150 | |||
| 1773 | Ga0070701_10000030 | |||
| 1774 | Ga0070711_100000630 | |||
| 1775 | Ga0070711_100011160 | |||
| 1776 | Ga0070711_100020259 | |||
| 1777 | Ga0070711_100032137 | |||
| 1778 | Ga0070705_100037303 | |||
| 1779 | Ga0070700_100001800 | |||
| 1780 | Ga0070700_100040001 | |||
| 1781 | Ga0070700_100061028 | |||
| 1782 | Ga0070694_100001327 | |||
| 1783 | Ga0070708_100022682 | |||
| 1784 | Ga0070708_100089370 | |||
| 1785 | Ga0070708_100114929 | |||
| 1786 | Ga0070663_100004939 | |||
| 1787 | Ga0070663_100014811 | |||
| 1788 | Ga0070663_100017579 | |||
| 1789 | Ga0070663_100059293 | |||
| 1790 | Ga0070663_100072592 | |||
| 1791 | Ga0070663_100124570 | |||
| 1792 | Ga0070663_100179724 | |||
| 1793 | Ga0070678_100000054 | |||
| 1794 | Ga0070678_100006773 | |||
| 1795 | Ga0070678_100416976 | |||
| 1796 | Ga0070662_100029675 | |||
| 1797 | Ga0070662_100144551 | |||
| 1798 | Ga0070681_10000284 | |||
| 1799 | Ga0070681_10019669 | |||
| 1800 | Ga0070681_10076781 | |||
| 1801 | Ga0070681_10332227 | |||
| 1802 | Ga0070681_10490527 | |||
| 1803 | Ga0068867_100000073 | |||
| 1804 | Ga0068867_100186374 | |||
| 1805 | Ga0070685_10050153 | |||
| 1806 | Ga0070707_100090495 | |||
| 1807 | Ga0070699_100332533 | |||
| 1808 | Ga0070679_100006931 | |||
| 1809 | Ga0070679_100099240 | |||
| 1810 | Ga0070684_100000022 | |||
| 1811 | Ga0070684_100026341 | |||
| 1812 | Ga0070684_100114453 | |||
| 1813 | Ga0070684_100151892 | |||
| 1814 | Ga0070684_100200295 | |||
| 1815 | Ga0070684_100517824 | |||
| 1816 | Ga0070697_100223843 | |||
| 1817 | Ga0068853_100000820 | |||
| 1818 | Ga0068853_100006375 | |||
| 1819 | Ga0068853_100016781 | |||
| 1820 | Ga0068853_100054719 | |||
| 1821 | Ga0068853_100178045 | |||
| 1822 | Ga0068853_100271544 | |||
| 1823 | Ga0070672_100000012 | |||
| 1824 | Ga0070672_100165557 | |||
| 1825 | Ga0070686_100000087 | |||
| 1826 | Ga0070686_100009191 | |||
| 1827 | Ga0070686_100097563 | |||
| 1828 | Ga0070695_100013698 | |||
| 1829 | Ga0070695_100044896 | |||
| 1830 | Ga0070695_100227561 | |||
| 1831 | Ga0070696_100024101 | |||
| 1832 | Ga0070696_100107464 | |||
| 1833 | Ga0070693_100007106 | |||
| 1834 | Ga0070693_100033679 | |||
| 1835 | Ga0070665_100002168 | |||
| 1836 | Ga0070665_100009158 | |||
| 1837 | Ga0070665_100054836 | |||
| 1838 | Ga0070665_100094590 | |||
| 1839 | Ga0070665_100208987 | |||
| 1840 | Ga0070704_100015624 | |||
| 1841 | Ga0070704_100270224 | |||
| 1842 | Ga0068855_100013715 | |||
| 1843 | Ga0068855_100034558 | |||
| 1844 | Ga0068855_100148336 | |||
| 1845 | Ga0070664_100000102 | |||
| 1846 | Ga0068857_100000069 | |||
| 1847 | Ga0068857_100000859 | |||
| 1848 | Ga0068854_100000215 | |||
| 1849 | Ga0068854_100042575 | |||
| 1850 | Ga0068856_100000214 | |||
| 1851 | Ga0068856_100005749 | |||
| 1852 | Ga0068856_100015547 | |||
| 1853 | Ga0068856_100115885 | |||
| 1854 | Ga0070702_100000418 | |||
| 1855 | Ga0070702_100009245 | |||
| 1856 | Ga0068852_100000269 | |||
| 1857 | Ga0068852_100035262 | |||
| 1858 | Ga0068852_100588173 | |||
| 1859 | Ga0068859_100003063 | |||
| 1860 | Ga0068859_100352934 | |||
| 1861 | Ga0068864_100001591 | |||
| 1862 | Ga0068866_10000150 | |||
| 1863 | Ga0068861_100007600 | |||
| 1864 | Ga0068861_100301277 | |||
| 1865 | Ga0068870_10000001 | |||
| 1866 | Ga0068863_100010203 | |||
| 1867 | Ga0068863_100141036 | |||
| 1868 | Ga0068863_100246587 | |||
| 1869 | Ga0068858_100001238 | |||
| 1870 | Ga0068860_100002196 | |||
| 1871 | Ga0068860_100002790 | |||
| 1872 | Ga0068860_100080264 | |||
| 1873 | Ga0068862_100000304 | |||
| 1874 | Ga0068862_100016948 | |||
| 1875 | Ga0081455_10000124 | |||
| 1876 | Ga0081455_10007243 | |||
| 1877 | Ga0081455_10095333 | |||
| 1878 | Ga0081538_10022322 | |||
| 1879 | Ga0081539_10000942 | |||
| 1880 | Ga0081539_10000950 | |||
| 1881 | Ga0081539_10015421 | |||
| 1882 | Ga0070717_10000580 | |||
| 1883 | Ga0070717_10000673 | |||
| 1884 | Ga0070717_10012410 | |||
| 1885 | Ga0070717_10058332 | |||
| 1886 | Ga0070717_10152078 | |||
| 1887 | Ga0075365_10009764 | |||
| 1888 | Ga0075365_10014389 | |||
| 1889 | Ga0075365_10015198 | |||
| 1890 | Ga0075365_10103890 | |||
| 1891 | Ga0075365_10151027 | |||
| 1892 | Ga0075368_10000514 | |||
| 1893 | Ga0075368_10008426 | |||
| 1894 | Ga0075368_10009212 | |||
| 1895 | Ga0075368_10017057 | |||
| 1896 | Ga0075363_100009613 | |||
| 1897 | Ga0075363_100013871 | |||
| 1898 | Ga0075363_100021691 | |||
| 1899 | Ga0075363_100136887 | |||
| 1900 | Ga0075364_10050071 | |||
| 1901 | Ga0075364_10053351 | |||
| 1902 | Ga0075364_10138910 | |||
| 1903 | Ga0075432_10005138 | |||
| 1904 | Ga0070715_10000687 | |||
| 1905 | Ga0070715_10004382 | |||
| 1906 | Ga0070716_100003594 | |||
| 1907 | Ga0070716_100003703 | |||
| 1908 | Ga0070716_100045269 | |||
| 1909 | Ga0070712_100002316 | |||
| 1910 | Ga0070712_100014590 | |||
| 1911 | Ga0070712_100122520 | |||
| 1912 | Ga0075362_10000033 | |||
| 1913 | Ga0075362_10015455 | |||
| 1914 | Ga0075367_10000094 | |||
| 1915 | Ga0075367_10001182 | |||
| 1916 | Ga0075367_10012710 | |||
| 1917 | Ga0075367_10054506 | |||
| 1918 | Ga0075367_10064366 | |||
| 1919 | Ga0075369_10018490 | |||
| 1920 | Ga0075369_10031756 | |||
| 1921 | Ga0075427_10000195 | |||
| 1922 | Ga0075366_10000058 | |||
| 1923 | Ga0075366_10037458 | |||
| 1924 | Ga0075366_10130292 | |||
| 1925 | Ga0097621_100001871 | |||
| 1926 | Ga0097621_100041280 | |||
| 1927 | Ga0075370_10000017 | |||
| 1928 | Ga0075370_10005269 | |||
| 1929 | Ga0075370_10105522 | |||
| 1930 | Ga0068871_100000007 | |||
| 1931 | Ga0068871_100036433 | |||
| 1932 | Ga0068871_100081538 | |||
| 1933 | Ga0068871_100082082 | |||
| 1934 | Ga0075430_100008800 | |||
| 1935 | Ga0075430_100014321 | |||
| 1936 | Ga0075431_100216548 | |||
| 1937 | Ga0075433_10012955 | |||
| 1938 | Ga0075433_10061991 | |||
| 1939 | Ga0075434_100000210 | |||
| 1940 | Ga0075434_100000421 | |||
| 1941 | Ga0075434_100021620 | |||
| 1942 | Ga0075434_100079189 | |||
| 1943 | Ga0075429_100101449 | |||
| 1944 | Ga0068865_100003045 | |||
| 1945 | Ga0068865_100020700 | |||
| 1946 | Ga0068865_100077038 | |||
| 1947 | Ga0075436_100048519 | |||
| 1948 | Ga0097620_100003063 | |||
| 1949 | Ga0097620_100352910 | |||
| 1950 | Ga0099826_10007048 | |||
| 1951 | Ga0099826_10028867 | |||
| 1952 | Ga0075435_100048505 | |||
| 1953 | Ga0075435_100180690 | |||
| 1954 | Ga0105251_10013627 | |||
| 1955 | Ga0105244_10019657 | |||
| 1956 | Ga0105250_10064689 | |||
| 1957 | Ga0105240_10003029 | |||
| 1958 | Ga0105240_10049388 | |||
| 1959 | Ga0111539_10000241 | |||
| 1960 | Ga0111539_10004570 | |||
| 1961 | Ga0111539_10070961 | |||
| 1962 | Ga0111539_10135881 | |||
| 1963 | Ga0105245_10000801 | |||
| 1964 | Ga0105245_10003072 | |||
| 1965 | Ga0105245_10030710 | |||
| 1966 | Ga0105247_10004748 | |||
| 1967 | Ga0105247_10094059 | |||
| 1968 | Ga0105247_10160323 | |||
| 1969 | Ga0114129_10773858 | |||
| 1970 | Ga0105243_10008450 | |||
| 1971 | Ga0105243_10011070 | |||
| 1972 | Ga0105243_10111752 | |||
| 1973 | Ga0105241_10008483 | |||
| 1974 | Ga0105241_10261664 | |||
| 1975 | Ga0105242_10001026 | |||
| 1976 | Ga0105242_10022111 | |||
| 1977 | Ga0105242_10029851 | |||
| 1978 | Ga0105248_10001294 | |||
| 1979 | Ga0105248_10077985 | |||
| 1980 | Ga0105248_10178563 | |||
| 1981 | Ga0105237_10017910 | |||
| 1982 | Ga0105237_10035878 | |||
| 1983 | Ga0105237_10056759 | |||
| 1984 | Ga0105238_10015395 | |||
| 1985 | Ga0105238_10205797 | |||
| 1986 | Ga0105238_10257327 | |||
| 1987 | Ga0105249_10000318 | |||
| 1988 | Ga0105249_10091463 | |||
| 1989 | Ga0123341_1000014 | |||
| 1990 | Ga0123342_1023821 | |||
| 1991 | Ga0105028_107499 | |||
| 1992 | Ga0105239_10001966 | |||
| 1993 | Ga0105239_10014516 | |||
| 1994 | Ga0105239_10064546 | |||
| 1995 | Ga0157325_1000593 | |||
| 1996 | Ga0157341_1000378 | |||
| 1997 | Ga0157345_1003304 | |||
| 1998 | Ga0157373_10005714 | |||
| 1999 | Ga0157371_10000002 | |||
| 2000 | Ga0157371_10006511 | |||
| 2001 | Ga0157370_10000246 | |||
| 2002 | Ga0157369_10001922 | |||
| 2003 | Ga0157369_10313793 | |||
| 2004 | Ga0157374_10004984 | |||
| 2005 | Ga0157374_10203519 | |||
| 2006 | Ga0157378_10002119 | |||
| 2007 | Ga0157378_10029322 | |||
| 2008 | Ga0157378_10259760 | |||
| 2009 | Ga0157378_10439018 | |||
| 2010 | Ga0163162_10000416 | |||
| 2011 | Ga0157372_10068690 | |||
| 2012 | Ga0157372_10138256 | |||
| 2013 | Ga0157375_10000571 | |||
| 2014 | Ga0157375_10080768 | |||
| 2015 | Ga0157375_10268094 | |||
| 2016 | Ga0157375_10296683 | |||
| 2017 | Ga0163163_10000673 | |||
| 2018 | Ga0163163_10036260 | |||
| 2019 | Ga0163163_10101226 | |||
| 2020 | Ga0163163_10171559 | |||
| 2021 | Ga0163163_10531914 | |||
| 2022 | Ga0157380_10000115 | |||
| 2023 | Ga0157377_10000086 | |||
| 2024 | Ga0157379_10003187 | |||
| 2025 | Ga0157379_10155762 | |||
| 2026 | Ga0157376_10000253 | |||
| 2027 | Ga0157376_10106694 | |||
| 2028 | Ga0163161_10000920 | |||
| 2029 | Ga0206356_10536735 | |||
| 2030 | Ga0206350_11580286 | |||
| 2031 | Ga0206350_11586057 | |||
| 2032 | Ga0213876_10017170 | |||
| 2033 | Ga0213876_10071469 | |||
| 2034 | Ga0224712_10023711 | |||
| 2035 | Ga0224712_10035954 | |||
| 2036 | Ga0209435_100005 | |||
| 2037 | Ga0209436_100027 | |||
| 2038 | Ga0207425_1003001 | |||
| 2039 | Ga0209646_1000011 | |||
| 2040 | Ga0209026_1000008 | |||
| 2041 | Ga0209026_1000041 | |||
| 2042 | Ga0209759_1000004 | |||
| 2043 | Ga0209759_1000280 | |||
| 2044 | Ga0209129_1000473 | |||
| 2045 | Ga0209129_1001033 | |||
| 2046 | Ga0209129_1004322 | |||
| 2047 | Ga0207666_1000007 | |||
| 2048 | Ga0209455_1012807 | |||
| 2049 | Ga0209673_1000037 | |||
| 2050 | Ga0209130_1000030 | |||
| 2051 | Ga0207673_1000390 | |||
| 2052 | Ga0209675_1010227 | |||
| 2053 | Ga0209676_1000089 | |||
| 2054 | Ga0209676_1017817 | |||
| 2055 | Ga0209025_1000255 | |||
| 2056 | Ga0209025_1010020 | |||
| 2057 | Ga0209564_1005953 | |||
| 2058 | Ga0209758_1001044 | |||
| 2059 | Ga0209758_1001658 | |||
| 2060 | Ga0209758_1002926 | |||
| 2061 | Ga0209256_1000979 | |||
| 2062 | Ga0209256_1011568 | |||
| 2063 | Ga0207426_1000047 | |||
| 2064 | Ga0209051_1001326 | |||
| 2065 | Ga0209257_1005895 | |||
| 2066 | Ga0209257_1016134 | |||
| 2067 | Ga0207697_10000083 | |||
| 2068 | Ga0207697_10002626 | |||
| 2069 | Ga0207682_10000002 | |||
| 2070 | Ga0207682_10002152 | |||
| 2071 | Ga0207692_10000961 | |||
| 2072 | Ga0207692_10006269 | |||
| 2073 | Ga0207692_10025380 | |||
| 2074 | Ga0207642_10044243 | |||
| 2075 | Ga0207642_10141900 | |||
| 2076 | Ga0207710_10009324 | |||
| 2077 | Ga0207710_10042160 | |||
| 2078 | Ga0207688_10000102 | |||
| 2079 | Ga0207680_10108725 | |||
| 2080 | Ga0207680_10300556 | |||
| 2081 | Ga0207647_10002077 | |||
| 2082 | Ga0207647_10012505 | |||
| 2083 | Ga0207685_10034188 | |||
| 2084 | Ga0207685_10047203 | |||
| 2085 | Ga0207699_10001084 | |||
| 2086 | Ga0207699_10017204 | |||
| 2087 | Ga0207699_10036297 | |||
| 2088 | Ga0207699_10108732 | |||
| 2089 | Ga0207645_10000026 | |||
| 2090 | Ga0207645_10013020 | |||
| 2091 | Ga0207643_10000003 | |||
| 2092 | Ga0207705_10069331 | |||
| 2093 | Ga0207684_10216660 | |||
| 2094 | Ga0207654_10000446 | |||
| 2095 | Ga0207654_10023803 | |||
| 2096 | Ga0207707_10000915 | |||
| 2097 | Ga0207707_10005780 | |||
| 2098 | Ga0207707_10008611 | |||
| 2099 | Ga0207707_10049361 | |||
| 2100 | Ga0207707_10126732 | |||
| 2101 | Ga0207707_10268717 | |||
| 2102 | Ga0207707_10364185 | |||
| 2103 | Ga0207695_10000343 | |||
| 2104 | Ga0207695_10032281 | |||
| 2105 | Ga0207671_10019670 | |||
| 2106 | Ga0207671_10109418 | |||
| 2107 | Ga0207671_10132090 | |||
| 2108 | Ga0207671_10306597 | |||
| 2109 | Ga0207693_10001056 | |||
| 2110 | Ga0207693_10002909 | |||
| 2111 | Ga0207693_10005106 | |||
| 2112 | Ga0207663_10000274 | |||
| 2113 | Ga0207663_10015670 | |||
| 2114 | Ga0207663_10019351 | |||
| 2115 | Ga0207663_10031939 | |||
| 2116 | Ga0207663_10046550 | |||
| 2117 | Ga0207663_10064818 | |||
| 2118 | Ga0207660_10000070 | |||
| 2119 | Ga0207660_10165236 | |||
| 2120 | Ga0207662_10000297 | |||
| 2121 | Ga0207662_10024049 | |||
| 2122 | Ga0207657_10000840 | |||
| 2123 | Ga0207657_10012080 | |||
| 2124 | Ga0207657_10043719 | |||
| 2125 | Ga0207657_10254291 | |||
| 2126 | Ga0207649_10000054 | |||
| 2127 | Ga0207649_10077345 | |||
| 2128 | Ga0207652_10000059 | |||
| 2129 | Ga0207652_10023605 | |||
| 2130 | Ga0207652_10042066 | |||
| 2131 | Ga0207652_10160138 | |||
| 2132 | Ga0207652_10179672 | |||
| 2133 | Ga0207652_10337463 | |||
| 2134 | Ga0207681_10000118 | |||
| 2135 | Ga0207681_10009906 | |||
| 2136 | Ga0207694_10000136 | |||
| 2137 | Ga0207694_10021745 | |||
| 2138 | Ga0207694_10192704 | |||
| 2139 | Ga0207694_10341004 | |||
| 2140 | Ga0207659_10000015 | |||
| 2141 | Ga0207659_10099537 | |||
| 2142 | Ga0207687_10000050 | |||
| 2143 | Ga0207687_10002145 | |||
| 2144 | Ga0207687_10015596 | |||
| 2145 | Ga0207687_10016045 | |||
| 2146 | Ga0207687_10199566 | |||
| 2147 | Ga0207700_10001567 | |||
| 2148 | Ga0207700_10013014 | |||
| 2149 | Ga0207700_10017266 | |||
| 2150 | Ga0207700_10061388 | |||
| 2151 | Ga0207664_10000795 | |||
| 2152 | Ga0207664_10013721 | |||
| 2153 | Ga0207664_10024515 | |||
| 2154 | Ga0207664_10516375 | |||
| 2155 | Ga0207644_10010053 | |||
| 2156 | Ga0207644_10016159 | |||
| 2157 | Ga0207644_10156266 | |||
| 2158 | Ga0207690_10000146 | |||
| 2159 | Ga0207690_10040654 | |||
| 2160 | Ga0207706_10001170 | |||
| 2161 | Ga0207706_10039134 | |||
| 2162 | Ga0207706_10051076 | |||
| 2163 | Ga0207706_10063883 | |||
| 2164 | Ga0207706_10084816 | |||
| 2165 | Ga0207686_10000256 | |||
| 2166 | Ga0207686_10017361 | |||
| 2167 | Ga0207686_10225615 | |||
| 2168 | Ga0207709_10000081 | |||
| 2169 | Ga0207709_10028842 | |||
| 2170 | Ga0207670_10000073 | |||
| 2171 | Ga0207670_10031416 | |||
| 2172 | Ga0207670_10116648 | |||
| 2173 | Ga0207670_10198557 | |||
| 2174 | Ga0207669_10000008 | |||
| 2175 | Ga0207704_10000031 | |||
| 2176 | Ga0207704_10100525 | |||
| 2177 | Ga0207665_10001785 | |||
| 2178 | Ga0207665_10287420 | |||
| 2179 | Ga0207691_10000251 | |||
| 2180 | Ga0207691_10003899 | |||
| 2181 | Ga0207691_10019452 | |||
| 2182 | Ga0207711_10000478 | |||
| 2183 | Ga0207711_10053792 | |||
| 2184 | Ga0207689_10000040 | |||
| 2185 | Ga0207661_10000474 | |||
| 2186 | Ga0207661_10009245 | |||
| 2187 | Ga0207661_10032176 | |||
| 2188 | Ga0207661_10199928 | |||
| 2189 | Ga0207679_10000014 | |||
| 2190 | Ga0207679_10033347 | |||
| 2191 | Ga0207667_10007058 | |||
| 2192 | Ga0207667_10015138 | |||
| 2193 | Ga0207667_10016134 | |||
| 2194 | Ga0207667_10021163 | |||
| 2195 | Ga0207651_10000317 | |||
| 2196 | Ga0207651_10004930 | |||
| 2197 | Ga0207651_10024053 | |||
| 2198 | Ga0207651_10134937 | |||
| 2199 | Ga0207712_10000777 | |||
| 2200 | Ga0207712_10028119 | |||
| 2201 | Ga0207712_10063145 | |||
| 2202 | Ga0207668_10000037 | |||
| 2203 | Ga0207668_10047449 | |||
| 2204 | Ga0207668_10381967 | |||
| 2205 | Ga0207640_10000444 | |||
| 2206 | Ga0207640_10008462 | |||
| 2207 | Ga0207640_10242906 | |||
| 2208 | Ga0207658_10001424 | |||
| 2209 | Ga0207658_10068384 | |||
| 2210 | Ga0207677_10000644 | |||
| 2211 | Ga0207703_10006289 | |||
| 2212 | Ga0207703_10037457 | |||
| 2213 | Ga0207703_10047188 | |||
| 2214 | Ga0207703_10202929 | |||
| 2215 | Ga0207639_10001125 | |||
| 2216 | Ga0207639_10200661 | |||
| 2217 | Ga0207639_10275770 | |||
| 2218 | Ga0207639_10308420 | |||
| 2219 | Ga0207678_10000733 | |||
| 2220 | Ga0207678_10011487 | |||
| 2221 | Ga0207678_10037394 | |||
| 2222 | Ga0207678_10056682 | |||
| 2223 | Ga0207678_10084239 | |||
| 2224 | Ga0207678_10092114 | |||
| 2225 | Ga0207678_10304548 | |||
| 2226 | Ga0207708_10000368 | |||
| 2227 | Ga0207708_10102704 | |||
| 2228 | Ga0207708_10137873 | |||
| 2229 | Ga0207708_10344312 | |||
| 2230 | Ga0207702_10000006 | |||
| 2231 | Ga0207702_10001585 | |||
| 2232 | Ga0207702_10006198 | |||
| 2233 | Ga0207702_10105924 | |||
| 2234 | Ga0207702_10134084 | |||
| 2235 | Ga0207702_10205016 | |||
| 2236 | Ga0207641_10000272 | |||
| 2237 | Ga0207648_10000516 | |||
| 2238 | Ga0207676_10001948 | |||
| 2239 | Ga0207676_10011986 | |||
| 2240 | Ga0207676_10109088 | |||
| 2241 | Ga0207674_10000555 | |||
| 2242 | Ga0207674_10010489 | |||
| 2243 | Ga0207674_10085545 | |||
| 2244 | Ga0207675_100000404 | |||
| 2245 | Ga0207675_100015706 | |||
| 2246 | Ga0207675_100121919 | |||
| 2247 | Ga0207675_100529937 | |||
| 2248 | Ga0207683_10000002 | |||
| 2249 | Ga0207683_10000604 | |||
| 2250 | Ga0207683_10013200 | |||
| 2251 | Ga0207683_10094882 | |||
| 2252 | Ga0207698_10000161 | |||
| 2253 | Ga0209371_1003111 | |||
| 2254 | Ga0209981_1009065 | |||
| 2255 | Ga0209982_1003813 | |||
| 2256 | Ga0210002_1000129 | |||
| 2257 | Ga0210002_1015742 | |||
| 2258 | Ga0209282_1002848 | |||
| 2259 | Ga0209966_1002955 | |||
| 2260 | Ga0209998_10001707 | |||
| 2261 | Ga0209998_10002315 | |||
| 2262 | Ga0209813_10000083 | |||
| 2263 | Ga0209813_10000290 | |||
| 2264 | Ga0209813_10003140 | |||
| 2265 | Ga0209813_10023718 | |||
| 2266 | Ga0209974_10006626 | |||
| 2267 | Ga0207428_10000011 | |||
| 2268 | Ga0207428_10000046 | |||
| 2269 | Ga0207428_10000243 | |||
| 2270 | Ga0207428_10000528 | |||
| 2271 | Ga0207428_10201795 | |||
| 2272 | Ga0268266_10008059 | |||
| 2273 | Ga0268266_10013020 | |||
| 2274 | Ga0268266_10029581 | |||
| 2275 | Ga0268266_10033998 | |||
| 2276 | Ga0268266_10039941 | |||
| 2277 | Ga0268266_10116545 | |||
| 2278 | Ga0268266_10224435 | |||
| 2279 | Ga0268266_10345042 | |||
| 2280 | Ga0268265_10000476 | |||
| 2281 | Ga0268265_10119494 | |||
| 2282 | Ga0268264_10001522 | |||
| 2283 | Ga0268264_10001990 | |||
| 2284 | Ga0268264_10085770 | |||
| 2285 | Ga0268264_10307864 | |||
| 2286 | Ga0265318_10038810 | |||
| 2287 | Ga0265318_10077429 | |||
| 2288 | Ga0307517_10003697 | |||
| 2289 | Ga0307515_10030919 | |||
| 2290 | Ga0268256_1012181 | |||
| 2291 | Ga0265330_10035468 | |||
| 2292 | Ga0265330_10071854 | |||
| 2293 | Ga0265328_10007797 | |||
| 2294 | Ga0265325_10013127 | |||
| 2295 | Ga0265329_10010306 | |||
| 2296 | Ga0265340_10000591 | |||
| 2297 | Ga0265340_10056622 | |||
| 2298 | Ga0265340_10153960 | |||
| 2299 | Ga0265339_10007606 | |||
| 2300 | Ga0265339_10031863 | |||
| 2301 | Ga0265339_10044250 | |||
| 2302 | Ga0265331_10004247 | |||
| 2303 | Ga0265331_10034148 | |||
| 2304 | Ga0265331_10104705 | |||
| 2305 | Ga0307509_10183095 | |||
| 2306 | Ga0307509_10314563 | |||
| 2307 | Ga0307408_100011770 | |||
| 2308 | Ga0265313_10003665 | |||
| 2309 | Ga0265313_10025679 | |||
| 2310 | Ga0265313_10031928 | |||
| 2311 | Ga0265313_10043034 | |||
| 2312 | Ga0307508_10000012 | |||
| 2313 | Ga0307508_10026843 | |||
| 2314 | Ga0316576_10052520 | |||
| 2315 | Ga0307516_10078690 | |||
| 2316 | Ga0307406_10109041 | |||
| 2317 | Ga0307414_10081837 | |||
| 2318 | Ga0307415_100304210 | |||
| 2319 | Ga0307507_10008246 | |||
| 2320 | Ga0307510_10090238 | |||
| 2321 | Ga0373930_0000029 | |||
| 2322 | Ga0373930_0016918 | |||
| 2323 | Ga0373948_0000456 | |||
| 2324 | Ga0373948_0002914 | |||
| 2325 | Ga0373950_0002464 | |||
| 2326 | Ga0373950_0025434 | |||
| 2327 | Ga0373959_0000650 | |||
| 2328 | Ga0373938_0000070 | |||
| 2329 | Ga0373938_0026291 | |||
| 2330 | Ga0373926_0004276 | |||
| 2331 | Ga0373928_0001986 | |||
| 2332 | Ga0373929_0000468 | |||
| 2333 | Ga0373934_0007043 | |||
| 2334 | Ga0373934_0040665 | |||
| 2335 | Ga0373949_0002572 | |||
| 2336 | Ga0373951_0001808 | |||
| 2337 | Ga0373952_0006538 | |||
| 2338 | Ga0373952_0015118 | |||
| 2339 | Ga0373923_0020925 | |||
| 2340 | Ga0373923_0020927 | |||
| 2341 | Ga0373932_0000208 | |||
| 2342 | Ga0373932_0046868 | |||
| 2343 | Ga0373936_0000626 | |||
| 2344 | Ga0373939_0079777 | |||
| 2345 | Ga0373941_0000926 | |||
| 2346 | Ga0373941_0009756 | |||
| 2347 | Ga0373945_0014152 | |||
| 2348 | Ga0373953_0008179 | |||
| 2349 | Ga0373953_0014407 | |||
| 2350 | Ga0373953_0019316 | |||
| 2351 | Ga0373954_0010431 | |||
| 2352 | Ga0373954_0029460 | |||
| 2353 | Ga0373954_0048212 | |||
| 2354 | Ga0373956_0002974 | |||
| 2355 | Ga0373956_0025777 | |||
| 2356 | Ga0373956_0115687 | |||
| 2357 | Ga0373957_0001098 | |||
| 2358 | Ga0373957_0029743 | |||
| 2359 | Ga0373957_0069364 | |||
| 2360 | Ga0373960_0000295 | |||
| 2361 | Ga0373960_0002031 | |||
| 2362 | Ga0373943_0065550 | |||
| 2363 | Ga0373946_0008942 | |||
| 2364 | Ga0373946_0011594 | |||
| 2365 | Ga0373955_0001515 | |||
| 2366 | Ga0373955_0011995 | |||
| 2367 | Ga0373955_0014469 | |||
| 2368 | Ga0373942_0000210 | |||
| 2369 | Ga0373962_0001251 | |||
| 2370 | Ga0373962_0039684 | |||
| 2371 | Ga0316574_0016912 | |||
| 2372 | Ga0373924_0053476 | |||
| 2373 | Ga0373924_0055660 | |||
| 2374 | Ga0373924_0089141 | |||
| 2375 | Ga0373931_0000081 | |||
| 2376 | Ga0373931_0000704 | |||
| 2377 | Ga0373931_0037654 | |||
| 2378 | Ga0373931_0063118 | |||
| 2379 | Ga0373935_0000150 | |||
| 2380 | Ga0373935_0062219 | |||
| 2381 | Ga0373935_0178587 | |||
| 2382 | Ga0373927_0000046 | |||
| 2383 | Ga0373927_0006298 | |||
| 2384 | Ga0373927_0010430 | |||
| 2385 | Ga0373927_0053378 | |||
| 2386 | Ga0373933_0000026 | |||
| 2387 | Ga0373933_0078461 | |||
| 2388 | Ga0373947_0001546 | |||
| 2389 | Ga0373947_0010765 | |||
| 2390 | Ga0373947_0075394 | |||
| 2391 | Ga0373937_0008776 | |||
| 2392 | Ga0373937_0036359 | |||
| 2393 | Ga0373937_0065027 | |||
| 2394 | Ga0373937_0078347 | |||
| 2395 | Ga0373937_0121472 | |||
| 2396 | Ga0373937_0143680 | |||
| 2397 | Ga0373925_0002696 | |||
| 2398 | Ga0373925_0059565 | |||
| 2399 | Ga0373925_0064165 | |||
| 2400 | Ga0373925_0084355 | |||
| 2401 | Ga0373925_0126683 | |||
| 2402 | Ga0373925_0143702 | |||
| 2403 | Ga0373925_0177906 | |||
| 2404 | Ga0373925_0209890 | |||
| 2405 | Ga0395900_0050037 | |||
| 2406 | Ga0395900_0056032 | |||
| 2407 | Ga0395898_0031545 | |||
| 2408 | Ga0395898_0176278 | |||
| 2409 | Ga0436364_1559478 | |||
| 2410 | Ga0395901_0148801 | |||
| 2411 | Ga0395901_0219919 | |||
| 2412 | Ga0436365_0317546 | |||
| 2413 | Ga0436365_1039862 | |||
| 2414 | Ga0436363_1290357 | |||
| 2415 | Ga0451846_46569 | |||
| 2416 | Ga0451855_1209298 | |||
| 2417 | Ga0451853_0214194 | |||
| 2418 | Ga0439463_006751 | |||
| 2419 | Ga0439434_0021545 | |||
| 2420 | Ga0466961_0174753 | |||
| 2421 | Ga0466963_0091441 | |||
| 2422 | Ga0453684_0073915 | |||
| 2423 | Ga0451576_0018612 | |||
| 2424 | Ga0451576_0045272 | |||
| 2425 | Ga0495617_007274 | |||
| 2426 | Ga0495592_0001895 | |||
| 2427 | Ga0495592_0015850 | |||
| 2428 | Ga0495592_0035747 | |||
| 2429 | Ga0495592_0050556 | |||
| 2430 | Ga0495603_0000136 | |||
| 2431 | Ga0495603_0072623 | |||
| 2432 | Ga0495629_0000182 | |||
| 2433 | Ga0495629_0000448 | |||
| 2434 | Ga0495629_0091194 | |||
| 2435 | Ga0495638_0154874 | |||
| 2436 | Ga0495641_0005083 | |||
| 2437 | Ga0495641_0026201 | |||
| 2438 | Ga0495641_0073382 | |||
| 2439 | Ga0495641_0113525 | |||
| 2440 | Ga0495651_0003639 | |||
| 2441 | Ga0495651_0016160 | |||
| 2442 | Ga0495651_0041772 | |||
| 2443 | Ga0495651_0094021 | |||
| 2444 | Ga0495653_0001478 | |||
| 2445 | Ga0495653_0046802 | |||
| 2446 | Ga0495580_0000235 | |||
| 2447 | Ga0495580_0012185 | |||
| 2448 | Ga0495582_0000357 | |||
| 2449 | Ga0495582_0012756 | |||
| 2450 | Ga0495582_0035879 | |||
| 2451 | Ga0495639_0000047 | |||
| 2452 | Ga0495662_0000129 | |||
| 2453 | Ga0495662_0011278 | |||
| 2454 | Ga0495662_0018119 | |||
| 2455 | Ga0495664_0004106 | |||
| 2456 | Ga0495664_0014176 | |||
| 2457 | Ga0495664_0014348 | |||
| 2458 | Ga0495664_0016235 | |||
| 2459 | Ga0495664_0040882 | |||
| 2460 | Ga0495584_0022415 | |||
| 2461 | Ga0495584_0053978 | |||
| 2462 | Ga0495584_0097490 | |||
| 2463 | Ga0495585_0002406 | |||
| 2464 | Ga0495594_0000464 | |||
| 2465 | Ga0495594_0025323 | |||
| 2466 | Ga0495594_0026696 | |||
| 2467 | Ga0495607_0015659 | |||
| 2468 | Ga0495606_0005081 | |||
| 2469 | Ga0495608_0075118 | |||
| 2470 | Ga0495608_0076185 | |||
| 2471 | Ga0495608_0076792 | |||
| 2472 | Ga0495616_0133385 | |||
| 2473 | Ga0495618_0044289 | |||
| 2474 | Ga0495618_0073190 | |||
| 2475 | Ga0495618_0078271 | |||
| 2476 | Ga0495620_0062137 | |||
| 2477 | Ga0495628_0006013 | |||
| 2478 | Ga0495628_0023433 | |||
| 2479 | Ga0495628_0207229 | |||
| 2480 | Ga0495630_0000501 | |||
| 2481 | Ga0495630_0023036 | |||
| 2482 | Ga0495630_0264284 | |||
| 2483 | Ga0495632_0053408 | |||
| 2484 | Ga0495644_0007902 | |||
| 2485 | Ga0495648_0002081 | |||
| 2486 | Ga0495666_0012697 | |||
| 2487 | Ga0495666_0019714 | |||
| 2488 | Ga0495652_0007988 | |||
| 2489 | Ga0495652_0055838 | |||
| 2490 | Ga0495652_0078955 | |||
| 2491 | Ga0495652_0093683 | |||
| 2492 | Ga0495665_0000230 | |||
| 2493 | Ga0495665_0017331 | |||
| 2494 | Ga0495665_0120296 | |||
| 2495 | Ga0495640_0000178 | |||
| 2496 | Ga0495640_0010630 | |||
| 2497 | Ga0495640_0024841 | |||
| 2498 | Ga0495640_0045870 | |||
| 2499 | Ga0495586_0127390 | |||
| 2500 | Ga0495587_0002711 | |||
| 2501 | Ga0495587_0034023 | |||
| 2502 | Ga0495587_0034435 | |||
| 2503 | Ga0495609_0055458 | |||
| 2504 | Ga0495621_0001814 | |||
| 2505 | Ga0495621_0035579 | |||
| 2506 | Ga0495597_0042259 | |||
| 2507 | Ga0495645_0021563 | |||
| 2508 | Ga0495645_0022818 | |||
| 2509 | Ga0495622_0041671 | |||
| 2510 | Ga0495667_0001312 | |||
| 2511 | Ga0495667_0005667 | |||
| 2512 | Ga0495667_0008306 | |||
| 2513 | Ga0495667_0081157 | |||
| 2514 | Ga0495667_0101513 | |||
| 2515 | Ga0495656_0003299 | |||
| 2516 | Ga0495668_0068546 | |||
| 2517 | Ga0495668_0115477 | |||
| 2518 | Ga0495634_0000680 | |||
| 2519 | Ga0495634_0018249 | |||
| 2520 | Ga0495611_0009169 | |||
| 2521 | Ga0495625_0025675 | |||
| 2522 | Ga0495625_0098654 | |||
| 2523 | Ga0495635_0000838 | |||
| 2524 | Ga0495635_0001125 | |||
| 2525 | Ga0495635_0002189 | |||
| 2526 | Ga0495635_0028070 | |||
| 2527 | Ga0495635_0033969 | |||
| 2528 | Ga0495635_0052626 | |||
| 2529 | Ga0495659_0005560 | |||
| 2530 | Ga0495659_0021940 | |||
| 2531 | Ga0495661_0106265 | |||
| 2532 | Ga0495588_0002925 | |||
| 2533 | Ga0495588_0004961 | |||
| 2534 | Ga0495588_0005562 | |||
| 2535 | Ga0495588_0018416 | |||
| 2536 | Ga0495588_0086330 | |||
| 2537 | Ga0495599_0039773 | |||
| 2538 | Ga0495599_0075781 | |||
| 2539 | Ga0495599_0101715 | |||
| 2540 | Ga0495599_0104399 | |||
| 2541 | Ga0495623_0001957 | |||
| 2542 | Ga0495646_0006971 | |||
| 2543 | Ga0495646_0007674 | |||
| 2544 | Ga0495646_0021061 | |||
| 2545 | Ga0495646_0026044 | |||
| 2546 | Ga0495647_0000171 | |||
| 2547 | Ga0495647_0036449 | |||
| 2548 | Ga0495647_0038535 | |||
| 2549 | Ga0495658_0000062 | |||
| 2550 | Ga0495658_0003963 | |||
| 2551 | Ga0495658_0011623 | |||
| 2552 | Ga0495613_0006197 | |||
| 2553 | Ga0495613_0008760 | |||
| 2554 | Ga0495613_0016392 | |||
| 2555 | Ga0495613_0069764 | |||
| 2556 | Ga0495613_0151521 | |||
| 2557 | Ga0495624_0000361 | |||
| 2558 | Ga0495624_0015889 | |||
| 2559 | Ga0495624_0024874 | |||
| 2560 | Ga0495670_0001263 | |||
| 2561 | Ga0495589_0043138 | |||
| 2562 | Ga0495600_0000776 | |||
| 2563 | Ga0495600_0042482 | |||
| 2564 | Ga0495600_0054516 | |||
| 2565 | Ga0495581_0000006 | |||
| 2566 | Ga0495581_0129976 | |||
| 2567 | Ga0495581_0141787 | |||
| 2568 | Ga0495604_0008160 | |||
| 2569 | Ga0495604_0016032 | |||
| 2570 | Ga0495604_0099631 | |||
| 2571 | Ga0495674_0000380 | |||
| 2572 | Ga0495674_0009717 | |||
| 2573 | Ga0495674_0056470 | |||
| 2574 | Ga0495674_0102156 | |||
| 2575 | Ga0495674_0106007 | |||
| 2576 | Ga0495672_0009744 | |||
| 2577 | Ga0495672_0021807 | |||
| 2578 | Ga0495676_0051834 | |||
| 2579 | Ga0495676_0287181 | |||
| 2580 | Ga0495680_0005450 | |||
| 2581 | Ga0495680_0008238 | |||
| 2582 | Ga0495675_0004525 | |||
| 2583 | Ga0495675_0007735 | |||
| 2584 | Ga0495684_0000101 | |||
| 2585 | Ga0495684_0006082 | |||
| 2586 | Ga0495684_0019497 | |||
| 2587 | Ga0495686_0046544 | |||
| 2588 | Ga0495686_0144020 | |||
| 2589 | Ga0495593_0000129 | |||
| 2590 | Ga0495593_0004354 | |||
| 2591 | Ga0495593_0012341 | |||
| 2592 | Ga0495602_0004530 | |||
| 2593 | Ga0495602_0032021 | |||
| 2594 | Ga0495614_0019615 | |||
| 2595 | Ga0496100_0000297 | |||
| 2596 | Ga0496100_0066314 | |||
| 2597 | Ga0496101_0000061 | |||
| 2598 | Ga0496101_0001222 | |||
| 2599 | Ga0496101_0015279 | |||
| 2600 | Ga0496101_0078430 | |||
| 2601 | Ga0496102_0000516 | |||
| 2602 | Ga0496102_0015726 | |||
| 2603 | Ga0496102_0020099 | |||
| 2604 | Ga0496102_0056390 | |||
| 2605 | Ga0496102_0086303 | |||
| 2606 | Ga0496102_0174177 | |||
| 2607 | Ga0496102_0244402 | |||
| 2608 | Ga0496102_0255113 | |||
| 2609 | Ga0496103_0007287 | |||
| 2610 | Ga0496104_0026144 | |||
| 2611 | Ga0496104_0043693 | |||
| 2612 | Ga0496104_0070262 | |||
| 2613 | Ga0496104_0084419 | |||
| 2614 | Ga0496104_0099524 | |||
| 2615 | Ga0496104_0381296 | |||
| 2616 | Ga0496105_0018252 | |||
| 2617 | Ga0496105_0046141 | |||
| 2618 | Ga0496105_0059913 | |||
| 2619 | Ga0496105_0094067 | |||
| 2620 | Ga0496106_0000690 | |||
| 2621 | Ga0496106_0004749 | |||
| 2622 | Ga0496106_0014549 | |||
| 2623 | Ga0496106_0039893 | |||
| 2624 | Ga0496106_0050026 | |||
| 2625 | Ga0496106_0056914 | |||
| 2626 | Ga0496106_0084280 | |||
| 2627 | Ga0496106_0232783 | |||
| 2628 | Ga0496107_0000308 | |||
| 2629 | Ga0496107_0002940 | |||
| 2630 | Ga0496107_0022548 | |||
| 2631 | Ga0496107_0047503 | |||
| 2632 | Ga0496108_0001212 | |||
| 2633 | Ga0496108_0001769 | |||
| 2634 | Ga0496108_0005567 | |||
| 2635 | Ga0496108_0080557 | |||
| 2636 | Ga0496108_0460058 | |||
| 2637 | Ga0496109_0000530 | |||
| 2638 | Ga0496109_0000928 | |||
| 2639 | Ga0496109_0002514 | |||
| 2640 | Ga0496109_0058647 | |||
| 2641 | Ga0496109_0091579 | |||
| 2642 | Ga0496109_0241931 | |||
| 2643 | Ga0496110_0020945 | |||
| 2644 | Ga0496110_0025171 | |||
| 2645 | Ga0496110_0039419 | |||
| 2646 | Ga0496110_0049472 | |||
| 2647 | Ga0496110_0114052 | |||
| 2648 | Ga0496110_0141474 | |||
| 2649 | Ga0496110_0290169 | |||
| 2650 | Ga0496111_0005963 | |||
| 2651 | Ga0496111_0014004 | |||
| 2652 | Ga0496112_0000029 | |||
| 2653 | Ga0496112_0002053 | |||
| 2654 | Ga0496112_0022716 | |||
| 2655 | Ga0496112_0038268 | |||
| 2656 | Ga0496112_0109524 | |||
| 2657 | Ga0496112_0544642 | |||
| 2658 | Ga0496113_0000122 | |||
| 2659 | Ga0496113_0030089 | |||
| 2660 | Ga0496113_0049390 | |||
| 2661 | Ga0496113_0055120 | |||
| 2662 | Ga0496113_0168131 | |||
| 2663 | Ga0496114_0002170 | |||
| 2664 | Ga0496114_0513896 | |||
| 2665 | Ga0496115_0010562 | |||
| 2666 | Ga0496115_0022185 | |||
| 2667 | Ga0496115_0028962 | |||
| 2668 | Ga0496115_0059068 | |||
| 2669 | Ga0496115_0124807 | |||
| 2670 | Ga0496115_0143772 | |||
| 2671 | Ga0496116_0068461 | |||
| 2672 | Ga0496117_0000052 | |||
| 2673 | Ga0496117_0025706 | |||
| 2674 | Ga0496117_0054886 | |||
| 2675 | Ga0496118_0000709 | |||
| 2676 | Ga0496119_0019638 | |||
| 2677 | Ga0496119_0135929 | |||
| 2678 | Ga0496120_0000019 | |||
| 2679 | Ga0496120_0006319 | |||
| 2680 | Ga0496121_0000003 | |||
| 2681 | Ga0496121_0000265 | |||
| 2682 | Ga0496121_0001149 | |||
| 2683 | Ga0496121_0011060 | |||
| 2684 | Ga0496121_0011669 | |||
| 2685 | Ga0496121_0033989 | |||
| 2686 | Ga0496121_0034284 | |||
| 2687 | Ga0496121_0044665 | |||
| 2688 | Ga0496121_0058309 | |||
| 2689 | Ga0496121_0124365 | |||
| 2690 | Ga0496121_0130628 | |||
| 2691 | Ga0496122_0000053 | |||
| 2692 | Ga0496123_0000038 | |||
| 2693 | Ga0496124_0000139 | |||
| 2694 | Ga0496124_0001146 | |||
| 2695 | Ga0496124_0006736 | |||
| 2696 | Ga0496124_0203521 | |||
| 2697 | Ga0496125_0000170 | |||
| 2698 | Ga0496125_0039828 | |||
| 2699 | Ga0496125_0086798 | |||
| 2700 | Ga0496125_0208477 | |||
| 2701 | Ga0496126_0007573 | |||
| 2702 | Ga0496126_0144509 | |||
| 2703 | Ga0495678_070814 | |||
| 2704 | Ga0501031_0000141 | |||
| 2705 | Ga0501031_0000891 | |||
| 2706 | Ga0501031_0066820 | |||
| 2707 | Ga0501031_0279214 | |||
| 2708 | Ga0501032_0000044 | |||
| 2709 | Ga0501032_0000301 | |||
| 2710 | Ga0501032_0007000 | |||
| 2711 | Ga0501032_0013677 | |||
| 2712 | Ga0501032_0020334 | |||
| 2713 | Ga0501032_0144240 | |||
| 2714 | Ga0501033_0000052 | |||
| 2715 | Ga0501033_0000207 | |||
| 2716 | Ga0501033_0011287 | |||
| 2717 | Ga0501033_0034080 | |||
| 2718 | Ga0501033_0037395 | |||
| 2719 | Ga0501033_0311197 | |||
| 2720 | Ga0501034_0000212 | |||
| 2721 | Ga0501034_0000715 | |||
| 2722 | Ga0501034_0046718 | |||
| 2723 | Ga0501034_0048417 | |||
| 2724 | Ga0501034_0127828 | |||
| 2725 | Ga0501034_0174502 | |||
| 2726 | Ga0501036_0000022 | |||
| 2727 | Ga0501036_0000043 | |||
| 2728 | Ga0501036_0006071 | |||
| 2729 | Ga0501036_0019013 | |||
| 2730 | Ga0501036_0051317 | |||
| 2731 | Ga0501036_0068219 | |||
| 2732 | Ga0501037_0000052 | |||
| 2733 | Ga0501037_0000263 | |||
| 2734 | Ga0501037_0000334 | |||
| 2735 | Ga0501038_0000044 | |||
| 2736 | Ga0501038_0000131 | |||
| 2737 | Ga0501038_0006199 | |||
| 2738 | Ga0501038_0013266 | |||
| 2739 | Ga0501038_0061236 | |||
| 2740 | Ga0501039_0000042 | |||
| 2741 | Ga0501039_0000106 | |||
| 2742 | Ga0501039_0012857 | |||
| 2743 | Ga0501039_0052858 | |||
| 2744 | Ga0501039_0076835 | |||
| 2745 | Ga0501039_0197258 | |||
| 2746 | Ga0501040_0001439 | |||
| 2747 | Ga0501040_0008487 | |||
| 2748 | Ga0501041_0162943 | |||
| 2749 | Ga0501042_0041907 | |||
| 2750 | Ga0501042_0042227 | |||
| 2751 | Ga0501042_0139073 | |||
| 2752 | Ga0501043_0000054 | |||
| 2753 | Ga0501043_0000074 | |||
| 2754 | Ga0501043_0010375 | |||
| 2755 | Ga0501043_0020610 | |||
| 2756 | Ga0501043_0033107 | |||
| 2757 | Ga0501043_0035799 | |||
| 2758 | Ga0501043_0048766 | |||
| 2759 | Ga0501043_0050854 | |||
| 2760 | Ga0501046_0000074 | |||
| 2761 | Ga0501046_0005430 | |||
| 2762 | Ga0501046_0020680 | |||
| 2763 | Ga0501046_0079562 | |||
| 2764 | Ga0501047_0000247 | |||
| 2765 | Ga0501047_0000301 | |||
| 2766 | Ga0501047_0126914 | |||
| 2767 | Ga0501047_0144915 | |||
| 2768 | Ga0501047_0172420 | |||
| 2769 | Ga0501048_0000738 | |||
| 2770 | Ga0501048_0027450 | |||
| 2771 | Ga0501048_0084729 | |||
| 2772 | Ga0501067_0000669 | |||
| 2773 | Ga0501067_0038123 | |||
| 2774 | Ga0501067_0061079 | |||
| 2775 | Ga0501067_0098537 | |||
| 2776 | Ga0501068_0003978 | |||
| 2777 | Ga0501069_0001738 | |||
| 2778 | Ga0501070_0011820 | |||
| 2779 | Ga0501070_0021638 | |||
| 2780 | Ga0501070_0022479 | |||
| 2781 | Ga0501070_0045389 | |||
| 2782 | Ga0501070_0070113 | |||
| 2783 | Ga0501070_0097224 | |||
| 2784 | Ga0501070_0271656 | |||
| 2785 | Ga0501072_0003050 | |||
| 2786 | Ga0501072_0089520 | |||
| 2787 | Ga0501073_0000287 | |||
| 2788 | Ga0501073_0001905 | |||
| 2789 | Ga0501074_0000657 | |||
| 2790 | Ga0501074_0008715 | |||
| 2791 | Ga0501074_0061641 | |||
| 2792 | Ga0501074_0066795 | |||
| 2793 | Ga0501074_0121804 | |||
| 2794 | Ga0501074_0215672 | |||
| 2795 | Ga0501076_0061043 | |||
| 2796 | Ga0501211_001780 | |||
| 2797 | Ga0501079_0011966 | |||
| 2798 | Ga0501079_0232205 | |||
| 2799 | Ga0501080_0001211 | |||
| 2800 | Ga0501080_0028354 | |||
| 2801 | Ga0501080_0078495 | |||
| 2802 | Ga0501080_0189631 | |||
| 2803 | Ga0501080_0471445 | |||
| 2804 | Ga0501081_0064474 | |||
| 2805 | Ga0501083_0001289 | |||
| 2806 | Ga0501083_0017102 | |||
| 2807 | Ga0501035_0000095 | |||
| 2808 | Ga0501035_0000484 | |||
| 2809 | Ga0501035_0002159 | |||
| 2810 | Ga0501035_0008707 | |||
| 2811 | Ga0501035_0015132 | |||
| 2812 | Ga0501035_0074337 | |||
| 2813 | Ga0501044_0000091 | |||
| 2814 | Ga0501044_0000667 | |||
| 2815 | Ga0501044_0010408 | |||
| 2816 | Ga0501044_0022920 | |||
| 2817 | Ga0501044_0035929 | |||
| 2818 | Ga0501044_0059155 | |||
| 2819 | Ga0501044_0071244 | |||
| 2820 | Ga0501044_0144428 | |||
| 2821 | Ga0501044_0229735 | |||
| 2822 | Ga0501045_0020082 | |||
| 2823 | Ga0501045_0027102 | |||
| 2824 | nmdc:mga03683_244_c1 | |||
| 2825 | nmdc:mga03683_3298_c1 | |||
| 2826 | nmdc:mga03683_366_c1 | |||
| 2827 | nmdc:mga03683_58051_c1 | |||
| 2828 | nmdc:mga03n38_270_c1 | |||
| 2829 | nmdc:mga03n38_28603_c1 | |||
| 2830 | nmdc:mga03n38_8007_c1 | |||
| 2831 | nmdc:mga00v17_107792_c1 | |||
| 2832 | nmdc:mga00v17_55_c1 | |||
| 2833 | nmdc:mga00v17_67909_c1 | |||
| 2834 | nmdc:mga00v17_90606_c1 | |||
| 2835 | nmdc:mga00v17_92367_c1 | |||
| 2836 | nmdc:mga0yw44_21423_c1 | |||
| 2837 | nmdc:mga0yw44_25940_c1 | |||
| 2838 | nmdc:mga0yw44_56882_c1 | |||
| 2839 | nmdc:mga0yw44_96611_c1 | |||
| 2840 | nmdc:mga0k408_5503_c1 | |||
| 2841 | nmdc:mga0k408_7_c1 | |||
| 2842 | nmdc:mga06z11_148247_c1 | |||
| 2843 | nmdc:mga06z11_4631_c1 | |||
| 2844 | nmdc:mga06z11_60093_c1 | |||
| 2845 | nmdc:mga06z11_6169_c1 | |||
| 2846 | nmdc:mga06z11_9_c1 | |||
| 2847 | nmdc:mga04h51_12_c1 | |||
| 2848 | nmdc:mga04h51_225_c1 | |||
| 2849 | nmdc:mga04h51_5734_c1 | |||
| 2850 | nmdc:mga07m45_15264_c1 | |||
| 2851 | nmdc:mga07m45_3_c1 | |||
| 2852 | nmdc:mga07m45_4_c1 | |||
| 2853 | nmdc:mga07m45_54310_c1 | |||
| 2854 | nmdc:mga07m45_84947_c2 | |||
| 2855 | nmdc:mga07m45_8904_c1 | |||
| 2856 | nmdc:mga05p37_3518_c1 | |||
| 2857 | nmdc:mga05p37_37170_c1 | |||
| 2858 | nmdc:mga09592_2329_c1 | |||
| 2859 | nmdc:mga0qj67_103_c1 | |||
| 2860 | nmdc:mga0qj67_655_c1 | |||
| 2861 | nmdc:mga06r32_13402_c1 | |||
| 2862 | nmdc:mga08y16_1572_c1 | |||
| 2863 | nmdc:mga08y16_337239_c1 | |||
| 2864 | nmdc:mga08y16_74572_c1 | |||
| 2865 | nmdc:mga0n895_104674_c1 | |||
| 2866 | nmdc:mga0n895_1438_c1 | |||
| 2867 | nmdc:mga0n895_27420_c1 | |||
| 2868 | nmdc:mga0n895_5378_c1 | |||
| 2869 | nmdc:mga0n895_7229_c1 | |||
| 2870 | nmdc:mga0rr50_108888_c1 | |||
| 2871 | nmdc:mga0rr50_109439_c1 | |||
| 2872 | nmdc:mga0rr50_56019_c1 | |||
| 2873 | nmdc:mga0a205_51064_c1 | |||
| 2874 | nmdc:mga0sz30_32_c1 | |||
| 2875 | nmdc:mga0sz30_425_c1 | |||
| 2876 | Ga0495601_0001725 | |||
| 2877 | Ga0495601_0002113 | |||
| 2878 | Ga0495601_0037839 | |||
| 2879 | Ga0495601_0066576 | |||
| 2880 | Ga0495601_0113687 | |||
| 2881 | Ga0495612_0002354 | |||
| 2882 | Ga0495612_0002553 | |||
| 2883 | Ga0495612_0014479 | |||
| 2884 | Ga0500635_0006560 | |||
| 2885 | Ga0495595_0010295 | |||
| 2886 | Ga0495595_0069315 | |||
| 2887 | Ga0495619_0000992 | |||
| 2888 | Ga0495619_0004603 | |||
| 2889 | Ga0495619_0176079 | |||
| 2890 | Ga0500643_018712 | |||
| 2891 | Ga0500643_024110 | |||
| 2892 | Ga0500647_0041554 | |||
| 2893 | Ga0500583_0028000 | |||
| 2894 | Ga0500651_0002902 | |||
| 2895 | Ga0500566_0026250 | |||
| 2896 | Ga0500641_0001073 | |||
| 2897 | Ga0500554_019071 | |||
| 2898 | Ga0500562_038733 | |||
| 2899 | Ga0500572_000446 | |||
| 2900 | Ga0500595_000262 | |||
| 2901 | Ga0500595_002787 | |||
| 2902 | Ga0500595_017382 | |||
| 2903 | Ga0500607_000048 | |||
| 2904 | Ga0500607_011224 | |||
| 2905 | Ga0500652_000019 | |||
| 2906 | Ga0500559_0000103 | |||
| 2907 | Ga0500559_0001130 | |||
| 2908 | Ga0500559_0003016 | |||
| 2909 | Ga0500568_0010565 | |||
| 2910 | Ga0500568_0084030 | |||
| 2911 | Ga0500603_000157 | |||
| 2912 | Ga0500616_0000046 | |||
| 2913 | Ga0500622_0005284 | |||
| 2914 | Ga0500627_0065853 | |||
| 2915 | Ga0500627_0130154 | |||
| 2916 | Ga0500634_0032954 | |||
| 2917 | Ga0500636_0000005 | |||
| 2918 | Ga0500637_0008800 | |||
| 2919 | Ga0500637_0010141 | |||
| 2920 | Ga0500637_0067957 | |||
| 2921 | Ga0500637_0092542 | |||
| 2922 | Ga0500645_028070 | |||
| 2923 | Ga0501084_0016960 | |||
| 2924 | Ga0501084_0026556 | |||
| 2925 | Ga0501084_0220410 | |||
| 2926 | Ga0587082_022046 | |||
| 2927 | Ga0587083_0021410 | |||
| 2928 | Ga0587083_0027968 | |||
| 2929 | Ga0587090_000544 | |||
| 2930 | Ga0587067_013279 | |||
| 2931 | Ga0501082_0028479 | |||
| 2932 | Ga0501082_0089704 | |||
| 2933 | Ga0501082_0129046 | |||
| 2934 | Ga0501082_0242474 | |||
| 2935 | 2509142277 | |||
| 2936 | 2509148238 | |||
| 2937 | 2509369982 | |||
| 2938 | 2509394361 | |||
| 2939 | 2510134726 | |||
| 2940 | 2510317946 | |||
| 2941 | 2510896075 | |||
| 2942 | 2511200178 | |||
| 2943 | 2512037184 | |||
| 2944 | 2513573223 | |||
| 2945 | 2513599112 | |||
| 2946 | 2513610246 | |||
| 2947 | 2513631436 | |||
| 2948 | 2513638220 | |||
| 2949 | 2513867547 | |||
| 2950 | 2514023739 | |||
| 2951 | 2514417748 | |||
| 2952 | 2515113815 | |||
| 2953 | 2515656898 | |||
| 2954 | 2517037428 | |||
| 2955 | 2517410624 | |||
| 2956 | 2524465366 | |||
| 2957 | 2524610809 | |||
| 2958 | 2535519555 | |||
| 2959 | 2537876430 | |||
| 2960 | 2554245220 | |||
| 2961 | 2559296950 | |||
| 2962 | 2585224908 | |||
| 2963 | 2585392334 | |||
| 2964 | 2585541131 | |||
| 2965 | 2585547464 | |||
| 2966 | 2585839894 | |||
| 2967 | 2585845211 | |||
| 2968 | 2588514045 | |||
| 2969 | 2597811521 | |||
| 2970 | 2599604640 | |||
| 2971 | 2599722510 | |||
| 2972 | 2599941000 | |||
| 2973 | 2600373747 | |||
| 2974 | 2601611203 | |||
| 2975 | 2601747976 | |||
| 2976 | 2616295445 | |||
| 2977 | 2643916944 | |||
| 2978 | 2644289930 | |||
| 2979 | 2644496285 | |||
| 2980 | 2644521192 | |||
| 2981 | 2688596709 | |||
| 2982 | 2694634113 | |||
| 2983 | 2694638449 | |||
| 2984 | 2719182493 | |||
| 2985 | 2719666797 | |||
| 2986 | 2719733212 | |||
| 2987 | 2720493217 | |||
| 2988 | 2720614692 | |||
| 2989 | 2720632793 | |||
| 2990 | 2720776517 | |||
| 2991 | 2721148606 | |||
| 2992 | 2721165420 | |||
| 2993 | 2722841590 | |||
| 2994 | 2723028105 | |||
| 2995 | 2723561736 | |||
| 2996 | 2723568365 | |||
| 2997 | 2723573812 | |||
| 2998 | 2724045968 | |||
| 2999 | 2724091124 | |||
| 3000 | 2724105630 | |||
| 3001 | 2724111458 | |||
| 3002 | 2725947713 | |||
| 3003 | 2730109041 | |||
| 3004 | 2730165728 | |||
| 3005 | 2738800572 | |||
| 3006 | 2756674120 | |||
| 3007 | 2778175902 | |||
| 3008 | 2792750578 | |||
| 3009 | 2793313172 | |||
| 3010 | 2793319833 | |||
| 3011 | 2793343793 | |||
| 3012 | 2793347265 | |||
| 3013 | 2793362940 | |||
| 3014 | 2806044671 | |||
| 3015 | 2806052871 | |||
| 3016 | 2806059171 | |||
| 3017 | 2806068166 | |||
| 3018 | 2806074286 | |||
| 3019 | 2808989090 | |||
| 3020 | 2819685569 | |||
| 3021 | 2838018993 | |||
| 3022 | 2838024407 | |||
| 3023 | 2838046365 | |||
| 3024 | 2838051290 | |||
| 3025 | 2838063733 | |||
| 3026 | 2838074301 | |||
| 3027 | 2838678243 | |||
| 3028 | 2838716851 | |||
| 3029 | 2838722539 | |||
| 3030 | 2838727600 | |||
| 3031 | 2841737138 | |||
| 3032 | 2841849206 | |||
| 3033 | 2841861723 | |||
| 3034 | 2842128045 | |||
| 3035 | 2842133136 | |||
| 3036 | 2842155130 | |||
| 3037 | 2842173629 | |||
| 3038 | 2842178751 | |||
| 3039 | 2842189958 | |||
| 3040 | 2842197791 | |||
| 3041 | 2842199950 | |||
| 3042 | 2842214272 | |||
| 3043 | 2842226991 | |||
| 3044 | 2842266499 | |||
| 3045 | 2842316192 | |||
| 3046 | 2842398645 | |||
| 3047 | 2842427925 | |||
| 3048 | 2842429818 | |||
| 3049 | 2842436522 | |||
| 3050 | 2842444225 | |||
| 3051 | 2842464239 | |||
| 3052 | 2842470851 | |||
| 3053 | 2842518011 | |||
| 3054 | 2844009361 | |||
| 3055 | 2844011961 | |||
| 3056 | 2847674473 | |||
| 3057 | 2847690602 | |||
| 3058 | 2854900344 | |||
| 3059 | 2854913154 | |||
| 3060 | 2854920175 | |||
| 3061 | 2856317611 | |||
| 3062 | 2856329581 | |||
| 3063 | 2856338212 | |||
| 3064 | 2856349055 | |||
| 3065 | 2856352974 | |||
| 3066 | 2856366585 | |||
| 3067 | 2857356735 | |||
| 3068 | 2857371542 | |||
| 3069 | 2869163659 | |||
| 3070 | 2869171003 | |||
| 3071 | 2869239641 | |||
| 3072 | 2869245912 | |||
| 3073 | 2869251180 | |||
| 3074 | 2869263252 | |||
| 3075 | 2869265431 | |||
| 3076 | 2869275538 | |||
| 3077 | 2869288004 | |||
| 3078 | 2871429891 | |||
| 3079 | 2871438790 | |||
| 3080 | 2871451027 | |||
| 3081 | 2871453408 | |||
| 3082 | 2871462177 | |||
| 3083 | 2871468439 | |||
| 3084 | 2871478594 | |||
| 3085 | 2871489178 | |||
| 3086 | 2874106685 | |||
| 3087 | 2874113372 | |||
| 3088 | 2874120158 | |||
| 3089 | 2874128664 | |||
| 3090 | 2874131993 | |||
| 3091 | 2874151637 | |||
| 3092 | 2874159269 | |||
| 3093 | 2874166794 | |||
| 3094 | 2874175883 | |||
| 3095 | 2876370363 | |||
| 3096 | 2876380052 | |||
| 3097 | 2876391491 | |||
| 3098 | 2876406220 | |||
| 3099 | 2876412621 | |||
| 3100 | 2876417688 | |||
| 3101 | 2876427550 | |||
| 3102 | 2878038669 | |||
| 3103 | 2878749515 | |||
| 3104 | 2878754652 | |||
| 3105 | 2878779015 | |||
| 3106 | 2878786369 | |||
| 3107 | 2878795973 | |||
| 3108 | 2881149255 | |||
| 3109 | 2881160492 | |||
| 3110 | 2881856419 | |||
| 3111 | 2881861930 | |||
| 3112 | 2882638248 | |||
| 3113 | 2882915012 | |||
| 3114 | 2885313400 | |||
| 3115 | 2885321391 | |||
| 3116 | 2885344564 | |||
| 3117 | 2885351520 | |||
| 3118 | 2885386200 | |||
| 3119 | 2888345095 | |||
| 3120 | 2888354301 | |||
| 3121 | 2889018937 | |||
| 3122 | 2894653973 | |||
| 3123 | 2899792811 | |||
| 3124 | 2899845452 | |||
| 3125 | 2903493745 | |||
| 3126 | 2903495865 | |||
| 3127 | 2903518931 | |||
| 3128 | 2906310553 | |||
| 3129 | 2906324617 | |||
| 3130 | 2906333417 | |||
| 3131 | 2906365626 | |||
| 3132 | 2906372863 | |||
| 3133 | 2906393511 | |||
| 3134 | 2906398274 | |||
| 3135 | 2906406069 | |||
| 3136 | 2906411610 | |||
| 3137 | 2906417676 | |||
| 3138 | 2906428659 | |||
| 3139 | 2915654232 | |||
| 3140 | 2919117042 | |||
| 3141 | 2922131232 | |||
| 3142 | 2922151535 | |||
| 3143 | 2922163744 | |||
| 3144 | 2922174749 | |||
| 3145 | 2922182238 | |||
| 3146 | 2922190125 | |||
| 3147 | 2923558897 | |||
| 3148 | 2924716296 | |||
| 3149 | 2924728264 | |||
| 3150 | 2924738374 | |||
| 3151 | 2924747257 | |||
| 3152 | 2924748475 | |||
| 3153 | 2924760621 | |||
| 3154 | 2924768370 | |||
| 3155 | 2924790317 | |||
| 3156 | 2926758555 | |||
| 3157 | 2926763913 | |||
| 3158 | 2929141303 | |||
| 3159 | 2933009491 | |||
| 3160 | 2933013640 | |||
| 3161 | 2933598118 | |||
| 3162 | 2933604757 | |||
| 3163 | 2936382153 | |||
| 3164 | 2937817381 | |||
| 3165 | 2937828236 | |||
| 3166 | 2937837383 | |||
| 3167 | 2937863224 | |||
| 3168 | 2937876936 | |||
| 3169 | 2937895561 | |||
| 3170 | 2937985789 | |||
| 3171 | 2958073417 | |||
| 3172 | 2958105368 | |||
| 3173 | 2958110929 | |||
| 3174 | 2958116017 | |||
| 3175 | 2958124350 | |||
| 3176 | 2958132407 | |||
| 3177 | 2958141470 | |||
| 3178 | 2958163673 | |||
| 3179 | 2958178318 | |||
| 3180 | 2958182221 | |||
| 3181 | 2961080065 | |||
| 3182 | 2961134563 | |||
| 3183 | 2961141699 | |||
| 3184 | 2961171254 | |||
| 3185 | 2961183891 | |||
| 3186 | 2965025534 | |||
| 3187 | 2965036531 | |||
| 3188 | 2965046410 | |||
| 3189 | 2965049161 | |||
| 3190 | 2965062359 | |||
| 3191 | 2965089302 | |||
| 3192 | 2965103618 | |||
| 3193 | 2967996241 | |||
| 3194 | 2968004476 | |||
| 3195 | 2968091567 | |||
| 3196 | 2968097449 | |||
| 3197 | 2968123383 | |||
| 3198 | 2968133463 | |||
| 3199 | 2968145308 | |||
| 3200 | 2970491244 | |||
| 3201 | 2970503851 | |||
| 3202 | 2970514458 | |||
| 3203 | 2970526825 | |||
| 3204 | 2970539899 | |||
| 3205 | 2970542961 | |||
| 3206 | 2970551264 | |||
| 3207 | 2970625870 | |||
| 3208 | 2970631649 | |||
| 3209 | 2977823869 | |||
| 3210 | 2977831051 | |||
| 3211 | 2977847667 | |||
| 3212 | 2977856305 | |||
| 3213 | 2977863159 | |||
| 3214 | 2977871143 | |||
| 3215 | 2977874734 | |||
| 3216 | 2977903947 | |||
| 3217 | 2977913077 | |||
| 3218 | 2977922127 | |||
| 3219 | 2977935874 | |||
| 3220 | 2977942939 | |||
| 3221 | 2977952707 | |||
| 3222 | 2977958859 | |||
| 3223 | 2977974643 | |||
| 3224 | 2979090989 | |||
| 3225 | 2979096515 | |||
| 3226 | 2979711911 | |||
| 3227 | 2979748617 | |||
| 3228 | 2979769509 | |||
| 3229 | 2979775628 | |||
| 3230 | 2979783307 | |||
| 3231 | 2979794520 | |||
| 3232 | 2979808484 | |||
| 3233 | 2987644016 | |||
| 3234 | 2987647838 | |||
| 3235 | 2987671656 | |||
| 3236 | 2987680420 | |||
| 3237 | 2996339922 | |||
| 3238 | 2996343843 | |||
| 3239 | 2996390465 | |||
| 3240 | 2996890537 | |||
| 3241 | 2996895929 | |||
| 3242 | 3004174064 | |||
| 3243 | 3004200374 | |||
| 3244 | 3004208165 | |||
| 3245 | 3004217568 | |||
| 3246 | 3004219915 | |||
| 3247 | 3004234667 | |||
| 3248 | 3004241665 | |||
| 3249 | 3004273844 | |||
| 3250 | 3005415611 | |||
| 3251 | 3005449157 | |||
| 3252 | 649871264 | |||
| 3253 | 650843370 | |||
| 3254 | 8003572967 | |||
| 3255 | 8004303373 | |||
| 3256 | 8004366216 | |||
| 3257 | 8004376232 | |||
| 3258 | 8004389791 | |||
| 3259 | 8004400573 | |||
| 3260 | 8004450923 | |||
| 3261 | 8004635015 | |||
| 3262 | 8004645655 | |||
| 3263 | 8004696880 | |||
| 3264 | 8004704383 | |||
| 3265 | 8004718188 | |||
| 3266 | 8004729944 | |||
| 3267 | 8005264344 | |||
| 3268 | 8005288872 | |||
| 3269 | 8005306790 | |||
| 3270 | 8005325064 | |||
| 3271 | 8005434237 | |||
| 3272 | 8005464502 | |||
| 3273 | 8005501543 | |||
| 3274 | 8005547252 | |||
| 3275 | 8005558501 | |||
| 3276 | 8005566655 | |||
| 3277 | 8005575057 | |||
| 3278 | 8005622905 | |||
| 3279 | 8005631795 | |||
| 3280 | 8005672964 | |||
| 3281 | 8005693514 | |||
| 3282 | 8005700730 | |||
| 3283 | 8006992999 | |||
| 3284 | 8018133728 | |||
| 3285 | 8018170099 | |||
| 3286 | 8024481666 | |||
| 3287 | 8054463373 | |||
| 3288 | 8055618671 | |||
| 3289 | 8056675331 | |||
| 3290 | 8056692063 | |||
| 3291 | 8057577508 | |||
| 3292 | 8057876705 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3doc-assembly1.cif.gz_A | crystal structure of trka glyceraldehyde-3-phosphate dehydrogenase from brucella melitensis | 0.9923 | 1 | 335 |
| 3l0d-assembly1.cif.gz_A | crystal structure of glyceraldehyde-3-phosphate dehydrogenase from bartonella henselae with bound nad | 0.9898 | 1 | 335 |
| 3l0d-assembly1.cif.gz_A | crystal structure of glyceraldehyde-3-phosphate dehydrogenase from bartonella henselae with bound nad | 0.9869 | 1 | 335 |
| 3dbv-assembly1.cif.gz_O | glyceraldehyde-3-phosphate dehydrogenase mutant with leu 33 replaced by thr, thr 34 replaced by gly, asp 36 replaced by gly, leu 187 replaced by ala, and pro 188 replaced by ser complexed with nad+ | 0.9833 | 2 | 333 |
| 1dbv-assembly1.cif.gz_O | glyceraldehyde-3-phosphate dehydrogenase mutant with asp 32 replaced by gly, leu 187 replaced by ala, and pro 188 replaced by ser complexed with nad+ | 0.9812 | 2 | 334 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A9B6_1_155_3.30.360.10 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.9826 | 1 | 153 | 3.30.360.10 |
| 4dibE02 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.98 | 152 | 316 | 3.30.360.10 |
| 4dibE02 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.9737 | 152 | 316 | 3.30.360.10 |
| af_Q9FX54_7_269_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9686 | 4 | 264 | 3.40.50.720 |
| af_F1M004_3_96_3.30.360.10 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.9684 | 236 | 316 | 3.30.360.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-I3RJH9-F1-model_v4 | Glyceraldehyde-3-phosphate dehydrogenase | 0.9994 | 242 | 328 |
GO:0016620
|
| AF-A0A357V737-F1-model_v4 | Erythrose-4-phosphate dehydrogenase (EC 1.2.1.12) | 0.9987 | 234 | 322 |
GO:0004365
|
| AF-A5Z1X9-F1-model_v4 | Chloroplast glyceraldehyde-3-phosphate dehydrogenase | 0.9972 | 237 | 318 |
GO:0016620
|
| AF-A0A6I5PFP5-F1-model_v4 | deleted | 0.9959 | 234 | 328 |
|
| AF-A0A348MSG3-F1-model_v4 | deleted | 0.9954 | 1 | 134 |
|