F495133

General Info

Members Datasets Scaffolds Average Seq Length
1631 462 1613 362

Family's Representative Sequence

Representative Sequence 3300049576|Ga0501040_0015481|Ga0501040_0015481_2255_3532
Length 425
Sequence LNHVSDRGPRIQLSLAIQKHFSGGGRRTAAADPVILFSVKRVRVGVLYGGRSGEHEVSLASAAAVIANLDRTRYEPVAIRIDKDGRWGLAERAPTASSAAEVIEQARLEAARPSRSGREVHLVARPSEETILAIDRGSRRGEIDAGQVIVTGMNLDVIFPVLHGPYGEDGTIQGLLELANVPYVGAGVLPSAVGMDKALMKVVFAASSLPVCPYRAFLRREWNGRRDDLVRELVAVLGFPMFVKPANLGSSVGISKAKDAAALAGAIDLAGSFDRKIVVEAAVPEAREIECAVLGNDDPAASVPGEVVPSREFYDYEAKYLDEGSRTIIPAELPPATTAEIQRLAIASFQAIDCAGMARIDFLLSRSSGAIFVNEVNTIPGFTTISMYSKLWAASGLAYPELLDRLIGLAFERHAEKQQLRTSVS

Samples

Sample ID Description Type Environment
1 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
2 2738543024 Aminobacter sp. AP02 Isolate Unclassified
3 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
4 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
5 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
6 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
7 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
8 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
9 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
10 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
11 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
12 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
13 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
14 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
15 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
16 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
17 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
18 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
20 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
21 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
22 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
23 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
26 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
27 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
42 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
43 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
48 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
49 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
50 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
51 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
52 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
53 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
54 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
55 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
56 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
57 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
58 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
59 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
60 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
61 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
62 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
63 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
64 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
65 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
66 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
67 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
68 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
69 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
70 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
71 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
72 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
73 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
74 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
75 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
76 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
77 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
78 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
79 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
80 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
81 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
82 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
83 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
84 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
85 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
86 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
87 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
88 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
89 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
90 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
91 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
92 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
93 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
94 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
95 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
96 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
97 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
98 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
99 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
100 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
101 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
102 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
103 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
104 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
105 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
106 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
107 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
108 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
109 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
110 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
111 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
112 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
113 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
114 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
116 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
117 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
118 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
119 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
120 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
121 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
122 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
123 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
124 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
125 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
126 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
127 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
128 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
129 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
130 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
131 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
132 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
133 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
134 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
135 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
136 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
137 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
138 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
139 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
140 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
141 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
142 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
143 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
144 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
145 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
146 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
147 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
148 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
149 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
150 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
151 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
152 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
153 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
154 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
155 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
156 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
157 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
158 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
159 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
160 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
223 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
227 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
228 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
229 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
230 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
231 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
232 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
233 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
234 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
235 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
236 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
238 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
239 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
240 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
241 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
242 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
243 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
244 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
245 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
246 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
247 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
248 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
249 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
250 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
251 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
252 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
253 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
254 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
255 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
256 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
257 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
258 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
259 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
260 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
261 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
262 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
263 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
264 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
265 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
266 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
267 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
269 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
270 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
271 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
272 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
273 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
274 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
275 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
276 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
277 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
278 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
279 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
280 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
281 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
282 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
283 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
284 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
285 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
286 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
287 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
288 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
289 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
290 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
291 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
292 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
293 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
294 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
295 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
296 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
297 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
298 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
299 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
300 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
301 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
302 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
303 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
304 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
305 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
306 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
307 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
308 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
309 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
310 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
311 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
312 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
313 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
314 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
315 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
316 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
317 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
318 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
319 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
320 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
321 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
322 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
323 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
324 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
325 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
326 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
327 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
328 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
329 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
330 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
331 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
332 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
333 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
334 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
335 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
336 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
337 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
338 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
339 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
340 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
341 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
342 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
343 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
344 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
345 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
346 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
347 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
348 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
349 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
350 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
351 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
352 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
353 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
354 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
355 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
356 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
357 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
358 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
359 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
360 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
361 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
362 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
363 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
364 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
365 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
366 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
367 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
368 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
369 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
370 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
371 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
372 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
373 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
374 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
375 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
376 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
377 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
378 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
379 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
380 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
381 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
382 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
383 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
384 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
385 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
386 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
387 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
388 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
389 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
390 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
393 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
394 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
395 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
396 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
397 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
398 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
399 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
400 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
401 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
403 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
404 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
405 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
406 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
407 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
408 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
409 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
410 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
411 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
412 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
413 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
414 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
415 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
416 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
417 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
418 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
419 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
420 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
421 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
422 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
423 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
424 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
425 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
426 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
427 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
428 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
429 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
430 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
431 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
432 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
433 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
434 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
435 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
436 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
437 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
438 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
439 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
440 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
441 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
442 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
443 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
444 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
445 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
446 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
447 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
448 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
449 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
450 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
451 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
452 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
453 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
454 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
455 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
456 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
457 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
458 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
459 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
460 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
461 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
462 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.41
Metatranscriptomes 0.49
Isolates 1.1

Biome Distribution

Category Percentage (%)
Aerial Root 0.06
Bulb 0
Endosphere 3.13
Nodule 0.06
Rhizoplane 3.86
Rhizosphere 89.21
Stem 0
Stem Tuber 0
Unclassified 3.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10015159 3300002077 Bacteria 1542
2 JGI25406J46586_10001453 3300003203 Bacteria 11169
3 JGI25406J46586_10002115 3300003203 Bacteria 9373
4 JGI25406J46586_10003867 3300003203 Bacteria 7001
5 JGI25406J46586_10020800 3300003203 Bacteria 2645
6 rootH1_10003792 3300003316 Bacteria 7262
7 rootH1_10015730 3300003316 Bacteria 1731
8 rootH1_10130565 3300003316 Bacteria 1965
9 rootH2_10029474 3300003320 Bacteria 14064
10 rootH2_10077888 3300003320 Unclassified 3554
11 rootH2_10246637 3300003320 Unclassified 1691
12 rootL2_10072383 3300003322 Bacteria 19068
13 rootL2_10147111 3300003322 Bacteria 14666
14 rootL2_10218153 3300003322 Unclassified 3063
15 rootH1_10000715 3300003323 Bacteria 71212
16 rootH1_10017154 3300003323 Bacteria 13652
17 rootH1_10038814 3300003323 Bacteria 11585
18 rootH1_10052808 3300003323 Bacteria 5340
19 rootH1_10072353 3300003323 Bacteria 9071
20 rootH1_10074058 3300003323 Bacteria 8116
21 rootH1_10271435 3300003323 Bacteria 3399
22 rootH1_10309830 3300003323 Unclassified 3417
23 JGI25407J50210_10001911 3300003373 Bacteria 4834
24 Ga0055531_10000197 3300003794 Bacteria 66822
25 Ga0065704_10090251 3300005289 Bacteria 2801
26 Ga0065712_10000291 3300005290 Bacteria 19019
27 Ga0065712_10004042 3300005290 Bacteria 7055
28 Ga0065712_10069922 3300005290 Bacteria 6509
29 Ga0065715_10007485 3300005293 Bacteria 6998
30 Ga0065715_10088927 3300005293 Bacteria 28121
31 Ga0065715_10093813 3300005293 Bacteria 4545
32 Ga0065715_10115116 3300005293 Bacteria 2426
33 Ga0065707_10002597 3300005295 Bacteria 7059
34 Ga0065707_10095335 3300005295 Bacteria 3389
35 Ga0065707_10137250 3300005295 Bacteria 1823
36 Ga0070658_10004558 3300005327 Bacteria 11265
37 Ga0070658_10021319 3300005327 Bacteria 5193
38 Ga0070658_10047664 3300005327 Bacteria 3467
39 Ga0070658_10063213 3300005327 Bacteria 3017
40 Ga0070676_10001001 3300005328 Bacteria 14035
41 Ga0070676_10004892 3300005328 Bacteria 7098
42 Ga0070683_100014524 3300005329 Bacteria 6892
43 Ga0070683_100066029 3300005329 Bacteria 3370
44 Ga0070683_100072617 3300005329 Bacteria 3212
45 Ga0070683_100080888 3300005329 Bacteria 3041
46 Ga0070690_100020399 3300005330 Bacteria 4037
47 Ga0070690_100046269 3300005330 Bacteria 2766
48 Ga0070690_100082498 3300005330 Bacteria 2105
49 Ga0070690_100115957 3300005330 Bacteria 1793
50 Ga0070670_100002473 3300005331 Bacteria 15248
51 Ga0070670_100037369 3300005331 Bacteria 4178
52 Ga0070670_100048794 3300005331 Bacteria 3643
53 Ga0070670_100194418 3300005331 Bacteria 1762
54 Ga0070677_10004528 3300005333 Bacteria 4536
55 Ga0070677_10007902 3300005333 Bacteria 3560
56 Ga0070677_10020902 3300005333 Bacteria 2393
57 Ga0070677_10038389 3300005333 Bacteria 1874
58 Ga0068869_100011797 3300005334 Bacteria 5748
59 Ga0068869_100015575 3300005334 Bacteria 5105
60 Ga0068869_100051024 3300005334 Bacteria 3000
61 Ga0068869_100189935 3300005334 Bacteria 1615
62 Ga0070666_10017347 3300005335 Bacteria 4615
63 Ga0070666_10038037 3300005335 Bacteria 3201
64 Ga0070666_10039300 3300005335 Bacteria 3153
65 Ga0070666_10124172 3300005335 Bacteria 1791
66 Ga0070666_10185287 3300005335 Bacteria 1461
67 Ga0070680_100001439 3300005336 Bacteria 17241
68 Ga0070680_100121292 3300005336 Bacteria 2183
69 Ga0070682_100012961 3300005337 Bacteria 4786
70 Ga0070682_100192315 3300005337 Bacteria 1433
71 Ga0068868_100004371 3300005338 Bacteria 9905
72 Ga0068868_100028174 3300005338 Bacteria 4292
73 Ga0068868_100107984 3300005338 Bacteria 2259
74 Ga0068868_100147442 3300005338 Bacteria 1936
75 Ga0070660_100015905 3300005339 Bacteria 5447
76 Ga0070660_100049144 3300005339 Bacteria 3241
77 Ga0070660_100086389 3300005339 Bacteria 2468
78 Ga0070689_100014123 3300005340 Bacteria 5794
79 Ga0070689_100040242 3300005340 Bacteria 3583
80 Ga0070689_100085455 3300005340 Bacteria 2481
81 Ga0070689_100099802 3300005340 Bacteria 2297
82 Ga0070689_100202478 3300005340 Bacteria 1622
83 Ga0070689_100273604 3300005340 Bacteria 1399
84 Ga0070691_10000641 3300005341 Bacteria 13508
85 Ga0070691_10024585 3300005341 Bacteria 2800
86 Ga0070687_100012056 3300005343 Bacteria 3803
87 Ga0070661_100003449 3300005344 Bacteria 10918
88 Ga0070661_100075997 3300005344 Bacteria 2475
89 Ga0070661_100106273 3300005344 Bacteria 2093
90 Ga0070692_10019617 3300005345 Bacteria 3265
91 Ga0070668_100028688 3300005347 Bacteria 4223
92 Ga0070668_100051252 3300005347 Bacteria 3180
93 Ga0070668_100054752 3300005347 Bacteria 3077
94 Ga0070668_100255113 3300005347 Bacteria 1457
95 Ga0070669_100019309 3300005353 Bacteria 4867
96 Ga0070669_100024441 3300005353 Bacteria 4331
97 Ga0070669_100027704 3300005353 Bacteria 4079
98 Ga0070669_100055599 3300005353 Bacteria 2900
99 Ga0070669_100113862 3300005353 Bacteria 2056
100 Ga0070669_100125363 3300005353 Bacteria 1965
101 Ga0070675_100000253 3300005354 Bacteria 34898
102 Ga0070675_100000801 3300005354 Bacteria 22093
103 Ga0070675_100010643 3300005354 Bacteria 7191
104 Ga0070675_100012438 3300005354 Bacteria 6667
105 Ga0070675_100016586 3300005354 Bacteria 5847
106 Ga0070675_100024137 3300005354 Bacteria 4869
107 Ga0070675_100033328 3300005354 Bacteria 4176
108 Ga0070675_100036573 3300005354 Bacteria 3996
109 Ga0070675_100047989 3300005354 Bacteria 3500
110 Ga0070675_100051450 3300005354 Bacteria 3385
111 Ga0070675_100118766 3300005354 Bacteria 2245
112 Ga0070675_100127945 3300005354 Bacteria 2162
113 Ga0070675_100154473 3300005354 Bacteria 1969
114 Ga0070675_100159515 3300005354 Bacteria 1939
115 Ga0070675_100216181 3300005354 Bacteria 1668
116 Ga0070675_100306837 3300005354 Bacteria 1399
117 Ga0070671_100010783 3300005355 Bacteria 7332
118 Ga0070671_100012745 3300005355 Bacteria 6778
119 Ga0070671_100081478 3300005355 Bacteria 2706
120 Ga0070671_100126264 3300005355 Bacteria 2154
121 Ga0070671_100133600 3300005355 Bacteria 2091
122 Ga0070671_100251314 3300005355 Bacteria 1502
123 Ga0070674_100008245 3300005356 Bacteria 6192
124 Ga0070674_100011162 3300005356 Bacteria 5457
125 Ga0070674_100021567 3300005356 Bacteria 4140
126 Ga0070674_100025985 3300005356 Bacteria 3819
127 Ga0070674_100106384 3300005356 Bacteria 2053
128 Ga0070673_100003415 3300005364 Bacteria 9888
129 Ga0070673_100010744 3300005364 Bacteria 6212
130 Ga0070673_100011536 3300005364 Bacteria 6035
131 Ga0070673_100031373 3300005364 Bacteria 3987
132 Ga0070673_100039829 3300005364 Bacteria 3600
133 Ga0070673_100046128 3300005364 Bacteria 3383
134 Ga0070673_100141248 3300005364 Bacteria 2031
135 Ga0070673_100161682 3300005364 Bacteria 1905
136 Ga0070673_100370344 3300005364 Bacteria 1275
137 Ga0070688_100001161 3300005365 Bacteria 13117
138 Ga0070688_100003997 3300005365 Bacteria 7645
139 Ga0070688_100011267 3300005365 Bacteria 4964
140 Ga0070688_100032333 3300005365 Bacteria 3154
141 Ga0070688_100110805 3300005365 Bacteria 1825
142 Ga0070688_100134579 3300005365 Bacteria 1672
143 Ga0070659_100012472 3300005366 Bacteria 6301
144 Ga0070659_100196671 3300005366 Bacteria 1658
145 Ga0070659_100197851 3300005366 Bacteria 1653
146 Ga0070667_100022929 3300005367 Bacteria 5175
147 Ga0070667_100106195 3300005367 Bacteria 2430
148 Ga0070667_100110257 3300005367 Bacteria 2386
149 Ga0070667_100270192 3300005367 Bacteria 1524
150 Ga0070709_10005949 3300005434 Bacteria 6623
151 Ga0070714_100004846 3300005435 Bacteria 10215
152 Ga0070714_100008730 3300005435 Bacteria 7921
153 Ga0070714_100037767 3300005435 Bacteria 4060
154 Ga0070713_100039343 3300005436 Bacteria 3837
155 Ga0070701_10003780 3300005438 Bacteria 6046
156 Ga0070701_10006652 3300005438 Bacteria 4879
157 Ga0070701_10018766 3300005438 Bacteria 3255
158 Ga0070701_10074729 3300005438 Bacteria 1821
159 Ga0070701_10143987 3300005438 Bacteria 1366
160 Ga0070705_100006809 3300005440 Bacteria 5618
161 Ga0070705_100009951 3300005440 Bacteria 4746
162 Ga0070700_100067464 3300005441 Bacteria 2272
163 Ga0070694_100000107 3300005444 Bacteria 40436
164 Ga0070694_100010050 3300005444 Bacteria 5818
165 Ga0070694_100095545 3300005444 Bacteria 2093
166 Ga0070708_100009182 3300005445 Bacteria 7973
167 Ga0070708_100023470 3300005445 Bacteria 5247
168 Ga0070708_100025793 3300005445 Bacteria 5026
169 Ga0070708_100033340 3300005445 Bacteria 4474
170 Ga0070708_100036455 3300005445 Bacteria 4289
171 Ga0070708_100045037 3300005445 Bacteria 3885
172 Ga0070708_100085577 3300005445 Bacteria 2862
173 Ga0070708_100147932 3300005445 Bacteria 2183
174 Ga0070663_100093338 3300005455 Bacteria 2233
175 Ga0070663_100130434 3300005455 Bacteria 1908
176 Ga0070678_100002431 3300005456 Bacteria 10202
177 Ga0070678_100007740 3300005456 Bacteria 6389
178 Ga0070678_100014125 3300005456 Bacteria 5028
179 Ga0070678_100079193 3300005456 Bacteria 2484
180 Ga0070678_100290583 3300005456 Bacteria 1385
181 Ga0070662_100027802 3300005457 Bacteria 3931
182 Ga0070662_100104796 3300005457 Bacteria 2146
183 Ga0070662_100105552 3300005457 Bacteria 2139
184 Ga0070662_100119446 3300005457 Bacteria 2019
185 Ga0070662_100185094 3300005457 Bacteria 1644
186 Ga0070681_10097714 3300005458 Bacteria 2883
187 Ga0070681_10104952 3300005458 Bacteria 2768
188 Ga0070681_10115744 3300005458 Bacteria 2619
189 Ga0070681_10204787 3300005458 Bacteria 1890
190 Ga0070681_10369968 3300005458 Bacteria 1344
191 Ga0068867_100002815 3300005459 Bacteria 12228
192 Ga0068867_100003246 3300005459 Bacteria 11462
193 Ga0068867_100136856 3300005459 Bacteria 1910
194 Ga0070685_10004772 3300005466 Bacteria 6864
195 Ga0070685_10046696 3300005466 Bacteria 2487
196 Ga0070685_10058265 3300005466 Bacteria 2251
197 Ga0070706_100060461 3300005467 Bacteria 3498
198 Ga0070706_100115262 3300005467 Bacteria 2502
199 Ga0070706_100273176 3300005467 Bacteria 1577
200 Ga0070707_100001749 3300005468 Bacteria 20908
201 Ga0070707_100005817 3300005468 Bacteria 11501
202 Ga0070707_100073832 3300005468 Bacteria 3289
203 Ga0070707_100247852 3300005468 Bacteria 1733
204 Ga0070698_100007001 3300005471 Bacteria 12212
205 Ga0070698_100060247 3300005471 Bacteria 3830
206 Ga0070698_100124924 3300005471 Bacteria 2530
207 Ga0070699_100010678 3300005518 Bacteria 7949
208 Ga0070699_100017590 3300005518 Bacteria 6136
209 Ga0070699_100042598 3300005518 Bacteria 3929
210 Ga0070699_100064384 3300005518 Bacteria 3180
211 Ga0070699_100077001 3300005518 Bacteria 2903
212 Ga0070679_100024192 3300005530 Bacteria 5951
213 Ga0070679_100062464 3300005530 Bacteria 3714
214 Ga0070679_100210201 3300005530 Bacteria 1910
215 Ga0070684_100000213 3300005535 Bacteria 40774
216 Ga0070684_100023808 3300005535 Bacteria 5129
217 Ga0070684_100052441 3300005535 Bacteria 3548
218 Ga0070684_100086426 3300005535 Bacteria 2783
219 Ga0070684_100139022 3300005535 Bacteria 2195
220 Ga0070684_100169766 3300005535 Bacteria 1981
221 Ga0070684_100171779 3300005535 Bacteria 1969
222 Ga0070684_100173029 3300005535 Bacteria 1961
223 Ga0070697_100036753 3300005536 Bacteria 3956
224 Ga0070697_100045110 3300005536 Bacteria 3572
225 Ga0070697_100058647 3300005536 Bacteria 3133
226 Ga0070697_100152772 3300005536 Bacteria 1946
227 Ga0070697_100171230 3300005536 Bacteria 1838
228 Ga0068853_100011384 3300005539 Bacteria 7225
229 Ga0068853_100089669 3300005539 Bacteria 2701
230 Ga0068853_100209435 3300005539 Bacteria 1776
231 Ga0070672_100006459 3300005543 Bacteria 7881
232 Ga0070672_100016774 3300005543 Bacteria 5251
233 Ga0070672_100021164 3300005543 Bacteria 4754
234 Ga0070672_100027841 3300005543 Bacteria 4220
235 Ga0070672_100079330 3300005543 Bacteria 2628
236 Ga0070672_100088071 3300005543 Bacteria 2499
237 Ga0070672_100110689 3300005543 Bacteria 2238
238 Ga0070672_100129850 3300005543 Bacteria 2070
239 Ga0070686_100002473 3300005544 Bacteria 10175
240 Ga0070686_100023123 3300005544 Bacteria 3712
241 Ga0070686_100046276 3300005544 Bacteria 2745
242 Ga0070695_100001868 3300005545 Bacteria 11896
243 Ga0070695_100066492 3300005545 Bacteria 2349
244 Ga0070696_100022563 3300005546 Bacteria 4277
245 Ga0070696_100025334 3300005546 Bacteria 4032
246 Ga0070693_100032240 3300005547 Bacteria 2880
247 Ga0070693_100036425 3300005547 Bacteria 2735
248 Ga0070693_100124278 3300005547 Bacteria 1604
249 Ga0070665_100002991 3300005548 Bacteria 18259
250 Ga0070665_100021844 3300005548 Bacteria 6435
251 Ga0070665_100044289 3300005548 Bacteria 4469
252 Ga0070665_100176423 3300005548 Bacteria 2138
253 Ga0070704_100008238 3300005549 Bacteria 6237
254 Ga0070704_100033130 3300005549 Bacteria 3491
255 Ga0068855_100009123 3300005563 Bacteria 11980
256 Ga0068855_100108732 3300005563 Bacteria 3184
257 Ga0068855_100119594 3300005563 Bacteria 3016
258 Ga0068855_100133775 3300005563 Bacteria 2830
259 Ga0068855_100168419 3300005563 Bacteria 2482
260 Ga0068855_100379915 3300005563 Bacteria 1551
261 Ga0070664_100000586 3300005564 Bacteria 27743
262 Ga0070664_100003485 3300005564 Bacteria 12706
263 Ga0070664_100017864 3300005564 Bacteria 5823
264 Ga0070664_100042073 3300005564 Bacteria 3858
265 Ga0070664_100130673 3300005564 Bacteria 2206
266 Ga0070664_100163765 3300005564 Bacteria 1969
267 Ga0070664_100287132 3300005564 Bacteria 1485
268 Ga0068857_100085189 3300005577 Bacteria 2824
269 Ga0068857_100132500 3300005577 Bacteria 2248
270 Ga0068854_100030643 3300005578 Bacteria 3732
271 Ga0068854_100059050 3300005578 Bacteria 2771
272 Ga0068854_100113415 3300005578 Bacteria 2048
273 Ga0068854_100296381 3300005578 Bacteria 1307
274 Ga0068856_100051081 3300005614 Unclassified 4077
275 Ga0068856_100220826 3300005614 Bacteria 1910
276 Ga0070702_100002472 3300005615 Bacteria 7992
277 Ga0070702_100029233 3300005615 Bacteria 2995
278 Ga0070702_100057673 3300005615 Bacteria 2247
279 Ga0070702_100139159 3300005615 Bacteria 1544
280 Ga0070702_100150313 3300005615 Bacteria 1494
281 Ga0068852_100045599 3300005616 Bacteria 3730
282 Ga0068852_100064492 3300005616 Bacteria 3193
283 Ga0068852_100166839 3300005616 Bacteria 2061
284 Ga0068859_100029439 3300005617 Bacteria 5509
285 Ga0068859_100033086 3300005617 Bacteria 5193
286 Ga0068859_100041652 3300005617 Bacteria 4612
287 Ga0068859_100073857 3300005617 Bacteria 3448
288 Ga0068859_100136215 3300005617 Bacteria 2528
289 Ga0068859_100162559 3300005617 Bacteria 2312
290 Ga0068859_100228236 3300005617 Bacteria 1950
291 Ga0068864_100003807 3300005618 Bacteria 12440
292 Ga0068864_100012301 3300005618 Bacteria 7073
293 Ga0068864_100030047 3300005618 Bacteria 4605
294 Ga0068864_100071533 3300005618 Bacteria 3020
295 Ga0068864_100129009 3300005618 Bacteria 2269
296 Ga0068864_100194065 3300005618 Bacteria 1862
297 Ga0068864_100375659 3300005618 Bacteria 1346
298 Ga0068866_10038903 3300005718 Bacteria 2346
299 Ga0068861_100006139 3300005719 Bacteria 8175
300 Ga0068861_100015207 3300005719 Bacteria 5418
301 Ga0068861_100028959 3300005719 Bacteria 4045
302 Ga0068851_10024137 3300005834 Bacteria 2977
303 Ga0068851_10028093 3300005834 Bacteria 2777
304 Ga0068851_10037183 3300005834 Bacteria 2440
305 Ga0068870_10083230 3300005840 Bacteria 1773
306 Ga0068863_100046319 3300005841 Bacteria 4127
307 Ga0068863_100152745 3300005841 Bacteria 2210
308 Ga0068863_100213775 3300005841 Bacteria 1857
309 Ga0068863_100393234 3300005841 Bacteria 1355
310 Ga0068858_100000002 3300005842 Bacteria 351633
311 Ga0068858_100005689 3300005842 Bacteria 12184
312 Ga0068858_100018354 3300005842 Bacteria 6550
313 Ga0068858_100035040 3300005842 Bacteria 4656
314 Ga0068858_100096443 3300005842 Bacteria 2755
315 Ga0068858_100312344 3300005842 Bacteria 1501
316 Ga0068860_100014438 3300005843 Bacteria 7737
317 Ga0068860_100059285 3300005843 Bacteria 3639
318 Ga0068860_100097700 3300005843 Bacteria 2800
319 Ga0068860_100108479 3300005843 Bacteria 2653
320 Ga0068860_100202888 3300005843 Bacteria 1922
321 Ga0068862_100000192 3300005844 Bacteria 67711
322 Ga0068862_100016510 3300005844 Bacteria 6146
323 Ga0068862_100096827 3300005844 Bacteria 2576
324 Ga0068862_100157271 3300005844 Bacteria 2027
325 Ga0068862_100224329 3300005844 Bacteria 1702
326 Ga0081455_10000995 3300005937 Bacteria 35927
327 Ga0081455_10049132 3300005937 Bacteria 3639
328 Ga0081455_10120691 3300005937 Bacteria 2066
329 Ga0081538_10000004 3300005981 Bacteria 194737
330 Ga0081539_10000024 3300005985 Bacteria 354702
331 Ga0081539_10000035 3300005985 Bacteria 302689
332 Ga0081539_10000244 3300005985 Bacteria 127514
333 Ga0081539_10014216 3300005985 Bacteria 5910
334 Ga0081539_10017051 3300005985 Bacteria 5131
335 Ga0081539_10022783 3300005985 Bacteria 4128
336 Ga0081539_10054855 3300005985 Bacteria 2221
337 Ga0081539_10092488 3300005985 Bacteria 1560
338 Ga0081539_10094365 3300005985 Bacteria 1539
339 Ga0070717_10070185 3300006028 Bacteria 2919
340 Ga0075365_10036265 3300006038 Bacteria 3194
341 Ga0075365_10054928 3300006038 Bacteria 2642
342 Ga0075365_10055190 3300006038 Bacteria 2636
343 Ga0075365_10065905 3300006038 Bacteria 2428
344 Ga0075368_10002301 3300006042 Bacteria 6203
345 Ga0075368_10017923 3300006042 Bacteria 2655
346 Ga0075363_100000364 3300006048 Bacteria 13662
347 Ga0075363_100004611 3300006048 Bacteria 6052
348 Ga0075363_100019594 3300006048 Bacteria 3383
349 Ga0075364_10035090 3300006051 Bacteria 3240
350 Ga0075364_10059297 3300006051 Bacteria 2508
351 Ga0075364_10094090 3300006051 Bacteria 1990
352 Ga0075364_10138463 3300006051 Bacteria 1636
353 Ga0075432_10022092 3300006058 Bacteria 2175
354 Ga0075432_10038984 3300006058 Bacteria 1656
355 Ga0070712_100069113 3300006175 Bacteria 2519
356 Ga0075367_10036217 3300006178 Bacteria 2860
357 Ga0075367_10123291 3300006178 Bacteria 1598
358 Ga0075369_10001831 3300006186 Bacteria 7419
359 Ga0075366_10006958 3300006195 Bacteria 6227
360 Ga0097621_100000510 3300006237 Bacteria 27211
361 Ga0097621_100023601 3300006237 Bacteria 4790
362 Ga0097621_100082245 3300006237 Bacteria 2681
363 Ga0097621_100092591 3300006237 Bacteria 2532
364 Ga0097621_100099825 3300006237 Bacteria 2441
365 Ga0097621_100108084 3300006237 Bacteria 2348
366 Ga0097621_100116772 3300006237 Bacteria 2260
367 Ga0097621_100125172 3300006237 Bacteria 2183
368 Ga0097621_100135672 3300006237 Bacteria 2099
369 Ga0075370_10013756 3300006353 Bacteria 4306
370 Ga0075370_10034318 3300006353 Bacteria 2844
371 Ga0075370_10047475 3300006353 Bacteria 2431
372 Ga0068871_100000108 3300006358 Bacteria 50255
373 Ga0068871_100001762 3300006358 Bacteria 14573
374 Ga0068871_100005779 3300006358 Bacteria 8691
375 Ga0068871_100044770 3300006358 Bacteria 3561
376 Ga0068871_100080567 3300006358 Bacteria 2696
377 Ga0068871_100129739 3300006358 Bacteria 2136
378 Ga0068871_100195840 3300006358 Bacteria 1743
379 Ga0075428_100000100 3300006844 Bacteria 72697
380 Ga0075428_100001176 3300006844 Bacteria 28020
381 Ga0075428_100002267 3300006844 Bacteria 20832
382 Ga0075428_100002710 3300006844 Bacteria 19287
383 Ga0075428_100003258 3300006844 Bacteria 17774
384 Ga0075428_100004744 3300006844 Bacteria 15048
385 Ga0075428_100011875 3300006844 Bacteria 9686
386 Ga0075428_100020681 3300006844 Bacteria 7288
387 Ga0075428_100021454 3300006844 Bacteria 7148
388 Ga0075428_100058385 3300006844 Bacteria 4224
389 Ga0075428_100061209 3300006844 Bacteria 4122
390 Ga0075428_100069973 3300006844 Bacteria 3836
391 Ga0075428_100072723 3300006844 Bacteria 3755
392 Ga0075428_100092312 3300006844 Bacteria 3301
393 Ga0075428_100106053 3300006844 Bacteria 3063
394 Ga0075428_100109485 3300006844 Bacteria 3010
395 Ga0075430_100002969 3300006846 Bacteria 14207
396 Ga0075430_100007284 3300006846 Bacteria 9338
397 Ga0075430_100015760 3300006846 Bacteria 6438
398 Ga0075430_100034006 3300006846 Bacteria 4325
399 Ga0075430_100045040 3300006846 Bacteria 3729
400 Ga0075430_100079058 3300006846 Bacteria 2757
401 Ga0075430_100090238 3300006846 Bacteria 2564
402 Ga0075430_100134779 3300006846 Bacteria 2058
403 Ga0075431_100001491 3300006847 Bacteria 21644
404 Ga0075431_100002445 3300006847 Bacteria 17879
405 Ga0075431_100003423 3300006847 Bacteria 15391
406 Ga0075431_100004448 3300006847 Bacteria 13746
407 Ga0075431_100008897 3300006847 Bacteria 10058
408 Ga0075431_100009529 3300006847 Bacteria 9755
409 Ga0075431_100009670 3300006847 Bacteria 9683
410 Ga0075431_100015256 3300006847 Bacteria 7786
411 Ga0075431_100018729 3300006847 Bacteria 7053
412 Ga0075431_100026022 3300006847 Bacteria 5999
413 Ga0075431_100076459 3300006847 Bacteria 3455
414 Ga0075431_100179361 3300006847 Bacteria 2174
415 Ga0075431_100217028 3300006847 Bacteria 1952
416 Ga0075433_10000348 3300006852 Bacteria 28818
417 Ga0075433_10006016 3300006852 Bacteria 9559
418 Ga0075433_10013934 3300006852 Bacteria 6554
419 Ga0075433_10026871 3300006852 Bacteria 4877
420 Ga0075433_10029614 3300006852 Bacteria 4667
421 Ga0075433_10082409 3300006852 Bacteria 2837
422 Ga0075433_10116262 3300006852 Bacteria 2373
423 Ga0075434_100002451 3300006871 Bacteria 16337
424 Ga0075434_100009109 3300006871 Bacteria 9249
425 Ga0075434_100017333 3300006871 Bacteria 6936
426 Ga0075434_100019774 3300006871 Bacteria 6519
427 Ga0075434_100021900 3300006871 Bacteria 6221
428 Ga0075434_100023769 3300006871 Bacteria 5980
429 Ga0075434_100041223 3300006871 Bacteria 4574
430 Ga0075434_100092342 3300006871 Bacteria 3029
431 Ga0075434_100106257 3300006871 Bacteria 2817
432 Ga0075434_100391167 3300006871 Bacteria 1411
433 Ga0075429_100000082 3300006880 Bacteria 49180
434 Ga0075429_100005845 3300006880 Bacteria 10615
435 Ga0075429_100008969 3300006880 Bacteria 8687
436 Ga0075429_100009769 3300006880 Bacteria 8318
437 Ga0075429_100055229 3300006880 Bacteria 3456
438 Ga0075429_100057994 3300006880 Bacteria 3372
439 Ga0075429_100071554 3300006880 Bacteria 3020
440 Ga0075429_100103843 3300006880 Bacteria 2482
441 Ga0075429_100160770 3300006880 Bacteria 1967
442 Ga0075429_100278492 3300006880 Bacteria 1465
443 Ga0075429_100305469 3300006880 Bacteria 1393
444 Ga0068865_100004918 3300006881 Bacteria 8076
445 Ga0068865_100051701 3300006881 Bacteria 2845
446 Ga0068865_100083553 3300006881 Bacteria 2299
447 Ga0068865_100103385 3300006881 Bacteria 2089
448 Ga0068865_100179413 3300006881 Bacteria 1630
449 Ga0068865_100202672 3300006881 Bacteria 1541
450 Ga0075436_100003014 3300006914 Bacteria 11541
451 Ga0075436_100058685 3300006914 Bacteria 2658
452 Ga0097620_100029436 3300006931 Bacteria 5509
453 Ga0097620_100033086 3300006931 Bacteria 5193
454 Ga0097620_100041655 3300006931 Bacteria 4612
455 Ga0097620_100073858 3300006931 Bacteria 3448
456 Ga0097620_100136213 3300006931 Bacteria 2528
457 Ga0097620_100162560 3300006931 Bacteria 2312
458 Ga0097620_100228244 3300006931 Bacteria 1950
459 Ga0075435_100003226 3300007076 Bacteria 11043
460 Ga0075435_100003893 3300007076 Bacteria 10196
461 Ga0075435_100020624 3300007076 Bacteria 5055
462 Ga0075435_100040892 3300007076 Bacteria 3704
463 Ga0075435_100042755 3300007076 Bacteria 3625
464 Ga0075435_100064482 3300007076 Bacteria 2977
465 Ga0075435_100101013 3300007076 Bacteria 2390
466 Ga0099794_10002655 3300007265 Bacteria 6655
467 Ga0099794_10008572 3300007265 Bacteria 4255
468 Ga0105240_10021429 3300009093 Bacteria 8593
469 Ga0105240_10275252 3300009093 Bacteria 1937
470 Ga0105240_10405961 3300009093 Bacteria 1533
471 Ga0111539_10003771 3300009094 Bacteria 19940
472 Ga0111539_10004229 3300009094 Bacteria 18819
473 Ga0111539_10004348 3300009094 Bacteria 18553
474 Ga0111539_10009801 3300009094 Bacteria 12091
475 Ga0111539_10021661 3300009094 Bacteria 7906
476 Ga0111539_10029039 3300009094 Bacteria 6742
477 Ga0111539_10034471 3300009094 Bacteria 6137
478 Ga0111539_10037135 3300009094 Bacteria 5884
479 Ga0111539_10048226 3300009094 Bacteria 5087
480 Ga0111539_10075167 3300009094 Bacteria 3981
481 Ga0111539_10092226 3300009094 Bacteria 3559
482 Ga0111539_10096271 3300009094 Bacteria 3477
483 Ga0111539_10108999 3300009094 Bacteria 3249
484 Ga0111539_10147900 3300009094 Bacteria 2750
485 Ga0111539_10159359 3300009094 Bacteria 2640
486 Ga0111539_10218455 3300009094 Bacteria 2220
487 Ga0111539_10229966 3300009094 Bacteria 2159
488 Ga0111539_10238610 3300009094 Bacteria 2116
489 Ga0111539_10576760 3300009094 Bacteria 1310
490 Ga0105245_10018518 3300009098 Bacteria 6090
491 Ga0105245_10049152 3300009098 Bacteria 3775
492 Ga0105245_10064134 3300009098 Bacteria 3320
493 Ga0105247_10011104 3300009101 Bacteria 5432
494 Ga0105247_10018503 3300009101 Bacteria 4178
495 Ga0114129_10000032 3300009147 Bacteria 111487
496 Ga0114129_10000127 3300009147 Bacteria 77507
497 Ga0114129_10000939 3300009147 Bacteria 38096
498 Ga0114129_10003134 3300009147 Bacteria 23200
499 Ga0114129_10003744 3300009147 Bacteria 21440
500 Ga0114129_10006207 3300009147 Bacteria 16951
501 Ga0114129_10006952 3300009147 Bacteria 16099
502 Ga0114129_10011327 3300009147 Bacteria 12704
503 Ga0114129_10015037 3300009147 Bacteria 11018
504 Ga0114129_10017930 3300009147 Bacteria 10079
505 Ga0114129_10029973 3300009147 Bacteria 7704
506 Ga0114129_10033131 3300009147 Bacteria 7301
507 Ga0114129_10037256 3300009147 Bacteria 6867
508 Ga0114129_10071958 3300009147 Bacteria 4820
509 Ga0114129_10157201 3300009147 Bacteria 3108
510 Ga0114129_10185545 3300009147 Bacteria 2827
511 Ga0114129_10200567 3300009147 Bacteria 2702
512 Ga0114129_10210827 3300009147 Bacteria 2626
513 Ga0114129_10556086 3300009147 Bacteria 1491
514 Ga0105243_10002886 3300009148 Bacteria 14242
515 Ga0105243_10006221 3300009148 Bacteria 9229
516 Ga0105243_10009076 3300009148 Bacteria 7596
517 Ga0105243_10013026 3300009148 Bacteria 6283
518 Ga0105243_10036259 3300009148 Bacteria 3827
519 Ga0105243_10054643 3300009148 Bacteria 3171
520 Ga0105243_10057372 3300009148 Bacteria 3100
521 Ga0105243_10163848 3300009148 Bacteria 1919
522 Ga0105243_10350370 3300009148 Bacteria 1355
523 Ga0105243_10411699 3300009148 Bacteria 1258
524 Ga0105241_10009863 3300009174 Bacteria 7019
525 Ga0105241_10122279 3300009174 Bacteria 2098
526 Ga0105242_10002197 3300009176 Bacteria 15395
527 Ga0105242_10026154 3300009176 Bacteria 4624
528 Ga0105242_10026311 3300009176 Bacteria 4611
529 Ga0105242_10109442 3300009176 Bacteria 2353
530 Ga0105242_10113762 3300009176 Bacteria 2311
531 Ga0105242_10114559 3300009176 Bacteria 2304
532 Ga0105242_10121863 3300009176 Bacteria 2239
533 Ga0105242_10190971 3300009176 Bacteria 1813
534 Ga0105248_10000943 3300009177 Bacteria 32364
535 Ga0105248_10007178 3300009177 Bacteria 12223
536 Ga0105248_10009334 3300009177 Bacteria 10803
537 Ga0105248_10012226 3300009177 Bacteria 9466
538 Ga0105248_10018050 3300009177 Bacteria 7788
539 Ga0105248_10029846 3300009177 Bacteria 6085
540 Ga0105248_10079334 3300009177 Bacteria 3690
541 Ga0105248_10098948 3300009177 Bacteria 3286
542 Ga0105248_10120483 3300009177 Bacteria 2960
543 Ga0105248_10177132 3300009177 Bacteria 2403
544 Ga0105248_10318894 3300009177 Bacteria 1750
545 Ga0105248_10368026 3300009177 Bacteria 1618
546 Ga0105238_10005510 3300009551 Bacteria 12501
547 Ga0105238_10038120 3300009551 Bacteria 4882
548 Ga0105238_10137774 3300009551 Bacteria 2418
549 Ga0105238_10170887 3300009551 Bacteria 2150
550 Ga0105238_10197339 3300009551 Bacteria 1988
551 Ga0105249_10003805 3300009553 Bacteria 13025
552 Ga0105249_10009569 3300009553 Bacteria 8493
553 Ga0105249_10028809 3300009553 Bacteria 5012
554 Ga0105249_10412692 3300009553 Bacteria 1382
555 Ga0105239_10081521 3300010375 Bacteria 3561
556 Ga0105239_10112876 3300010375 Bacteria 3013
557 Ga0105239_10274524 3300010375 Bacteria 1897
558 Ga0105246_10002150 3300011119 Bacteria 11883
559 Ga0105246_10021870 3300011119 Bacteria 4122
560 Ga0105246_10136664 3300011119 Bacteria 1838
561 Ga0105246_10143116 3300011119 Bacteria 1801
562 Ga0105246_10147169 3300011119 Bacteria 1779
563 Ga0157371_10024677 3300013102 Bacteria 4387
564 Ga0157370_10016729 3300013104 Bacteria 7421
565 Ga0157370_10042219 3300013104 Bacteria 4396
566 Ga0157370_10116970 3300013104 Bacteria 2490
567 Ga0157369_10011406 3300013105 Bacteria 10092
568 Ga0157369_10012708 3300013105 Bacteria 9548
569 Ga0157374_10191254 3300013296 Bacteria 2002
570 Ga0157374_10242036 3300013296 Bacteria 1774
571 Ga0157378_10090899 3300013297 Bacteria 2775
572 Ga0157378_10120861 3300013297 Bacteria 2414
573 Ga0157378_10171200 3300013297 Bacteria 2037
574 Ga0157378_10391349 3300013297 Bacteria 1367
575 Ga0163162_10008524 3300013306 Bacteria 9993
576 Ga0163162_10008622 3300013306 Bacteria 9935
577 Ga0163162_10092279 3300013306 Bacteria 3112
578 Ga0163162_10331878 3300013306 Bacteria 1653
579 Ga0157372_10046056 3300013307 Bacteria 4840
580 Ga0157372_10079042 3300013307 Bacteria 3718
581 Ga0157372_10265210 3300013307 Bacteria 1994
582 Ga0157375_10017505 3300013308 Bacteria 6469
583 Ga0157375_10047330 3300013308 Bacteria 4199
584 Ga0157375_10066597 3300013308 Bacteria 3597
585 Ga0157375_10074179 3300013308 Bacteria 3423
586 Ga0157375_10107640 3300013308 Bacteria 2881
587 Ga0157375_10114966 3300013308 Bacteria 2793
588 Ga0157375_10211661 3300013308 Bacteria 2096
589 Ga0163163_10008055 3300014325 Bacteria 9335
590 Ga0163163_10017879 3300014325 Bacteria 6620
591 Ga0163163_10022835 3300014325 Bacteria 5930
592 Ga0163163_10047022 3300014325 Bacteria 4240
593 Ga0163163_10071192 3300014325 Bacteria 3464
594 Ga0163163_10087836 3300014325 Bacteria 3120
595 Ga0163163_10136659 3300014325 Bacteria 2492
596 Ga0163163_10210525 3300014325 Bacteria 1993
597 Ga0163163_10544418 3300014325 Bacteria 1223
598 Ga0157380_10001491 3300014326 Bacteria 15326
599 Ga0157380_10010921 3300014326 Bacteria 6549
600 Ga0157380_10014471 3300014326 Bacteria 5772
601 Ga0157380_10029501 3300014326 Bacteria 4192
602 Ga0157380_10030663 3300014326 Bacteria 4121
603 Ga0157380_10036819 3300014326 Bacteria 3788
604 Ga0157380_10037074 3300014326 Bacteria 3777
605 Ga0157380_10064627 3300014326 Bacteria 2938
606 Ga0157380_10067423 3300014326 Bacteria 2881
607 Ga0157380_10116889 3300014326 Bacteria 2252
608 Ga0157380_10175468 3300014326 Bacteria 1877
609 Ga0157380_10204849 3300014326 Bacteria 1753
610 Ga0157380_10344942 3300014326 Bacteria 1391
611 Ga0157380_10367117 3300014326 Bacteria 1353
612 Ga0157380_10367951 3300014326 Bacteria 1352
613 Ga0182008_10006801 3300014497 Bacteria 6363
614 Ga0157377_10005968 3300014745 Bacteria 5769
615 Ga0157377_10011755 3300014745 Bacteria 4379
616 Ga0157377_10109470 3300014745 Bacteria 1658
617 Ga0157379_10000007 3300014968 Bacteria 142402
618 Ga0157379_10003064 3300014968 Bacteria 14133
619 Ga0157379_10013575 3300014968 Bacteria 7138
620 Ga0157379_10017832 3300014968 Bacteria 6255
621 Ga0157379_10044088 3300014968 Bacteria 3982
622 Ga0157379_10069016 3300014968 Bacteria 3160
623 Ga0157379_10190944 3300014968 Bacteria 1851
624 Ga0157379_10203540 3300014968 Bacteria 1790
625 Ga0157376_10011280 3300014969 Bacteria 6579
626 Ga0157376_10036613 3300014969 Bacteria 3976
627 Ga0157376_10070517 3300014969 Bacteria 2967
628 Ga0157376_10299891 3300014969 Bacteria 1521
629 Ga0182007_10023328 3300015262 Bacteria 2176
630 Ga0163161_10028324 3300017792 Bacteria 3978
631 Ga0163161_10078278 3300017792 Bacteria 2430
632 Ga0206356_10209910 3300020070 Bacteria 4669
633 Ga0206353_10257956 3300020082 Bacteria 1212
634 Ga0206353_10390452 3300020082 Bacteria 14670
635 Ga0206353_11931331 3300020082 Bacteria 4097
636 Ga0213876_10086674 3300021384 Bacteria 1657
637 Ga0209050_1002956 3300025298 Bacteria 13286
638 Ga0209257_1000006 3300025304 Bacteria 1570111
639 Ga0207697_10002059 3300025315 Bacteria 10589
640 Ga0207697_10002496 3300025315 Bacteria 9506
641 Ga0207697_10028256 3300025315 Bacteria 2294
642 Ga0207697_10068738 3300025315 Bacteria 1482
643 Ga0207656_10045227 3300025321 Bacteria 1883
644 Ga0207682_10002902 3300025893 Bacteria 7559
645 Ga0207682_10003368 3300025893 Bacteria 6959
646 Ga0207682_10011854 3300025893 Bacteria 3405
647 Ga0207642_10036849 3300025899 Bacteria 2103
648 Ga0207688_10004310 3300025901 Bacteria 7760
649 Ga0207688_10010791 3300025901 Bacteria 4972
650 Ga0207688_10063280 3300025901 Bacteria 2087
651 Ga0207688_10092310 3300025901 Bacteria 1740
652 Ga0207680_10053614 3300025903 Bacteria 2422
653 Ga0207680_10111437 3300025903 Bacteria 1775
654 Ga0207699_10014716 3300025906 Bacteria 4043
655 Ga0207645_10001211 3300025907 Bacteria 21295
656 Ga0207645_10002990 3300025907 Bacteria 13067
657 Ga0207645_10054617 3300025907 Bacteria 2551
658 Ga0207645_10056145 3300025907 Bacteria 2514
659 Ga0207645_10079852 3300025907 Bacteria 2097
660 Ga0207645_10080516 3300025907 Bacteria 2088
661 Ga0207643_10006077 3300025908 Bacteria 6452
662 Ga0207643_10010032 3300025908 Bacteria 5092
663 Ga0207643_10014099 3300025908 Bacteria 4339
664 Ga0207643_10021872 3300025908 Bacteria 3518
665 Ga0207643_10037355 3300025908 Bacteria 2725
666 Ga0207643_10048157 3300025908 Bacteria 2414
667 Ga0207643_10132954 3300025908 Bacteria 1482
668 Ga0207705_10003753 3300025909 Bacteria 11574
669 Ga0207705_10054656 3300025909 Bacteria 2878
670 Ga0207705_10069859 3300025909 Bacteria 2544
671 Ga0207684_10000491 3300025910 Bacteria 50201
672 Ga0207684_10031743 3300025910 Bacteria 4493
673 Ga0207684_10311778 3300025910 Bacteria 1356
674 Ga0207654_10014370 3300025911 Bacteria 4089
675 Ga0207707_10019997 3300025912 Bacteria 5842
676 Ga0207695_10014226 3300025913 Bacteria 9438
677 Ga0207695_10059773 3300025913 Bacteria 3950
678 Ga0207695_10158762 3300025913 Bacteria 2194
679 Ga0207693_10120583 3300025915 Bacteria 2059
680 Ga0207660_10015632 3300025917 Bacteria 5012
681 Ga0207662_10019025 3300025918 Bacteria 3902
682 Ga0207662_10022979 3300025918 Bacteria 3579
683 Ga0207662_10084746 3300025918 Bacteria 1939
684 Ga0207662_10088745 3300025918 Bacteria 1899
685 Ga0207662_10185391 3300025918 Bacteria 1341
686 Ga0207657_10024642 3300025919 Bacteria 5565
687 Ga0207657_10040322 3300025919 Bacteria 4138
688 Ga0207657_10100137 3300025919 Bacteria 2406
689 Ga0207649_10023474 3300025920 Bacteria 3573
690 Ga0207649_10043227 3300025920 Bacteria 2754
691 Ga0207649_10129224 3300025920 Bacteria 1714
692 Ga0207652_10047440 3300025921 Bacteria 3669
693 Ga0207646_10001586 3300025922 Bacteria 27768
694 Ga0207646_10002404 3300025922 Bacteria 22088
695 Ga0207646_10009215 3300025922 Bacteria 9784
696 Ga0207646_10012777 3300025922 Bacteria 8053
697 Ga0207646_10017164 3300025922 Bacteria 6779
698 Ga0207646_10028693 3300025922 Bacteria 5063
699 Ga0207646_10092641 3300025922 Bacteria 2705
700 Ga0207681_10009853 3300025923 Bacteria 5844
701 Ga0207681_10020691 3300025923 Bacteria 4173
702 Ga0207681_10111301 3300025923 Bacteria 1992
703 Ga0207681_10135371 3300025923 Bacteria 1827
704 Ga0207681_10220191 3300025923 Bacteria 1468
705 Ga0207694_10015342 3300025924 Bacteria 5781
706 Ga0207650_10032986 3300025925 Bacteria 3748
707 Ga0207650_10142047 3300025925 Bacteria 1888
708 Ga0207650_10191455 3300025925 Bacteria 1634
709 Ga0207659_10000209 3300025926 Bacteria 35219
710 Ga0207659_10000854 3300025926 Bacteria 18070
711 Ga0207659_10002047 3300025926 Bacteria 11973
712 Ga0207659_10006129 3300025926 Bacteria 7345
713 Ga0207659_10009478 3300025926 Bacteria 6087
714 Ga0207659_10011484 3300025926 Bacteria 5596
715 Ga0207659_10030752 3300025926 Bacteria 3671
716 Ga0207659_10035003 3300025926 Bacteria 3468
717 Ga0207659_10036189 3300025926 Bacteria 3417
718 Ga0207659_10045322 3300025926 Bacteria 3100
719 Ga0207659_10056908 3300025926 Bacteria 2801
720 Ga0207687_10016974 3300025927 Bacteria 4785
721 Ga0207700_10195584 3300025928 Bacteria 1701
722 Ga0207664_10028758 3300025929 Bacteria 4227
723 Ga0207664_10083724 3300025929 Bacteria 2601
724 Ga0207644_10038219 3300025931 Bacteria 3380
725 Ga0207644_10039388 3300025931 Bacteria 3336
726 Ga0207644_10040682 3300025931 Bacteria 3286
727 Ga0207644_10153803 3300025931 Bacteria 1782
728 Ga0207644_10204901 3300025931 Bacteria 1557
729 Ga0207706_10009358 3300025933 Bacteria 8996
730 Ga0207706_10015076 3300025933 Bacteria 6996
731 Ga0207706_10038166 3300025933 Bacteria 4261
732 Ga0207706_10038926 3300025933 Bacteria 4217
733 Ga0207706_10041924 3300025933 Bacteria 4056
734 Ga0207706_10082819 3300025933 Bacteria 2820
735 Ga0207706_10087790 3300025933 Bacteria 2735
736 Ga0207686_10003421 3300025934 Bacteria 8521
737 Ga0207686_10006274 3300025934 Bacteria 6397
738 Ga0207686_10010825 3300025934 Bacteria 4973
739 Ga0207686_10217860 3300025934 Bacteria 1376
740 Ga0207709_10008062 3300025935 Bacteria 5834
741 Ga0207709_10010140 3300025935 Bacteria 5189
742 Ga0207709_10017542 3300025935 Bacteria 3996
743 Ga0207709_10028476 3300025935 Bacteria 3230
744 Ga0207709_10058745 3300025935 Bacteria 2391
745 Ga0207709_10061172 3300025935 Bacteria 2352
746 Ga0207709_10167256 3300025935 Bacteria 1540
747 Ga0207670_10003370 3300025936 Bacteria 8479
748 Ga0207670_10050656 3300025936 Bacteria 2784
749 Ga0207670_10058770 3300025936 Bacteria 2613
750 Ga0207670_10058784 3300025936 Bacteria 2613
751 Ga0207670_10149525 3300025936 Bacteria 1731
752 Ga0207670_10198646 3300025936 Bacteria 1522
753 Ga0207670_10199551 3300025936 Bacteria 1519
754 Ga0207670_10200801 3300025936 Bacteria 1515
755 Ga0207670_10235702 3300025936 Bacteria 1407
756 Ga0207670_10274841 3300025936 Bacteria 1311
757 Ga0207669_10016067 3300025937 Bacteria 3792
758 Ga0207669_10019064 3300025937 Bacteria 3563
759 Ga0207669_10058122 3300025937 Bacteria 2358
760 Ga0207704_10043620 3300025938 Bacteria 2650
761 Ga0207704_10075104 3300025938 Bacteria 2160
762 Ga0207691_10006867 3300025940 Bacteria 10983
763 Ga0207691_10006894 3300025940 Bacteria 10958
764 Ga0207691_10029696 3300025940 Bacteria 5113
765 Ga0207691_10030061 3300025940 Bacteria 5079
766 Ga0207691_10036136 3300025940 Bacteria 4578
767 Ga0207691_10051484 3300025940 Bacteria 3764
768 Ga0207691_10081206 3300025940 Bacteria 2915
769 Ga0207691_10087850 3300025940 Bacteria 2789
770 Ga0207691_10150241 3300025940 Bacteria 2048
771 Ga0207711_10001278 3300025941 Bacteria 23847
772 Ga0207711_10010515 3300025941 Bacteria 7688
773 Ga0207711_10011686 3300025941 Bacteria 7295
774 Ga0207711_10018748 3300025941 Bacteria 5753
775 Ga0207711_10062275 3300025941 Bacteria 3218
776 Ga0207711_10090877 3300025941 Bacteria 2685
777 Ga0207711_10097778 3300025941 Bacteria 2592
778 Ga0207689_10006638 3300025942 Bacteria 10203
779 Ga0207689_10036444 3300025942 Bacteria 4083
780 Ga0207689_10038079 3300025942 Bacteria 3984
781 Ga0207689_10092527 3300025942 Bacteria 2484
782 Ga0207689_10292362 3300025942 Bacteria 1350
783 Ga0207661_10001430 3300025944 Bacteria 16095
784 Ga0207661_10001693 3300025944 Bacteria 15030
785 Ga0207661_10017151 3300025944 Bacteria 5352
786 Ga0207661_10043583 3300025944 Bacteria 3542
787 Ga0207661_10059670 3300025944 Bacteria 3075
788 Ga0207661_10105298 3300025944 Bacteria 2376
789 Ga0207679_10007694 3300025945 Bacteria 6844
790 Ga0207679_10037475 3300025945 Bacteria 3447
791 Ga0207679_10059730 3300025945 Bacteria 2830
792 Ga0207679_10090800 3300025945 Bacteria 2362
793 Ga0207679_10117062 3300025945 Bacteria 2114
794 Ga0207679_10167973 3300025945 Bacteria 1803
795 Ga0207679_10168597 3300025945 Bacteria 1800
796 Ga0207667_10073659 3300025949 Bacteria 3548
797 Ga0207667_10086606 3300025949 Bacteria 3242
798 Ga0207667_10250735 3300025949 Bacteria 1811
799 Ga0207651_10009269 3300025960 Bacteria 5375
800 Ga0207651_10026264 3300025960 Bacteria 3634
801 Ga0207651_10028137 3300025960 Bacteria 3541
802 Ga0207651_10105102 3300025960 Bacteria 2105
803 Ga0207651_10121253 3300025960 Bacteria 1983
804 Ga0207651_10203723 3300025960 Bacteria 1587
805 Ga0207651_10326444 3300025960 Bacteria 1284
806 Ga0207712_10016816 3300025961 Bacteria 4742
807 Ga0207712_10023448 3300025961 Bacteria 4072
808 Ga0207712_10035472 3300025961 Bacteria 3389
809 Ga0207712_10048939 3300025961 Bacteria 2943
810 Ga0207712_10105025 3300025961 Bacteria 2107
811 Ga0207640_10063796 3300025981 Bacteria 2449
812 Ga0207640_10109378 3300025981 Bacteria 1955
813 Ga0207640_10145833 3300025981 Bacteria 1732
814 Ga0207658_10105918 3300025986 Bacteria 2213
815 Ga0207658_10194161 3300025986 Bacteria 1690
816 Ga0207677_10005324 3300026023 Bacteria 6976
817 Ga0207677_10123707 3300026023 Bacteria 1951
818 Ga0207677_10181823 3300026023 Bacteria 1655
819 Ga0207703_10000001 3300026035 Bacteria 822925
820 Ga0207703_10001811 3300026035 Bacteria 19051
821 Ga0207703_10003450 3300026035 Bacteria 13241
822 Ga0207703_10028221 3300026035 Bacteria 4422
823 Ga0207703_10064866 3300026035 Bacteria 2999
824 Ga0207639_10175722 3300026041 Bacteria 1818
825 Ga0207639_10205469 3300026041 Bacteria 1692
826 Ga0207678_10004486 3300026067 Bacteria 12554
827 Ga0207678_10036465 3300026067 Bacteria 4280
828 Ga0207678_10045317 3300026067 Bacteria 3803
829 Ga0207678_10067075 3300026067 Bacteria 3080
830 Ga0207678_10074382 3300026067 Bacteria 2911
831 Ga0207678_10112554 3300026067 Bacteria 2321
832 Ga0207678_10121680 3300026067 Bacteria 2227
833 Ga0207708_10003212 3300026075 Bacteria 12042
834 Ga0207708_10003477 3300026075 Bacteria 11612
835 Ga0207708_10008663 3300026075 Bacteria 7531
836 Ga0207708_10014140 3300026075 Bacteria 5966
837 Ga0207708_10018446 3300026075 Bacteria 5255
838 Ga0207708_10051556 3300026075 Bacteria 3133
839 Ga0207708_10056058 3300026075 Bacteria 3006
840 Ga0207708_10081767 3300026075 Bacteria 2483
841 Ga0207708_10082413 3300026075 Bacteria 2473
842 Ga0207708_10147771 3300026075 Bacteria 1848
843 Ga0207708_10314022 3300026075 Bacteria 1277
844 Ga0207702_10032147 3300026078 Bacteria 4379
845 Ga0207702_10135040 3300026078 Bacteria 2225
846 Ga0207702_10216984 3300026078 Bacteria 1781
847 Ga0207641_10087888 3300026088 Bacteria 2712
848 Ga0207641_10122856 3300026088 Bacteria 2320
849 Ga0207641_10148860 3300026088 Bacteria 2119
850 Ga0207648_10001129 3300026089 Bacteria 29973
851 Ga0207648_10004649 3300026089 Bacteria 14051
852 Ga0207648_10013721 3300026089 Bacteria 7521
853 Ga0207648_10023072 3300026089 Bacteria 5581
854 Ga0207648_10023618 3300026089 Bacteria 5504
855 Ga0207648_10031547 3300026089 Bacteria 4684
856 Ga0207648_10031931 3300026089 Bacteria 4652
857 Ga0207648_10046921 3300026089 Bacteria 3787
858 Ga0207648_10054768 3300026089 Bacteria 3483
859 Ga0207648_10063665 3300026089 Bacteria 3214
860 Ga0207648_10113510 3300026089 Bacteria 2379
861 Ga0207648_10191481 3300026089 Bacteria 1813
862 Ga0207648_10305520 3300026089 Bacteria 1427
863 Ga0207676_10022681 3300026095 Bacteria 4619
864 Ga0207676_10047034 3300026095 Bacteria 3342
865 Ga0207676_10087204 3300026095 Bacteria 2552
866 Ga0207676_10124781 3300026095 Bacteria 2178
867 Ga0207674_10019100 3300026116 Bacteria 7430
868 Ga0207674_10046794 3300026116 Bacteria 4439
869 Ga0207674_10071773 3300026116 Bacteria 3479
870 Ga0207674_10096765 3300026116 Bacteria 2936
871 Ga0207674_10124853 3300026116 Bacteria 2540
872 Ga0207674_10169714 3300026116 Bacteria 2136
873 Ga0207674_10227804 3300026116 Bacteria 1812
874 Ga0207675_100010366 3300026118 Bacteria 8731
875 Ga0207675_100012983 3300026118 Bacteria 7776
876 Ga0207675_100043996 3300026118 Bacteria 4170
877 Ga0207675_100052039 3300026118 Bacteria 3822
878 Ga0207683_10000190 3300026121 Bacteria 52505
879 Ga0207683_10003923 3300026121 Bacteria 12898
880 Ga0207683_10007767 3300026121 Bacteria 9177
881 Ga0207683_10054688 3300026121 Bacteria 3500
882 Ga0207683_10056469 3300026121 Bacteria 3444
883 Ga0207683_10082387 3300026121 Bacteria 2858
884 Ga0207683_10124695 3300026121 Bacteria 2314
885 Ga0207683_10140584 3300026121 Bacteria 2175
886 Ga0207698_10060892 3300026142 Bacteria 2938
887 Ga0207698_10238718 3300026142 Bacteria 1655
888 Ga0209588_1022596 3300027671 Unclassified 1979
889 Ga0209588_1028619 3300027671 Bacteria 1774
890 Ga0209998_10010271 3300027717 Bacteria 1939
891 Ga0207428_10000393 3300027907 Bacteria 54718
892 Ga0207428_10000574 3300027907 Bacteria 43446
893 Ga0207428_10001100 3300027907 Bacteria 29381
894 Ga0207428_10011660 3300027907 Bacteria 7755
895 Ga0207428_10016192 3300027907 Bacteria 6419
896 Ga0207428_10038835 3300027907 Bacteria 3867
897 Ga0207428_10063561 3300027907 Bacteria 2915
898 Ga0207428_10084280 3300027907 Bacteria 2477
899 Ga0207428_10084727 3300027907 Bacteria 2469
900 Ga0207428_10086614 3300027907 Bacteria 2438
901 Ga0207428_10089007 3300027907 Bacteria 2400
902 Ga0207428_10161341 3300027907 Bacteria 1702
903 Ga0207428_10178367 3300027907 Bacteria 1606
904 Ga0207428_10244222 3300027907 Bacteria 1341
905 Ga0268266_10004015 3300028379 Bacteria 14232
906 Ga0268266_10012762 3300028379 Bacteria 7259
907 Ga0268265_10000185 3300028380 Bacteria 73947
908 Ga0268265_10030738 3300028380 Bacteria 3871
909 Ga0268265_10051363 3300028380 Bacteria 3112
910 Ga0268265_10089961 3300028380 Bacteria 2451
911 Ga0268265_10191468 3300028380 Bacteria 1767
912 Ga0268264_10007749 3300028381 Bacteria 8940
913 Ga0268264_10062017 3300028381 Bacteria 3138
914 Ga0268264_10303755 3300028381 Bacteria 1503
915 Ga0265337_1014920 3300028556 Bacteria 2563
916 Ga0265337_1026590 3300028556 Bacteria 1751
917 Ga0265326_10000821 3300028558 Bacteria 11439
918 Ga0265319_1004075 3300028563 Bacteria 7367
919 Ga0265334_10011902 3300028573 Bacteria 3654
920 Ga0265318_10010683 3300028577 Bacteria 3988
921 Ga0265336_10014135 3300028666 Bacteria 2648
922 Ga0307515_10002908 3300028794 Bacteria 36383
923 Ga0307515_10099224 3300028794 Unclassified 3538
924 Ga0265338_10007839 3300028800 Bacteria 13118
925 Ga0265324_10002985 3300029957 Bacteria 8268
926 Ga0316176_1037086 3300030732 Bacteria 3136
927 Ga0265770_1007359 3300030878 Bacteria 1548
928 Ga0265330_10015743 3300031235 Bacteria 3496
929 Ga0265332_10020389 3300031238 Bacteria 2926
930 Ga0265328_10041085 3300031239 Bacteria 1703
931 Ga0265320_10002308 3300031240 Bacteria 13378
932 Ga0265320_10004075 3300031240 Bacteria 9600
933 Ga0265325_10013604 3300031241 Bacteria 4626
934 Ga0265329_10004508 3300031242 Bacteria 5780
935 Ga0265340_10000470 3300031247 Bacteria 21864
936 Ga0265327_10004586 3300031251 Bacteria 12162
937 Ga0265316_10010209 3300031344 Bacteria 8573
938 Ga0265316_10011723 3300031344 Bacteria 7890
939 Ga0265316_10238937 3300031344 Bacteria 1336
940 Ga0307513_10000007 3300031456 Bacteria 451043
941 Ga0307509_10032339 3300031507 Bacteria 5765
942 Ga0307509_10078800 3300031507 Unclassified 3412
943 Ga0307408_100013432 3300031548 Bacteria 5435
944 Ga0307408_100059644 3300031548 Unclassified 2778
945 Ga0307408_100203948 3300031548 Bacteria 1602
946 Ga0307408_100220969 3300031548 Bacteria 1546
947 Ga0265313_10038254 3300031595 Bacteria 2391
948 Ga0316575_10000826 3300031665 Bacteria 9421
949 Ga0316575_10001083 3300031665 Bacteria 8488
950 Ga0316575_10009431 3300031665 Bacteria 3574
951 Ga0316579_10008036 3300031691 Bacteria 4381
952 Ga0316579_10020391 3300031691 Bacteria 2940
953 Ga0316579_10039001 3300031691 Bacteria 2199
954 Ga0265314_10002620 3300031711 Bacteria 18168
955 Ga0265314_10015520 3300031711 Bacteria 6044
956 Ga0265314_10027079 3300031711 Bacteria 4297
957 Ga0265314_10052424 3300031711 Bacteria 2836
958 Ga0316576_10003639 3300031727 Bacteria 9084
959 Ga0316576_10006146 3300031727 Bacteria 7440
960 Ga0316576_10011842 3300031727 Bacteria 5736
961 Ga0316576_10027074 3300031727 Unclassified 4028
962 Ga0316576_10056092 3300031727 Bacteria 2877
963 Ga0316576_10071907 3300031727 Bacteria 2552
964 Ga0316576_10082011 3300031727 Bacteria 2394
965 Ga0316576_10100244 3300031727 Bacteria 2164
966 Ga0316576_10139728 3300031727 Bacteria 1823
967 Ga0316578_10001433 3300031728 Bacteria 9668
968 Ga0316578_10001971 3300031728 Bacteria 8709
969 Ga0316578_10041392 3300031728 Bacteria 2668
970 Ga0316578_10041628 3300031728 Bacteria 2661
971 Ga0316578_10117930 3300031728 Bacteria 1595
972 Ga0307405_10058926 3300031731 Bacteria 2418
973 Ga0307405_10091025 3300031731 Unclassified 2020
974 Ga0307405_10104994 3300031731 Bacteria 1902
975 Ga0316577_10000080 3300031733 Bacteria 25210
976 Ga0316577_10000089 3300031733 Bacteria 24350
977 Ga0316577_10000636 3300031733 Bacteria 14588
978 Ga0316577_10004746 3300031733 Bacteria 7060
979 Ga0316577_10005239 3300031733 Bacteria 6786
980 Ga0316577_10089796 3300031733 Bacteria 1720
981 Ga0307413_10039012 3300031824 Bacteria 2758
982 Ga0307413_10054017 3300031824 Bacteria 2435
983 Ga0307413_10062645 3300031824 Bacteria 2302
984 Ga0307410_10019576 3300031852 Bacteria 4121
985 Ga0307410_10025569 3300031852 Bacteria 3706
986 Ga0307410_10103711 3300031852 Bacteria 2043
987 Ga0307406_10081494 3300031901 Bacteria 2152
988 Ga0307412_10087758 3300031911 Bacteria 2168
989 Ga0307409_100027899 3300031995 Bacteria 4011
990 Ga0307409_100037964 3300031995 Bacteria 3557
991 Ga0307409_100144540 3300031995 Bacteria 2055
992 Ga0307416_100008589 3300032002 Bacteria 6605
993 Ga0307416_100016633 3300032002 Bacteria 5120
994 Ga0307416_100165180 3300032002 Bacteria 2052
995 Ga0307416_100178783 3300032002 Bacteria 1986
996 Ga0307415_100018876 3300032126 Unclassified 4175
997 Ga0316583_10009047 3300032133 Bacteria 3591
998 Ga0316583_10020931 3300032133 Bacteria 2345
999 Ga0316583_10021849 3300032133 Bacteria 2293
1000 Ga0316583_10068207 3300032133 Bacteria 1244
1001 Ga0316585_10021473 3300032137 Bacteria 1983
1002 Ga0316585_10053676 3300032137 Unclassified 1296
1003 Ga0316580_10001255 3300032139 Bacteria 6534
1004 Ga0316580_10006543 3300032139 Bacteria 3443
1005 Ga0316593_10008734 3300032168 Bacteria 2836
1006 Ga0373923_0045215 3300035111 Bacteria 1828
1007 Ga0373932_0018875 3300035112 Bacteria 1790
1008 Ga0373945_0059996 3300035116 Bacteria 1418
1009 Ga0373954_0023176 3300035118 Bacteria 2821
1010 Ga0373956_0052479 3300035119 Bacteria 1834
1011 Ga0373943_0015607 3300035170 Bacteria 3453
1012 Ga0373943_0038565 3300035170 Bacteria 2298
1013 Ga0373946_0024979 3300035171 Bacteria 2347
1014 Ga0373955_0033485 3300035172 Bacteria 2707
1015 Ga0373962_0023654 3300035242 Bacteria 1638
1016 Ga0316574_0000151 3300035398 Bacteria 22405
1017 Ga0316574_0001153 3300035398 Bacteria 12184
1018 Ga0316574_0001764 3300035398 Bacteria 10495
1019 Ga0316574_0066657 3300035398 Bacteria 2269
1020 Ga0316574_0080492 3300035398 Bacteria 2067
1021 Ga0373924_0007928 3300035410 Bacteria 3844
1022 Ga0373931_0016904 3300035691 Bacteria 3598
1023 Ga0373931_0035227 3300035691 Bacteria 2601
1024 Ga0373935_0076680 3300035692 Bacteria 2165
1025 Ga0373935_0141213 3300035692 Bacteria 1627
1026 Ga0373927_0022808 3300035695 Bacteria 4100
1027 Ga0373947_0002973 3300035725 Bacteria 10111
1028 Ga0373947_0013397 3300035725 Bacteria 4699
1029 Ga0373937_0008628 3300036401 Bacteria 8854
1030 Ga0373937_0055725 3300036401 Bacteria 3630
1031 Ga0373937_0210739 3300036401 Bacteria 1828
1032 Ga0373937_0243687 3300036401 Bacteria 1694
1033 Ga0316582_0000480 3300036647 Bacteria 14910
1034 Ga0316582_0006227 3300036647 Bacteria 6240
1035 Ga0316582_0015286 3300036647 Bacteria 4384
1036 Ga0316582_0043091 3300036647 Bacteria 2830
1037 Ga0316582_0137838 3300036647 Bacteria 1643
1038 Ga0316582_0154380 3300036647 Bacteria 1553
1039 Ga0316584_0000413 3300036712 Bacteria 22346
1040 Ga0316584_0001506 3300036712 Bacteria 14029
1041 Ga0316584_0010138 3300036712 Bacteria 6576
1042 Ga0316584_0011733 3300036712 Bacteria 6166
1043 Ga0316584_0023624 3300036712 Bacteria 4492
1044 Ga0316584_0046235 3300036712 Bacteria 3250
1045 Ga0316584_0061249 3300036712 Bacteria 2818
1046 Ga0316584_0203567 3300036712 Bacteria 1460
1047 Ga0373925_0021612 3300037068 Bacteria 4690
1048 Ga0373925_0029664 3300037068 Bacteria 4013
1049 Ga0373925_0044438 3300037068 Bacteria 3298
1050 Ga0395900_0147181 3300037418 Bacteria 2408
1051 Ga0395900_0327770 3300037418 Bacteria 1510
1052 Ga0395898_0076611 3300037466 Bacteria 3229
1053 Ga0395905_0035481 3300037471 Bacteria 4683
1054 Ga0436364_0619729 3300037853 Bacteria 11470
1055 Ga0395901_0006804 3300038443 Bacteria 11552
1056 Ga0395901_0023635 3300038443 Bacteria 6301
1057 Ga0395901_0157581 3300038443 Bacteria 2384
1058 Ga0400484_12566 3300038725 Bacteria 11306
1059 Ga0400490_37255 3300038726 Bacteria 31974
1060 Ga0400490_39545 3300038726 Bacteria 12070
1061 Ga0400490_42916 3300038726 Bacteria 2138
1062 Ga0400491_05038 3300038727 Bacteria 2416
1063 Ga0400491_07905 3300038727 Bacteria 7863
1064 Ga0400485_03365 3300038735 Bacteria 8632
1065 Ga0400485_09643 3300038735 Bacteria 2009
1066 Ga0400488_06186 3300038741 Bacteria 2520
1067 Ga0400488_41691 3300038741 Bacteria 5506
1068 Ga0400486_13051 3300038742 Bacteria 12497
1069 Ga0400483_032670 3300039062 Bacteria 4098
1070 Ga0400483_123874 3300039062 Bacteria 1403
1071 Ga0400483_155563 3300039062 Bacteria 6344
1072 Ga0400489_27482 3300039093 Bacteria 35511
1073 Ga0436365_0895231 3300039437 Bacteria 2488
1074 Ga0439439_0000378 3300041406 Bacteria 7310
1075 Ga0439465_0015220 3300041413 Bacteria 2400
1076 Ga0451789_0440849 3300041443 Bacteria 5430
1077 Ga0451791_0426296 3300041451 Bacteria 2831
1078 Ga0451793_0141268 3300041452 Bacteria 1282
1079 Ga0451793_0476113 3300041452 Bacteria 4486
1080 Ga0451800_0714665 3300041459 Bacteria 1503
1081 Ga0451841_0256531 3300041498 Bacteria 1460
1082 Ga0451843_0257713 3300041509 Bacteria 4028
1083 Ga0451853_3751897 3300041512 Bacteria 1692
1084 Ga0439433_0013975 3300041999 Bacteria 1766
1085 Ga0439449_0008770 3300042007 Bacteria 3837
1086 Ga0439449_0010419 3300042007 Bacteria 3510
1087 Ga0439454_004658 3300042011 Bacteria 1595
1088 Ga0439457_010577 3300042014 Bacteria 2118
1089 Ga0450920_001937 3300042122 Bacteria 3483
1090 Ga0450923_004384 3300042125 Bacteria 2216
1091 Ga0450907_002845 3300042146 Bacteria 3194
1092 Ga0439435_0002282 3300042436 Bacteria 3774
1093 Ga0439435_0008994 3300042436 Bacteria 2332
1094 Ga0439435_0038192 3300042436 Bacteria 1334
1095 Ga0439460_0020898 3300042461 Bacteria 1784
1096 Ga0451577_0052810 3300042876 Unclassified 3629
1097 Ga0451577_0085446 3300042876 Bacteria 2815
1098 Ga0451577_0280582 3300042876 Bacteria 1509
1099 Ga0466972_0006816 3300044658 Bacteria 5733
1100 Ga0453683_0065627 3300044673 Bacteria 2269
1101 Ga0453683_0193185 3300044673 Bacteria 1292
1102 Ga0466966_0037157 3300044684 Bacteria 3142
1103 Ga0466963_0064225 3300044694 Bacteria 2459
1104 Ga0466963_0152872 3300044694 Bacteria 1603
1105 Ga0466963_0169693 3300044694 Bacteria 1521
1106 Ga0453684_0000173 3300044712 Bacteria 285446
1107 Ga0453684_0001703 3300044712 Bacteria 59231
1108 Ga0453684_0007129 3300044712 Bacteria 20828
1109 Ga0453684_0015989 3300044712 Bacteria 11792
1110 Ga0453684_0080375 3300044712 Bacteria 4071
1111 Ga0453684_0115462 3300044712 Bacteria 3253
1112 Ga0453684_0166957 3300044712 Bacteria 2598
1113 Ga0453684_0360157 3300044712 Bacteria 1638
1114 Ga0466971_0051355 3300044719 Bacteria 1856
1115 Ga0466968_0025832 3300044735 Bacteria 2407
1116 Ga0466970_0013084 3300044765 Bacteria 4252
1117 Ga0466970_0017062 3300044765 Bacteria 3749
1118 Ga0466957_0039512 3300044842 Bacteria 2847
1119 Ga0466957_0047436 3300044842 Bacteria 2610
1120 Ga0466959_0009315 3300045049 Bacteria 6979
1121 Ga0451576_0008442 3300045051 Bacteria 12094
1122 Ga0451576_0008949 3300045051 Bacteria 11677
1123 Ga0451576_0153042 3300045051 Bacteria 2405
1124 Ga0451576_0165470 3300045051 Bacteria 2308
1125 Ga0451576_0201454 3300045051 Bacteria 2079
1126 Ga0466958_0009420 3300045836 Bacteria 5442
1127 Ga0466958_0064423 3300045836 Bacteria 2235
1128 Ga0466958_0099781 3300045836 Bacteria 1804
1129 Ga0466958_0139498 3300045836 Bacteria 1525
1130 Ga0466967_0005268 3300045976 Bacteria 8920
1131 Ga0466967_0022309 3300045976 Bacteria 5163
1132 Ga0466967_0091982 3300045976 Bacteria 2757
1133 Ga0466967_0133259 3300045976 Bacteria 2309
1134 Ga0466967_0163140 3300045976 Bacteria 2093
1135 Ga0495603_0008241 3300046455 Bacteria 6298
1136 Ga0495603_0013562 3300046455 Bacteria 4931
1137 Ga0495629_0000523 3300046459 Bacteria 32051
1138 Ga0495638_0000003 3300046460 Bacteria 888792
1139 Ga0495653_0017324 3300046463 Bacteria 5860
1140 Ga0495653_0093503 3300046463 Bacteria 2193
1141 Ga0495580_0000346 3300046472 Bacteria 37864
1142 Ga0495580_0073561 3300046472 Bacteria 2386
1143 Ga0495580_0172151 3300046472 Bacteria 1497
1144 Ga0495582_0008009 3300046473 Bacteria 5832
1145 Ga0495582_0098518 3300046473 Bacteria 1636
1146 Ga0495639_0008933 3300046475 Bacteria 4295
1147 Ga0495594_0076126 3300046499 Bacteria 1871
1148 Ga0495594_0201852 3300046499 Bacteria 1133
1149 Ga0495608_0020626 3300046511 Bacteria 4528
1150 Ga0495618_0235901 3300046514 Bacteria 1151
1151 Ga0495628_0003293 3300046516 Bacteria 14451
1152 Ga0495628_0011434 3300046516 Bacteria 7506
1153 Ga0495628_0122326 3300046516 Bacteria 1995
1154 Ga0495630_0009089 3300046517 Bacteria 7142
1155 Ga0495630_0013143 3300046517 Bacteria 6019
1156 Ga0495666_0121750 3300046526 Bacteria 1221
1157 Ga0495665_0108169 3300046531 Bacteria 1459
1158 Ga0495640_0018120 3300046533 Bacteria 5232
1159 Ga0495640_0094151 3300046533 Bacteria 1973
1160 Ga0495586_0168486 3300046535 Bacteria 1237
1161 Ga0495587_0081896 3300046536 Bacteria 1870
1162 Ga0495609_0033729 3300046538 Bacteria 2323
1163 Ga0495621_0000799 3300046539 Bacteria 7962
1164 Ga0495621_0001364 3300046539 Bacteria 6315
1165 Ga0495621_0013561 3300046539 Bacteria 2564
1166 Ga0495645_0000509 3300046543 Bacteria 26861
1167 Ga0495667_0021852 3300046559 Bacteria 4314
1168 Ga0495635_0132119 3300046663 Bacteria 1702
1169 Ga0495659_0022356 3300046664 Bacteria 2139
1170 Ga0495659_0024145 3300046664 Bacteria 2070
1171 Ga0495588_0044414 3300046674 Bacteria 2276
1172 Ga0495647_0030358 3300046681 Bacteria 2005
1173 Ga0495658_0001090 3300046683 Bacteria 14314
1174 Ga0495658_0034283 3300046683 Bacteria 2785
1175 Ga0495658_0048533 3300046683 Bacteria 2394
1176 Ga0495658_0219255 3300046683 Bacteria 1190
1177 Ga0495669_0011838 3300046684 Bacteria 3709
1178 Ga0495669_0108264 3300046684 Bacteria 1296
1179 Ga0495613_0008520 3300046689 Bacteria 7612
1180 Ga0495613_0124506 3300046689 Bacteria 1849
1181 Ga0495613_0227618 3300046689 Bacteria 1307
1182 Ga0495600_0098163 3300046809 Bacteria 1909
1183 Ga0495581_0043855 3300047315 Bacteria 2586
1184 Ga0495674_0021360 3300047319 Bacteria 5988
1185 Ga0495674_0051535 3300047319 Bacteria 3628
1186 Ga0495672_0000242 3300047320 Bacteria 76766
1187 Ga0495672_0004208 3300047320 Bacteria 11921
1188 Ga0495677_0044018 3300047445 Bacteria 1637
1189 Ga0495684_0001676 3300047471 Bacteria 17798
1190 Ga0495602_0136664 3300048088 Bacteria 1946
1191 Ga0496101_0156636 3300048904 Bacteria 1745
1192 Ga0496101_0236363 3300048904 Bacteria 1421
1193 Ga0496102_0043243 3300048905 Bacteria 4084
1194 Ga0496102_0072640 3300048905 Bacteria 3162
1195 Ga0496102_0079705 3300048905 Bacteria 3016
1196 Ga0496102_0093756 3300048905 Bacteria 2781
1197 Ga0496102_0119680 3300048905 Bacteria 2459
1198 Ga0496104_0003311 3300048907 Bacteria 13902
1199 Ga0496104_0010031 3300048907 Bacteria 8455
1200 Ga0496104_0020628 3300048907 Bacteria 6043
1201 Ga0496104_0079682 3300048907 Bacteria 3122
1202 Ga0496104_0243987 3300048907 Bacteria 1709
1203 Ga0496105_0000513 3300048908 Bacteria 25567
1204 Ga0496105_0092061 3300048908 Bacteria 2504
1205 Ga0496105_0096560 3300048908 Bacteria 2441
1206 Ga0496105_0161757 3300048908 Bacteria 1838
1207 Ga0496106_0006809 3300048909 Bacteria 8459
1208 Ga0496106_0029816 3300048909 Bacteria 4067
1209 Ga0496106_0110583 3300048909 Bacteria 2139
1210 Ga0496106_0159907 3300048909 Bacteria 1781
1211 Ga0496107_0003244 3300048910 Bacteria 10823
1212 Ga0496107_0082562 3300048910 Bacteria 2344
1213 Ga0496108_0002685 3300048911 Bacteria 14243
1214 Ga0496108_0005882 3300048911 Bacteria 9943
1215 Ga0496108_0024891 3300048911 Bacteria 4930
1216 Ga0496108_0074259 3300048911 Bacteria 2871
1217 Ga0496108_0168024 3300048911 Bacteria 1897
1218 Ga0496109_0001158 3300048912 Bacteria 21942
1219 Ga0496109_0003151 3300048912 Bacteria 13754
1220 Ga0496109_0030856 3300048912 Bacteria 4805
1221 Ga0496109_0265194 3300048912 Bacteria 1618
1222 Ga0496110_0006677 3300048913 Bacteria 9168
1223 Ga0496110_0013256 3300048913 Bacteria 6807
1224 Ga0496110_0017224 3300048913 Bacteria 6043
1225 Ga0496110_0092227 3300048913 Bacteria 2710
1226 Ga0496111_0006838 3300048914 Bacteria 7439
1227 Ga0496111_0010934 3300048914 Bacteria 6105
1228 Ga0496111_0076714 3300048914 Bacteria 2436
1229 Ga0496111_0219971 3300048914 Bacteria 1411
1230 Ga0496112_0001156 3300048915 Bacteria 19704
1231 Ga0496112_0041108 3300048915 Bacteria 4523
1232 Ga0496112_0088517 3300048915 Bacteria 3064
1233 Ga0496112_0157512 3300048915 Bacteria 2238
1234 Ga0496112_0194101 3300048915 Bacteria 1992
1235 Ga0496112_0436367 3300048915 Bacteria 1248
1236 Ga0496113_0008939 3300048916 Bacteria 6558
1237 Ga0496113_0012915 3300048916 Bacteria 5633
1238 Ga0496113_0021398 3300048916 Bacteria 4562
1239 Ga0496113_0025915 3300048916 Bacteria 4187
1240 Ga0496114_0005398 3300048917 Bacteria 9998
1241 Ga0496114_0014629 3300048917 Bacteria 6303
1242 Ga0496114_0080620 3300048917 Bacteria 2749
1243 Ga0496114_0144195 3300048917 Bacteria 2064
1244 Ga0496114_0174311 3300048917 Bacteria 1876
1245 Ga0496114_0467976 3300048917 Bacteria 1116
1246 Ga0496115_0001888 3300048918 Bacteria 14992
1247 Ga0496115_0053909 3300048918 Bacteria 3229
1248 Ga0496115_0056811 3300048918 Bacteria 3146
1249 Ga0496117_0004173 3300048920 Bacteria 16158
1250 Ga0496118_0000909 3300048921 Bacteria 46249
1251 Ga0496121_0000025 3300048924 Bacteria 453467
1252 Ga0496122_0002058 3300048925 Bacteria 29852
1253 Ga0496122_0111496 3300048925 Bacteria 1794
1254 Ga0496123_0006537 3300048926 Bacteria 11257
1255 Ga0496123_0011752 3300048926 Bacteria 7543
1256 Ga0496123_0121298 3300048926 Bacteria 1470
1257 Ga0496124_0000639 3300048927 Bacteria 57891
1258 Ga0496124_0132995 3300048927 Bacteria 1974
1259 Ga0496124_0162442 3300048927 Bacteria 1739
1260 Ga0496126_0027150 3300048929 Bacteria 5475
1261 Ga0501300_001453 3300049523 Bacteria 3549
1262 Ga0501323_004435 3300049539 Bacteria 1485
1263 Ga0501325_001364 3300049541 Bacteria 1483
1264 Ga0501031_0001166 3300049568 Bacteria 15986
1265 Ga0501031_0016519 3300049568 Bacteria 4794
1266 Ga0501031_0019548 3300049568 Bacteria 4413
1267 Ga0501031_0087488 3300049568 Bacteria 2032
1268 Ga0501032_0002307 3300049569 Bacteria 14975
1269 Ga0501033_0000941 3300049570 Bacteria 26478
1270 Ga0501033_0019917 3300049570 Bacteria 5071
1271 Ga0501033_0063719 3300049570 Bacteria 2713
1272 Ga0501033_0078188 3300049570 Bacteria 2428
1273 Ga0501034_0002121 3300049571 Bacteria 24658
1274 Ga0501034_0008189 3300049571 Bacteria 11084
1275 Ga0501034_0164197 3300049571 Bacteria 2190
1276 Ga0501034_0201836 3300049571 Bacteria 1946
1277 Ga0501036_0000057 3300049572 Bacteria 72542
1278 Ga0501036_0001775 3300049572 Bacteria 16746
1279 Ga0501036_0022956 3300049572 Bacteria 5253
1280 Ga0501036_0051933 3300049572 Bacteria 3472
1281 Ga0501036_0103190 3300049572 Bacteria 2412
1282 Ga0501036_0137854 3300049572 Bacteria 2059
1283 Ga0501037_0001310 3300049573 Bacteria 18313
1284 Ga0501037_0009021 3300049573 Bacteria 7309
1285 Ga0501037_0030509 3300049573 Bacteria 3984
1286 Ga0501038_0000391 3300049574 Bacteria 37957
1287 Ga0501038_0027841 3300049574 Bacteria 5022
1288 Ga0501038_0086524 3300049574 Bacteria 2633
1289 Ga0501038_0134033 3300049574 Bacteria 2031
1290 Ga0501039_0000309 3300049575 Bacteria 34600
1291 Ga0501039_0013387 3300049575 Bacteria 6270
1292 Ga0501039_0021253 3300049575 Bacteria 4980
1293 Ga0501039_0028801 3300049575 Bacteria 4277
1294 Ga0501039_0043221 3300049575 Bacteria 3481
1295 Ga0501039_0114050 3300049575 Bacteria 2114
1296 Ga0501039_0206551 3300049575 Bacteria 1544
1297 Ga0501040_0004086 3300049576 Bacteria 9486
1298 Ga0501040_0009350 3300049576 Bacteria 6386
1299 Ga0501040_0015481 3300049576 Bacteria 5040
1300 Ga0501040_0016992 3300049576 Bacteria 4824
1301 Ga0501040_0020914 3300049576 Bacteria 4363
1302 Ga0501040_0021385 3300049576 Bacteria 4320
1303 Ga0501040_0033917 3300049576 Bacteria 3459
1304 Ga0501040_0166529 3300049576 Bacteria 1560
1305 Ga0501040_0176649 3300049576 Bacteria 1513
1306 Ga0501041_0002498 3300049577 Bacteria 10468
1307 Ga0501041_0014933 3300049577 Bacteria 4612
1308 Ga0501041_0018696 3300049577 Bacteria 4127
1309 Ga0501041_0123376 3300049577 Bacteria 1611
1310 Ga0501041_0126730 3300049577 Bacteria 1590
1311 Ga0501042_0002039 3300049578 Bacteria 12242
1312 Ga0501042_0003181 3300049578 Bacteria 10244
1313 Ga0501042_0011677 3300049578 Bacteria 5934
1314 Ga0501042_0050630 3300049578 Bacteria 2962
1315 Ga0501042_0058483 3300049578 Bacteria 2752
1316 Ga0501042_0092036 3300049578 Bacteria 2177
1317 Ga0501042_0099901 3300049578 Bacteria 2086
1318 Ga0501042_0104152 3300049578 Bacteria 2041
1319 Ga0501042_0241435 3300049578 Bacteria 1303
1320 Ga0501043_0000111 3300049579 Bacteria 76773
1321 Ga0501043_0043834 3300049579 Bacteria 3517
1322 Ga0501043_0118797 3300049579 Bacteria 2073
1323 Ga0501046_0000307 3300049580 Bacteria 49550
1324 Ga0501046_0014958 3300049580 Bacteria 6529
1325 Ga0501046_0114077 3300049580 Bacteria 2062
1326 Ga0501046_0125431 3300049580 Bacteria 1951
1327 Ga0501047_0000289 3300049581 Bacteria 57793
1328 Ga0501047_0002400 3300049581 Bacteria 17896
1329 Ga0501048_0000298 3300049582 Bacteria 33825
1330 Ga0501048_0005925 3300049582 Bacteria 9304
1331 Ga0501048_0016854 3300049582 Bacteria 5386
1332 Ga0501048_0022284 3300049582 Bacteria 4635
1333 Ga0501048_0165633 3300049582 Bacteria 1565
1334 Ga0501067_0000065 3300049583 Bacteria 59946
1335 Ga0501067_0013273 3300049583 Bacteria 4562
1336 Ga0501067_0016818 3300049583 Bacteria 4040
1337 Ga0501067_0020205 3300049583 Bacteria 3684
1338 Ga0501067_0036773 3300049583 Bacteria 2718
1339 Ga0501067_0146587 3300049583 Bacteria 1315
1340 Ga0501068_0000099 3300049584 Bacteria 37456
1341 Ga0501068_0039468 3300049584 Bacteria 2831
1342 Ga0501068_0043827 3300049584 Bacteria 2692
1343 Ga0501068_0054740 3300049584 Bacteria 2417
1344 Ga0501068_0068423 3300049584 Bacteria 2164
1345 Ga0501068_0103014 3300049584 Bacteria 1770
1346 Ga0501069_0001404 3300049585 Bacteria 11809
1347 Ga0501069_0006770 3300049585 Bacteria 6001
1348 Ga0501069_0046809 3300049585 Bacteria 2400
1349 Ga0501070_0001132 3300049586 Bacteria 23911
1350 Ga0501070_0016772 3300049586 Bacteria 6148
1351 Ga0501070_0024597 3300049586 Bacteria 5050
1352 Ga0501070_0073617 3300049586 Bacteria 2826
1353 Ga0501070_0146802 3300049586 Bacteria 1947
1354 Ga0501071_0000488 3300049587 Bacteria 20060
1355 Ga0501071_0003854 3300049587 Bacteria 9442
1356 Ga0501071_0005549 3300049587 Bacteria 8126
1357 Ga0501071_0019597 3300049587 Bacteria 4695
1358 Ga0501071_0020005 3300049587 Bacteria 4650
1359 Ga0501071_0025545 3300049587 Bacteria 4139
1360 Ga0501071_0039050 3300049587 Bacteria 3395
1361 Ga0501071_0048161 3300049587 Bacteria 3064
1362 Ga0501071_0075934 3300049587 Bacteria 2453
1363 Ga0501071_0116344 3300049587 Bacteria 1979
1364 Ga0501071_0184437 3300049587 Bacteria 1564
1365 Ga0501072_0004844 3300049588 Bacteria 10248
1366 Ga0501072_0009359 3300049588 Bacteria 7448
1367 Ga0501072_0009420 3300049588 Bacteria 7425
1368 Ga0501072_0013185 3300049588 Bacteria 6329
1369 Ga0501072_0017150 3300049588 Bacteria 5564
1370 Ga0501072_0029963 3300049588 Bacteria 4252
1371 Ga0501072_0031779 3300049588 Bacteria 4133
1372 Ga0501072_0032367 3300049588 Bacteria 4095
1373 Ga0501072_0061470 3300049588 Bacteria 2963
1374 Ga0501072_0071964 3300049588 Bacteria 2732
1375 Ga0501072_0105608 3300049588 Bacteria 2239
1376 Ga0501072_0303699 3300049588 Bacteria 1269
1377 Ga0501073_0007238 3300049589 Bacteria 8263
1378 Ga0501073_0013683 3300049589 Bacteria 5903
1379 Ga0501073_0015002 3300049589 Bacteria 5621
1380 Ga0501073_0126313 3300049589 Bacteria 1773
1381 Ga0501073_0214598 3300049589 Bacteria 1330
1382 Ga0501074_0000074 3300049590 Bacteria 48322
1383 Ga0501074_0019499 3300049590 Bacteria 4925
1384 Ga0501074_0058553 3300049590 Bacteria 2776
1385 Ga0501074_0088881 3300049590 Bacteria 2212
1386 Ga0501074_0106746 3300049590 Bacteria 2005
1387 Ga0501075_0003648 3300049591 Bacteria 10323
1388 Ga0501075_0018685 3300049591 Bacteria 5019
1389 Ga0501075_0025444 3300049591 Bacteria 4348
1390 Ga0501075_0040497 3300049591 Bacteria 3489
1391 Ga0501075_0041989 3300049591 Bacteria 3429
1392 Ga0501075_0073297 3300049591 Bacteria 2589
1393 Ga0501075_0098365 3300049591 Bacteria 2221
1394 Ga0501075_0233080 3300049591 Bacteria 1404
1395 Ga0501076_0002631 3300049592 Bacteria 12381
1396 Ga0501076_0007851 3300049592 Bacteria 7775
1397 Ga0501076_0011199 3300049592 Bacteria 6676
1398 Ga0501076_0011969 3300049592 Bacteria 6481
1399 Ga0501076_0041077 3300049592 Bacteria 3637
1400 Ga0501076_0105052 3300049592 Bacteria 2279
1401 Ga0501076_0200901 3300049592 Bacteria 1628
1402 Ga0501076_0257598 3300049592 Bacteria 1428
1403 Ga0501077_0016934 3300049593 Bacteria 4597
1404 Ga0501077_0062494 3300049593 Bacteria 2363
1405 Ga0501077_0100103 3300049593 Bacteria 1837
1406 Ga0501077_0176385 3300049593 Bacteria 1358
1407 Ga0501221_014438 3300049704 Bacteria 1468
1408 Ga0501079_0005025 3300049741 Bacteria 9816
1409 Ga0501079_0018044 3300049741 Bacteria 5389
1410 Ga0501079_0024592 3300049741 Bacteria 4622
1411 Ga0501079_0047886 3300049741 Bacteria 3299
1412 Ga0501079_0061460 3300049741 Bacteria 2898
1413 Ga0501079_0100333 3300049741 Bacteria 2244
1414 Ga0501079_0106723 3300049741 Bacteria 2173
1415 Ga0501079_0107212 3300049741 Bacteria 2169
1416 Ga0501079_0170704 3300049741 Bacteria 1696
1417 Ga0501080_0000244 3300049742 Bacteria 40757
1418 Ga0501080_0000414 3300049742 Bacteria 32763
1419 Ga0501080_0070329 3300049742 Bacteria 3255
1420 Ga0501080_0096840 3300049742 Bacteria 2740
1421 Ga0501080_0104895 3300049742 Bacteria 2621
1422 Ga0501080_0161284 3300049742 Bacteria 2071
1423 Ga0501081_0000754 3300049743 Bacteria 18935
1424 Ga0501081_0008776 3300049743 Bacteria 6570
1425 Ga0501081_0011798 3300049743 Bacteria 5724
1426 Ga0501081_0090290 3300049743 Bacteria 2153
1427 Ga0501081_0138662 3300049743 Bacteria 1742
1428 Ga0501081_0142686 3300049743 Bacteria 1717
1429 Ga0501081_0195964 3300049743 Bacteria 1464
1430 Ga0501083_0019965 3300049744 Bacteria 4663
1431 Ga0501083_0036872 3300049744 Bacteria 3332
1432 Ga0501083_0192587 3300049744 Bacteria 1331
1433 Ga0501264_000063 3300049761 Bacteria 15044
1434 Ga0501035_0000262 3300049822 Bacteria 62472
1435 Ga0501035_0013824 3300049822 Bacteria 7450
1436 Ga0501035_0108437 3300049822 Bacteria 2435
1437 Ga0501044_0000312 3300049823 Bacteria 61322
1438 Ga0501045_0003035 3300049824 Bacteria 11480
1439 Ga0501045_0003799 3300049824 Bacteria 10386
1440 Ga0501045_0011531 3300049824 Bacteria 6208
1441 Ga0501045_0017723 3300049824 Bacteria 5057
1442 Ga0501045_0025444 3300049824 Bacteria 4254
1443 Ga0501045_0034416 3300049824 Bacteria 3677
1444 Ga0501045_0074245 3300049824 Bacteria 2504
1445 Ga0501045_0082011 3300049824 Bacteria 2378
1446 Ga0501045_0147944 3300049824 Bacteria 1747
1447 nmdc:mga03n38_31977_c1 3300050490 Bacteria 2225
1448 nmdc:mga00v17_102676_c1 3300050491 Bacteria 1806
1449 nmdc:mga00v17_105147_c1 3300050491 Bacteria 1786
1450 nmdc:mga0yw44_12118_c1 3300050492 Bacteria 4482
1451 nmdc:mga0yw44_148377_c1 3300050492 Bacteria 1528
1452 nmdc:mga0yw44_18976_c1 3300050492 Bacteria 3355
1453 nmdc:mga0yw44_52124_c1 3300050492 Bacteria 2480
1454 nmdc:mga0yw44_64894_c1 3300050492 Bacteria 2248
1455 nmdc:mga0k408_24679_c1 3300050493 Bacteria 3400
1456 nmdc:mga0k408_76416_c1 3300050493 Bacteria 1957
1457 nmdc:mga06z11_50726_c1 3300050494 Bacteria 2122
1458 nmdc:mga06z11_98093_c1 3300050494 Bacteria 1603
1459 nmdc:mga07m45_24539_c1 3300050496 Bacteria 3305
1460 nmdc:mga07m45_25794_c1 3300050496 Bacteria 3227
1461 nmdc:mga05p37_10188_c1 3300050507 Bacteria 11159
1462 nmdc:mga05p37_115999_c1 3300050507 Bacteria 3291
1463 nmdc:mga05p37_123154_c1 3300050507 Bacteria 3185
1464 nmdc:mga05p37_12946_c1 3300050507 Bacteria 9978
1465 nmdc:mga05p37_13104_c1 3300050507 Bacteria 9923
1466 nmdc:mga05p37_13976_c1 3300050507 Bacteria 9626
1467 nmdc:mga05p37_147215_c1 3300050507 Bacteria 2882
1468 nmdc:mga05p37_156577_c1 3300050507 Bacteria 2784
1469 nmdc:mga05p37_16959_c1 3300050507 Bacteria 8785
1470 nmdc:mga05p37_275_c1 3300050507 Bacteria 53593
1471 nmdc:mga05p37_3361_c1 3300050507 Bacteria 18671
1472 nmdc:mga05p37_441566_c1 3300050507 Bacteria 1509
1473 nmdc:mga05p37_444686_c1 3300050507 Bacteria 1502
1474 nmdc:mga05p37_45778_c1 3300050507 Bacteria 5380
1475 nmdc:mga05p37_482297_c1 3300050507 Bacteria 1428
1476 nmdc:mga05p37_6361_c1 3300050507 Bacteria 13918
1477 nmdc:mga05p37_63640_c1 3300050507 Bacteria 4539
1478 nmdc:mga05p37_65409_c1 3300050507 Bacteria 4474
1479 nmdc:mga09592_12832_c1 3300050508 Bacteria 6831
1480 nmdc:mga09592_137332_c1 3300050508 Bacteria 2106
1481 nmdc:mga09592_182953_c1 3300050508 Bacteria 1813
1482 nmdc:mga09592_183003_c1 3300050508 Bacteria 1813
1483 nmdc:mga09592_252817_c1 3300050508 Bacteria 1528
1484 nmdc:mga09592_302676_c1 3300050508 Bacteria 1386
1485 nmdc:mga09592_5612_c1 3300050508 Bacteria 10225
1486 nmdc:mga09592_65081_c1 3300050508 Bacteria 3087
1487 nmdc:mga09592_67270_c1 3300050508 Bacteria 3038
1488 nmdc:mga09592_70846_c1 3300050508 Bacteria 2959
1489 nmdc:mga09592_953_c1 3300050508 Bacteria 22761
1490 nmdc:mga09592_96657_c1 3300050508 Bacteria 2527
1491 nmdc:mga0qj67_13711_c1 3300050509 Bacteria 6117
1492 nmdc:mga0qj67_21101_c1 3300050509 Bacteria 4995
1493 nmdc:mga0qj67_24595_c1 3300050509 Bacteria 4644
1494 nmdc:mga0qj67_245972_c1 3300050509 Bacteria 1451
1495 nmdc:mga0qj67_2517_c1 3300050509 Bacteria 13091
1496 nmdc:mga0qj67_2598_c1 3300050509 Bacteria 12929
1497 nmdc:mga0qj67_75052_c1 3300050509 Bacteria 2702
1498 nmdc:mga0qj67_95202_c1 3300050509 Bacteria 2396
1499 nmdc:mga06r32_10914_c1 3300050510 Bacteria 8179
1500 nmdc:mga06r32_113653_c1 3300050510 Bacteria 2665
1501 nmdc:mga06r32_113980_c1 3300050510 Bacteria 2661
1502 nmdc:mga06r32_14263_c1 3300050510 Bacteria 7208
1503 nmdc:mga06r32_14472_c1 3300050510 Bacteria 7159
1504 nmdc:mga06r32_15782_c1 3300050510 Bacteria 6866
1505 nmdc:mga06r32_220850_c1 3300050510 Bacteria 1883
1506 nmdc:mga06r32_4670_c1 3300050510 Bacteria 12295
1507 nmdc:mga06r32_46937_c1 3300050510 Bacteria 4124
1508 nmdc:mga06r32_48535_c1 3300050510 Bacteria 4058
1509 nmdc:mga06r32_52312_c1 3300050510 Bacteria 3911
1510 nmdc:mga06r32_66280_c1 3300050510 Bacteria 3484
1511 nmdc:mga06r32_66410_c1 3300050510 Bacteria 3481
1512 nmdc:mga06r32_6887_c1 3300050510 Bacteria 10217
1513 nmdc:mga06r32_7657_c1 3300050510 Bacteria 9712
1514 nmdc:mga08y16_103170_c1 3300050511 Bacteria 2969
1515 nmdc:mga08y16_11284_c1 3300050511 Bacteria 9388
1516 nmdc:mga08y16_185985_c1 3300050511 Bacteria 2156
1517 nmdc:mga08y16_269854_c1 3300050511 Bacteria 1757
1518 nmdc:mga08y16_2708_c1 3300050511 Bacteria 18180
1519 nmdc:mga08y16_273965_c1 3300050511 Bacteria 1742
1520 nmdc:mga08y16_282487_c1 3300050511 Bacteria 1712
1521 nmdc:mga08y16_28869_c1 3300050511 Bacteria 5848
1522 nmdc:mga08y16_32443_c1 3300050511 Bacteria 5490
1523 nmdc:mga08y16_3393_c1 3300050511 Bacteria 16521
1524 nmdc:mga08y16_46864_c1 3300050511 Bacteria 4525
1525 nmdc:mga08y16_504_c1 3300050511 Bacteria 36040
1526 nmdc:mga08y16_6332_c1 3300050511 Bacteria 12414
1527 nmdc:mga08y16_8405_c1 3300050511 Bacteria 10802
1528 nmdc:mga0n895_10806_c1 3300050512 Bacteria 8100
1529 nmdc:mga0n895_118817_c1 3300050512 Bacteria 2664
1530 nmdc:mga0n895_11991_c1 3300050512 Bacteria 7756
1531 nmdc:mga0n895_130462_c1 3300050512 Bacteria 2538
1532 nmdc:mga0n895_18517_c1 3300050512 Bacteria 6446
1533 nmdc:mga0n895_20427_c1 3300050512 Bacteria 6178
1534 nmdc:mga0n895_2106_c1 3300050512 Bacteria 15347
1535 nmdc:mga0n895_28190_c1 3300050512 Bacteria 5342
1536 nmdc:mga0n895_50397_c1 3300050512 Bacteria 4082
1537 nmdc:mga0n895_5966_c1 3300050512 Bacteria 10256
1538 nmdc:mga0n895_62888_c1 3300050512 Bacteria 3669
1539 nmdc:mga0n895_78707_c1 3300050512 Bacteria 3281
1540 nmdc:mga0n895_829_c1 3300050512 Bacteria 22161
1541 nmdc:mga0rr50_145299_c1 3300050513 Bacteria 1912
1542 nmdc:mga0rr50_151407_c1 3300050513 Bacteria 1875
1543 nmdc:mga0rr50_167056_c1 3300050513 Bacteria 1790
1544 nmdc:mga0rr50_32236_c1 3300050513 Bacteria 3732
1545 nmdc:mga0rr50_354_c1 3300050513 Bacteria 24902
1546 nmdc:mga0rr50_7956_c1 3300050513 Bacteria 6579
1547 nmdc:mga0rr50_80461_c1 3300050513 Bacteria 2512
1548 nmdc:mga08x19_2446_c1 3300050514 Bacteria 11284
1549 nmdc:mga0a205_1093_c1 3300050515 Bacteria 22518
1550 nmdc:mga0a205_140551_c1 3300050515 Bacteria 2315
1551 nmdc:mga0a205_141186_c1 3300050515 Bacteria 2309
1552 nmdc:mga0a205_14504_c1 3300050515 Bacteria 7352
1553 nmdc:mga0a205_146419_c1 3300050515 Bacteria 2262
1554 nmdc:mga0a205_18128_c1 3300050515 Bacteria 6614
1555 nmdc:mga0a205_2072_c1 3300050515 Bacteria 17539
1556 nmdc:mga0a205_3147_c1 3300050515 Bacteria 14638
1557 nmdc:mga0a205_38110_c1 3300050515 Bacteria 4624
1558 nmdc:mga0a205_72728_c1 3300050515 Bacteria 3322
1559 nmdc:mga0a205_74669_c1 3300050515 Bacteria 2099
1560 Ga0495601_0006657 3300053077 Bacteria 6763
1561 Ga0495595_0006010 3300053084 Bacteria 4931
1562 Ga0495619_0003726 3300053085 Bacteria 9825
1563 Ga0495619_0011460 3300053085 Bacteria 5587
1564 Ga0495619_0074185 3300053085 Bacteria 2281
1565 Ga0495619_0081543 3300053085 Bacteria 2178
1566 Ga0495619_0088962 3300053085 Bacteria 2089
1567 Ga0500643_000913 3300053087 Bacteria 18624
1568 Ga0500644_0000106 3300053088 Bacteria 52751
1569 Ga0500641_0002700 3300053096 Bacteria 6267
1570 Ga0500556_0000001 3300053104 Bacteria 1135060
1571 Ga0500568_0000003 3300053139 Bacteria 863587
1572 Ga0500568_0032010 3300053139 Bacteria 2164
1573 Ga0500604_0002802 3300053151 Bacteria 4732
1574 Ga0500616_0000007 3300053153 Bacteria 836875
1575 Ga0500616_0000205 3300053153 Bacteria 96713
1576 Ga0500616_0037765 3300053153 Bacteria 2613
1577 Ga0500622_0000066 3300053156 Bacteria 124842
1578 Ga0500622_0000179 3300053156 Bacteria 68943
1579 Ga0500622_0001539 3300053156 Bacteria 18262
1580 Ga0500645_001172 3300053730 Bacteria 14012
1581 Ga0501084_0001637 3300054114 Bacteria 17781
1582 Ga0501084_0006547 3300054114 Bacteria 9576
1583 Ga0501084_0023342 3300054114 Bacteria 5163
1584 Ga0501084_0023478 3300054114 Bacteria 5145
1585 Ga0501084_0026974 3300054114 Bacteria 4799
1586 Ga0501084_0043651 3300054114 Bacteria 3750
1587 Ga0501084_0053078 3300054114 Bacteria 3390
1588 Ga0501084_0066241 3300054114 Bacteria 3022
1589 Ga0501084_0135199 3300054114 Bacteria 2076
1590 Ga0501084_0167806 3300054114 Bacteria 1853
1591 Ga0501084_0282519 3300054114 Bacteria 1402
1592 Ga0590071_014634 3300059421 Bacteria 1840
1593 Ga0590075_000348 3300059424 Bacteria 12914
1594 Ga0590075_000928 3300059424 Bacteria 7624
1595 Ga0590077_000323 3300059426 Bacteria 13559
1596 Ga0590077_003620 3300059426 Bacteria 3192
1597 Ga0501082_0002453 3300060353 Bacteria 16280
1598 Ga0501082_0007432 3300060353 Bacteria 9454
1599 Ga0501082_0012030 3300060353 Bacteria 7439
1600 Ga0501082_0022921 3300060353 Bacteria 5380
1601 Ga0501082_0038929 3300060353 Bacteria 4101
1602 Ga0501082_0063921 3300060353 Bacteria 3169
1603 Ga0501082_0073646 3300060353 Bacteria 2942
1604 Ga0501082_0107841 3300060353 Bacteria 2410
1605 Ga0466962_0006259 3300061719 Bacteria 5719
1606 Ga0530510_0002726 3300061734 Bacteria 12164
1607 Ga0530510_0017917 3300061734 Bacteria 5021
1608 Ga0530510_0022875 3300061734 Bacteria 4454
1609 Ga0530510_0027284 3300061734 Bacteria 4092
1610 Ga0530510_0029713 3300061734 Bacteria 3923
1611 Ga0530510_0034058 3300061734 Bacteria 3668
1612 Ga0530510_0041103 3300061734 Bacteria 3338
1613 Ga0530510_0078292 3300061734 Bacteria 2403

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026089 Ga0207648_10063665 Ga0207648_100636651 267
2 3300038735 Ga0400485_03365 Ga0400485_03365_3746_4690 292
3 3300038742 Ga0400486_13051 Ga0400486_13051_7919_8863 292
4 3300050492 nmdc:mga0yw44_148377_c1 nmdc:mga0yw44_148377_c1_543_1502 293
5 3300035725 Ga0373947_0013397 Ga0373947_0013397_3779_4678 296
6 3300046689 Ga0495613_0124506 Ga0495613_0124506_26_925 296
7 3300025942 Ga0207689_10292362 Ga0207689_102923622 298
8 3300003323 rootH1_10038814 rootH1_100388146 299
9 3300035398 Ga0316574_0080492 Ga0316574_0080492_18_953 299
10 3300038735 Ga0400485_09643 Ga0400485_09643_97_1041 300
11 3300031727 Ga0316576_10056092 Ga0316576_100560924 301
12 3300032133 Ga0316583_10068207 Ga0316583_100682071 303
13 3300032139 Ga0316580_10006543 Ga0316580_100065432 303
14 3300031727 Ga0316576_10027074 Ga0316576_100270742 304
15 3300044712 Ga0453684_0015989 Ga0453684_0015989_4857_5792 304
16 3300031665 Ga0316575_10000826 Ga0316575_100008269 307
17 3300031691 Ga0316579_10008036 Ga0316579_100080365 307
18 3300031727 Ga0316576_10011842 Ga0316576_100118426 307
19 3300031728 Ga0316578_10001433 Ga0316578_100014338 307
20 3300031733 Ga0316577_10000089 Ga0316577_1000008918 307
21 3300031733 Ga0316577_10000636 Ga0316577_1000063615 307
22 3300032133 Ga0316583_10009047 Ga0316583_100090472 307
23 3300032137 Ga0316585_10053676 Ga0316585_100536761 307
24 3300032139 Ga0316580_10001255 Ga0316580_100012553 307
25 3300035398 Ga0316574_0000151 Ga0316574_0000151_2141_3085 307
26 3300036647 Ga0316582_0000480 Ga0316582_0000480_9980_10924 307
27 3300036647 Ga0316582_0006227 Ga0316582_0006227_1899_2843 307
28 3300036712 Ga0316584_0001506 Ga0316584_0001506_6438_7439 307
29 3300036712 Ga0316584_0011733 Ga0316584_0011733_3756_4700 307
30 3300038725 Ga0400484_12566 Ga0400484_12566_7757_8716 307
31 3300038726 Ga0400490_39545 Ga0400490_39545_7806_8756 307
32 3300038727 Ga0400491_07905 Ga0400491_07905_2188_3138 307
33 3300038741 Ga0400488_41691 Ga0400488_41691_277_1350 307
34 3300039062 Ga0400483_032670 Ga0400483_032670_845_1789 307
35 3300039062 Ga0400483_155563 Ga0400483_155563_3329_4273 307
36 3300039093 Ga0400489_27482 Ga0400489_27482_12355_13299 307
37 3300031665 Ga0316575_10001083 Ga0316575_100010834 308
38 3300031691 Ga0316579_10039001 Ga0316579_100390012 308
39 3300031733 Ga0316577_10089796 Ga0316577_100897962 308
40 3300032133 Ga0316583_10021849 Ga0316583_100218493 308
41 3300032137 Ga0316585_10021473 Ga0316585_100214732 308
42 3300035398 Ga0316574_0001764 Ga0316574_0001764_2578_3537 308
43 3300036647 Ga0316582_0015286 Ga0316582_0015286_1814_2773 308
44 3300036712 Ga0316584_0023624 Ga0316584_0023624_2038_2997 308
45 3300036712 Ga0316584_0046235 Ga0316584_0046235_1401_2360 308
46 3300031727 Ga0316576_10071907 Ga0316576_100719071 309
47 3300032168 Ga0316593_10008734 Ga0316593_100087343 309
48 3300003316 rootH1_10130565 rootH1_101305652 311
49 3300014326 Ga0157380_10064627 Ga0157380_100646272 311
50 3300050508 nmdc:mga09592_302676_c1 nmdc:mga09592_302676_c1_406_1356 312
51 3300035118 Ga0373954_0023176 Ga0373954_0023176_1681_2790 313
52 3300025961 Ga0207712_10048939 Ga0207712_100489392 314
53 3300026067 Ga0207678_10036465 Ga0207678_100364652 314
54 3300041498 Ga0451841_0256531 Ga0451841_0256531_187_1209 315
55 3300005340 Ga0070689_100014123 Ga0070689_1000141232 317
56 3300005353 Ga0070669_100027704 Ga0070669_1000277044 317
57 3300005355 Ga0070671_100010783 Ga0070671_1000107835 317
58 3300005365 Ga0070688_100003997 Ga0070688_1000039973 317
59 3300005366 Ga0070659_100197851 Ga0070659_1001978512 317
60 3300005367 Ga0070667_100106195 Ga0070667_1001061952 317
61 3300005444 Ga0070694_100095545 Ga0070694_1000955452 317
62 3300005466 Ga0070685_10004772 Ga0070685_100047726 317
63 3300005535 Ga0070684_100139022 Ga0070684_1001390222 317
64 3300005539 Ga0068853_100209435 Ga0068853_1002094352 317
65 3300005543 Ga0070672_100021164 Ga0070672_1000211642 317
66 3300005564 Ga0070664_100130673 Ga0070664_1001306732 317
67 3300005834 Ga0068851_10028093 Ga0068851_100280932 317
68 3300006038 Ga0075365_10065905 Ga0075365_100659052 317
69 3300006358 Ga0068871_100195840 Ga0068871_1001958402 317
70 3300009101 Ga0105247_10011104 Ga0105247_100111042 317
71 3300009148 Ga0105243_10163848 Ga0105243_101638482 317
72 3300009177 Ga0105248_10079334 Ga0105248_100793343 317
73 3300009551 Ga0105238_10137774 Ga0105238_101377742 317
74 3300009553 Ga0105249_10412692 Ga0105249_104126922 317
75 3300010375 Ga0105239_10274524 Ga0105239_102745242 317
76 3300013296 Ga0157374_10242036 Ga0157374_102420362 317
77 3300014968 Ga0157379_10044088 Ga0157379_100440882 317
78 3300014969 Ga0157376_10011280 Ga0157376_100112802 317
79 3300025918 Ga0207662_10019025 Ga0207662_100190252 317
80 3300025931 Ga0207644_10153803 Ga0207644_101538032 317
81 3300025933 Ga0207706_10087790 Ga0207706_100877902 317
82 3300025936 Ga0207670_10198646 Ga0207670_101986462 317
83 3300025937 Ga0207669_10058122 Ga0207669_100581222 317
84 3300025940 Ga0207691_10029696 Ga0207691_100296962 317
85 3300025941 Ga0207711_10097778 Ga0207711_100977782 317
86 3300025942 Ga0207689_10038079 Ga0207689_100380792 317
87 3300025945 Ga0207679_10168597 Ga0207679_101685972 317
88 3300026089 Ga0207648_10046921 Ga0207648_100469212 317
89 3300026118 Ga0207675_100012983 Ga0207675_1000129833 317
90 3300028380 Ga0268265_10191468 Ga0268265_101914682 317
91 3300048907 Ga0496104_0020628 Ga0496104_0020628_3829_4860 317
92 3300048915 Ga0496112_0194101 Ga0496112_0194101_463_1494 317
93 3300048916 Ga0496113_0021398 Ga0496113_0021398_1844_2875 317
94 3300005336 Ga0070680_100001439 Ga0070680_1000014396 318
95 3300005347 Ga0070668_100051252 Ga0070668_1000512522 318
96 3300005615 Ga0070702_100139159 Ga0070702_1001391592 318
97 3300006844 Ga0075428_100002710 Ga0075428_1000027108 318
98 3300006852 Ga0075433_10029614 Ga0075433_100296142 318
99 3300009098 Ga0105245_10018518 Ga0105245_100185183 318
100 3300009148 Ga0105243_10057372 Ga0105243_100573722 318
101 3300027907 Ga0207428_10000393 Ga0207428_1000039311 318
102 3300050507 nmdc:mga05p37_13976_c1 nmdc:mga05p37_13976_c1_1971_2990 318
103 3300050515 nmdc:mga0a205_18128_c1 nmdc:mga0a205_18128_c1_2439_3458 318
104 3300005339 Ga0070660_100086389 Ga0070660_1000863892 319
105 3300005458 Ga0070681_10104952 Ga0070681_101049522 319
106 3300005530 Ga0070679_100024192 Ga0070679_1000241922 319
107 3300005535 Ga0070684_100171779 Ga0070684_1001717792 319
108 3300005547 Ga0070693_100124278 Ga0070693_1001242782 319
109 3300006048 Ga0075363_100000364 Ga0075363_1000003646 319
110 3300006051 Ga0075364_10059297 Ga0075364_100592972 319
111 3300006353 Ga0075370_10034318 Ga0075370_100343183 319
112 3300006847 Ga0075431_100179361 Ga0075431_1001793612 319
113 3300006880 Ga0075429_100057994 Ga0075429_1000579942 319
114 3300009094 Ga0111539_10037135 Ga0111539_100371352 319
115 3300009147 Ga0114129_10017930 Ga0114129_1001793011 319
116 3300014326 Ga0157380_10037074 Ga0157380_100370742 319
117 3300025907 Ga0207645_10080516 Ga0207645_100805162 319
118 3300025912 Ga0207707_10019997 Ga0207707_100199972 319
119 3300025917 Ga0207660_10015632 Ga0207660_100156322 319
120 3300025927 Ga0207687_10016974 Ga0207687_100169742 319
121 3300025933 Ga0207706_10082819 Ga0207706_100828192 319
122 3300025935 Ga0207709_10010140 Ga0207709_100101402 319
123 3300025961 Ga0207712_10035472 Ga0207712_100354722 319
124 3300026075 Ga0207708_10314022 Ga0207708_103140221 319
125 3300026089 Ga0207648_10305520 Ga0207648_103055203 319
126 3300031344 Ga0265316_10238937 Ga0265316_102389371 319
127 3300046683 Ga0495658_0219255 Ga0495658_0219255_196_1164 319
128 3300005356 Ga0070674_100106384 Ga0070674_1001063841 320
129 3300026089 Ga0207648_10191481 Ga0207648_101914812 320
130 3300049576 Ga0501040_0020914 Ga0501040_0020914_3017_4051 320
131 3300049582 Ga0501048_0165633 Ga0501048_0165633_421_1455 320
132 3300049584 Ga0501068_0068423 Ga0501068_0068423_227_1261 320
133 3300049585 Ga0501069_0046809 Ga0501069_0046809_10_1044 320
134 3300049587 Ga0501071_0000488 Ga0501071_0000488_19006_20040 320
135 3300049589 Ga0501073_0126313 Ga0501073_0126313_720_1754 320
136 3300049590 Ga0501074_0058553 Ga0501074_0058553_474_1508 320
137 3300049591 Ga0501075_0025444 Ga0501075_0025444_3021_4055 320
138 3300049592 Ga0501076_0002631 Ga0501076_0002631_11265_12299 320
139 3300049741 Ga0501079_0005025 Ga0501079_0005025_8760_9794 320
140 3300049743 Ga0501081_0090290 Ga0501081_0090290_15_1049 320
141 3300049824 Ga0501045_0074245 Ga0501045_0074245_1430_2464 320
142 3300054114 Ga0501084_0053078 Ga0501084_0053078_80_1114 320
143 3300060353 Ga0501082_0038929 Ga0501082_0038929_798_1832 320
144 3300005344 Ga0070661_100075997 Ga0070661_1000759972 321
145 3300005345 Ga0070692_10019617 Ga0070692_100196173 321
146 3300005455 Ga0070663_100093338 Ga0070663_1000933382 321
147 3300005543 Ga0070672_100016774 Ga0070672_1000167743 321
148 3300005615 Ga0070702_100029233 Ga0070702_1000292332 321
149 3300005834 Ga0068851_10024137 Ga0068851_100241372 321
150 3300006881 Ga0068865_100051701 Ga0068865_1000517012 321
151 3300009098 Ga0105245_10049152 Ga0105245_100491523 321
152 3300009148 Ga0105243_10013026 Ga0105243_100130266 321
153 3300009177 Ga0105248_10098948 Ga0105248_100989482 321
154 3300013308 Ga0157375_10017505 Ga0157375_100175054 321
155 3300014745 Ga0157377_10011755 Ga0157377_100117552 321
156 3300020082 Ga0206353_10257956 Ga0206353_102579562 321
157 3300025321 Ga0207656_10045227 Ga0207656_100452272 321
158 3300025940 Ga0207691_10036136 Ga0207691_100361363 321
159 3300025941 Ga0207711_10090877 Ga0207711_100908771 321
160 3300025945 Ga0207679_10117062 Ga0207679_101170622 321
161 3300026067 Ga0207678_10045317 Ga0207678_100453172 321
162 3300044673 Ga0453683_0065627 Ga0453683_0065627_960_2072 321
163 3300046664 Ga0495659_0024145 Ga0495659_0024145_1087_2055 321
164 3300048911 Ga0496108_0168024 Ga0496108_0168024_562_1593 321
165 3300005435 Ga0070714_100037767 Ga0070714_1000377672 322
166 3300036401 Ga0373937_0008628 Ga0373937_0008628_890_1945 322
167 3300049573 Ga0501037_0030509 Ga0501037_0030509_1612_2607 322
168 3300005327 Ga0070658_10047664 Ga0070658_100476643 323
169 3300005337 Ga0070682_100012961 Ga0070682_1000129613 323
170 3300005339 Ga0070660_100015905 Ga0070660_1000159053 323
171 3300005354 Ga0070675_100033328 Ga0070675_1000333282 323
172 3300005356 Ga0070674_100008245 Ga0070674_1000082452 323
173 3300005364 Ga0070673_100039829 Ga0070673_1000398293 323
174 3300005366 Ga0070659_100012472 Ga0070659_1000124723 323
175 3300005535 Ga0070684_100169766 Ga0070684_1001697662 323
176 3300005539 Ga0068853_100011384 Ga0068853_1000113845 323
177 3300005563 Ga0068855_100108732 Ga0068855_1001087323 323
178 3300005578 Ga0068854_100030643 Ga0068854_1000306433 323
179 3300005614 Ga0068856_100220826 Ga0068856_1002208262 323
180 3300005616 Ga0068852_100064492 Ga0068852_1000644922 323
181 3300005718 Ga0068866_10038903 Ga0068866_100389032 323
182 3300006237 Ga0097621_100135672 Ga0097621_1001356722 323
183 3300006358 Ga0068871_100044770 Ga0068871_1000447702 323
184 3300009176 Ga0105242_10026311 Ga0105242_100263112 323
185 3300009551 Ga0105238_10170887 Ga0105238_101708872 323
186 3300010375 Ga0105239_10081521 Ga0105239_100815212 323
187 3300013102 Ga0157371_10024677 Ga0157371_100246773 323
188 3300013307 Ga0157372_10046056 Ga0157372_100460562 323
189 3300014325 Ga0163163_10071192 Ga0163163_100711922 323
190 3300025901 Ga0207688_10010791 Ga0207688_100107912 323
191 3300025909 Ga0207705_10054656 Ga0207705_100546562 323
192 3300025918 Ga0207662_10185391 Ga0207662_101853912 323
193 3300025919 Ga0207657_10040322 Ga0207657_100403224 323
194 3300025933 Ga0207706_10015076 Ga0207706_100150763 323
195 3300025934 Ga0207686_10217860 Ga0207686_102178602 323
196 3300025935 Ga0207709_10017542 Ga0207709_100175423 323
197 3300025981 Ga0207640_10063796 Ga0207640_100637962 323
198 3300026041 Ga0207639_10205469 Ga0207639_102054692 323
199 3300026078 Ga0207702_10032147 Ga0207702_100321472 323
200 3300026089 Ga0207648_10013721 Ga0207648_100137212 323
201 3300026121 Ga0207683_10054688 Ga0207683_100546882 323
202 3300044719 Ga0466971_0051355 Ga0466971_0051355_46_1155 323
203 3300045836 Ga0466958_0099781 Ga0466958_0099781_623_1732 323
204 3300048907 Ga0496104_0243987 Ga0496104_0243987_190_1221 323
205 3300049572 Ga0501036_0103190 Ga0501036_0103190_1358_2392 323
206 3300049575 Ga0501039_0021253 Ga0501039_0021253_3655_4689 323
207 3300049588 Ga0501072_0013185 Ga0501072_0013185_2017_3051 323
208 3300061719 Ga0466962_0006259 Ga0466962_0006259_1485_2594 323
209 3300009094 Ga0111539_10147900 Ga0111539_101479001 324
210 3300028556 Ga0265337_1026590 Ga0265337_10265901 324
211 3300050512 nmdc:mga0n895_62888_c1 nmdc:mga0n895_62888_c1_945_2111 325
212 3300046499 Ga0495594_0201852 Ga0495594_0201852_11_1105 326
213 3300049575 Ga0501039_0043221 Ga0501039_0043221_1303_2427 326
214 3300049578 Ga0501042_0050630 Ga0501042_0050630_27_1193 326
215 3300049588 Ga0501072_0009359 Ga0501072_0009359_5586_6710 326
216 3300049591 Ga0501075_0040497 Ga0501075_0040497_1087_2211 326
217 3300049742 Ga0501080_0104895 Ga0501080_0104895_577_1701 326
218 3300049824 Ga0501045_0003035 Ga0501045_0003035_113_1237 326
219 3300054114 Ga0501084_0026974 Ga0501084_0026974_3553_4677 326
220 3300060353 Ga0501082_0007432 Ga0501082_0007432_2075_3199 326
221 3300005330 Ga0070690_100046269 Ga0070690_1000462692 327
222 3300005456 Ga0070678_100002431 Ga0070678_1000024317 327
223 3300005544 Ga0070686_100002473 Ga0070686_1000024737 327
224 3300005547 Ga0070693_100036425 Ga0070693_1000364252 327
225 3300005843 Ga0068860_100108479 Ga0068860_1001084792 327
226 3300006358 Ga0068871_100005779 Ga0068871_1000057792 327
227 3300009101 Ga0105247_10018503 Ga0105247_100185033 327
228 3300009148 Ga0105243_10009076 Ga0105243_100090765 327
229 3300009174 Ga0105241_10009863 Ga0105241_100098632 327
230 3300009176 Ga0105242_10002197 Ga0105242_100021975 327
231 3300013297 Ga0157378_10090899 Ga0157378_100908992 327
232 3300014968 Ga0157379_10017832 Ga0157379_100178325 327
233 3300014969 Ga0157376_10070517 Ga0157376_100705172 327
234 3300025899 Ga0207642_10036849 Ga0207642_100368492 327
235 3300025911 Ga0207654_10014370 Ga0207654_100143702 327
236 3300025934 Ga0207686_10003421 Ga0207686_100034215 327
237 3300025935 Ga0207709_10167256 Ga0207709_101672561 327
238 3300025941 Ga0207711_10011686 Ga0207711_100116862 327
239 3300025986 Ga0207658_10105918 Ga0207658_101059182 327
240 3300026067 Ga0207678_10067075 Ga0207678_100670752 327
241 3300026089 Ga0207648_10113510 Ga0207648_101135102 327
242 3300026121 Ga0207683_10000190 Ga0207683_1000019052 327
243 3300028381 Ga0268264_10303755 Ga0268264_103037552 327
244 3300045049 Ga0466959_0009315 Ga0466959_0009315_5754_6794 327
245 3300048905 Ga0496102_0043243 Ga0496102_0043243_2597_3691 327
246 3300048908 Ga0496105_0000513 Ga0496105_0000513_1540_2634 327
247 3300048909 Ga0496106_0006809 Ga0496106_0006809_684_1778 327
248 3300048910 Ga0496107_0003244 Ga0496107_0003244_981_2075 327
249 3300048917 Ga0496114_0144195 Ga0496114_0144195_201_1259 327
250 3300005354 Ga0070675_100012438 Ga0070675_1000124387 328
251 3300027671 Ga0209588_1022596 Ga0209588_10225962 328
252 3300044673 Ga0453683_0193185 Ga0453683_0193185_137_1180 328
253 3300006844 Ga0075428_100000100 Ga0075428_10000010046 329
254 3300009094 Ga0111539_10003771 Ga0111539_100037719 329
255 3300027907 Ga0207428_10084727 Ga0207428_100847272 329
256 3300045051 Ga0451576_0165470 Ga0451576_0165470_1027_2130 329
257 3300050511 nmdc:mga08y16_3393_c1 nmdc:mga08y16_3393_c1_7908_9011 329
258 3300005445 Ga0070708_100036455 Ga0070708_1000364554 330
259 3300005468 Ga0070707_100005817 Ga0070707_1000058172 330
260 3300009093 Ga0105240_10405961 Ga0105240_104059611 330
261 3300036647 Ga0316582_0043091 Ga0316582_0043091_1500_2549 330
262 3300036712 Ga0316584_0000413 Ga0316584_0000413_4673_5722 330
263 3300038443 Ga0395901_0023635 Ga0395901_0023635_2886_3911 330
264 3300042146 Ga0450907_002845 Ga0450907_002845_674_1690 330
265 3300049541 Ga0501325_001364 Ga0501325_001364_370_1413 330
266 3300005327 Ga0070658_10021319 Ga0070658_100213195 331
267 3300005329 Ga0070683_100080888 Ga0070683_1000808882 331
268 3300005458 Ga0070681_10097714 Ga0070681_100977141 331
269 3300005535 Ga0070684_100086426 Ga0070684_1000864262 331
270 3300005842 Ga0068858_100000002 Ga0068858_100000002243 331
271 3300009177 Ga0105248_10000943 Ga0105248_1000094318 331
272 3300013308 Ga0157375_10107640 Ga0157375_101076402 331
273 3300014968 Ga0157379_10000007 Ga0157379_1000000774 331
274 3300025919 Ga0207657_10024642 Ga0207657_100246424 331
275 3300025941 Ga0207711_10001278 Ga0207711_1000127818 331
276 3300025944 Ga0207661_10017151 Ga0207661_100171514 331
277 3300026035 Ga0207703_10000001 Ga0207703_10000001486 331
278 3300026078 Ga0207702_10135040 Ga0207702_101350402 331
279 3300026116 Ga0207674_10019100 Ga0207674_100191002 331
280 3300041413 Ga0439465_0015220 Ga0439465_0015220_793_1839 331
281 3300042122 Ga0450920_001937 Ga0450920_001937_792_1811 331
282 3300048913 Ga0496110_0006677 Ga0496110_0006677_7815_8834 331
283 3300048916 Ga0496113_0012915 Ga0496113_0012915_1710_2729 331
284 3300049588 Ga0501072_0032367 Ga0501072_0032367_856_1875 331
285 3300049588 Ga0501072_0303699 Ga0501072_0303699_44_1063 331
286 3300049589 Ga0501073_0214598 Ga0501073_0214598_56_1084 331
287 3300049590 Ga0501074_0106746 Ga0501074_0106746_614_1633 331
288 3300049591 Ga0501075_0041989 Ga0501075_0041989_1987_3006 331
289 3300003203 JGI25406J46586_10002115 JGI25406J46586_100021153 332
290 3300005327 Ga0070658_10063213 Ga0070658_100632132 332
291 3300005329 Ga0070683_100066029 Ga0070683_1000660292 332
292 3300005329 Ga0070683_100072617 Ga0070683_1000726172 332
293 3300005356 Ga0070674_100021567 Ga0070674_1000215672 332
294 3300005366 Ga0070659_100196671 Ga0070659_1001966712 332
295 3300005435 Ga0070714_100004846 Ga0070714_1000048462 332
296 3300005457 Ga0070662_100105552 Ga0070662_1001055522 332
297 3300005458 Ga0070681_10115744 Ga0070681_101157442 332
298 3300005530 Ga0070679_100062464 Ga0070679_1000624642 332
299 3300005535 Ga0070684_100023808 Ga0070684_1000238084 332
300 3300005543 Ga0070672_100027841 Ga0070672_1000278413 332
301 3300005563 Ga0068855_100009123 Ga0068855_1000091232 332
302 3300005564 Ga0070664_100287132 Ga0070664_1002871322 332
303 3300005578 Ga0068854_100296381 Ga0068854_1002963812 332
304 3300005616 Ga0068852_100045599 Ga0068852_1000455992 332
305 3300005843 Ga0068860_100202888 Ga0068860_1002028882 332
306 3300005985 Ga0081539_10000244 Ga0081539_1000024484 332
307 3300006881 Ga0068865_100004918 Ga0068865_1000049186 332
308 3300009094 Ga0111539_10034471 Ga0111539_100344712 332
309 3300009148 Ga0105243_10002886 Ga0105243_100028868 332
310 3300009176 Ga0105242_10190971 Ga0105242_101909711 332
311 3300009177 Ga0105248_10009334 Ga0105248_100093348 332
312 3300009551 Ga0105238_10197339 Ga0105238_101973392 332
313 3300010375 Ga0105239_10112876 Ga0105239_101128762 332
314 3300011119 Ga0105246_10002150 Ga0105246_100021506 332
315 3300011119 Ga0105246_10143116 Ga0105246_101431162 332
316 3300013104 Ga0157370_10016729 Ga0157370_100167294 332
317 3300013104 Ga0157370_10116970 Ga0157370_101169702 332
318 3300013105 Ga0157369_10012708 Ga0157369_100127082 332
319 3300013307 Ga0157372_10079042 Ga0157372_100790422 332
320 3300013308 Ga0157375_10066597 Ga0157375_100665972 332
321 3300014325 Ga0163163_10210525 Ga0163163_102105252 332
322 3300014326 Ga0157380_10014471 Ga0157380_100144714 332
323 3300020070 Ga0206356_10209910 Ga0206356_102099102 332
324 3300020082 Ga0206353_11931331 Ga0206353_119313313 332
325 3300025909 Ga0207705_10069859 Ga0207705_100698592 332
326 3300025913 Ga0207695_10059773 Ga0207695_100597733 332
327 3300025921 Ga0207652_10047440 Ga0207652_100474402 332
328 3300025922 Ga0207646_10009215 Ga0207646_1000921510 332
329 3300025929 Ga0207664_10083724 Ga0207664_100837242 332
330 3300025933 Ga0207706_10038166 Ga0207706_100381663 332
331 3300025936 Ga0207670_10274841 Ga0207670_102748411 332
332 3300025940 Ga0207691_10030061 Ga0207691_100300615 332
333 3300025944 Ga0207661_10059670 Ga0207661_100596702 332
334 3300025949 Ga0207667_10073659 Ga0207667_100736592 332
335 3300025981 Ga0207640_10145833 Ga0207640_101458332 332
336 3300026067 Ga0207678_10112554 Ga0207678_101125542 332
337 3300026089 Ga0207648_10031547 Ga0207648_100315472 332
338 3300026142 Ga0207698_10060892 Ga0207698_100608922 332
339 3300027907 Ga0207428_10011660 Ga0207428_100116607 332
340 3300027907 Ga0207428_10063561 Ga0207428_100635612 332
341 3300031728 Ga0316578_10041628 Ga0316578_100416283 332
342 3300037466 Ga0395898_0076611 Ga0395898_0076611_620_1651 332
343 3300046455 Ga0495603_0013562 Ga0495603_0013562_1769_2800 332
344 3300047445 Ga0495677_0044018 Ga0495677_0044018_248_1279 332
345 3300048913 Ga0496110_0013256 Ga0496110_0013256_3747_4778 332
346 3300048914 Ga0496111_0010934 Ga0496111_0010934_4948_5979 332
347 3300049568 Ga0501031_0016519 Ga0501031_0016519_2488_3519 332
348 3300049570 Ga0501033_0019917 Ga0501033_0019917_1439_2470 332
349 3300049572 Ga0501036_0001775 Ga0501036_0001775_9594_10625 332
350 3300049573 Ga0501037_0009021 Ga0501037_0009021_3756_4787 332
351 3300049574 Ga0501038_0027841 Ga0501038_0027841_1753_2784 332
352 3300049575 Ga0501039_0013387 Ga0501039_0013387_637_1668 332
353 3300049575 Ga0501039_0028801 Ga0501039_0028801_835_1866 332
354 3300049576 Ga0501040_0021385 Ga0501040_0021385_801_1832 332
355 3300049577 Ga0501041_0018696 Ga0501041_0018696_740_1771 332
356 3300049578 Ga0501042_0058483 Ga0501042_0058483_1223_2254 332
357 3300049578 Ga0501042_0104152 Ga0501042_0104152_211_1242 332
358 3300049579 Ga0501043_0118797 Ga0501043_0118797_498_1529 332
359 3300049583 Ga0501067_0013273 Ga0501067_0013273_2758_3804 332
360 3300049584 Ga0501068_0043827 Ga0501068_0043827_627_1658 332
361 3300049584 Ga0501068_0103014 Ga0501068_0103014_720_1751 332
362 3300049586 Ga0501070_0016772 Ga0501070_0016772_3911_4942 332
363 3300049587 Ga0501071_0003854 Ga0501071_0003854_260_1291 332
364 3300049588 Ga0501072_0029963 Ga0501072_0029963_1073_2104 332
365 3300049589 Ga0501073_0007238 Ga0501073_0007238_6168_7199 332
366 3300049589 Ga0501073_0015002 Ga0501073_0015002_1957_3003 332
367 3300049590 Ga0501074_0088881 Ga0501074_0088881_140_1171 332
368 3300049591 Ga0501075_0018685 Ga0501075_0018685_3672_4703 332
369 3300049593 Ga0501077_0016934 Ga0501077_0016934_2489_3520 332
370 3300049741 Ga0501079_0100333 Ga0501079_0100333_269_1300 332
371 3300049742 Ga0501080_0000414 Ga0501080_0000414_12787_13833 332
372 3300049742 Ga0501080_0070329 Ga0501080_0070329_1186_2217 332
373 3300049743 Ga0501081_0008776 Ga0501081_0008776_1246_2277 332
374 3300049743 Ga0501081_0142686 Ga0501081_0142686_541_1572 332
375 3300049744 Ga0501083_0019965 Ga0501083_0019965_728_1759 332
376 3300049744 Ga0501083_0192587 Ga0501083_0192587_267_1313 332
377 3300049822 Ga0501035_0013824 Ga0501035_0013824_497_1528 332
378 3300049824 Ga0501045_0017723 Ga0501045_0017723_3249_4280 332
379 3300049824 Ga0501045_0025444 Ga0501045_0025444_1179_2210 332
380 3300050507 nmdc:mga05p37_115999_c1 nmdc:mga05p37_115999_c1_1212_2243 332
381 3300054114 Ga0501084_0043651 Ga0501084_0043651_1043_2074 332
382 3300060353 Ga0501082_0022921 Ga0501082_0022921_2201_3232 332
383 3300061734 Ga0530510_0029713 Ga0530510_0029713_2414_3445 332
384 3300005937 Ga0081455_10000995 Ga0081455_1000099525 333
385 3300044694 Ga0466963_0152872 Ga0466963_0152872_100_1146 333
386 3300044842 Ga0466957_0047436 Ga0466957_0047436_1291_2337 333
387 3300048915 Ga0496112_0157512 Ga0496112_0157512_577_1671 333
388 3300048917 Ga0496114_0467976 Ga0496114_0467976_19_1050 333
389 3300005535 Ga0070684_100052441 Ga0070684_1000524412 334
390 3300014497 Ga0182008_10006801 Ga0182008_100068015 334
391 3300015262 Ga0182007_10023328 Ga0182007_100233282 334
392 3300020082 Ga0206353_10390452 Ga0206353_103904522 334
393 3300025909 Ga0207705_10003753 Ga0207705_100037533 334
394 3300025919 Ga0207657_10100137 Ga0207657_101001373 334
395 3300025944 Ga0207661_10001693 Ga0207661_100016932 334
396 3300035398 Ga0316574_0001153 Ga0316574_0001153_2534_3592 334
397 3300036647 Ga0316582_0137838 Ga0316582_0137838_86_1144 334
398 3300036712 Ga0316584_0061249 Ga0316584_0061249_659_1717 334
399 3300044694 Ga0466963_0169693 Ga0466963_0169693_86_1291 334
400 3300045836 Ga0466958_0009420 Ga0466958_0009420_3361_4410 334
401 3300045976 Ga0466967_0005268 Ga0466967_0005268_3710_4750 334
402 3300045976 Ga0466967_0091982 Ga0466967_0091982_534_1577 334
403 3300049583 Ga0501067_0016818 Ga0501067_0016818_2535_3584 334
404 3300031691 Ga0316579_10020391 Ga0316579_100203912 335
405 3300031727 Ga0316576_10006146 Ga0316576_100061467 335
406 3300031728 Ga0316578_10001971 Ga0316578_100019718 335
407 3300031728 Ga0316578_10117930 Ga0316578_101179302 335
408 3300031733 Ga0316577_10000080 Ga0316577_1000008022 335
409 3300049593 Ga0501077_0176385 Ga0501077_0176385_268_1311 335
410 3300050507 nmdc:mga05p37_441566_c1 nmdc:mga05p37_441566_c1_24_1055 335
411 iso_pu_bacteria 8056054917 8056056240 335
412 3300005364 Ga0070673_100370344 Ga0070673_1003703441 336
413 3300005546 Ga0070696_100025334 Ga0070696_1000253342 336
414 3300035398 Ga0316574_0066657 Ga0316574_0066657_485_1543 337
415 3300048907 Ga0496104_0079682 Ga0496104_0079682_934_1998 337
416 3300048917 Ga0496114_0005398 Ga0496114_0005398_3488_4552 337
417 3300049576 Ga0501040_0016992 Ga0501040_0016992_2322_3446 337
418 3300009148 Ga0105243_10411699 Ga0105243_104116991 338
419 3300030732 Ga0316176_1037086 Ga0316176_10370862 338
420 3300031456 Ga0307513_10000007 Ga0307513_1000000762 338
421 3300031665 Ga0316575_10009431 Ga0316575_100094313 338
422 3300036647 Ga0316582_0154380 Ga0316582_0154380_371_1444 338
423 3300041406 Ga0439439_0000378 Ga0439439_0000378_1218_2279 338
424 3300041999 Ga0439433_0013975 Ga0439433_0013975_206_1267 338
425 3300042007 Ga0439449_0008770 Ga0439449_0008770_2498_3559 338
426 3300042007 Ga0439449_0010419 Ga0439449_0010419_941_2002 338
427 3300042014 Ga0439457_010577 Ga0439457_010577_844_1905 338
428 3300044684 Ga0466966_0037157 Ga0466966_0037157_1371_2501 338
429 3300049592 Ga0501076_0105052 Ga0501076_0105052_198_1247 338
430 3300049741 Ga0501079_0047886 Ga0501079_0047886_198_1247 338
431 3300054114 Ga0501084_0167806 Ga0501084_0167806_167_1210 338
432 3300061734 Ga0530510_0017917 Ga0530510_0017917_928_1977 338
433 3300031727 Ga0316576_10100244 Ga0316576_101002441 339
434 3300038726 Ga0400490_37255 Ga0400490_37255_30757_31791 339
435 3300038727 Ga0400491_05038 Ga0400491_05038_1199_2233 339
436 3300049572 Ga0501036_0051933 Ga0501036_0051933_39_1067 339
437 3300049577 Ga0501041_0002498 Ga0501041_0002498_1858_2886 339
438 3300049580 Ga0501046_0114077 Ga0501046_0114077_131_1159 339
439 3300049591 Ga0501075_0073297 Ga0501075_0073297_95_1123 339
440 3300049592 Ga0501076_0011199 Ga0501076_0011199_5109_6137 339
441 3300049741 Ga0501079_0024592 Ga0501079_0024592_241_1269 339
442 3300054114 Ga0501084_0023342 Ga0501084_0023342_1395_2423 339
443 3300006847 Ga0075431_100217028 Ga0075431_1002170282 340
444 3300044712 Ga0453684_0080375 Ga0453684_0080375_2565_3671 340
445 3300048914 Ga0496111_0219971 Ga0496111_0219971_68_1123 340
446 3300005331 Ga0070670_100048794 Ga0070670_1000487941 341
447 3300005335 Ga0070666_10038037 Ga0070666_100380373 341
448 3300005353 Ga0070669_100019309 Ga0070669_1000193091 341
449 3300005354 Ga0070675_100216181 Ga0070675_1002161811 341
450 3300005457 Ga0070662_100185094 Ga0070662_1001850942 341
451 3300005471 Ga0070698_100007001 Ga0070698_10000700111 341
452 3300005617 Ga0068859_100162559 Ga0068859_1001625592 341
453 3300006237 Ga0097621_100125172 Ga0097621_1001251722 341
454 3300006931 Ga0097620_100162560 Ga0097620_1001625602 341
455 3300009177 Ga0105248_10029846 Ga0105248_100298464 341
456 3300013297 Ga0157378_10120861 Ga0157378_101208612 341
457 3300014325 Ga0163163_10087836 Ga0163163_100878362 341
458 3300014326 Ga0157380_10344942 Ga0157380_103449422 341
459 3300025903 Ga0207680_10053614 Ga0207680_100536142 341
460 3300025923 Ga0207681_10220191 Ga0207681_102201912 341
461 3300025936 Ga0207670_10200801 Ga0207670_102008011 341
462 3300026023 Ga0207677_10181823 Ga0207677_101818231 341
463 3300031995 Ga0307409_100144540 Ga0307409_1001445402 341
464 3300036712 Ga0316584_0203567 Ga0316584_0203567_350_1396 341
465 3300046516 Ga0495628_0011434 Ga0495628_0011434_3429_4541 341
466 3300046517 Ga0495630_0009089 Ga0495630_0009089_3201_4313 341
467 3300047319 Ga0495674_0051535 Ga0495674_0051535_1812_2924 341
468 3300048908 Ga0496105_0096560 Ga0496105_0096560_632_1807 341
469 3300049583 Ga0501067_0000065 Ga0501067_0000065_16820_17866 341
470 3300049584 Ga0501068_0000099 Ga0501068_0000099_25004_26050 341
471 3300049585 Ga0501069_0001404 Ga0501069_0001404_453_1499 341
472 3300049587 Ga0501071_0025545 Ga0501071_0025545_1065_2111 341
473 3300061734 Ga0530510_0078292 Ga0530510_0078292_1087_2133 341
474 3300006844 Ga0075428_100002267 Ga0075428_10000226710 342
475 3300014326 Ga0157380_10175468 Ga0157380_101754682 342
476 3300025937 Ga0207669_10019064 Ga0207669_100190642 342
477 3300031727 Ga0316576_10003639 Ga0316576_100036395 342
478 3300048905 Ga0496102_0072640 Ga0496102_0072640_170_1357 342
479 3300005334 Ga0068869_100011797 Ga0068869_1000117972 343
480 3300005445 Ga0070708_100023470 Ga0070708_1000234704 343
481 3300005445 Ga0070708_100147932 Ga0070708_1001479322 343
482 3300005467 Ga0070706_100060461 Ga0070706_1000604612 343
483 3300005467 Ga0070706_100115262 Ga0070706_1001152621 343
484 3300025910 Ga0207684_10311778 Ga0207684_103117781 343
485 3300046459 Ga0495629_0000523 Ga0495629_0000523_14945_16030 343
486 3300046473 Ga0495582_0008009 Ga0495582_0008009_1596_2681 343
487 3300046475 Ga0495639_0008933 Ga0495639_0008933_553_1638 343
488 3300046526 Ga0495666_0121750 Ga0495666_0121750_63_1148 343
489 3300046674 Ga0495588_0044414 Ga0495588_0044414_1039_2124 343
490 3300046683 Ga0495658_0001090 Ga0495658_0001090_3408_4493 343
491 3300047315 Ga0495581_0043855 Ga0495581_0043855_1309_2394 343
492 3300048905 Ga0496102_0079705 Ga0496102_0079705_14_1117 343
493 3300048917 Ga0496114_0014629 Ga0496114_0014629_4272_5375 343
494 3300048917 Ga0496114_0080620 Ga0496114_0080620_626_1690 343
495 3300048917 Ga0496114_0174311 Ga0496114_0174311_748_1851 343
496 3300048920 Ga0496117_0004173 Ga0496117_0004173_2618_3715 343
497 3300048921 Ga0496118_0000909 Ga0496118_0000909_11732_12829 343
498 3300049741 Ga0501079_0170704 Ga0501079_0170704_175_1293 343
499 3300006186 Ga0075369_10001831 Ga0075369_100018312 344
500 3300025918 Ga0207662_10088745 Ga0207662_100887452 344
501 3300028558 Ga0265326_10000821 Ga0265326_100008217 344
502 3300031240 Ga0265320_10004075 Ga0265320_100040752 344
503 3300031344 Ga0265316_10011723 Ga0265316_100117234 344
504 3300031595 Ga0265313_10038254 Ga0265313_100382542 344
505 3300031711 Ga0265314_10015520 Ga0265314_100155204 344
506 3300031711 Ga0265314_10052424 Ga0265314_100524242 344
507 3300031733 Ga0316577_10004746 Ga0316577_100047463 344
508 3300036712 Ga0316584_0010138 Ga0316584_0010138_2919_4064 344
509 3300041443 Ga0451789_0440849 Ga0451789_0440849_2700_3797 344
510 3300041451 Ga0451791_0426296 Ga0451791_0426296_135_1232 344
511 3300041452 Ga0451793_0476113 Ga0451793_0476113_1530_2627 344
512 3300041459 Ga0451800_0714665 Ga0451800_0714665_260_1357 344
513 3300041509 Ga0451843_0257713 Ga0451843_0257713_1628_2725 344
514 3300041512 Ga0451853_3751897 Ga0451853_3751897_66_1163 344
515 3300046535 Ga0495586_0168486 Ga0495586_0168486_164_1210 344
516 iso_pu_bacteria 2643221623 2644131281 344
517 3300003320 rootH2_10246637 rootH2_102466372 345
518 3300003794 Ga0055531_10000197 Ga0055531_1000019711 345
519 3300005336 Ga0070680_100121292 Ga0070680_1001212921 345
520 3300005337 Ga0070682_100192315 Ga0070682_1001923152 345
521 3300005340 Ga0070689_100202478 Ga0070689_1002024782 345
522 3300005471 Ga0070698_100060247 Ga0070698_1000602472 345
523 3300005536 Ga0070697_100171230 Ga0070697_1001712301 345
524 3300005547 Ga0070693_100032240 Ga0070693_1000322402 345
525 3300005563 Ga0068855_100119594 Ga0068855_1001195942 345
526 3300005985 Ga0081539_10014216 Ga0081539_100142163 345
527 3300006871 Ga0075434_100017333 Ga0075434_1000173336 345
528 3300009098 Ga0105245_10064134 Ga0105245_100641343 345
529 3300009148 Ga0105243_10350370 Ga0105243_103503702 345
530 3300009174 Ga0105241_10122279 Ga0105241_101222791 345
531 3300009176 Ga0105242_10113762 Ga0105242_101137623 345
532 3300009551 Ga0105238_10038120 Ga0105238_100381203 345
533 3300014968 Ga0157379_10069016 Ga0157379_100690163 345
534 3300025304 Ga0209257_1000006 Ga0209257_1000006628 345
535 3300025944 Ga0207661_10105298 Ga0207661_101052982 345
536 3300025945 Ga0207679_10037475 Ga0207679_100374752 345
537 3300026078 Ga0207702_10216984 Ga0207702_102169842 345
538 3300026116 Ga0207674_10046794 Ga0207674_100467942 345
539 3300028556 Ga0265337_1014920 Ga0265337_10149202 345
540 3300028563 Ga0265319_1004075 Ga0265319_10040756 345
541 3300028573 Ga0265334_10011902 Ga0265334_100119023 345
542 3300028577 Ga0265318_10010683 Ga0265318_100106832 345
543 3300028666 Ga0265336_10014135 Ga0265336_100141352 345
544 3300028800 Ga0265338_10007839 Ga0265338_100078395 345
545 3300029957 Ga0265324_10002985 Ga0265324_100029857 345
546 3300031235 Ga0265330_10015743 Ga0265330_100157434 345
547 3300031239 Ga0265328_10041085 Ga0265328_100410852 345
548 3300031240 Ga0265320_10002308 Ga0265320_1000230811 345
549 3300031241 Ga0265325_10013604 Ga0265325_100136045 345
550 3300031242 Ga0265329_10004508 Ga0265329_100045084 345
551 3300031247 Ga0265340_10000470 Ga0265340_1000047019 345
552 3300031344 Ga0265316_10010209 Ga0265316_100102092 345
553 3300031507 Ga0307509_10032339 Ga0307509_100323394 345
554 3300031507 Ga0307509_10078800 Ga0307509_100788002 345
555 3300031711 Ga0265314_10002620 Ga0265314_100026208 345
556 3300035695 Ga0373927_0022808 Ga0373927_0022808_1231_2307 345
557 3300037853 Ga0436364_0619729 Ga0436364_0619729_4356_5492 345
558 3300044658 Ga0466972_0006816 Ga0466972_0006816_2829_3953 345
559 3300044694 Ga0466963_0064225 Ga0466963_0064225_573_1670 345
560 3300044712 Ga0453684_0115462 Ga0453684_0115462_1318_2505 345
561 3300044842 Ga0466957_0039512 Ga0466957_0039512_1293_2390 345
562 3300045836 Ga0466958_0064423 Ga0466958_0064423_513_1610 345
563 3300045836 Ga0466958_0139498 Ga0466958_0139498_365_1462 345
564 3300046463 Ga0495653_0093503 Ga0495653_0093503_52_1146 345
565 3300046514 Ga0495618_0235901 Ga0495618_0235901_33_1127 345
566 3300046516 Ga0495628_0003293 Ga0495628_0003293_11711_12805 345
567 3300046517 Ga0495630_0013143 Ga0495630_0013143_3484_4578 345
568 3300046533 Ga0495640_0018120 Ga0495640_0018120_2886_3980 345
569 3300046681 Ga0495647_0030358 Ga0495647_0030358_66_1136 345
570 3300046683 Ga0495658_0034283 Ga0495658_0034283_979_2049 345
571 3300048909 Ga0496106_0110583 Ga0496106_0110583_130_1200 345
572 3300048911 Ga0496108_0024891 Ga0496108_0024891_2593_3663 345
573 3300048912 Ga0496109_0030856 Ga0496109_0030856_2668_3738 345
574 3300048916 Ga0496113_0025915 Ga0496113_0025915_1717_2787 345
575 3300048918 Ga0496115_0001888 Ga0496115_0001888_7581_8690 345
576 3300050512 nmdc:mga0n895_829_c1 nmdc:mga0n895_829_c1_4851_5921 345
577 3300053077 Ga0495601_0006657 Ga0495601_0006657_3331_4425 345
578 3300053084 Ga0495595_0006010 Ga0495595_0006010_1121_2215 345
579 3300053085 Ga0495619_0003726 Ga0495619_0003726_2695_3789 345
580 3300053153 Ga0500616_0037765 Ga0500616_0037765_798_1874 345
581 iso_pu_bacteria 2738543024 2739310205 345
582 iso_pu_bacteria 8002285264 8002290462 345
583 3300003322 rootL2_10218153 rootL2_102181533 346
584 3300005548 Ga0070665_100021844 Ga0070665_1000218442 346
585 3300007265 Ga0099794_10008572 Ga0099794_100085724 346
586 3300028794 Ga0307515_10002908 Ga0307515_1000290831 346
587 3300028794 Ga0307515_10099224 Ga0307515_100992243 346
588 3300038443 Ga0395901_0006804 Ga0395901_0006804_8924_9994 346
589 3300042876 Ga0451577_0280582 Ga0451577_0280582_211_1338 346
590 3300044712 Ga0453684_0001703 Ga0453684_0001703_50822_51949 346
591 3300045051 Ga0451576_0153042 Ga0451576_0153042_284_1411 346
592 3300045976 Ga0466967_0022309 Ga0466967_0022309_1919_3064 346
593 3300048918 Ga0496115_0056811 Ga0496115_0056811_629_1708 346
594 3300048929 Ga0496126_0027150 Ga0496126_0027150_2709_3788 346
595 3300049704 Ga0501221_014438 Ga0501221_014438_31_1071 346
596 3300003316 rootH1_10003792 rootH1_100037929 347
597 3300003316 rootH1_10015730 rootH1_100157302 347
598 3300003320 rootH2_10029474 rootH2_100294741 347
599 3300003320 rootH2_10077888 rootH2_100778882 347
600 3300003322 rootL2_10072383 rootL2_100723834 347
601 3300003322 rootL2_10147111 rootL2_1014711110 347
602 3300003323 rootH1_10000715 rootH1_1000071540 347
603 3300003323 rootH1_10017154 rootH1_1001715410 347
604 3300003323 rootH1_10072353 rootH1_100723533 347
605 3300003323 rootH1_10074058 rootH1_100740582 347
606 3300003323 rootH1_10271435 rootH1_102714351 347
607 3300005563 Ga0068855_100133775 Ga0068855_1001337752 347
608 3300005563 Ga0068855_100168419 Ga0068855_1001684192 347
609 3300005614 Ga0068856_100051081 Ga0068856_1000510812 347
610 3300005616 Ga0068852_100166839 Ga0068852_1001668392 347
611 3300006846 Ga0075430_100090238 Ga0075430_1000902382 347
612 3300009094 Ga0111539_10021661 Ga0111539_100216612 347
613 3300009094 Ga0111539_10029039 Ga0111539_100290394 347
614 3300009147 Ga0114129_10556086 Ga0114129_105560862 347
615 3300013104 Ga0157370_10042219 Ga0157370_100422192 347
616 3300013105 Ga0157369_10011406 Ga0157369_100114067 347
617 3300013307 Ga0157372_10265210 Ga0157372_102652102 347
618 3300014326 Ga0157380_10001491 Ga0157380_100014919 347
619 3300014326 Ga0157380_10030663 Ga0157380_100306633 347
620 3300025298 Ga0209050_1002956 Ga0209050_10029562 347
621 3300025949 Ga0207667_10086606 Ga0207667_100866062 347
622 3300025949 Ga0207667_10250735 Ga0207667_102507352 347
623 3300027907 Ga0207428_10161341 Ga0207428_101613411 347
624 3300031548 Ga0307408_100059644 Ga0307408_1000596443 347
625 3300031548 Ga0307408_100203948 Ga0307408_1002039481 347
626 3300031731 Ga0307405_10091025 Ga0307405_100910252 347
627 3300031733 Ga0316577_10005239 Ga0316577_100052396 347
628 3300032126 Ga0307415_100018876 Ga0307415_1000188763 347
629 3300037068 Ga0373925_0021612 Ga0373925_0021612_2064_3182 347
630 3300046460 Ga0495638_0000003 Ga0495638_0000003_721198_722283 347
631 3300049523 Ga0501300_001453 Ga0501300_001453_732_1817 347
632 3300049761 Ga0501264_000063 Ga0501264_000063_5867_6952 347
633 3300050509 nmdc:mga0qj67_95202_c1 nmdc:mga0qj67_95202_c1_728_1813 347
634 3300050511 nmdc:mga08y16_8405_c1 nmdc:mga08y16_8405_c1_4567_5652 347
635 3300053153 Ga0500616_0000007 Ga0500616_0000007_45160_46245 347
636 3300053156 Ga0500622_0001539 Ga0500622_0001539_7372_8457 347
637 3300005445 Ga0070708_100009182 Ga0070708_1000091826 348
638 3300005468 Ga0070707_100073832 Ga0070707_1000738323 348
639 3300005539 Ga0068853_100089669 Ga0068853_1000896692 348
640 3300006844 Ga0075428_100058385 Ga0075428_1000583854 348
641 3300025922 Ga0207646_10028693 Ga0207646_100286933 348
642 3300026041 Ga0207639_10175722 Ga0207639_101757222 348
643 3300050492 nmdc:mga0yw44_64894_c1 nmdc:mga0yw44_64894_c1_1101_2198 348
644 3300053151 Ga0500604_0002802 Ga0500604_0002802_3045_4133 348
645 3300053156 Ga0500622_0000066 Ga0500622_0000066_78908_79996 348
646 3300053156 Ga0500622_0000179 Ga0500622_0000179_11696_12784 348
647 3300005334 Ga0068869_100189935 Ga0068869_1001899351 349
648 3300005364 Ga0070673_100031373 Ga0070673_1000313734 349
649 3300005563 Ga0068855_100379915 Ga0068855_1003799152 349
650 3300005841 Ga0068863_100393234 Ga0068863_1003932342 349
651 3300006844 Ga0075428_100011875 Ga0075428_1000118754 349
652 3300006852 Ga0075433_10013934 Ga0075433_100139344 349
653 3300006871 Ga0075434_100009109 Ga0075434_1000091094 349
654 3300007076 Ga0075435_100064482 Ga0075435_1000644822 349
655 3300009094 Ga0111539_10159359 Ga0111539_101593592 349
656 3300009147 Ga0114129_10210827 Ga0114129_102108272 349
657 3300025913 Ga0207695_10014226 Ga0207695_1001422612 349
658 3300025960 Ga0207651_10105102 Ga0207651_101051023 349
659 3300026075 Ga0207708_10147771 Ga0207708_101477712 349
660 3300026116 Ga0207674_10096765 Ga0207674_100967652 349
661 3300027907 Ga0207428_10038835 Ga0207428_100388352 349
662 3300031727 Ga0316576_10139728 Ga0316576_101397282 349
663 3300031728 Ga0316578_10041392 Ga0316578_100413923 349
664 3300044765 Ga0466970_0013084 Ga0466970_0013084_1929_3041 349
665 3300045051 Ga0451576_0201454 Ga0451576_0201454_412_1479 349
666 3300047320 Ga0495672_0000242 Ga0495672_0000242_45523_46590 349
667 3300049576 Ga0501040_0166529 Ga0501040_0166529_273_1388 349
668 3300049593 Ga0501077_0062494 Ga0501077_0062494_920_2008 349
669 3300050508 nmdc:mga09592_12832_c1 nmdc:mga09592_12832_c1_5383_6471 349
670 3300050508 nmdc:mga09592_67270_c1 nmdc:mga09592_67270_c1_558_1628 349
671 3300050509 nmdc:mga0qj67_2517_c1 nmdc:mga0qj67_2517_c1_1360_2448 349
672 3300050510 nmdc:mga06r32_14263_c1 nmdc:mga06r32_14263_c1_960_2048 349
673 3300050511 nmdc:mga08y16_282487_c1 nmdc:mga08y16_282487_c1_56_1126 349
674 3300050511 nmdc:mga08y16_32443_c1 nmdc:mga08y16_32443_c1_1668_2735 349
675 3300050512 nmdc:mga0n895_50397_c1 nmdc:mga0n895_50397_c1_177_1244 349
676 3300050515 nmdc:mga0a205_72728_c1 nmdc:mga0a205_72728_c1_37_1104 349
677 iso_pu_bacteria 2844852863 2844856075 349
678 iso_pu_bacteria 2919042368 2919045610 349
679 3300005844 Ga0068862_100096827 Ga0068862_1000968273 350
680 3300006844 Ga0075428_100069973 Ga0075428_1000699732 350
681 3300028380 Ga0268265_10051363 Ga0268265_100513632 350
682 3300006042 Ga0075368_10017923 Ga0075368_100179232 351
683 3300006178 Ga0075367_10123291 Ga0075367_101232912 351
684 3300006353 Ga0075370_10047475 Ga0075370_100474752 351
685 3300031731 Ga0307405_10058926 Ga0307405_100589262 351
686 3300031852 Ga0307410_10025569 Ga0307410_100255694 351
687 3300045976 Ga0466967_0163140 Ga0466967_0163140_881_1981 351
688 3300049539 Ga0501323_004435 Ga0501323_004435_11_1156 351
689 3300049571 Ga0501034_0201836 Ga0501034_0201836_574_1656 351
690 3300050492 nmdc:mga0yw44_18976_c1 nmdc:mga0yw44_18976_c1_1851_2963 351
691 3300050494 nmdc:mga06z11_98093_c1 nmdc:mga06z11_98093_c1_237_1349 351
692 iso_pu_bacteria 2852643534 2852646055 351
693 iso_pu_bacteria 2857733635 2857734016 351
694 3300005327 Ga0070658_10004558 Ga0070658_100045586 352
695 3300031824 Ga0307413_10062645 Ga0307413_100626453 352
696 3300044735 Ga0466968_0025832 Ga0466968_0025832_430_1515 352
697 3300044765 Ga0466970_0017062 Ga0466970_0017062_1467_2564 352
698 3300046463 Ga0495653_0017324 Ga0495653_0017324_3252_4340 352
699 3300048924 Ga0496121_0000025 Ga0496121_0000025_58007_59095 352
700 3300048926 Ga0496123_0011752 Ga0496123_0011752_1298_2395 352
701 3300048927 Ga0496124_0000639 Ga0496124_0000639_4137_5234 352
702 3300049581 Ga0501047_0002400 Ga0501047_0002400_904_1998 352
703 3300053088 Ga0500644_0000106 Ga0500644_0000106_21918_23033 352
704 3300053153 Ga0500616_0000205 Ga0500616_0000205_1766_2851 352
705 iso_pu_bacteria 2751185788 2753302454 352
706 iso_pu_bacteria 2904430863 2904432919 352
707 iso_pu_bacteria 2904501621 2904503372 352
708 iso_pu_bacteria 2908674828 2908675451 352
709 iso_pu_bacteria 2909074476 2909074507 352
710 iso_pu_bacteria 2919039151 2919041481 352
711 iso_pu_bacteria 2928104781 2928107441 352
712 iso_pu_bacteria 2928500415 2928500436 352
713 3300005335 Ga0070666_10124172 Ga0070666_101241722 353
714 3300005367 Ga0070667_100270192 Ga0070667_1002701922 353
715 3300005445 Ga0070708_100045037 Ga0070708_1000450372 353
716 3300005445 Ga0070708_100085577 Ga0070708_1000855772 353
717 3300005468 Ga0070707_100001749 Ga0070707_10000174910 353
718 3300005842 Ga0068858_100312344 Ga0068858_1003123442 353
719 3300006038 Ga0075365_10036265 Ga0075365_100362652 353
720 3300006038 Ga0075365_10054928 Ga0075365_100549282 353
721 3300006038 Ga0075365_10055190 Ga0075365_100551902 353
722 3300006042 Ga0075368_10002301 Ga0075368_100023012 353
723 3300006048 Ga0075363_100004611 Ga0075363_1000046115 353
724 3300006048 Ga0075363_100019594 Ga0075363_1000195942 353
725 3300006051 Ga0075364_10094090 Ga0075364_100940902 353
726 3300006353 Ga0075370_10013756 Ga0075370_100137564 353
727 3300011119 Ga0105246_10021870 Ga0105246_100218702 353
728 3300025922 Ga0207646_10001586 Ga0207646_1000158615 353
729 3300025922 Ga0207646_10012777 Ga0207646_100127777 353
730 3300048905 Ga0496102_0093756 Ga0496102_0093756_1019_2119 353
731 3300048925 Ga0496122_0111496 Ga0496122_0111496_129_1238 353
732 3300048926 Ga0496123_0121298 Ga0496123_0121298_106_1215 353
733 3300048927 Ga0496124_0132995 Ga0496124_0132995_549_1649 353
734 3300048927 Ga0496124_0162442 Ga0496124_0162442_565_1674 353
735 3300049568 Ga0501031_0087488 Ga0501031_0087488_130_1227 353
736 3300049574 Ga0501038_0086524 Ga0501038_0086524_1272_2369 353
737 3300049575 Ga0501039_0206551 Ga0501039_0206551_303_1400 353
738 3300049576 Ga0501040_0033917 Ga0501040_0033917_1579_2676 353
739 3300049578 Ga0501042_0241435 Ga0501042_0241435_189_1286 353
740 3300049582 Ga0501048_0022284 Ga0501048_0022284_1623_2720 353
741 3300049586 Ga0501070_0073617 Ga0501070_0073617_29_1147 353
742 3300049587 Ga0501071_0075934 Ga0501071_0075934_927_2024 353
743 3300049588 Ga0501072_0061470 Ga0501072_0061470_826_1923 353
744 3300049590 Ga0501074_0019499 Ga0501074_0019499_2304_3401 353
745 3300049592 Ga0501076_0041077 Ga0501076_0041077_2243_3340 353
746 3300049593 Ga0501077_0100103 Ga0501077_0100103_533_1630 353
747 3300049741 Ga0501079_0106723 Ga0501079_0106723_276_1373 353
748 3300049824 Ga0501045_0003799 Ga0501045_0003799_5464_6561 353
749 3300050490 nmdc:mga03n38_31977_c1 nmdc:mga03n38_31977_c1_888_2006 353
750 3300050491 nmdc:mga00v17_102676_c1 nmdc:mga00v17_102676_c1_73_1191 353
751 3300050491 nmdc:mga00v17_105147_c1 nmdc:mga00v17_105147_c1_560_1678 353
752 3300050492 nmdc:mga0yw44_12118_c1 nmdc:mga0yw44_12118_c1_690_1805 353
753 3300050492 nmdc:mga0yw44_52124_c1 nmdc:mga0yw44_52124_c1_1095_2213 353
754 3300050494 nmdc:mga06z11_50726_c1 nmdc:mga06z11_50726_c1_111_1229 353
755 3300050496 nmdc:mga07m45_25794_c1 nmdc:mga07m45_25794_c1_1909_3027 353
756 3300054114 Ga0501084_0023478 Ga0501084_0023478_2584_3681 353
757 iso_pu_bacteria 2984551494 2984554623 353
758 3300006844 Ga0075428_100092312 Ga0075428_1000923121 354
759 3300006846 Ga0075430_100015760 Ga0075430_1000157602 354
760 3300006847 Ga0075431_100001491 Ga0075431_10000149118 354
761 3300006880 Ga0075429_100000082 Ga0075429_10000008211 354
762 3300021384 Ga0213876_10086674 Ga0213876_100866741 354
763 3300025922 Ga0207646_10092641 Ga0207646_100926411 354
764 3300027907 Ga0207428_10000574 Ga0207428_100005746 354
765 3300038726 Ga0400490_42916 Ga0400490_42916_236_1336 354
766 3300039437 Ga0436365_0895231 Ga0436365_0895231_1000_2130 354
767 3300044712 Ga0453684_0166957 Ga0453684_0166957_1014_2126 354
768 3300047320 Ga0495672_0004208 Ga0495672_0004208_2396_3493 354
769 3300049743 Ga0501081_0138662 Ga0501081_0138662_565_1695 354
770 3300053087 Ga0500643_000913 Ga0500643_000913_526_1614 354
771 iso_pu_bacteria 2895660088 2895661688 354
772 3300005290 Ga0065712_10004042 Ga0065712_100040422 355
773 3300005293 Ga0065715_10007485 Ga0065715_100074855 355
774 3300005328 Ga0070676_10004892 Ga0070676_100048925 355
775 3300005330 Ga0070690_100020399 Ga0070690_1000203994 355
776 3300005331 Ga0070670_100002473 Ga0070670_1000024735 355
777 3300005333 Ga0070677_10004528 Ga0070677_100045283 355
778 3300005333 Ga0070677_10007902 Ga0070677_100079024 355
779 3300005334 Ga0068869_100015575 Ga0068869_1000155753 355
780 3300005335 Ga0070666_10017347 Ga0070666_100173472 355
781 3300005338 Ga0068868_100028174 Ga0068868_1000281744 355
782 3300005343 Ga0070687_100012056 Ga0070687_1000120564 355
783 3300005344 Ga0070661_100106273 Ga0070661_1001062732 355
784 3300005347 Ga0070668_100054752 Ga0070668_1000547522 355
785 3300005353 Ga0070669_100024441 Ga0070669_1000244412 355
786 3300005354 Ga0070675_100010643 Ga0070675_1000106436 355
787 3300005354 Ga0070675_100051450 Ga0070675_1000514502 355
788 3300005354 Ga0070675_100306837 Ga0070675_1003068372 355
789 3300005364 Ga0070673_100011536 Ga0070673_1000115364 355
790 3300005364 Ga0070673_100141248 Ga0070673_1001412482 355
791 3300005365 Ga0070688_100001161 Ga0070688_1000011612 355
792 3300005365 Ga0070688_100134579 Ga0070688_1001345792 355
793 3300005367 Ga0070667_100022929 Ga0070667_1000229294 355
794 3300005438 Ga0070701_10143987 Ga0070701_101439872 355
795 3300005441 Ga0070700_100067464 Ga0070700_1000674641 355
796 3300005456 Ga0070678_100014125 Ga0070678_1000141254 355
797 3300005456 Ga0070678_100079193 Ga0070678_1000791933 355
798 3300005457 Ga0070662_100027802 Ga0070662_1000278024 355
799 3300005457 Ga0070662_100104796 Ga0070662_1001047962 355
800 3300005543 Ga0070672_100088071 Ga0070672_1000880712 355
801 3300005544 Ga0070686_100023123 Ga0070686_1000231232 355
802 3300005548 Ga0070665_100176423 Ga0070665_1001764232 355
803 3300005564 Ga0070664_100000586 Ga0070664_10000058610 355
804 3300005577 Ga0068857_100132500 Ga0068857_1001325004 355
805 3300005615 Ga0070702_100057673 Ga0070702_1000576732 355
806 3300005617 Ga0068859_100073857 Ga0068859_1000738572 355
807 3300005618 Ga0068864_100012301 Ga0068864_1000123015 355
808 3300005840 Ga0068870_10083230 Ga0068870_100832302 355
809 3300005841 Ga0068863_100046319 Ga0068863_1000463194 355
810 3300005844 Ga0068862_100016510 Ga0068862_1000165102 355
811 3300006237 Ga0097621_100108084 Ga0097621_1001080841 355
812 3300006844 Ga0075428_100001176 Ga0075428_1000011768 355
813 3300006846 Ga0075430_100034006 Ga0075430_1000340064 355
814 3300006846 Ga0075430_100045040 Ga0075430_1000450404 355
815 3300006847 Ga0075431_100003423 Ga0075431_1000034233 355
816 3300006852 Ga0075433_10006016 Ga0075433_100060164 355
817 3300006871 Ga0075434_100023769 Ga0075434_1000237692 355
818 3300006880 Ga0075429_100009769 Ga0075429_1000097692 355
819 3300006881 Ga0068865_100179413 Ga0068865_1001794132 355
820 3300006931 Ga0097620_100073858 Ga0097620_1000738582 355
821 3300009094 Ga0111539_10096271 Ga0111539_100962714 355
822 3300009094 Ga0111539_10108999 Ga0111539_101089992 355
823 3300009147 Ga0114129_10157201 Ga0114129_101572012 355
824 3300009553 Ga0105249_10009569 Ga0105249_100095695 355
825 3300013296 Ga0157374_10191254 Ga0157374_101912542 355
826 3300013306 Ga0163162_10008524 Ga0163162_100085246 355
827 3300013308 Ga0157375_10074179 Ga0157375_100741791 355
828 3300014326 Ga0157380_10029501 Ga0157380_100295011 355
829 3300014326 Ga0157380_10116889 Ga0157380_101168892 355
830 3300014745 Ga0157377_10005968 Ga0157377_100059684 355
831 3300014969 Ga0157376_10036613 Ga0157376_100366132 355
832 3300017792 Ga0163161_10028324 Ga0163161_100283242 355
833 3300017792 Ga0163161_10078278 Ga0163161_100782782 355
834 3300025315 Ga0207697_10002059 Ga0207697_100020594 355
835 3300025893 Ga0207682_10002902 Ga0207682_100029023 355
836 3300025893 Ga0207682_10003368 Ga0207682_100033685 355
837 3300025901 Ga0207688_10004310 Ga0207688_100043108 355
838 3300025901 Ga0207688_10092310 Ga0207688_100923102 355
839 3300025903 Ga0207680_10111437 Ga0207680_101114372 355
840 3300025907 Ga0207645_10056145 Ga0207645_100561452 355
841 3300025908 Ga0207643_10014099 Ga0207643_100140992 355
842 3300025908 Ga0207643_10037355 Ga0207643_100373552 355
843 3300025918 Ga0207662_10022979 Ga0207662_100229791 355
844 3300025920 Ga0207649_10023474 Ga0207649_100234744 355
845 3300025923 Ga0207681_10009853 Ga0207681_100098537 355
846 3300025926 Ga0207659_10009478 Ga0207659_100094784 355
847 3300025926 Ga0207659_10036189 Ga0207659_100361894 355
848 3300025933 Ga0207706_10038926 Ga0207706_100389264 355
849 3300025936 Ga0207670_10050656 Ga0207670_100506564 355
850 3300025936 Ga0207670_10149525 Ga0207670_101495251 355
851 3300025937 Ga0207669_10016067 Ga0207669_100160673 355
852 3300025940 Ga0207691_10006894 Ga0207691_100068948 355
853 3300025942 Ga0207689_10006638 Ga0207689_100066384 355
854 3300025945 Ga0207679_10007694 Ga0207679_100076945 355
855 3300025960 Ga0207651_10326444 Ga0207651_103264441 355
856 3300025961 Ga0207712_10023448 Ga0207712_100234484 355
857 3300026035 Ga0207703_10064866 Ga0207703_100648664 355
858 3300026067 Ga0207678_10121680 Ga0207678_101216803 355
859 3300026075 Ga0207708_10008663 Ga0207708_100086632 355
860 3300026075 Ga0207708_10082413 Ga0207708_100824132 355
861 3300026088 Ga0207641_10087888 Ga0207641_100878882 355
862 3300026089 Ga0207648_10023072 Ga0207648_100230724 355
863 3300026089 Ga0207648_10031931 Ga0207648_100319313 355
864 3300026116 Ga0207674_10124853 Ga0207674_101248532 355
865 3300026121 Ga0207683_10007767 Ga0207683_100077677 355
866 3300026121 Ga0207683_10140584 Ga0207683_101405842 355
867 3300027717 Ga0209998_10010271 Ga0209998_100102712 355
868 3300027907 Ga0207428_10016192 Ga0207428_100161926 355
869 3300028380 Ga0268265_10030738 Ga0268265_100307384 355
870 3300028381 Ga0268264_10062017 Ga0268264_100620174 355
871 3300032133 Ga0316583_10020931 Ga0316583_100209312 355
872 3300035112 Ga0373932_0018875 Ga0373932_0018875_458_1534 355
873 3300038741 Ga0400488_06186 Ga0400488_06186_309_1406 355
874 3300039062 Ga0400483_123874 Ga0400483_123874_85_1191 355
875 3300041452 Ga0451793_0141268 Ga0451793_0141268_115_1215 355
876 3300048915 Ga0496112_0436367 Ga0496112_0436367_67_1182 355
877 3300048925 Ga0496122_0002058 Ga0496122_0002058_26625_27725 355
878 3300048926 Ga0496123_0006537 Ga0496123_0006537_3563_4663 355
879 3300050507 nmdc:mga05p37_147215_c1 nmdc:mga05p37_147215_c1_931_2007 355
880 3300050508 nmdc:mga09592_953_c1 nmdc:mga09592_953_c1_1121_2197 355
881 3300050509 nmdc:mga0qj67_75052_c1 nmdc:mga0qj67_75052_c1_1432_2508 355
882 3300050510 nmdc:mga06r32_220850_c1 nmdc:mga06r32_220850_c1_512_1609 355
883 3300050511 nmdc:mga08y16_103170_c1 nmdc:mga08y16_103170_c1_1476_2552 355
884 3300050515 nmdc:mga0a205_1093_c1 nmdc:mga0a205_1093_c1_831_1907 355
885 3300053104 Ga0500556_0000001 Ga0500556_0000001_826151_827242 355
886 3300053139 Ga0500568_0000003 Ga0500568_0000003_796685_797776 355
887 3300003323 rootH1_10309830 rootH1_103098302 356
888 3300005331 Ga0070670_100037369 Ga0070670_1000373692 356
889 3300005354 Ga0070675_100154473 Ga0070675_1001544732 356
890 3300005355 Ga0070671_100012745 Ga0070671_1000127452 356
891 3300005356 Ga0070674_100025985 Ga0070674_1000259852 356
892 3300005364 Ga0070673_100046128 Ga0070673_1000461282 356
893 3300005456 Ga0070678_100290583 Ga0070678_1002905832 356
894 3300005564 Ga0070664_100017864 Ga0070664_1000178642 356
895 3300005844 Ga0068862_100224329 Ga0068862_1002243292 356
896 3300006871 Ga0075434_100019774 Ga0075434_1000197744 356
897 3300006881 Ga0068865_100083553 Ga0068865_1000835532 356
898 3300006914 Ga0075436_100058685 Ga0075436_1000586852 356
899 3300007076 Ga0075435_100003226 Ga0075435_1000032268 356
900 3300009177 Ga0105248_10177132 Ga0105248_101771322 356
901 3300014325 Ga0163163_10022835 Ga0163163_100228352 356
902 3300025920 Ga0207649_10129224 Ga0207649_101292241 356
903 3300025925 Ga0207650_10032986 Ga0207650_100329862 356
904 3300025931 Ga0207644_10040682 Ga0207644_100406823 356
905 3300025940 Ga0207691_10051484 Ga0207691_100514842 356
906 3300025940 Ga0207691_10081206 Ga0207691_100812062 356
907 3300025945 Ga0207679_10090800 Ga0207679_100908001 356
908 3300025960 Ga0207651_10028137 Ga0207651_100281372 356
909 3300026095 Ga0207676_10124781 Ga0207676_101247812 356
910 3300026116 Ga0207674_10169714 Ga0207674_101697142 356
911 3300026121 Ga0207683_10082387 Ga0207683_100823872 356
912 3300031548 Ga0307408_100220969 Ga0307408_1002209692 356
913 3300031727 Ga0316576_10082011 Ga0316576_100820111 356
914 3300031824 Ga0307413_10039012 Ga0307413_100390122 356
915 3300031995 Ga0307409_100027899 Ga0307409_1000278993 356
916 3300042876 Ga0451577_0052810 Ga0451577_0052810_967_2055 356
917 3300044712 Ga0453684_0000173 Ga0453684_0000173_181154_182242 356
918 3300049571 Ga0501034_0008189 Ga0501034_0008189_2280_3386 356
919 3300050512 nmdc:mga0n895_28190_c1 nmdc:mga0n895_28190_c1_4067_5203 356
920 3300050513 nmdc:mga0rr50_145299_c1 nmdc:mga0rr50_145299_c1_614_1750 356
921 3300050515 nmdc:mga0a205_141186_c1 nmdc:mga0a205_141186_c1_469_1605 356
922 3300005330 Ga0070690_100115957 Ga0070690_1001159572 357
923 3300005333 Ga0070677_10020902 Ga0070677_100209022 357
924 3300005333 Ga0070677_10038389 Ga0070677_100383892 357
925 3300005334 Ga0068869_100051024 Ga0068869_1000510242 357
926 3300005338 Ga0068868_100147442 Ga0068868_1001474422 357
927 3300005340 Ga0070689_100040242 Ga0070689_1000402422 357
928 3300005353 Ga0070669_100113862 Ga0070669_1001138622 357
929 3300005354 Ga0070675_100000801 Ga0070675_10000080115 357
930 3300005354 Ga0070675_100016586 Ga0070675_1000165864 357
931 3300005355 Ga0070671_100081478 Ga0070671_1000814782 357
932 3300005355 Ga0070671_100126264 Ga0070671_1001262642 357
933 3300005365 Ga0070688_100032333 Ga0070688_1000323332 357
934 3300005438 Ga0070701_10074729 Ga0070701_100747292 357
935 3300005459 Ga0068867_100002815 Ga0068867_1000028155 357
936 3300005466 Ga0070685_10046696 Ga0070685_100466962 357
937 3300005543 Ga0070672_100110689 Ga0070672_1001106892 357
938 3300005578 Ga0068854_100059050 Ga0068854_1000590502 357
939 3300005617 Ga0068859_100029439 Ga0068859_1000294392 357
940 3300005617 Ga0068859_100041652 Ga0068859_1000416524 357
941 3300005719 Ga0068861_100028959 Ga0068861_1000289593 357
942 3300005841 Ga0068863_100152745 Ga0068863_1001527452 357
943 3300005842 Ga0068858_100018354 Ga0068858_1000183542 357
944 3300005842 Ga0068858_100035040 Ga0068858_1000350402 357
945 3300005843 Ga0068860_100014438 Ga0068860_1000144382 357
946 3300006237 Ga0097621_100092591 Ga0097621_1000925911 357
947 3300006237 Ga0097621_100099825 Ga0097621_1000998252 357
948 3300006358 Ga0068871_100129739 Ga0068871_1001297392 357
949 3300006846 Ga0075430_100134779 Ga0075430_1001347792 357
950 3300006847 Ga0075431_100009529 Ga0075431_1000095292 357
951 3300006871 Ga0075434_100106257 Ga0075434_1001062572 357
952 3300006880 Ga0075429_100305469 Ga0075429_1003054691 357
953 3300006931 Ga0097620_100029436 Ga0097620_1000294362 357
954 3300006931 Ga0097620_100041655 Ga0097620_1000416552 357
955 3300009094 Ga0111539_10075167 Ga0111539_100751672 357
956 3300009094 Ga0111539_10092226 Ga0111539_100922262 357
957 3300009094 Ga0111539_10238610 Ga0111539_102386102 357
958 3300011119 Ga0105246_10147169 Ga0105246_101471692 357
959 3300014325 Ga0163163_10544418 Ga0163163_105444181 357
960 3300014326 Ga0157380_10010921 Ga0157380_100109216 357
961 3300014326 Ga0157380_10036819 Ga0157380_100368192 357
962 3300014326 Ga0157380_10067423 Ga0157380_100674232 357
963 3300014326 Ga0157380_10204849 Ga0157380_102048492 357
964 3300025893 Ga0207682_10011854 Ga0207682_100118542 357
965 3300025907 Ga0207645_10002990 Ga0207645_100029906 357
966 3300025908 Ga0207643_10006077 Ga0207643_100060776 357
967 3300025908 Ga0207643_10010032 Ga0207643_100100324 357
968 3300025908 Ga0207643_10021872 Ga0207643_100218722 357
969 3300025923 Ga0207681_10111301 Ga0207681_101113012 357
970 3300025925 Ga0207650_10142047 Ga0207650_101420471 357
971 3300025926 Ga0207659_10000209 Ga0207659_1000020917 357
972 3300025926 Ga0207659_10002047 Ga0207659_100020476 357
973 3300025926 Ga0207659_10006129 Ga0207659_100061296 357
974 3300025926 Ga0207659_10035003 Ga0207659_100350032 357
975 3300025931 Ga0207644_10038219 Ga0207644_100382191 357
976 3300025931 Ga0207644_10039388 Ga0207644_100393882 357
977 3300025934 Ga0207686_10010825 Ga0207686_100108254 357
978 3300025936 Ga0207670_10003370 Ga0207670_100033701 357
979 3300025936 Ga0207670_10058770 Ga0207670_100587703 357
980 3300025936 Ga0207670_10199551 Ga0207670_101995512 357
981 3300025938 Ga0207704_10043620 Ga0207704_100436203 357
982 3300025940 Ga0207691_10150241 Ga0207691_101502412 357
983 3300025942 Ga0207689_10036444 Ga0207689_100364442 357
984 3300025960 Ga0207651_10203723 Ga0207651_102037232 357
985 3300025981 Ga0207640_10109378 Ga0207640_101093781 357
986 3300026035 Ga0207703_10003450 Ga0207703_100034506 357
987 3300026075 Ga0207708_10003477 Ga0207708_100034773 357
988 3300026075 Ga0207708_10056058 Ga0207708_100560582 357
989 3300026075 Ga0207708_10081767 Ga0207708_100817672 357
990 3300026088 Ga0207641_10122856 Ga0207641_101228562 357
991 3300026089 Ga0207648_10001129 Ga0207648_1000112923 357
992 3300026095 Ga0207676_10087204 Ga0207676_100872042 357
993 3300026121 Ga0207683_10056469 Ga0207683_100564692 357
994 3300027907 Ga0207428_10084280 Ga0207428_100842802 357
995 3300027907 Ga0207428_10089007 Ga0207428_100890071 357
996 3300028381 Ga0268264_10007749 Ga0268264_100077497 357
997 3300031251 Ga0265327_10004586 Ga0265327_100045867 357
998 3300045051 Ga0451576_0008442 Ga0451576_0008442_5467_6543 357
999 3300046539 Ga0495621_0001364 Ga0495621_0001364_4475_5548 357
1000 3300049578 Ga0501042_0011677 Ga0501042_0011677_3458_4540 357
1001 3300049587 Ga0501071_0019597 Ga0501071_0019597_2780_3862 357
1002 3300049743 Ga0501081_0011798 Ga0501081_0011798_4490_5572 357
1003 3300050507 nmdc:mga05p37_444686_c1 nmdc:mga05p37_444686_c1_36_1112 357
1004 3300050511 nmdc:mga08y16_273965_c1 nmdc:mga08y16_273965_c1_617_1690 357
1005 3300050511 nmdc:mga08y16_46864_c1 nmdc:mga08y16_46864_c1_616_1689 357
1006 3300050511 nmdc:mga08y16_504_c1 nmdc:mga08y16_504_c1_14616_15689 357
1007 3300050512 nmdc:mga0n895_78707_c1 nmdc:mga0n895_78707_c1_1027_2103 357
1008 3300003323 rootH1_10052808 rootH1_100528085 358
1009 3300006175 Ga0070712_100069113 Ga0070712_1000691132 358
1010 3300009551 Ga0105238_10005510 Ga0105238_100055105 358
1011 3300025915 Ga0207693_10120583 Ga0207693_101205832 358
1012 3300025924 Ga0207694_10015342 Ga0207694_100153422 358
1013 3300035691 Ga0373931_0035227 Ga0373931_0035227_809_1924 358
1014 3300050508 nmdc:mga09592_252817_c1 nmdc:mga09592_252817_c1_281_1396 358
1015 3300050509 nmdc:mga0qj67_21101_c1 nmdc:mga0qj67_21101_c1_1186_2301 358
1016 3300050510 nmdc:mga06r32_46937_c1 nmdc:mga06r32_46937_c1_728_1843 358
1017 3300003373 JGI25407J50210_10001911 JGI25407J50210_100019113 359
1018 3300005981 Ga0081538_10000004 Ga0081538_1000000473 359
1019 3300006051 Ga0075364_10138463 Ga0075364_101384632 359
1020 3300013297 Ga0157378_10391349 Ga0157378_103913491 359
1021 3300030878 Ga0265770_1007359 Ga0265770_10073591 359
1022 3300031852 Ga0307410_10019576 Ga0307410_100195762 359
1023 3300031995 Ga0307409_100037964 Ga0307409_1000379642 359
1024 3300032002 Ga0307416_100165180 Ga0307416_1001651802 359
1025 3300045051 Ga0451576_0008949 Ga0451576_0008949_9202_10287 359
1026 3300005518 Ga0070699_100064384 Ga0070699_1000643843 360
1027 3300005530 Ga0070679_100210201 Ga0070679_1002102012 360
1028 3300005536 Ga0070697_100036753 Ga0070697_1000367531 360
1029 3300005618 Ga0068864_100129009 Ga0068864_1001290091 360
1030 3300006847 Ga0075431_100076459 Ga0075431_1000764593 360
1031 3300009177 Ga0105248_10018050 Ga0105248_100180508 360
1032 3300048911 Ga0496108_0005882 Ga0496108_0005882_8268_9398 360
1033 3300048912 Ga0496109_0265194 Ga0496109_0265194_299_1387 360
1034 3300048913 Ga0496110_0017224 Ga0496110_0017224_2969_4057 360
1035 3300049742 Ga0501080_0161284 Ga0501080_0161284_350_1507 360
1036 3300050510 nmdc:mga06r32_113980_c1 nmdc:mga06r32_113980_c1_1516_2628 360
1037 3300061734 Ga0530510_0034058 Ga0530510_0034058_324_1445 360
1038 3300005295 Ga0065707_10095335 Ga0065707_100953353 361
1039 3300006844 Ga0075428_100109485 Ga0075428_1001094852 361
1040 3300006847 Ga0075431_100018729 Ga0075431_1000187295 361
1041 3300006880 Ga0075429_100071554 Ga0075429_1000715543 361
1042 3300007265 Ga0099794_10002655 Ga0099794_100026553 361
1043 3300009147 Ga0114129_10006952 Ga0114129_1000695210 361
1044 3300009147 Ga0114129_10033131 Ga0114129_100331317 361
1045 3300027671 Ga0209588_1028619 Ga0209588_10286192 361
1046 3300036401 Ga0373937_0210739 Ga0373937_0210739_332_1456 361
1047 3300049568 Ga0501031_0019548 Ga0501031_0019548_1508_2608 361
1048 3300049570 Ga0501033_0063719 Ga0501033_0063719_261_1361 361
1049 3300049574 Ga0501038_0134033 Ga0501038_0134033_658_1758 361
1050 3300049576 Ga0501040_0004086 Ga0501040_0004086_2790_3890 361
1051 3300049577 Ga0501041_0014933 Ga0501041_0014933_476_1576 361
1052 3300049578 Ga0501042_0003181 Ga0501042_0003181_3407_4507 361
1053 3300049582 Ga0501048_0016854 Ga0501048_0016854_1080_2180 361
1054 3300049587 Ga0501071_0020005 Ga0501071_0020005_1981_3081 361
1055 3300049588 Ga0501072_0004844 Ga0501072_0004844_4763_5863 361
1056 3300049592 Ga0501076_0011969 Ga0501076_0011969_1552_2652 361
1057 3300049742 Ga0501080_0096840 Ga0501080_0096840_1187_2287 361
1058 3300049824 Ga0501045_0011531 Ga0501045_0011531_2629_3729 361
1059 3300050507 nmdc:mga05p37_16959_c1 nmdc:mga05p37_16959_c1_7503_8627 361
1060 3300050510 nmdc:mga06r32_15782_c1 nmdc:mga06r32_15782_c1_2553_3677 361
1061 3300053085 Ga0495619_0081543 Ga0495619_0081543_669_1793 361
1062 3300054114 Ga0501084_0006547 Ga0501084_0006547_4336_5436 361
1063 3300060353 Ga0501082_0012030 Ga0501082_0012030_1184_2284 361
1064 3300061734 Ga0530510_0022875 Ga0530510_0022875_1018_2118 361
1065 3300003203 JGI25406J46586_10020800 JGI25406J46586_100208002 362
1066 3300005445 Ga0070708_100025793 Ga0070708_1000257935 362
1067 3300005445 Ga0070708_100033340 Ga0070708_1000333405 362
1068 3300005467 Ga0070706_100273176 Ga0070706_1002731761 362
1069 3300005468 Ga0070707_100247852 Ga0070707_1002478522 362
1070 3300005471 Ga0070698_100124924 Ga0070698_1001249241 362
1071 3300005518 Ga0070699_100077001 Ga0070699_1000770013 362
1072 3300005536 Ga0070697_100045110 Ga0070697_1000451104 362
1073 3300005536 Ga0070697_100152772 Ga0070697_1001527721 362
1074 3300005985 Ga0081539_10000035 Ga0081539_1000003533 362
1075 3300006844 Ga0075428_100003258 Ga0075428_10000325814 362
1076 3300006844 Ga0075428_100004744 Ga0075428_10000474412 362
1077 3300006844 Ga0075428_100020681 Ga0075428_1000206817 362
1078 3300006847 Ga0075431_100002445 Ga0075431_1000024452 362
1079 3300006847 Ga0075431_100004448 Ga0075431_10000444812 362
1080 3300006847 Ga0075431_100009670 Ga0075431_1000096706 362
1081 3300006847 Ga0075431_100026022 Ga0075431_1000260224 362
1082 3300006852 Ga0075433_10000348 Ga0075433_1000034824 362
1083 3300006871 Ga0075434_100092342 Ga0075434_1000923422 362
1084 3300006880 Ga0075429_100005845 Ga0075429_1000058456 362
1085 3300006880 Ga0075429_100055229 Ga0075429_1000552293 362
1086 3300006880 Ga0075429_100160770 Ga0075429_1001607702 362
1087 3300006914 Ga0075436_100003014 Ga0075436_1000030141 362
1088 3300007076 Ga0075435_100003893 Ga0075435_1000038932 362
1089 3300009093 Ga0105240_10021429 Ga0105240_100214298 362
1090 3300009094 Ga0111539_10576760 Ga0111539_105767602 362
1091 3300009147 Ga0114129_10000032 Ga0114129_1000003267 362
1092 3300009147 Ga0114129_10000127 Ga0114129_1000012720 362
1093 3300009147 Ga0114129_10006207 Ga0114129_100062075 362
1094 3300009147 Ga0114129_10037256 Ga0114129_100372565 362
1095 3300025910 Ga0207684_10000491 Ga0207684_100004918 362
1096 3300025922 Ga0207646_10002404 Ga0207646_100024044 362
1097 3300037471 Ga0395905_0035481 Ga0395905_0035481_1384_2517 362
1098 3300048088 Ga0495602_0136664 Ga0495602_0136664_613_1815 362
1099 3300050507 nmdc:mga05p37_10188_c1 nmdc:mga05p37_10188_c1_3481_4611 362
1100 3300050507 nmdc:mga05p37_12946_c1 nmdc:mga05p37_12946_c1_7443_8573 362
1101 3300050507 nmdc:mga05p37_13104_c1 nmdc:mga05p37_13104_c1_365_1498 362
1102 3300050507 nmdc:mga05p37_156577_c1 nmdc:mga05p37_156577_c1_480_1610 362
1103 3300050507 nmdc:mga05p37_3361_c1 nmdc:mga05p37_3361_c1_16728_17870 362
1104 3300050508 nmdc:mga09592_183003_c1 nmdc:mga09592_183003_c1_444_1574 362
1105 3300050508 nmdc:mga09592_5612_c1 nmdc:mga09592_5612_c1_4405_5535 362
1106 3300050508 nmdc:mga09592_70846_c1 nmdc:mga09592_70846_c1_1705_2838 362
1107 3300050509 nmdc:mga0qj67_13711_c1 nmdc:mga0qj67_13711_c1_3954_5084 362
1108 3300050509 nmdc:mga0qj67_245972_c1 nmdc:mga0qj67_245972_c1_123_1253 362
1109 3300050510 nmdc:mga06r32_4670_c1 nmdc:mga06r32_4670_c1_10458_11588 362
1110 3300050510 nmdc:mga06r32_48535_c1 nmdc:mga06r32_48535_c1_23_1153 362
1111 3300050510 nmdc:mga06r32_66280_c1 nmdc:mga06r32_66280_c1_461_1591 362
1112 3300050510 nmdc:mga06r32_66410_c1 nmdc:mga06r32_66410_c1_1628_2761 362
1113 3300050512 nmdc:mga0n895_5966_c1 nmdc:mga0n895_5966_c1_7828_8970 362
1114 3300050513 nmdc:mga0rr50_354_c1 nmdc:mga0rr50_354_c1_2164_3306 362
1115 3300050514 nmdc:mga08x19_2446_c1 nmdc:mga08x19_2446_c1_9875_11017 362
1116 3300050515 nmdc:mga0a205_2072_c1 nmdc:mga0a205_2072_c1_7604_8746 362
1117 3300053085 Ga0495619_0011460 Ga0495619_0011460_2136_3263 362
1118 3300005440 Ga0070705_100009951 Ga0070705_1000099512 363
1119 3300005459 Ga0068867_100136856 Ga0068867_1001368562 363
1120 3300005518 Ga0070699_100017590 Ga0070699_1000175907 363
1121 3300005841 Ga0068863_100213775 Ga0068863_1002137752 363
1122 3300006058 Ga0075432_10022092 Ga0075432_100220922 363
1123 3300006846 Ga0075430_100002969 Ga0075430_1000029697 363
1124 3300006871 Ga0075434_100002451 Ga0075434_1000024514 363
1125 3300007076 Ga0075435_100020624 Ga0075435_1000206245 363
1126 3300007076 Ga0075435_100040892 Ga0075435_1000408924 363
1127 3300007076 Ga0075435_100101013 Ga0075435_1001010133 363
1128 3300009147 Ga0114129_10011327 Ga0114129_100113276 363
1129 3300009147 Ga0114129_10185545 Ga0114129_101855452 363
1130 3300013308 Ga0157375_10211661 Ga0157375_102116612 363
1131 3300025910 Ga0207684_10031743 Ga0207684_100317434 363
1132 3300026088 Ga0207641_10148860 Ga0207641_101488603 363
1133 3300027907 Ga0207428_10086614 Ga0207428_100866143 363
1134 3300035691 Ga0373931_0016904 Ga0373931_0016904_807_1937 363
1135 3300046472 Ga0495580_0000346 Ga0495580_0000346_18542_19672 363
1136 3300046664 Ga0495659_0022356 Ga0495659_0022356_266_1396 363
1137 3300049583 Ga0501067_0020205 Ga0501067_0020205_2100_3212 363
1138 3300050507 nmdc:mga05p37_45778_c1 nmdc:mga05p37_45778_c1_3772_4884 363
1139 3300050507 nmdc:mga05p37_65409_c1 nmdc:mga05p37_65409_c1_2240_3370 363
1140 3300050511 nmdc:mga08y16_2708_c1 nmdc:mga08y16_2708_c1_3756_4886 363
1141 3300050512 nmdc:mga0n895_118817_c1 nmdc:mga0n895_118817_c1_951_2042 363
1142 3300050512 nmdc:mga0n895_11991_c1 nmdc:mga0n895_11991_c1_5845_6978 363
1143 3300050512 nmdc:mga0n895_20427_c1 nmdc:mga0n895_20427_c1_3090_4220 363
1144 3300050513 nmdc:mga0rr50_32236_c1 nmdc:mga0rr50_32236_c1_2348_3481 363
1145 3300050513 nmdc:mga0rr50_80461_c1 nmdc:mga0rr50_80461_c1_913_2046 363
1146 3300050515 nmdc:mga0a205_3147_c1 nmdc:mga0a205_3147_c1_12715_13845 363
1147 3300050515 nmdc:mga0a205_74669_c1 nmdc:mga0a205_74669_c1_668_1798 363
1148 3300005354 Ga0070675_100000253 Ga0070675_10000025312 364
1149 3300005937 Ga0081455_10049132 Ga0081455_100491324 364
1150 3300005985 Ga0081539_10017051 Ga0081539_100170514 364
1151 3300025918 Ga0207662_10084746 Ga0207662_100847461 364
1152 3300025926 Ga0207659_10000854 Ga0207659_100008542 364
1153 3300025942 Ga0207689_10092527 Ga0207689_100925272 364
1154 3300049576 Ga0501040_0009350 Ga0501040_0009350_1344_2447 364
1155 3300049586 Ga0501070_0024597 Ga0501070_0024597_3323_4426 364
1156 3300005340 Ga0070689_100085455 Ga0070689_1000854552 365
1157 3300005353 Ga0070669_100055599 Ga0070669_1000555991 365
1158 3300005354 Ga0070675_100127945 Ga0070675_1001279451 365
1159 3300005365 Ga0070688_100110805 Ga0070688_1001108052 365
1160 3300005543 Ga0070672_100079330 Ga0070672_1000793302 365
1161 3300005985 Ga0081539_10092488 Ga0081539_100924882 365
1162 3300006880 Ga0075429_100278492 Ga0075429_1002784922 365
1163 3300025940 Ga0207691_10087850 Ga0207691_100878503 365
1164 3300026067 Ga0207678_10074382 Ga0207678_100743822 365
1165 3300037418 Ga0395900_0147181 Ga0395900_0147181_708_1814 365
1166 3300038443 Ga0395901_0157581 Ga0395901_0157581_548_1654 365
1167 3300044712 Ga0453684_0007129 Ga0453684_0007129_14783_15910 365
1168 3300049568 Ga0501031_0001166 Ga0501031_0001166_887_2020 365
1169 3300049569 Ga0501032_0002307 Ga0501032_0002307_4932_6065 365
1170 3300049570 Ga0501033_0000941 Ga0501033_0000941_9664_10797 365
1171 3300049571 Ga0501034_0002121 Ga0501034_0002121_1015_2148 365
1172 3300049572 Ga0501036_0000057 Ga0501036_0000057_2103_3236 365
1173 3300049573 Ga0501037_0001310 Ga0501037_0001310_887_2020 365
1174 3300049574 Ga0501038_0000391 Ga0501038_0000391_30585_31718 365
1175 3300049575 Ga0501039_0000309 Ga0501039_0000309_23806_24939 365
1176 3300049578 Ga0501042_0099901 Ga0501042_0099901_305_1438 365
1177 3300049579 Ga0501043_0000111 Ga0501043_0000111_54316_55449 365
1178 3300049580 Ga0501046_0000307 Ga0501046_0000307_37845_38978 365
1179 3300049581 Ga0501047_0000289 Ga0501047_0000289_21189_22322 365
1180 3300049582 Ga0501048_0000298 Ga0501048_0000298_4933_6066 365
1181 3300049584 Ga0501068_0054740 Ga0501068_0054740_478_1611 365
1182 3300049585 Ga0501069_0006770 Ga0501069_0006770_4839_5972 365
1183 3300049586 Ga0501070_0001132 Ga0501070_0001132_17846_18979 365
1184 3300049587 Ga0501071_0048161 Ga0501071_0048161_1189_2322 365
1185 3300049588 Ga0501072_0105608 Ga0501072_0105608_189_1322 365
1186 3300049589 Ga0501073_0013683 Ga0501073_0013683_2736_3869 365
1187 3300049590 Ga0501074_0000074 Ga0501074_0000074_10090_11223 365
1188 3300049742 Ga0501080_0000244 Ga0501080_0000244_19673_20806 365
1189 3300049744 Ga0501083_0036872 Ga0501083_0036872_1014_2147 365
1190 3300049822 Ga0501035_0000262 Ga0501035_0000262_13410_14543 365
1191 3300049823 Ga0501044_0000312 Ga0501044_0000312_43896_45029 365
1192 3300049824 Ga0501045_0082011 Ga0501045_0082011_1096_2229 365
1193 3300050496 nmdc:mga07m45_24539_c1 nmdc:mga07m45_24539_c1_1999_3144 365
1194 3300054114 Ga0501084_0001637 Ga0501084_0001637_6811_7944 365
1195 3300060353 Ga0501082_0107841 Ga0501082_0107841_1208_2341 365
1196 3300003203 JGI25406J46586_10001453 JGI25406J46586_100014532 366
1197 3300005338 Ga0068868_100107984 Ga0068868_1001079842 366
1198 3300005618 Ga0068864_100030047 Ga0068864_1000300473 366
1199 3300005985 Ga0081539_10000024 Ga0081539_10000024240 366
1200 3300026023 Ga0207677_10123707 Ga0207677_101237072 366
1201 3300026095 Ga0207676_10022681 Ga0207676_100226813 366
1202 3300026142 Ga0207698_10238718 Ga0207698_102387182 366
1203 3300035242 Ga0373962_0023654 Ga0373962_0023654_106_1209 366
1204 3300050515 nmdc:mga0a205_146419_c1 nmdc:mga0a205_146419_c1_489_1589 366
1205 3300049591 Ga0501075_0233080 Ga0501075_0233080_48_1178 367
1206 3300006051 Ga0075364_10035090 Ga0075364_100350902 368
1207 3300006178 Ga0075367_10036217 Ga0075367_100362172 368
1208 3300006852 Ga0075433_10116262 Ga0075433_101162622 368
1209 3300009094 Ga0111539_10004229 Ga0111539_1000422911 368
1210 3300027907 Ga0207428_10244222 Ga0207428_102442221 368
1211 3300031548 Ga0307408_100013432 Ga0307408_1000134324 368
1212 3300032002 Ga0307416_100008589 Ga0307416_1000085894 368
1213 3300042436 Ga0439435_0002282 Ga0439435_0002282_2436_3545 368
1214 3300050513 nmdc:mga0rr50_167056_c1 nmdc:mga0rr50_167056_c1_24_1136 368
1215 3300003203 JGI25406J46586_10003867 JGI25406J46586_100038674 369
1216 3300005518 Ga0070699_100010678 Ga0070699_1000106784 369
1217 3300005985 Ga0081539_10022783 Ga0081539_100227832 369
1218 3300025941 Ga0207711_10018748 Ga0207711_100187482 369
1219 3300005985 Ga0081539_10094365 Ga0081539_100943652 370
1220 3300045976 Ga0466967_0133259 Ga0466967_0133259_939_2054 370
1221 3300046543 Ga0495645_0000509 Ga0495645_0000509_1133_2257 370
1222 3300049577 Ga0501041_0126730 Ga0501041_0126730_227_1480 370
1223 3300005618 Ga0068864_100375659 Ga0068864_1003756591 373
1224 3300005842 Ga0068858_100005689 Ga0068858_1000056897 373
1225 3300005843 Ga0068860_100097700 Ga0068860_1000977003 373
1226 3300014968 Ga0157379_10003064 Ga0157379_1000306412 373
1227 3300026035 Ga0207703_10028221 Ga0207703_100282212 373
1228 3300036401 Ga0373937_0055725 Ga0373937_0055725_2278_3405 373
1229 3300005548 Ga0070665_100044289 Ga0070665_1000442892 374
1230 3300006358 Ga0068871_100001762 Ga0068871_10000176211 374
1231 3300006871 Ga0075434_100041223 Ga0075434_1000412232 374
1232 3300009147 Ga0114129_10003744 Ga0114129_1000374418 374
1233 3300026121 Ga0207683_10124695 Ga0207683_101246953 374
1234 3300028379 Ga0268266_10012762 Ga0268266_100127622 374
1235 3300042876 Ga0451577_0085446 Ga0451577_0085446_267_1445 374
1236 3300050507 nmdc:mga05p37_6361_c1 nmdc:mga05p37_6361_c1_2919_4046 374
1237 3300050512 nmdc:mga0n895_10806_c1 nmdc:mga0n895_10806_c1_795_1922 374
1238 3300005347 Ga0070668_100028688 Ga0070668_1000286884 375
1239 3300005354 Ga0070675_100036573 Ga0070675_1000365731 375
1240 3300005434 Ga0070709_10005949 Ga0070709_100059494 375
1241 3300005436 Ga0070713_100039343 Ga0070713_1000393432 375
1242 3300005457 Ga0070662_100119446 Ga0070662_1001194462 375
1243 3300005458 Ga0070681_10369968 Ga0070681_103699681 375
1244 3300005617 Ga0068859_100136215 Ga0068859_1001362152 375
1245 3300005937 Ga0081455_10120691 Ga0081455_101206912 375
1246 3300005985 Ga0081539_10054855 Ga0081539_100548552 375
1247 3300006028 Ga0070717_10070185 Ga0070717_100701852 375
1248 3300006237 Ga0097621_100000510 Ga0097621_10000051017 375
1249 3300006237 Ga0097621_100116772 Ga0097621_1001167722 375
1250 3300006358 Ga0068871_100000108 Ga0068871_1000001085 375
1251 3300006358 Ga0068871_100080567 Ga0068871_1000805672 375
1252 3300006931 Ga0097620_100136213 Ga0097620_1001362132 375
1253 3300009094 Ga0111539_10048226 Ga0111539_100482264 375
1254 3300009176 Ga0105242_10026154 Ga0105242_100261542 375
1255 3300009177 Ga0105248_10012226 Ga0105248_100122265 375
1256 3300009177 Ga0105248_10120483 Ga0105248_101204832 375
1257 3300009553 Ga0105249_10003805 Ga0105249_100038059 375
1258 3300013297 Ga0157378_10171200 Ga0157378_101712002 375
1259 3300014326 Ga0157380_10367951 Ga0157380_103679511 375
1260 3300025906 Ga0207699_10014716 Ga0207699_100147164 375
1261 3300025926 Ga0207659_10030752 Ga0207659_100307521 375
1262 3300025928 Ga0207700_10195584 Ga0207700_101955842 375
1263 3300025933 Ga0207706_10041924 Ga0207706_100419242 375
1264 3300025961 Ga0207712_10105025 Ga0207712_101050252 375
1265 3300026075 Ga0207708_10014140 Ga0207708_100141403 375
1266 3300026118 Ga0207675_100052039 Ga0207675_1000520392 375
1267 3300031238 Ga0265332_10020389 Ga0265332_100203892 375
1268 3300031711 Ga0265314_10027079 Ga0265314_100270792 375
1269 3300046472 Ga0495580_0172151 Ga0495580_0172151_327_1457 375
1270 3300046684 Ga0495669_0011838 Ga0495669_0011838_491_1621 375
1271 3300050511 nmdc:mga08y16_11284_c1 nmdc:mga08y16_11284_c1_206_1333 375
1272 3300050513 nmdc:mga0rr50_151407_c1 nmdc:mga0rr50_151407_c1_362_1492 375
1273 3300050515 nmdc:mga0a205_38110_c1 nmdc:mga0a205_38110_c1_2949_4076 375
1274 3300005328 Ga0070676_10001001 Ga0070676_100010016 376
1275 3300005341 Ga0070691_10000641 Ga0070691_100006412 376
1276 3300005353 Ga0070669_100125363 Ga0070669_1001253632 376
1277 3300005364 Ga0070673_100003415 Ga0070673_1000034156 376
1278 3300005364 Ga0070673_100161682 Ga0070673_1001616821 376
1279 3300005435 Ga0070714_100008730 Ga0070714_1000087306 376
1280 3300005438 Ga0070701_10003780 Ga0070701_100037802 376
1281 3300005444 Ga0070694_100010050 Ga0070694_1000100501 376
1282 3300005545 Ga0070695_100066492 Ga0070695_1000664921 376
1283 3300005549 Ga0070704_100033130 Ga0070704_1000331301 376
1284 3300005578 Ga0068854_100113415 Ga0068854_1001134152 376
1285 3300005615 Ga0070702_100002472 Ga0070702_1000024722 376
1286 3300005719 Ga0068861_100015207 Ga0068861_1000152074 376
1287 3300005844 Ga0068862_100157271 Ga0068862_1001572712 376
1288 3300006844 Ga0075428_100106053 Ga0075428_1001060533 376
1289 3300006871 Ga0075434_100391167 Ga0075434_1003911671 376
1290 3300009094 Ga0111539_10009801 Ga0111539_100098018 376
1291 3300009094 Ga0111539_10229966 Ga0111539_102299661 376
1292 3300009147 Ga0114129_10000939 Ga0114129_100009398 376
1293 3300009148 Ga0105243_10006221 Ga0105243_100062217 376
1294 3300014325 Ga0163163_10047022 Ga0163163_100470222 376
1295 3300025907 Ga0207645_10001211 Ga0207645_1000121117 376
1296 3300025907 Ga0207645_10054617 Ga0207645_100546171 376
1297 3300025922 Ga0207646_10017164 Ga0207646_100171645 376
1298 3300025923 Ga0207681_10135371 Ga0207681_101353711 376
1299 3300025929 Ga0207664_10028758 Ga0207664_100287582 376
1300 3300025935 Ga0207709_10028476 Ga0207709_100284762 376
1301 3300025936 Ga0207670_10058784 Ga0207670_100587841 376
1302 3300025960 Ga0207651_10009269 Ga0207651_100092694 376
1303 3300025960 Ga0207651_10121253 Ga0207651_101212531 376
1304 3300026075 Ga0207708_10003212 Ga0207708_100032124 376
1305 3300026089 Ga0207648_10054768 Ga0207648_100547682 376
1306 3300026118 Ga0207675_100010366 Ga0207675_1000103664 376
1307 3300027907 Ga0207428_10178367 Ga0207428_101783672 376
1308 3300035111 Ga0373923_0045215 Ga0373923_0045215_352_1485 376
1309 3300035116 Ga0373945_0059996 Ga0373945_0059996_72_1205 376
1310 3300035119 Ga0373956_0052479 Ga0373956_0052479_207_1340 376
1311 3300035170 Ga0373943_0015607 Ga0373943_0015607_2171_3304 376
1312 3300035171 Ga0373946_0024979 Ga0373946_0024979_1023_2156 376
1313 3300035172 Ga0373955_0033485 Ga0373955_0033485_1319_2452 376
1314 3300035410 Ga0373924_0007928 Ga0373924_0007928_1155_2288 376
1315 3300035692 Ga0373935_0076680 Ga0373935_0076680_264_1397 376
1316 3300035725 Ga0373947_0002973 Ga0373947_0002973_6329_7462 376
1317 3300037068 Ga0373925_0029664 Ga0373925_0029664_181_1314 376
1318 3300042011 Ga0439454_004658 Ga0439454_004658_154_1284 376
1319 3300042125 Ga0450923_004384 Ga0450923_004384_714_1844 376
1320 3300046473 Ga0495582_0098518 Ga0495582_0098518_47_1180 376
1321 3300046511 Ga0495608_0020626 Ga0495608_0020626_1764_2897 376
1322 3300046516 Ga0495628_0122326 Ga0495628_0122326_770_1903 376
1323 3300046531 Ga0495665_0108169 Ga0495665_0108169_276_1409 376
1324 3300046533 Ga0495640_0094151 Ga0495640_0094151_44_1177 376
1325 3300046536 Ga0495587_0081896 Ga0495587_0081896_155_1288 376
1326 3300046539 Ga0495621_0013561 Ga0495621_0013561_201_1370 376
1327 3300046559 Ga0495667_0021852 Ga0495667_0021852_2520_3653 376
1328 3300046663 Ga0495635_0132119 Ga0495635_0132119_357_1490 376
1329 3300046683 Ga0495658_0048533 Ga0495658_0048533_799_1932 376
1330 3300046689 Ga0495613_0008520 Ga0495613_0008520_4189_5322 376
1331 3300046689 Ga0495613_0227618 Ga0495613_0227618_146_1279 376
1332 3300046809 Ga0495600_0098163 Ga0495600_0098163_186_1319 376
1333 3300047319 Ga0495674_0021360 Ga0495674_0021360_3784_4917 376
1334 3300047471 Ga0495684_0001676 Ga0495684_0001676_7865_8998 376
1335 3300050510 nmdc:mga06r32_113653_c1 nmdc:mga06r32_113653_c1_720_1868 376
1336 3300050511 nmdc:mga08y16_185985_c1 nmdc:mga08y16_185985_c1_67_1236 376
1337 3300050512 nmdc:mga0n895_2106_c1 nmdc:mga0n895_2106_c1_4747_5877 376
1338 3300053085 Ga0495619_0074185 Ga0495619_0074185_87_1220 376
1339 3300060353 Ga0501082_0073646 Ga0501082_0073646_61_1194 376
1340 3300005330 Ga0070690_100082498 Ga0070690_1000824981 377
1341 3300005335 Ga0070666_10039300 Ga0070666_100393004 377
1342 3300005338 Ga0068868_100004371 Ga0068868_1000043713 377
1343 3300005367 Ga0070667_100110257 Ga0070667_1001102572 377
1344 3300005548 Ga0070665_100002991 Ga0070665_10000299113 377
1345 3300005842 Ga0068858_100096443 Ga0068858_1000964431 377
1346 3300005843 Ga0068860_100059285 Ga0068860_1000592852 377
1347 3300006237 Ga0097621_100023601 Ga0097621_1000236012 377
1348 3300009176 Ga0105242_10114559 Ga0105242_101145591 377
1349 3300009177 Ga0105248_10368026 Ga0105248_103680261 377
1350 3300013306 Ga0163162_10092279 Ga0163162_100922793 377
1351 3300014968 Ga0157379_10013575 Ga0157379_100135753 377
1352 3300025934 Ga0207686_10006274 Ga0207686_100062742 377
1353 3300025941 Ga0207711_10062275 Ga0207711_100622752 377
1354 3300025986 Ga0207658_10194161 Ga0207658_101941611 377
1355 3300026023 Ga0207677_10005324 Ga0207677_100053244 377
1356 3300026035 Ga0207703_10001811 Ga0207703_100018111 377
1357 3300028379 Ga0268266_10004015 Ga0268266_100040159 377
1358 3300048918 Ga0496115_0053909 Ga0496115_0053909_1628_2809 377
1359 3300049586 Ga0501070_0146802 Ga0501070_0146802_659_1816 377
1360 3300050512 nmdc:mga0n895_130462_c1 nmdc:mga0n895_130462_c1_688_1827 377
1361 3300050513 nmdc:mga0rr50_7956_c1 nmdc:mga0rr50_7956_c1_5096_6235 377
1362 3300005340 Ga0070689_100099802 Ga0070689_1000998022 378
1363 3300042461 Ga0439460_0020898 Ga0439460_0020898_416_1555 378
1364 3300049571 Ga0501034_0164197 Ga0501034_0164197_628_1788 378
1365 3300005295 Ga0065707_10137250 Ga0065707_101372502 379
1366 3300005340 Ga0070689_100273604 Ga0070689_1002736041 379
1367 3300011119 Ga0105246_10136664 Ga0105246_101366641 379
1368 3300014325 Ga0163163_10136659 Ga0163163_101366592 379
1369 3300025936 Ga0207670_10235702 Ga0207670_102357022 379
1370 3300031824 Ga0307413_10054017 Ga0307413_100540172 379
1371 3300031852 Ga0307410_10103711 Ga0307410_101037111 379
1372 3300037418 Ga0395900_0327770 Ga0395900_0327770_289_1431 379
1373 3300042436 Ga0439435_0038192 Ga0439435_0038192_101_1240 379
1374 3300009147 Ga0114129_10003134 Ga0114129_1000313422 380
1375 3300032002 Ga0307416_100016633 Ga0307416_1000166333 380
1376 3300050507 nmdc:mga05p37_63640_c1 nmdc:mga05p37_63640_c1_3100_4248 380
1377 3300049580 Ga0501046_0125431 Ga0501046_0125431_367_1521 381
1378 3300049587 Ga0501071_0184437 Ga0501071_0184437_145_1299 381
1379 3300053085 Ga0495619_0088962 Ga0495619_0088962_760_1947 381
1380 3300060353 Ga0501082_0063921 Ga0501082_0063921_425_1579 381
1381 3300005290 Ga0065712_10000291 Ga0065712_100002919 382
1382 3300005293 Ga0065715_10088927 Ga0065715_100889279 382
1383 3300005347 Ga0070668_100255113 Ga0070668_1002551132 382
1384 3300005354 Ga0070675_100024137 Ga0070675_1000241372 382
1385 3300005355 Ga0070671_100133600 Ga0070671_1001336002 382
1386 3300005364 Ga0070673_100010744 Ga0070673_1000107446 382
1387 3300005365 Ga0070688_100011267 Ga0070688_1000112674 382
1388 3300005456 Ga0070678_100007740 Ga0070678_1000077403 382
1389 3300005466 Ga0070685_10058265 Ga0070685_100582652 382
1390 3300005543 Ga0070672_100006459 Ga0070672_1000064592 382
1391 3300005544 Ga0070686_100046276 Ga0070686_1000462762 382
1392 3300005615 Ga0070702_100150313 Ga0070702_1001503132 382
1393 3300005618 Ga0068864_100003807 Ga0068864_1000038079 382
1394 3300005834 Ga0068851_10037183 Ga0068851_100371832 382
1395 3300009094 Ga0111539_10218455 Ga0111539_102184551 382
1396 3300009176 Ga0105242_10109442 Ga0105242_101094422 382
1397 3300009177 Ga0105248_10007178 Ga0105248_100071785 382
1398 3300009553 Ga0105249_10028809 Ga0105249_100288092 382
1399 3300013308 Ga0157375_10114966 Ga0157375_101149662 382
1400 3300014325 Ga0163163_10017879 Ga0163163_100178792 382
1401 3300025315 Ga0207697_10028256 Ga0207697_100282562 382
1402 3300025901 Ga0207688_10063280 Ga0207688_100632802 382
1403 3300025907 Ga0207645_10079852 Ga0207645_100798522 382
1404 3300025908 Ga0207643_10132954 Ga0207643_101329542 382
1405 3300025926 Ga0207659_10011484 Ga0207659_100114842 382
1406 3300025935 Ga0207709_10061172 Ga0207709_100611722 382
1407 3300025940 Ga0207691_10006867 Ga0207691_100068674 382
1408 3300025941 Ga0207711_10010515 Ga0207711_100105152 382
1409 3300025960 Ga0207651_10026264 Ga0207651_100262644 382
1410 3300025961 Ga0207712_10016816 Ga0207712_100168163 382
1411 3300026089 Ga0207648_10023618 Ga0207648_100236183 382
1412 3300026121 Ga0207683_10003923 Ga0207683_100039233 382
1413 3300028380 Ga0268265_10089961 Ga0268265_100899611 382
1414 3300035170 Ga0373943_0038565 Ga0373943_0038565_165_1367 382
1415 3300048904 Ga0496101_0236363 Ga0496101_0236363_29_1186 382
1416 3300048905 Ga0496102_0119680 Ga0496102_0119680_956_2113 382
1417 3300048907 Ga0496104_0010031 Ga0496104_0010031_1011_2168 382
1418 3300048908 Ga0496105_0161757 Ga0496105_0161757_664_1821 382
1419 3300048909 Ga0496106_0029816 Ga0496106_0029816_1964_3121 382
1420 3300048909 Ga0496106_0159907 Ga0496106_0159907_381_1538 382
1421 3300048910 Ga0496107_0082562 Ga0496107_0082562_758_1915 382
1422 3300048911 Ga0496108_0002685 Ga0496108_0002685_162_1319 382
1423 3300048912 Ga0496109_0001158 Ga0496109_0001158_16850_18007 382
1424 3300048913 Ga0496110_0092227 Ga0496110_0092227_851_2008 382
1425 3300048914 Ga0496111_0076714 Ga0496111_0076714_637_1794 382
1426 3300048915 Ga0496112_0001156 Ga0496112_0001156_7862_9019 382
1427 3300048916 Ga0496113_0008939 Ga0496113_0008939_341_1498 382
1428 3300005290 Ga0065712_10069922 Ga0065712_100699225 383
1429 3300005293 Ga0065715_10093813 Ga0065715_100938133 383
1430 3300005329 Ga0070683_100014524 Ga0070683_1000145242 383
1431 3300005344 Ga0070661_100003449 Ga0070661_1000034495 383
1432 3300005455 Ga0070663_100130434 Ga0070663_1001304341 383
1433 3300005535 Ga0070684_100000213 Ga0070684_1000002138 383
1434 3300005543 Ga0070672_100129850 Ga0070672_1001298502 383
1435 3300005564 Ga0070664_100003485 Ga0070664_1000034853 383
1436 3300006852 Ga0075433_10082409 Ga0075433_100824092 383
1437 3300006881 Ga0068865_100202672 Ga0068865_1002026721 383
1438 3300009094 Ga0111539_10004348 Ga0111539_100043486 383
1439 3300009177 Ga0105248_10318894 Ga0105248_103188941 383
1440 3300013306 Ga0163162_10008622 Ga0163162_100086228 383
1441 3300013306 Ga0163162_10331878 Ga0163162_103318782 383
1442 3300014325 Ga0163163_10008055 Ga0163163_100080554 383
1443 3300014745 Ga0157377_10109470 Ga0157377_101094701 383
1444 3300014968 Ga0157379_10190944 Ga0157379_101909441 383
1445 3300025920 Ga0207649_10043227 Ga0207649_100432272 383
1446 3300025926 Ga0207659_10056908 Ga0207659_100569082 383
1447 3300025944 Ga0207661_10001430 Ga0207661_100014302 383
1448 3300025945 Ga0207679_10059730 Ga0207679_100597302 383
1449 3300026067 Ga0207678_10004486 Ga0207678_100044868 383
1450 3300036401 Ga0373937_0243687 Ga0373937_0243687_304_1476 383
1451 3300048907 Ga0496104_0003311 Ga0496104_0003311_292_1443 383
1452 3300048908 Ga0496105_0092061 Ga0496105_0092061_969_2120 383
1453 3300048912 Ga0496109_0003151 Ga0496109_0003151_10020_11171 383
1454 3300048914 Ga0496111_0006838 Ga0496111_0006838_3512_4663 383
1455 3300049570 Ga0501033_0078188 Ga0501033_0078188_63_1217 383
1456 3300049575 Ga0501039_0114050 Ga0501039_0114050_43_1197 383
1457 3300049576 Ga0501040_0176649 Ga0501040_0176649_268_1422 383
1458 3300049587 Ga0501071_0039050 Ga0501071_0039050_734_1888 383
1459 3300049588 Ga0501072_0009420 Ga0501072_0009420_4090_5244 383
1460 3300049741 Ga0501079_0107212 Ga0501079_0107212_22_1176 383
1461 3300050507 nmdc:mga05p37_275_c1 nmdc:mga05p37_275_c1_8280_9440 383
1462 3300050508 nmdc:mga09592_137332_c1 nmdc:mga09592_137332_c1_901_2061 383
1463 3300050510 nmdc:mga06r32_52312_c1 nmdc:mga06r32_52312_c1_708_1868 383
1464 3300050510 nmdc:mga06r32_7657_c1 nmdc:mga06r32_7657_c1_7883_9034 383
1465 3300050511 nmdc:mga08y16_28869_c1 nmdc:mga08y16_28869_c1_1776_2936 383
1466 3300050511 nmdc:mga08y16_6332_c1 nmdc:mga08y16_6332_c1_6134_7306 383
1467 3300054114 Ga0501084_0282519 Ga0501084_0282519_150_1304 383
1468 3300005289 Ga0065704_10090251 Ga0065704_100902512 384
1469 3300005295 Ga0065707_10002597 Ga0065707_100025972 384
1470 3300005331 Ga0070670_100194418 Ga0070670_1001944182 384
1471 3300005354 Ga0070675_100047989 Ga0070675_1000479892 384
1472 3300005356 Ga0070674_100011162 Ga0070674_1000111624 384
1473 3300005438 Ga0070701_10006652 Ga0070701_100066522 384
1474 3300005459 Ga0068867_100003246 Ga0068867_1000032468 384
1475 3300005549 Ga0070704_100008238 Ga0070704_1000082385 384
1476 3300005564 Ga0070664_100163765 Ga0070664_1001637652 384
1477 3300005577 Ga0068857_100085189 Ga0068857_1000851893 384
1478 3300005617 Ga0068859_100033086 Ga0068859_1000330862 384
1479 3300005617 Ga0068859_100228236 Ga0068859_1002282361 384
1480 3300005618 Ga0068864_100071533 Ga0068864_1000715332 384
1481 3300005618 Ga0068864_100194065 Ga0068864_1001940652 384
1482 3300005719 Ga0068861_100006139 Ga0068861_1000061394 384
1483 3300005844 Ga0068862_100000192 Ga0068862_10000019228 384
1484 3300006195 Ga0075366_10006958 Ga0075366_100069582 384
1485 3300006844 Ga0075428_100061209 Ga0075428_1000612093 384
1486 3300006844 Ga0075428_100072723 Ga0075428_1000727232 384
1487 3300006846 Ga0075430_100007284 Ga0075430_1000072845 384
1488 3300006847 Ga0075431_100008897 Ga0075431_1000088972 384
1489 3300006880 Ga0075429_100103843 Ga0075429_1001038432 384
1490 3300006881 Ga0068865_100103385 Ga0068865_1001033852 384
1491 3300006931 Ga0097620_100033086 Ga0097620_1000330862 384
1492 3300006931 Ga0097620_100228244 Ga0097620_1002282442 384
1493 3300009147 Ga0114129_10015037 Ga0114129_100150373 384
1494 3300009147 Ga0114129_10029973 Ga0114129_100299732 384
1495 3300009148 Ga0105243_10054643 Ga0105243_100546432 384
1496 3300013308 Ga0157375_10047330 Ga0157375_100473304 384
1497 3300014968 Ga0157379_10203540 Ga0157379_102035402 384
1498 3300014969 Ga0157376_10299891 Ga0157376_102998912 384
1499 3300025908 Ga0207643_10048157 Ga0207643_100481571 384
1500 3300025923 Ga0207681_10020691 Ga0207681_100206912 384
1501 3300025925 Ga0207650_10191455 Ga0207650_101914551 384
1502 3300025933 Ga0207706_10009358 Ga0207706_100093587 384
1503 3300025935 Ga0207709_10008062 Ga0207709_100080624 384
1504 3300025938 Ga0207704_10075104 Ga0207704_100751042 384
1505 3300026075 Ga0207708_10018446 Ga0207708_100184464 384
1506 3300026089 Ga0207648_10004649 Ga0207648_100046494 384
1507 3300026095 Ga0207676_10047034 Ga0207676_100470342 384
1508 3300026116 Ga0207674_10071773 Ga0207674_100717734 384
1509 3300026116 Ga0207674_10227804 Ga0207674_102278042 384
1510 3300026118 Ga0207675_100043996 Ga0207675_1000439963 384
1511 3300027907 Ga0207428_10001100 Ga0207428_1000110025 384
1512 3300028380 Ga0268265_10000185 Ga0268265_1000018540 384
1513 3300031731 Ga0307405_10104994 Ga0307405_101049941 384
1514 3300031901 Ga0307406_10081494 Ga0307406_100814942 384
1515 3300032002 Ga0307416_100178783 Ga0307416_1001787832 384
1516 3300044712 Ga0453684_0360157 Ga0453684_0360157_184_1338 384
1517 3300046684 Ga0495669_0108264 Ga0495669_0108264_88_1245 384
1518 3300048904 Ga0496101_0156636 Ga0496101_0156636_50_1207 384
1519 3300049583 Ga0501067_0036773 Ga0501067_0036773_725_1882 384
1520 3300049583 Ga0501067_0146587 Ga0501067_0146587_133_1290 384
1521 3300050493 nmdc:mga0k408_24679_c1 nmdc:mga0k408_24679_c1_2190_3380 384
1522 3300050507 nmdc:mga05p37_482297_c1 nmdc:mga05p37_482297_c1_86_1243 384
1523 3300050508 nmdc:mga09592_182953_c1 nmdc:mga09592_182953_c1_182_1339 384
1524 3300050508 nmdc:mga09592_65081_c1 nmdc:mga09592_65081_c1_65_1222 384
1525 3300050509 nmdc:mga0qj67_2598_c1 nmdc:mga0qj67_2598_c1_9192_10349 384
1526 3300050510 nmdc:mga06r32_10914_c1 nmdc:mga06r32_10914_c1_2844_4001 384
1527 3300050511 nmdc:mga08y16_269854_c1 nmdc:mga08y16_269854_c1_47_1204 384
1528 3300053730 Ga0500645_001172 Ga0500645_001172_8009_9199 384
1529 3300005339 Ga0070660_100049144 Ga0070660_1000491442 385
1530 3300009093 Ga0105240_10275252 Ga0105240_102752522 385
1531 3300014326 Ga0157380_10367117 Ga0157380_103671171 385
1532 3300025913 Ga0207695_10158762 Ga0207695_101587622 385
1533 3300035692 Ga0373935_0141213 Ga0373935_0141213_168_1328 385
1534 3300037068 Ga0373925_0044438 Ga0373925_0044438_392_1552 385
1535 3300046538 Ga0495609_0033729 Ga0495609_0033729_1030_2193 385
1536 3300048915 Ga0496112_0041108 Ga0496112_0041108_639_1799 385
1537 3300048915 Ga0496112_0088517 Ga0496112_0088517_1349_2509 385
1538 3300049592 Ga0501076_0200901 Ga0501076_0200901_232_1392 385
1539 3300053096 Ga0500641_0002700 Ga0500641_0002700_1531_2691 385
1540 3300059424 Ga0590075_000928 Ga0590075_000928_3879_5042 385
1541 3300059426 Ga0590077_000323 Ga0590077_000323_3180_4343 385
1542 3300061734 Ga0530510_0041103 Ga0530510_0041103_2153_3319 385
1543 3300002077 JGI24744J21845_10015159 JGI24744J21845_100151591 386
1544 3300005293 Ga0065715_10115116 Ga0065715_101151162 386
1545 3300005335 Ga0070666_10185287 Ga0070666_101852871 386
1546 3300005341 Ga0070691_10024585 Ga0070691_100245852 386
1547 3300005354 Ga0070675_100118766 Ga0070675_1001187661 386
1548 3300005354 Ga0070675_100159515 Ga0070675_1001595152 386
1549 3300005355 Ga0070671_100251314 Ga0070671_1002513141 386
1550 3300005438 Ga0070701_10018766 Ga0070701_100187664 386
1551 3300005440 Ga0070705_100006809 Ga0070705_1000068092 386
1552 3300005444 Ga0070694_100000107 Ga0070694_10000010727 386
1553 3300005458 Ga0070681_10204787 Ga0070681_102047872 386
1554 3300005518 Ga0070699_100042598 Ga0070699_1000425983 386
1555 3300005535 Ga0070684_100173029 Ga0070684_1001730292 386
1556 3300005536 Ga0070697_100058647 Ga0070697_1000586472 386
1557 3300005545 Ga0070695_100001868 Ga0070695_1000018682 386
1558 3300005546 Ga0070696_100022563 Ga0070696_1000225634 386
1559 3300005564 Ga0070664_100042073 Ga0070664_1000420733 386
1560 3300006058 Ga0075432_10038984 Ga0075432_100389841 386
1561 3300006237 Ga0097621_100082245 Ga0097621_1000822452 386
1562 3300006844 Ga0075428_100021454 Ga0075428_1000214545 386
1563 3300006846 Ga0075430_100079058 Ga0075430_1000790582 386
1564 3300006847 Ga0075431_100015256 Ga0075431_1000152562 386
1565 3300006852 Ga0075433_10026871 Ga0075433_100268713 386
1566 3300006871 Ga0075434_100021900 Ga0075434_1000219002 386
1567 3300006880 Ga0075429_100008969 Ga0075429_1000089698 386
1568 3300007076 Ga0075435_100042755 Ga0075435_1000427553 386
1569 3300009147 Ga0114129_10071958 Ga0114129_100719584 386
1570 3300009147 Ga0114129_10200567 Ga0114129_102005673 386
1571 3300009148 Ga0105243_10036259 Ga0105243_100362592 386
1572 3300009176 Ga0105242_10121863 Ga0105242_101218632 386
1573 3300025315 Ga0207697_10002496 Ga0207697_100024968 386
1574 3300025315 Ga0207697_10068738 Ga0207697_100687382 386
1575 3300025926 Ga0207659_10045322 Ga0207659_100453222 386
1576 3300025931 Ga0207644_10204901 Ga0207644_102049011 386
1577 3300025935 Ga0207709_10058745 Ga0207709_100587452 386
1578 3300025944 Ga0207661_10043583 Ga0207661_100435832 386
1579 3300025945 Ga0207679_10167973 Ga0207679_101679732 386
1580 3300026075 Ga0207708_10051556 Ga0207708_100515562 386
1581 3300031911 Ga0307412_10087758 Ga0307412_100877582 386
1582 3300042436 Ga0439435_0008994 Ga0439435_0008994_699_1868 386
1583 3300046455 Ga0495603_0008241 Ga0495603_0008241_3871_5037 386
1584 3300046472 Ga0495580_0073561 Ga0495580_0073561_789_1955 386
1585 3300046499 Ga0495594_0076126 Ga0495594_0076126_450_1616 386
1586 3300046539 Ga0495621_0000799 Ga0495621_0000799_3414_4580 386
1587 3300048911 Ga0496108_0074259 Ga0496108_0074259_1392_2552 386
1588 3300049572 Ga0501036_0022956 Ga0501036_0022956_329_1492 386
1589 3300049572 Ga0501036_0137854 Ga0501036_0137854_309_1469 386
1590 3300049576 Ga0501040_0015481 Ga0501040_0015481_2255_3532 386
1591 3300049577 Ga0501041_0123376 Ga0501041_0123376_431_1594 386
1592 3300049578 Ga0501042_0002039 Ga0501042_0002039_8138_9307 386
1593 3300049578 Ga0501042_0092036 Ga0501042_0092036_423_1586 386
1594 3300049579 Ga0501043_0043834 Ga0501043_0043834_1040_2209 386
1595 3300049580 Ga0501046_0014958 Ga0501046_0014958_301_1470 386
1596 3300049582 Ga0501048_0005925 Ga0501048_0005925_6596_7765 386
1597 3300049584 Ga0501068_0039468 Ga0501068_0039468_1639_2808 386
1598 3300049587 Ga0501071_0005549 Ga0501071_0005549_5752_6921 386
1599 3300049587 Ga0501071_0116344 Ga0501071_0116344_511_1788 386
1600 3300049588 Ga0501072_0017150 Ga0501072_0017150_1151_2320 386
1601 3300049588 Ga0501072_0031779 Ga0501072_0031779_1124_2287 386
1602 3300049588 Ga0501072_0071964 Ga0501072_0071964_759_1919 386
1603 3300049591 Ga0501075_0003648 Ga0501075_0003648_20_1189 386
1604 3300049591 Ga0501075_0098365 Ga0501075_0098365_382_1545 386
1605 3300049592 Ga0501076_0007851 Ga0501076_0007851_419_1588 386
1606 3300049592 Ga0501076_0257598 Ga0501076_0257598_132_1292 386
1607 3300049741 Ga0501079_0018044 Ga0501079_0018044_270_1439 386
1608 3300049741 Ga0501079_0061460 Ga0501079_0061460_179_1342 386
1609 3300049743 Ga0501081_0000754 Ga0501081_0000754_11738_12907 386
1610 3300049743 Ga0501081_0195964 Ga0501081_0195964_123_1286 386
1611 3300049822 Ga0501035_0108437 Ga0501035_0108437_926_2095 386
1612 3300049824 Ga0501045_0034416 Ga0501045_0034416_2013_3290 386
1613 3300049824 Ga0501045_0147944 Ga0501045_0147944_163_1326 386
1614 3300050493 nmdc:mga0k408_76416_c1 nmdc:mga0k408_76416_c1_247_1410 386
1615 3300050507 nmdc:mga05p37_123154_c1 nmdc:mga05p37_123154_c1_918_2084 386
1616 3300050508 nmdc:mga09592_96657_c1 nmdc:mga09592_96657_c1_83_1249 386
1617 3300050509 nmdc:mga0qj67_24595_c1 nmdc:mga0qj67_24595_c1_1030_2196 386
1618 3300050510 nmdc:mga06r32_14472_c1 nmdc:mga06r32_14472_c1_2876_4036 386
1619 3300050510 nmdc:mga06r32_6887_c1 nmdc:mga06r32_6887_c1_8084_9250 386
1620 3300050512 nmdc:mga0n895_18517_c1 nmdc:mga0n895_18517_c1_617_1783 386
1621 3300050515 nmdc:mga0a205_140551_c1 nmdc:mga0a205_140551_c1_362_1528 386
1622 3300050515 nmdc:mga0a205_14504_c1 nmdc:mga0a205_14504_c1_2564_3730 386
1623 3300053139 Ga0500568_0032010 Ga0500568_0032010_42_1205 386
1624 3300054114 Ga0501084_0066241 Ga0501084_0066241_240_1403 386
1625 3300054114 Ga0501084_0135199 Ga0501084_0135199_398_1675 386
1626 3300059421 Ga0590071_014634 Ga0590071_014634_270_1430 386
1627 3300059424 Ga0590075_000348 Ga0590075_000348_3041_4201 386
1628 3300059426 Ga0590077_003620 Ga0590077_003620_1836_2996 386
1629 3300060353 Ga0501082_0002453 Ga0501082_0002453_11934_13103 386
1630 3300061734 Ga0530510_0002726 Ga0530510_0002726_6849_8018 386
1631 3300061734 Ga0530510_0027284 Ga0530510_0027284_2766_3929 386

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07478

Dala_Dala_lig_C

D-ala D-ala ligase C-terminus

203

408

0.98

PF01820

Dala_Dala_lig_N

D-ala D-ala ligase N-terminus

43

186

0.86

PF02786

CPSase_L_D2

Carbamoyl-phosphate synthase L chain, ATP binding domain

219

379

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r5f-assembly1.cif.gz_A-2 crystal structure of d-alanine-d-alnine ligase from xanthomonas oryzae pv. oryzae with atp 0.9306 3 386
4me6-assembly1.cif.gz_A-2 crystal structure of d-alanine-d-alanine ligase a from xanthomonas oryzae pathovar oryzae with adp 0.9302 2 386
3rfc-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9282 2 385
3r5f-assembly1.cif.gz_A-2 crystal structure of d-alanine-d-alnine ligase from xanthomonas oryzae pv. oryzae with atp 0.9279 3 386
4me6-assembly1.cif.gz_A-2 crystal structure of d-alanine-d-alanine ligase a from xanthomonas oryzae pathovar oryzae with adp 0.9276 2 386
ID Description Score Start End Superfamily
3q1kB02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9541 146 384 3.30.470.20
5bpfD02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9505 146 371 3.30.470.20
3q1kB02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9477 146 384 3.30.470.20
1ehiB02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9429 244 382 3.30.470.20
5bpfD02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9377 146 371 3.30.470.20
ID Description Score Start End GO Terms
AF-A0A535FBX8-F1-model_v4 D-alanine--D-alanine ligase 0.9939 131 384 GO:0005524
GO:0005829
GO:0008360
GO:0008716
GO:0009252
GO:0046872
GO:0071555
AF-A0A7X6VCQ7-F1-model_v4 ATP-grasp domain-containing protein 0.991 216 380 GO:0005524
GO:0005829
GO:0008360
GO:0008716
GO:0009252
GO:0046872
AF-A0A357CRR7-F1-model_v4 D-alanine--D-alanine ligase A 0.9895 117 378 GO:0005524
GO:0005829
GO:0008360
GO:0008716
GO:0009252
GO:0046872
GO:0071555
AF-A0A7W0ZQ39-F1-model_v4 ATP-grasp domain-containing protein 0.9865 216 380 GO:0005524
GO:0005829
GO:0008360
GO:0008716
GO:0009252
GO:0046872
AF-A0A535FBX8-F1-model_v4 D-alanine--D-alanine ligase 0.9862 131 384 GO:0005524
GO:0005829
GO:0008360
GO:0008716
GO:0009252
GO:0046872
GO:0071555

Feature Viewer

pLDDT pTM Quality
89.98 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map