F495058
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1613 | 759 | 1371 | 244 |
Family's Representative Sequence
| Representative Sequence | 3300009551|Ga0105238_10478174|Ga0105238_104781741 |
| Length | 277 |
| Sequence | MHWPLPSRLKFAHDLSGKPLHAFPDRALEEFSMFDLTGKKALVTGATGGIGNAIAQALHAQGATVAISGTRKEVLDELAGKLGERTHVLPCNLSKADEVEALVPAAEAAMGQVDILVANAGITRDNLFVQLRDEDWEEVININLTSTFRLARAATKLMMRKRFGRIIAITSIVGVTGNPGQGNYTASKAGLIGMIKTLGAEYAKRGVTANCIAPGFIKTPMTDALNDKQRETILTKVPAARLGTPEDIAAAAVYLSSNEAAYVTGQTIHVNGGMAMI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 7 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 8 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 9 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 10 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 11 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 12 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 13 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 14 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 15 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 16 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 17 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 18 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 19 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 20 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 21 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 22 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 23 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 24 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 25 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 26 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 27 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 28 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 29 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 30 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 31 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 32 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 33 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 34 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 35 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 36 | 2791355199 | |||
| 37 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 38 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 39 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 40 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 41 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 42 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 43 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 44 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 45 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 46 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 47 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 48 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 49 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 50 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 51 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 52 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 53 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 54 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 55 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 56 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 57 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 58 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 59 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 60 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 61 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 62 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 63 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 64 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 65 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 66 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 67 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 68 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 69 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 70 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 71 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 72 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 73 | 2870721527 | Saccharothrix ecbatanensis DSM 45486 | Isolate | Rhizosphere |
| 74 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 75 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 76 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 77 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 78 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 79 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 80 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 81 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 82 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 83 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 84 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 85 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 86 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 87 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 88 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 89 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 90 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 91 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 92 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 93 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 94 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 95 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 96 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 97 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 98 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 99 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 100 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 101 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 102 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 103 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 104 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 105 | 2904699407 | |||
| 106 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 107 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 108 | 2906610324 | |||
| 109 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 110 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 111 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 112 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 113 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 114 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 115 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 116 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 117 | 2922368715 | |||
| 118 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 119 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 120 | 2922425934 | |||
| 121 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 122 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 123 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 124 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 125 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 126 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 127 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 128 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 129 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 130 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 131 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 132 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 133 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 134 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 135 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 136 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 137 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 138 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 139 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 140 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 141 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 142 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 143 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 144 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 145 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 146 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 147 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 148 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 149 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 150 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 151 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 152 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 153 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 154 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 155 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 156 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 157 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 158 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 159 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 160 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 161 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 162 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 163 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 164 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 165 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 166 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 167 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 168 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 169 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 170 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 171 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 172 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 173 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 174 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 175 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 176 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 177 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 178 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 179 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 180 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 181 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 182 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 183 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 184 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 185 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 186 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 187 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 188 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 189 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 190 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 191 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 192 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 193 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 194 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 195 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 196 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 197 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 198 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 199 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 200 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 201 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 202 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 203 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 204 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 205 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 206 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 207 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 208 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 209 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 210 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 211 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 212 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 213 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 214 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 215 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 216 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 217 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 218 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 219 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 220 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 221 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 222 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 223 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 224 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 225 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 226 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 227 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 228 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 229 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 230 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 231 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 232 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 233 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 234 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 235 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 236 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 237 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 238 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 239 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 240 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 241 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 242 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 243 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 244 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 245 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 246 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 247 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 248 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 249 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 250 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 251 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 252 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 253 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 254 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 255 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 256 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 257 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 258 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 259 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 260 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 261 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 262 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 263 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 264 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 265 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 266 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 267 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 268 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 269 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 270 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 271 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 272 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 273 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 274 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 275 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 276 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 277 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 278 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 280 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 281 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 282 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 283 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 284 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 285 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 286 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 287 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 288 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 289 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 291 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 292 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 293 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 294 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 295 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 296 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 297 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 299 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 300 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 302 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 303 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 304 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 305 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 306 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 307 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 308 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 309 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 310 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 311 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 312 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 313 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 314 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 315 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 316 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 317 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 318 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 319 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 320 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 321 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 322 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 323 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 324 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 325 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 326 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 327 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 328 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 329 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 330 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 331 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 332 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 333 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 334 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 335 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 336 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 337 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 338 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 339 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 340 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 341 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 342 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 374 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 381 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 382 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 383 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 384 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 385 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 386 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 387 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 388 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 389 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 390 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 391 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 392 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 393 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 394 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 395 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 396 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 397 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 398 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 399 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 400 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 401 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 402 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 403 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 404 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 405 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 406 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 407 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 408 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 409 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 410 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 411 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 412 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 413 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 414 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 415 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 416 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 417 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 418 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 419 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 420 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 421 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 422 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 423 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 424 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 425 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 426 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 427 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 428 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 429 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 430 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 431 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 432 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 433 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 434 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 435 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 436 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 437 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 438 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 439 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 440 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 441 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 442 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 443 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 444 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 445 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 446 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 447 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 448 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 449 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 450 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 451 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 452 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 453 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 454 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 455 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 456 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 457 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 458 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 459 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 460 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 461 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 462 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 463 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 464 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 465 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 466 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 467 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 468 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 469 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 470 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 471 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 472 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 473 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 474 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 475 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 476 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 477 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 478 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 479 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 480 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 481 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 482 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 483 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 484 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 485 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 486 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 487 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 488 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 489 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 490 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 491 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 492 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 493 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 494 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 495 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 496 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 497 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 498 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 499 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 500 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 501 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 502 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 503 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 504 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 552 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 553 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 561 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 562 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 563 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 564 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 565 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 566 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 567 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 568 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 569 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 570 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 571 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 572 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 573 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 574 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 575 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 576 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 577 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 578 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 579 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 580 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 581 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 582 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 583 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 584 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 585 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 586 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 587 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 588 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 589 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 590 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 591 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 592 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 593 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 594 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 595 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 596 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 597 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 598 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 599 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 600 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 601 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 602 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 603 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 604 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 605 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 606 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 607 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 608 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 609 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 610 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 611 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 612 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 613 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 614 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 615 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 616 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 617 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 618 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 619 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 620 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 621 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 622 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 623 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 624 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 625 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 626 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 627 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 628 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 629 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 630 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 631 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 632 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 633 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 634 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 635 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 636 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 637 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 638 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 639 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 640 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 641 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 642 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 643 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 644 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 645 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 646 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 647 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 648 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 649 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 650 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 651 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 652 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 653 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 654 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 655 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 656 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 657 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 658 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 659 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 660 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 661 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 662 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 663 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 664 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 665 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 666 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 667 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 668 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 669 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 670 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 671 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 672 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 673 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 674 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 675 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 676 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 677 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 678 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 679 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 680 | 3300053114 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere | Metagenome | Endosphere |
| 681 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 682 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 683 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 684 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 685 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 686 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 687 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 688 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 689 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 690 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 691 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 692 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 693 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 694 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 695 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 696 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 697 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 698 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 699 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 700 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 701 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 702 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 703 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 704 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 705 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 706 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 707 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 708 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 709 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 710 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 711 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 712 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 713 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 714 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 715 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 716 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 717 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 718 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 719 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 720 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 721 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 722 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 723 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 724 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 725 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 726 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 727 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 728 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 729 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 730 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 731 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 732 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 733 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 734 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 735 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 736 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 737 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 738 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 739 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 740 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 741 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 742 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 743 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 744 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 745 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 746 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 747 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 748 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 749 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 750 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 751 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 752 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 753 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 754 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 755 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 756 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 757 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 758 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 759 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.14 |
| Metatranscriptomes | 0.12 |
| Isolates | 14.74 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.61 |
| Nodule | 11.9 |
| Rhizoplane | 6.88 |
| Rhizosphere | 63.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.75 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10011915 | 3300001989 | Bacteria | 3200 |
| 2 | JGI25406J46586_10000152 | 3300003203 | Bacteria | 30382 |
| 3 | JGI25406J46586_10001897 | 3300003203 | Bacteria | 9844 |
| 4 | JGI25153J46596_10001484 | 3300003215 | Bacteria | 13977 |
| 5 | JGI25153J46596_10007366 | 3300003215 | Bacteria | 5426 |
| 6 | JGI25153J46596_10010783 | 3300003215 | Bacteria | 4102 |
| 7 | JGI25153J46596_10010984 | 3300003215 | Bacteria | 4041 |
| 8 | JGI25160J50197_1003224 | 3300003354 | Bacteria | 7367 |
| 9 | JGI25160J50197_1020832 | 3300003354 | Bacteria | 1967 |
| 10 | JGI25404J52841_10011149 | 3300003659 | Bacteria | 1936 |
| 11 | JGI25404J52841_10012715 | 3300003659 | Bacteria | 1824 |
| 12 | Ga0055531_10027686 | 3300003794 | Bacteria | 1980 |
| 13 | Ga0065165_1006665 | 3300005262 | Bacteria | 5960 |
| 14 | Ga0065165_1009480 | 3300005262 | Bacteria | 4358 |
| 15 | Ga0065165_1016313 | 3300005262 | Bacteria | 2787 |
| 16 | Ga0065165_1044199 | 3300005262 | Bacteria | 1304 |
| 17 | Ga0070658_10085134 | 3300005327 | Bacteria | 2600 |
| 18 | Ga0070658_10109433 | 3300005327 | Bacteria | 2288 |
| 19 | Ga0070676_10045474 | 3300005328 | Bacteria | 2557 |
| 20 | Ga0070683_100009176 | 3300005329 | Bacteria | 8445 |
| 21 | Ga0070683_100092374 | 3300005329 | Bacteria | 2843 |
| 22 | Ga0070683_100421074 | 3300005329 | Bacteria | 1274 |
| 23 | Ga0070670_100140336 | 3300005331 | Bacteria | 2089 |
| 24 | Ga0070670_100444375 | 3300005331 | Bacteria | 1148 |
| 25 | Ga0068869_100015964 | 3300005334 | Bacteria | 5053 |
| 26 | Ga0068869_100099803 | 3300005334 | Bacteria | 2194 |
| 27 | Ga0070680_100010915 | 3300005336 | Bacteria | 7018 |
| 28 | Ga0070680_100016559 | 3300005336 | Bacteria | 5800 |
| 29 | Ga0070680_100045774 | 3300005336 | Bacteria | 3558 |
| 30 | Ga0070680_100058822 | 3300005336 | Bacteria | 3144 |
| 31 | Ga0070680_100094910 | 3300005336 | Bacteria | 2472 |
| 32 | Ga0070680_100289007 | 3300005336 | Bacteria | 1389 |
| 33 | Ga0070682_100015561 | 3300005337 | Bacteria | 4411 |
| 34 | Ga0070682_100136919 | 3300005337 | Bacteria | 1664 |
| 35 | Ga0068868_100030944 | 3300005338 | Bacteria | 4106 |
| 36 | Ga0068868_100063031 | 3300005338 | Bacteria | 2940 |
| 37 | Ga0068868_100309414 | 3300005338 | Bacteria | 1344 |
| 38 | Ga0068868_100329121 | 3300005338 | Bacteria | 1303 |
| 39 | Ga0068868_100599677 | 3300005338 | Bacteria | 976 |
| 40 | Ga0070660_100015177 | 3300005339 | Bacteria | 5557 |
| 41 | Ga0070660_100636143 | 3300005339 | Bacteria | 893 |
| 42 | Ga0070689_100388345 | 3300005340 | Bacteria | 1178 |
| 43 | Ga0070691_10040873 | 3300005341 | Bacteria | 2192 |
| 44 | Ga0070661_100068091 | 3300005344 | Bacteria | 2617 |
| 45 | Ga0070661_100243529 | 3300005344 | Bacteria | 1385 |
| 46 | Ga0070661_100519315 | 3300005344 | Bacteria | 955 |
| 47 | Ga0070668_100062782 | 3300005347 | Bacteria | 2879 |
| 48 | Ga0070668_100283512 | 3300005347 | Bacteria | 1384 |
| 49 | Ga0070668_100361828 | 3300005347 | Bacteria | 1230 |
| 50 | Ga0070668_100635831 | 3300005347 | Bacteria | 936 |
| 51 | Ga0070668_100785394 | 3300005347 | Bacteria | 845 |
| 52 | Ga0070669_100138429 | 3300005353 | Bacteria | 1874 |
| 53 | Ga0070669_100187901 | 3300005353 | Bacteria | 1619 |
| 54 | Ga0070675_100153835 | 3300005354 | Bacteria | 1973 |
| 55 | Ga0070675_100681844 | 3300005354 | Bacteria | 935 |
| 56 | Ga0070671_100055683 | 3300005355 | Bacteria | 3289 |
| 57 | Ga0070671_100221809 | 3300005355 | Bacteria | 1604 |
| 58 | Ga0070674_100451175 | 3300005356 | Bacteria | 1061 |
| 59 | Ga0070688_100023990 | 3300005365 | Bacteria | 3593 |
| 60 | Ga0070688_100069711 | 3300005365 | Bacteria | 2246 |
| 61 | Ga0070688_100219130 | 3300005365 | Bacteria | 1340 |
| 62 | Ga0070688_100413870 | 3300005365 | Bacteria | 1000 |
| 63 | Ga0070659_100448068 | 3300005366 | Bacteria | 1095 |
| 64 | Ga0070667_100044451 | 3300005367 | Bacteria | 3731 |
| 65 | Ga0070667_100192490 | 3300005367 | Bacteria | 1807 |
| 66 | Ga0070709_10000348 | 3300005434 | Bacteria | 28698 |
| 67 | Ga0070709_10389736 | 3300005434 | Bacteria | 1038 |
| 68 | Ga0070709_10491369 | 3300005434 | Bacteria | 931 |
| 69 | Ga0070714_100185256 | 3300005435 | Bacteria | 1896 |
| 70 | Ga0070714_100372649 | 3300005435 | Bacteria | 1344 |
| 71 | Ga0070713_100030721 | 3300005436 | Bacteria | 4270 |
| 72 | Ga0070713_100131727 | 3300005436 | Bacteria | 2206 |
| 73 | Ga0070713_100159978 | 3300005436 | Bacteria | 2009 |
| 74 | Ga0070710_10001018 | 3300005437 | Bacteria | 13295 |
| 75 | Ga0070710_10025298 | 3300005437 | Bacteria | 3143 |
| 76 | Ga0070701_10001976 | 3300005438 | Bacteria | 7767 |
| 77 | Ga0070711_100003777 | 3300005439 | Bacteria | 8882 |
| 78 | Ga0070711_100017214 | 3300005439 | Bacteria | 4599 |
| 79 | Ga0070711_100017253 | 3300005439 | Bacteria | 4595 |
| 80 | Ga0070711_100017385 | 3300005439 | Bacteria | 4577 |
| 81 | Ga0070711_100035090 | 3300005439 | Bacteria | 3350 |
| 82 | Ga0070705_100000184 | 3300005440 | Bacteria | 36475 |
| 83 | Ga0070705_100075838 | 3300005440 | Bacteria | 2048 |
| 84 | Ga0070705_100144563 | 3300005440 | Bacteria | 1570 |
| 85 | Ga0070700_100020538 | 3300005441 | Bacteria | 3827 |
| 86 | Ga0070700_100170257 | 3300005441 | Bacteria | 1507 |
| 87 | Ga0070700_100343007 | 3300005441 | Bacteria | 1105 |
| 88 | Ga0070694_100001319 | 3300005444 | Bacteria | 14437 |
| 89 | Ga0070694_100072822 | 3300005444 | Bacteria | 2371 |
| 90 | Ga0070708_100164554 | 3300005445 | Bacteria | 2068 |
| 91 | Ga0070663_100004200 | 3300005455 | Bacteria | 8424 |
| 92 | Ga0070663_100033806 | 3300005455 | Bacteria | 3535 |
| 93 | Ga0070663_100075413 | 3300005455 | Bacteria | 2465 |
| 94 | Ga0070663_100089460 | 3300005455 | Bacteria | 2279 |
| 95 | Ga0070663_100124014 | 3300005455 | Bacteria | 1954 |
| 96 | Ga0070663_100679846 | 3300005455 | Bacteria | 873 |
| 97 | Ga0070678_100057626 | 3300005456 | Bacteria | 2847 |
| 98 | Ga0070678_100074209 | 3300005456 | Bacteria | 2556 |
| 99 | Ga0070678_100184789 | 3300005456 | Bacteria | 1709 |
| 100 | Ga0070678_100236001 | 3300005456 | Bacteria | 1527 |
| 101 | Ga0070678_100351573 | 3300005456 | Bacteria | 1267 |
| 102 | Ga0070662_100407110 | 3300005457 | Bacteria | 1123 |
| 103 | Ga0070681_10018832 | 3300005458 | Bacteria | 6909 |
| 104 | Ga0070681_10032485 | 3300005458 | Bacteria | 5238 |
| 105 | Ga0070681_10040909 | 3300005458 | Bacteria | 4644 |
| 106 | Ga0070681_10072055 | 3300005458 | Bacteria | 3418 |
| 107 | Ga0070681_10171363 | 3300005458 | Bacteria | 2092 |
| 108 | Ga0070706_100439610 | 3300005467 | Bacteria | 1214 |
| 109 | Ga0070698_100110518 | 3300005471 | Bacteria | 2714 |
| 110 | Ga0070699_100006925 | 3300005518 | Bacteria | 9856 |
| 111 | Ga0070679_100070394 | 3300005530 | Bacteria | 3490 |
| 112 | Ga0070679_100096351 | 3300005530 | Bacteria | 2946 |
| 113 | Ga0070679_100101490 | 3300005530 | Bacteria | 2864 |
| 114 | Ga0070679_100135666 | 3300005530 | Bacteria | 2442 |
| 115 | Ga0070679_100212367 | 3300005530 | Bacteria | 1898 |
| 116 | Ga0070679_100392242 | 3300005530 | Bacteria | 1334 |
| 117 | Ga0070684_100000716 | 3300005535 | Bacteria | 22930 |
| 118 | Ga0070684_100013944 | 3300005535 | Bacteria | 6495 |
| 119 | Ga0070697_100004908 | 3300005536 | Bacteria | 10262 |
| 120 | Ga0070697_100021627 | 3300005536 | Bacteria | 5099 |
| 121 | Ga0068853_100037777 | 3300005539 | Bacteria | 4110 |
| 122 | Ga0068853_100303436 | 3300005539 | Bacteria | 1476 |
| 123 | Ga0068853_100332698 | 3300005539 | Bacteria | 1410 |
| 124 | Ga0068853_100420193 | 3300005539 | Bacteria | 1254 |
| 125 | Ga0070686_100251212 | 3300005544 | Bacteria | 1292 |
| 126 | Ga0070695_100000587 | 3300005545 | Bacteria | 19221 |
| 127 | Ga0070696_100001650 | 3300005546 | Bacteria | 14632 |
| 128 | Ga0070696_100110800 | 3300005546 | Bacteria | 1976 |
| 129 | Ga0070693_100133101 | 3300005547 | Bacteria | 1557 |
| 130 | Ga0070665_100030276 | 3300005548 | Bacteria | 5447 |
| 131 | Ga0070665_100055908 | 3300005548 | Bacteria | 3957 |
| 132 | Ga0070665_100062937 | 3300005548 | Bacteria | 3720 |
| 133 | Ga0070665_100075430 | 3300005548 | Bacteria | 3379 |
| 134 | Ga0070665_100148070 | 3300005548 | Bacteria | 2350 |
| 135 | Ga0070665_100273328 | 3300005548 | Bacteria | 1691 |
| 136 | Ga0070665_100371790 | 3300005548 | Bacteria | 1436 |
| 137 | Ga0070704_100000206 | 3300005549 | Bacteria | 24525 |
| 138 | Ga0068855_100016984 | 3300005563 | Bacteria | 8753 |
| 139 | Ga0068855_100019039 | 3300005563 | Bacteria | 8252 |
| 140 | Ga0068855_100058060 | 3300005563 | Bacteria | 4533 |
| 141 | Ga0068855_100089413 | 3300005563 | Bacteria | 3556 |
| 142 | Ga0068855_100093587 | 3300005563 | Bacteria | 3465 |
| 143 | Ga0068855_100157409 | 3300005563 | Bacteria | 2580 |
| 144 | Ga0068855_100164567 | 3300005563 | Bacteria | 2515 |
| 145 | Ga0068855_100186299 | 3300005563 | Bacteria | 2344 |
| 146 | Ga0068855_100209861 | 3300005563 | Bacteria | 2189 |
| 147 | Ga0068855_100367294 | 3300005563 | Bacteria | 1582 |
| 148 | Ga0068855_100720381 | 3300005563 | Bacteria | 1066 |
| 149 | Ga0070664_100195015 | 3300005564 | Bacteria | 1805 |
| 150 | Ga0068857_100002509 | 3300005577 | Bacteria | 15020 |
| 151 | Ga0068857_100003141 | 3300005577 | Bacteria | 13673 |
| 152 | Ga0068857_100037702 | 3300005577 | Bacteria | 4283 |
| 153 | Ga0068857_100106490 | 3300005577 | Bacteria | 2518 |
| 154 | Ga0068857_100354273 | 3300005577 | Bacteria | 1359 |
| 155 | Ga0068854_100234774 | 3300005578 | Bacteria | 1457 |
| 156 | Ga0068856_100000205 | 3300005614 | Bacteria | 63226 |
| 157 | Ga0068856_100033304 | 3300005614 | Bacteria | 5044 |
| 158 | Ga0068856_100066935 | 3300005614 | Bacteria | 3550 |
| 159 | Ga0068856_100121604 | 3300005614 | Bacteria | 2612 |
| 160 | Ga0068856_100126813 | 3300005614 | Bacteria | 2556 |
| 161 | Ga0068856_100244008 | 3300005614 | Bacteria | 1811 |
| 162 | Ga0068856_100352890 | 3300005614 | Bacteria | 1489 |
| 163 | Ga0068856_100435430 | 3300005614 | Bacteria | 1331 |
| 164 | Ga0070702_100048741 | 3300005615 | Bacteria | 2412 |
| 165 | Ga0068852_100041102 | 3300005616 | Bacteria | 3906 |
| 166 | Ga0068852_100188264 | 3300005616 | Bacteria | 1945 |
| 167 | Ga0068852_100400846 | 3300005616 | Bacteria | 1349 |
| 168 | Ga0068852_100461050 | 3300005616 | Bacteria | 1260 |
| 169 | Ga0068852_100773042 | 3300005616 | Bacteria | 973 |
| 170 | Ga0068859_100072341 | 3300005617 | Bacteria | 3485 |
| 171 | Ga0068859_100092646 | 3300005617 | Bacteria | 3073 |
| 172 | Ga0068859_100392746 | 3300005617 | Bacteria | 1483 |
| 173 | Ga0068859_100713107 | 3300005617 | Bacteria | 1093 |
| 174 | Ga0068864_100027216 | 3300005618 | Bacteria | 4826 |
| 175 | Ga0068864_100110644 | 3300005618 | Bacteria | 2446 |
| 176 | Ga0068864_100372035 | 3300005618 | Bacteria | 1352 |
| 177 | Ga0068864_100377671 | 3300005618 | Bacteria | 1342 |
| 178 | Ga0068864_100524381 | 3300005618 | Bacteria | 1142 |
| 179 | Ga0068861_100022098 | 3300005719 | Bacteria | 4579 |
| 180 | Ga0068861_100070911 | 3300005719 | Bacteria | 2700 |
| 181 | Ga0068861_100072212 | 3300005719 | Bacteria | 2677 |
| 182 | Ga0068861_100125966 | 3300005719 | Bacteria | 2072 |
| 183 | Ga0068861_100416924 | 3300005719 | Bacteria | 1195 |
| 184 | Ga0068861_100463597 | 3300005719 | Bacteria | 1138 |
| 185 | Ga0068851_10004835 | 3300005834 | Bacteria | 6095 |
| 186 | Ga0068851_10008966 | 3300005834 | Bacteria | 4641 |
| 187 | Ga0068851_10126831 | 3300005834 | Bacteria | 1377 |
| 188 | Ga0068863_100377740 | 3300005841 | Bacteria | 1383 |
| 189 | Ga0068863_100807019 | 3300005841 | Bacteria | 936 |
| 190 | Ga0068858_100240414 | 3300005842 | Bacteria | 1718 |
| 191 | Ga0068858_100258161 | 3300005842 | Bacteria | 1656 |
| 192 | Ga0068858_100480766 | 3300005842 | Bacteria | 1199 |
| 193 | Ga0068858_100513421 | 3300005842 | Bacteria | 1158 |
| 194 | Ga0068858_100595031 | 3300005842 | Bacteria | 1073 |
| 195 | Ga0068860_100000316 | 3300005843 | Bacteria | 65709 |
| 196 | Ga0068860_100002287 | 3300005843 | Bacteria | 20134 |
| 197 | Ga0068860_100113422 | 3300005843 | Bacteria | 2592 |
| 198 | Ga0068860_100179282 | 3300005843 | Bacteria | 2048 |
| 199 | Ga0068860_100238704 | 3300005843 | Bacteria | 1768 |
| 200 | Ga0068862_100000157 | 3300005844 | Bacteria | 76001 |
| 201 | Ga0068862_100178558 | 3300005844 | Bacteria | 1904 |
| 202 | Ga0068862_100299043 | 3300005844 | Bacteria | 1480 |
| 203 | Ga0068862_100302627 | 3300005844 | Bacteria | 1471 |
| 204 | Ga0081455_10000179 | 3300005937 | Bacteria | 79869 |
| 205 | Ga0081455_10002652 | 3300005937 | Bacteria | 21173 |
| 206 | Ga0081455_10003466 | 3300005937 | Bacteria | 18131 |
| 207 | Ga0081455_10003832 | 3300005937 | Bacteria | 17150 |
| 208 | Ga0081455_10027258 | 3300005937 | Bacteria | 5236 |
| 209 | Ga0081538_10082973 | 3300005981 | Bacteria | 1696 |
| 210 | Ga0081540_1000500 | 3300005983 | Bacteria | 38559 |
| 211 | Ga0081540_1005905 | 3300005983 | Bacteria | 9036 |
| 212 | Ga0081540_1006800 | 3300005983 | Bacteria | 8265 |
| 213 | Ga0081540_1009855 | 3300005983 | Bacteria | 6531 |
| 214 | Ga0081540_1013838 | 3300005983 | Bacteria | 5218 |
| 215 | Ga0081540_1015121 | 3300005983 | Bacteria | 4898 |
| 216 | Ga0081540_1015390 | 3300005983 | Bacteria | 4845 |
| 217 | Ga0081540_1015394 | 3300005983 | Bacteria | 4845 |
| 218 | Ga0081540_1017128 | 3300005983 | Bacteria | 4498 |
| 219 | Ga0081540_1041100 | 3300005983 | Bacteria | 2401 |
| 220 | Ga0081540_1108864 | 3300005983 | Bacteria | 1177 |
| 221 | Ga0081539_10000273 | 3300005985 | Bacteria | 117936 |
| 222 | Ga0081539_10000735 | 3300005985 | Bacteria | 65597 |
| 223 | Ga0081539_10013306 | 3300005985 | Bacteria | 6210 |
| 224 | Ga0081539_10047212 | 3300005985 | Bacteria | 2461 |
| 225 | Ga0070717_10001338 | 3300006028 | Bacteria | 16934 |
| 226 | Ga0070717_10082183 | 3300006028 | Bacteria | 2706 |
| 227 | Ga0075365_10239715 | 3300006038 | Bacteria | 1274 |
| 228 | Ga0075365_10243393 | 3300006038 | Bacteria | 1263 |
| 229 | Ga0075365_10293262 | 3300006038 | Bacteria | 1144 |
| 230 | Ga0075365_10358951 | 3300006038 | Bacteria | 1027 |
| 231 | Ga0075368_10044167 | 3300006042 | Bacteria | 1757 |
| 232 | Ga0075363_100009382 | 3300006048 | Bacteria | 4599 |
| 233 | Ga0075363_100016047 | 3300006048 | Bacteria | 3694 |
| 234 | Ga0075363_100072931 | 3300006048 | Bacteria | 1867 |
| 235 | Ga0075364_10251397 | 3300006051 | Bacteria | 1201 |
| 236 | Ga0075364_10270098 | 3300006051 | Bacteria | 1157 |
| 237 | Ga0075364_10328620 | 3300006051 | Bacteria | 1041 |
| 238 | Ga0070715_10119267 | 3300006163 | Bacteria | 1255 |
| 239 | Ga0070716_100001393 | 3300006173 | Bacteria | 10721 |
| 240 | Ga0070716_100053034 | 3300006173 | Bacteria | 2311 |
| 241 | Ga0070716_100091457 | 3300006173 | Bacteria | 1842 |
| 242 | Ga0070716_100156068 | 3300006173 | Bacteria | 1474 |
| 243 | Ga0070712_100003228 | 3300006175 | Bacteria | 10049 |
| 244 | Ga0070712_100205018 | 3300006175 | Bacteria | 1552 |
| 245 | Ga0070712_100276691 | 3300006175 | Bacteria | 1351 |
| 246 | Ga0075362_10124679 | 3300006177 | Bacteria | 1221 |
| 247 | Ga0075367_10017879 | 3300006178 | Bacteria | 3900 |
| 248 | Ga0075367_10162835 | 3300006178 | Bacteria | 1387 |
| 249 | Ga0075367_10262457 | 3300006178 | Bacteria | 1084 |
| 250 | Ga0075369_10068263 | 3300006186 | Bacteria | 1562 |
| 251 | Ga0075366_10135616 | 3300006195 | Bacteria | 1486 |
| 252 | Ga0075366_10136140 | 3300006195 | Bacteria | 1483 |
| 253 | Ga0075366_10182887 | 3300006195 | Bacteria | 1273 |
| 254 | Ga0075366_10355416 | 3300006195 | Bacteria | 899 |
| 255 | Ga0097621_100283602 | 3300006237 | Bacteria | 1458 |
| 256 | Ga0075370_10034969 | 3300006353 | Bacteria | 2818 |
| 257 | Ga0075370_10166921 | 3300006353 | Bacteria | 1293 |
| 258 | Ga0068871_100029523 | 3300006358 | Bacteria | 4307 |
| 259 | Ga0068871_100197001 | 3300006358 | Bacteria | 1738 |
| 260 | Ga0075428_100063252 | 3300006844 | Bacteria | 4051 |
| 261 | Ga0075428_100096395 | 3300006844 | Bacteria | 3224 |
| 262 | Ga0075428_100478331 | 3300006844 | Bacteria | 1333 |
| 263 | Ga0075430_100000460 | 3300006846 | Bacteria | 30410 |
| 264 | Ga0075430_100064268 | 3300006846 | Bacteria | 3083 |
| 265 | Ga0075431_100000618 | 3300006847 | Bacteria | 30007 |
| 266 | Ga0075431_100000844 | 3300006847 | Bacteria | 26847 |
| 267 | Ga0075431_100006976 | 3300006847 | Bacteria | 11232 |
| 268 | Ga0075431_100282644 | 3300006847 | Bacteria | 1680 |
| 269 | Ga0075431_100282684 | 3300006847 | Bacteria | 1680 |
| 270 | Ga0075431_100556640 | 3300006847 | Bacteria | 1134 |
| 271 | Ga0075433_10001926 | 3300006852 | Bacteria | 15619 |
| 272 | Ga0075434_100000993 | 3300006871 | Bacteria | 22983 |
| 273 | Ga0075434_100016830 | 3300006871 | Bacteria | 7034 |
| 274 | Ga0075434_100130106 | 3300006871 | Bacteria | 2535 |
| 275 | Ga0075429_100235466 | 3300006880 | Bacteria | 1604 |
| 276 | Ga0068865_100542563 | 3300006881 | Bacteria | 975 |
| 277 | Ga0075436_100042779 | 3300006914 | Bacteria | 3124 |
| 278 | Ga0097620_100072342 | 3300006931 | Bacteria | 3485 |
| 279 | Ga0097620_100092641 | 3300006931 | Bacteria | 3073 |
| 280 | Ga0097620_100392713 | 3300006931 | Bacteria | 1483 |
| 281 | Ga0097620_100713125 | 3300006931 | Bacteria | 1093 |
| 282 | Ga0099825_1036129 | 3300006941 | Bacteria | 1721 |
| 283 | Ga0099824_1019396 | 3300006942 | Bacteria | 5308 |
| 284 | Ga0099824_1044365 | 3300006942 | Bacteria | 964 |
| 285 | Ga0099822_1002380 | 3300006943 | Bacteria | 23355 |
| 286 | Ga0075435_100125140 | 3300007076 | Bacteria | 2148 |
| 287 | Ga0099795_10109057 | 3300007788 | Bacteria | 1095 |
| 288 | Ga0105250_10173880 | 3300009092 | Bacteria | 902 |
| 289 | Ga0105240_10008011 | 3300009093 | Bacteria | 15216 |
| 290 | Ga0105240_10035111 | 3300009093 | Bacteria | 6465 |
| 291 | Ga0105240_10035437 | 3300009093 | Bacteria | 6431 |
| 292 | Ga0105240_10036454 | 3300009093 | Bacteria | 6326 |
| 293 | Ga0105240_10387695 | 3300009093 | Bacteria | 1576 |
| 294 | Ga0105240_10406209 | 3300009093 | Bacteria | 1533 |
| 295 | Ga0111539_10005028 | 3300009094 | Bacteria | 17187 |
| 296 | Ga0111539_10044229 | 3300009094 | Bacteria | 5335 |
| 297 | Ga0111539_10052427 | 3300009094 | Bacteria | 4856 |
| 298 | Ga0105245_10372479 | 3300009098 | Bacteria | 1420 |
| 299 | Ga0105245_10376463 | 3300009098 | Bacteria | 1413 |
| 300 | Ga0105245_10660278 | 3300009098 | Bacteria | 1076 |
| 301 | Ga0105247_10015353 | 3300009101 | Bacteria | 4588 |
| 302 | Ga0105247_10078191 | 3300009101 | Bacteria | 2080 |
| 303 | Ga0105247_10232179 | 3300009101 | Bacteria | 1253 |
| 304 | Ga0114129_10092734 | 3300009147 | Bacteria | 4184 |
| 305 | Ga0114129_10110252 | 3300009147 | Bacteria | 3799 |
| 306 | Ga0114129_10135904 | 3300009147 | Bacteria | 3373 |
| 307 | Ga0105243_10082405 | 3300009148 | Bacteria | 2629 |
| 308 | Ga0105243_10689448 | 3300009148 | Bacteria | 994 |
| 309 | Ga0105241_10019598 | 3300009174 | Bacteria | 4990 |
| 310 | Ga0105242_10566557 | 3300009176 | Bacteria | 1092 |
| 311 | Ga0105242_10829096 | 3300009176 | Bacteria | 918 |
| 312 | Ga0105248_10130363 | 3300009177 | Bacteria | 2837 |
| 313 | Ga0105248_10183906 | 3300009177 | Bacteria | 2355 |
| 314 | Ga0105248_10199477 | 3300009177 | Bacteria | 2254 |
| 315 | Ga0105248_10265803 | 3300009177 | Bacteria | 1931 |
| 316 | Ga0105248_10290770 | 3300009177 | Bacteria | 1840 |
| 317 | Ga0105248_10685886 | 3300009177 | Bacteria | 1156 |
| 318 | Ga0105237_10017852 | 3300009545 | Bacteria | 7354 |
| 319 | Ga0105237_10023811 | 3300009545 | Bacteria | 6268 |
| 320 | Ga0105237_10033114 | 3300009545 | Bacteria | 5235 |
| 321 | Ga0105237_10059905 | 3300009545 | Bacteria | 3808 |
| 322 | Ga0105237_10082613 | 3300009545 | Bacteria | 3203 |
| 323 | Ga0105237_10281961 | 3300009545 | Bacteria | 1664 |
| 324 | Ga0105237_10405931 | 3300009545 | Bacteria | 1367 |
| 325 | Ga0105238_10002798 | 3300009551 | Bacteria | 17414 |
| 326 | Ga0105238_10004789 | 3300009551 | Bacteria | 13388 |
| 327 | Ga0105238_10059132 | 3300009551 | Bacteria | 3841 |
| 328 | Ga0105238_10088391 | 3300009551 | Bacteria | 3085 |
| 329 | Ga0105238_10167167 | 3300009551 | Bacteria | 2175 |
| 330 | Ga0105238_10357917 | 3300009551 | Bacteria | 1449 |
| 331 | Ga0105238_10478174 | 3300009551 | Bacteria | 1245 |
| 332 | Ga0105238_10914560 | 3300009551 | Bacteria | 896 |
| 333 | Ga0105249_10004242 | 3300009553 | Bacteria | 12399 |
| 334 | Ga0105249_10095847 | 3300009553 | Bacteria | 2783 |
| 335 | Ga0105239_10007959 | 3300010375 | Bacteria | 12109 |
| 336 | Ga0105239_10072517 | 3300010375 | Bacteria | 3786 |
| 337 | Ga0105239_10090645 | 3300010375 | Bacteria | 3373 |
| 338 | Ga0105239_10109330 | 3300010375 | Bacteria | 3064 |
| 339 | Ga0105239_10115086 | 3300010375 | Bacteria | 2983 |
| 340 | Ga0105239_10144167 | 3300010375 | Bacteria | 2655 |
| 341 | Ga0105239_10156564 | 3300010375 | Bacteria | 2544 |
| 342 | Ga0105239_10161331 | 3300010375 | Bacteria | 2504 |
| 343 | Ga0105239_10219870 | 3300010375 | Bacteria | 2130 |
| 344 | Ga0105239_10289885 | 3300010375 | Bacteria | 1843 |
| 345 | Ga0105239_10379054 | 3300010375 | Bacteria | 1599 |
| 346 | Ga0105239_10400619 | 3300010375 | Bacteria | 1553 |
| 347 | Ga0105239_10623615 | 3300010375 | Bacteria | 1231 |
| 348 | Ga0105239_10771880 | 3300010375 | Bacteria | 1101 |
| 349 | Ga0105246_10036299 | 3300011119 | Bacteria | 3301 |
| 350 | Ga0105246_10072125 | 3300011119 | Bacteria | 2434 |
| 351 | Ga0105246_10308624 | 3300011119 | Bacteria | 1281 |
| 352 | Ga0157373_10223971 | 3300013100 | Bacteria | 1327 |
| 353 | Ga0157370_10015624 | 3300013104 | Bacteria | 7711 |
| 354 | Ga0157370_10055142 | 3300013104 | Bacteria | 3788 |
| 355 | Ga0157370_10296344 | 3300013104 | Bacteria | 1493 |
| 356 | Ga0157369_10000996 | 3300013105 | Bacteria | 35806 |
| 357 | Ga0157369_10007824 | 3300013105 | Bacteria | 12302 |
| 358 | Ga0157369_10051549 | 3300013105 | Bacteria | 4453 |
| 359 | Ga0157369_10112631 | 3300013105 | Bacteria | 2890 |
| 360 | Ga0157369_10415169 | 3300013105 | Bacteria | 1395 |
| 361 | Ga0157374_10013272 | 3300013296 | Bacteria | 7188 |
| 362 | Ga0157374_10299631 | 3300013296 | Bacteria | 1590 |
| 363 | Ga0157378_10103182 | 3300013297 | Bacteria | 2605 |
| 364 | Ga0157378_10163265 | 3300013297 | Bacteria | 2084 |
| 365 | Ga0157378_10700145 | 3300013297 | Bacteria | 1032 |
| 366 | Ga0157378_10926882 | 3300013297 | Bacteria | 903 |
| 367 | Ga0163162_10177021 | 3300013306 | Bacteria | 2259 |
| 368 | Ga0163162_10279967 | 3300013306 | Bacteria | 1800 |
| 369 | Ga0157372_10339872 | 3300013307 | Bacteria | 1749 |
| 370 | Ga0157375_10000681 | 3300013308 | Bacteria | 30065 |
| 371 | Ga0157375_10036651 | 3300013308 | Bacteria | 4694 |
| 372 | Ga0157375_10079068 | 3300013308 | Bacteria | 3323 |
| 373 | Ga0163163_10006000 | 3300014325 | Bacteria | 10568 |
| 374 | Ga0163163_10337601 | 3300014325 | Bacteria | 1562 |
| 375 | Ga0157380_10086801 | 3300014326 | Bacteria | 2572 |
| 376 | Ga0157380_10118538 | 3300014326 | Bacteria | 2238 |
| 377 | Ga0157380_10357420 | 3300014326 | Bacteria | 1369 |
| 378 | Ga0157377_10091192 | 3300014745 | Bacteria | 1800 |
| 379 | Ga0157377_10116747 | 3300014745 | Bacteria | 1612 |
| 380 | Ga0157379_10041047 | 3300014968 | Bacteria | 4130 |
| 381 | Ga0157379_10066997 | 3300014968 | Bacteria | 3210 |
| 382 | Ga0157379_10226391 | 3300014968 | Bacteria | 1695 |
| 383 | Ga0157379_10251519 | 3300014968 | Bacteria | 1604 |
| 384 | Ga0157379_10521856 | 3300014968 | Bacteria | 1103 |
| 385 | Ga0157379_10713154 | 3300014968 | Bacteria | 942 |
| 386 | Ga0157376_10014965 | 3300014969 | Bacteria | 5846 |
| 387 | Ga0157376_10075405 | 3300014969 | Bacteria | 2878 |
| 388 | Ga0163161_10244239 | 3300017792 | Bacteria | 1397 |
| 389 | Ga0206356_10359229 | 3300020070 | Bacteria | 930 |
| 390 | Ga0214544_1000002 | 3300021320 | Bacteria | 753857 |
| 391 | Ga0214542_1000001 | 3300021321 | Bacteria | 1018696 |
| 392 | Ga0214545_1000001 | 3300021324 | Bacteria | 1092817 |
| 393 | Ga0214543_1000001 | 3300021327 | Bacteria | 776921 |
| 394 | Ga0213873_10003228 | 3300021358 | Bacteria | 2917 |
| 395 | Ga0213876_10001215 | 3300021384 | Bacteria | 16252 |
| 396 | Ga0213876_10198854 | 3300021384 | Bacteria | 1065 |
| 397 | Ga0213875_10032072 | 3300021388 | Bacteria | 2483 |
| 398 | Ga0213875_10132272 | 3300021388 | Bacteria | 1167 |
| 399 | Ga0224712_10015360 | 3300022467 | Bacteria | 2490 |
| 400 | Ga0209677_103425 | 3300025253 | Bacteria | 5168 |
| 401 | Ga0209148_1000613 | 3300025254 | Bacteria | 31818 |
| 402 | Ga0209148_1006070 | 3300025254 | Bacteria | 2664 |
| 403 | Ga0209233_1005807 | 3300025261 | Bacteria | 4055 |
| 404 | Ga0209233_1008575 | 3300025261 | Bacteria | 3151 |
| 405 | Ga0209233_1021595 | 3300025261 | Bacteria | 1663 |
| 406 | Ga0209233_1022933 | 3300025261 | Bacteria | 1589 |
| 407 | Ga0209455_1005473 | 3300025272 | Bacteria | 3917 |
| 408 | Ga0209455_1009401 | 3300025272 | Bacteria | 2571 |
| 409 | Ga0209564_1015858 | 3300025295 | Bacteria | 3041 |
| 410 | Ga0209758_1000140 | 3300025297 | Bacteria | 174267 |
| 411 | Ga0209758_1000947 | 3300025297 | Bacteria | 39101 |
| 412 | Ga0209758_1003609 | 3300025297 | Bacteria | 13852 |
| 413 | Ga0209758_1004382 | 3300025297 | Bacteria | 11794 |
| 414 | Ga0209758_1005082 | 3300025297 | Bacteria | 10418 |
| 415 | Ga0209758_1007936 | 3300025297 | Bacteria | 7040 |
| 416 | Ga0209758_1016825 | 3300025297 | Bacteria | 3688 |
| 417 | Ga0209256_1023531 | 3300025299 | Bacteria | 1835 |
| 418 | Ga0207426_1000626 | 3300025302 | Bacteria | 44875 |
| 419 | Ga0207426_1000892 | 3300025302 | Bacteria | 30213 |
| 420 | Ga0207426_1005341 | 3300025302 | Bacteria | 5902 |
| 421 | Ga0207426_1027317 | 3300025302 | Bacteria | 1902 |
| 422 | Ga0207426_1050027 | 3300025302 | Bacteria | 1248 |
| 423 | Ga0209257_1007293 | 3300025304 | Bacteria | 6731 |
| 424 | Ga0209257_1022286 | 3300025304 | Bacteria | 2264 |
| 425 | Ga0207697_10012580 | 3300025315 | Bacteria | 3545 |
| 426 | Ga0207697_10051545 | 3300025315 | Bacteria | 1701 |
| 427 | Ga0207697_10135181 | 3300025315 | Bacteria | 1067 |
| 428 | Ga0207656_10008091 | 3300025321 | Bacteria | 3856 |
| 429 | Ga0207656_10013293 | 3300025321 | Bacteria | 3143 |
| 430 | Ga0207656_10125020 | 3300025321 | Bacteria | 1201 |
| 431 | Ga0207656_10162756 | 3300025321 | Bacteria | 1063 |
| 432 | Ga0207696_1042465 | 3300025711 | Bacteria | 1325 |
| 433 | Ga0207653_10000536 | 3300025885 | Bacteria | 14219 |
| 434 | Ga0207653_10002803 | 3300025885 | Bacteria | 5541 |
| 435 | Ga0207692_10000116 | 3300025898 | Bacteria | 23998 |
| 436 | Ga0207692_10030959 | 3300025898 | Bacteria | 2558 |
| 437 | Ga0207642_10115630 | 3300025899 | Bacteria | 1374 |
| 438 | Ga0207710_10007078 | 3300025900 | Bacteria | 4761 |
| 439 | Ga0207710_10008551 | 3300025900 | Bacteria | 4315 |
| 440 | Ga0207710_10062029 | 3300025900 | Bacteria | 1698 |
| 441 | Ga0207688_10205981 | 3300025901 | Bacteria | 1181 |
| 442 | Ga0207647_10011073 | 3300025904 | Bacteria | 6339 |
| 443 | Ga0207647_10023846 | 3300025904 | Bacteria | 4041 |
| 444 | Ga0207647_10025616 | 3300025904 | Bacteria | 3872 |
| 445 | Ga0207647_10204172 | 3300025904 | Bacteria | 1143 |
| 446 | Ga0207685_10107587 | 3300025905 | Bacteria | 1203 |
| 447 | Ga0207685_10193965 | 3300025905 | Bacteria | 950 |
| 448 | Ga0207699_10000958 | 3300025906 | Bacteria | 13749 |
| 449 | Ga0207699_10090766 | 3300025906 | Bacteria | 1917 |
| 450 | Ga0207699_10165628 | 3300025906 | Bacteria | 1475 |
| 451 | Ga0207699_10342268 | 3300025906 | Bacteria | 1054 |
| 452 | Ga0207699_10550578 | 3300025906 | Bacteria | 837 |
| 453 | Ga0207645_10101658 | 3300025907 | Bacteria | 1855 |
| 454 | Ga0207643_10153888 | 3300025908 | Bacteria | 1380 |
| 455 | Ga0207705_10058216 | 3300025909 | Bacteria | 2788 |
| 456 | Ga0207684_10221856 | 3300025910 | Bacteria | 1631 |
| 457 | Ga0207684_10340482 | 3300025910 | Bacteria | 1292 |
| 458 | Ga0207654_10000308 | 3300025911 | Bacteria | 29561 |
| 459 | Ga0207654_10165481 | 3300025911 | Bacteria | 1432 |
| 460 | Ga0207654_10302430 | 3300025911 | Bacteria | 1088 |
| 461 | Ga0207707_10000713 | 3300025912 | Bacteria | 32997 |
| 462 | Ga0207707_10001623 | 3300025912 | Bacteria | 20718 |
| 463 | Ga0207707_10005494 | 3300025912 | Bacteria | 11083 |
| 464 | Ga0207707_10060434 | 3300025912 | Bacteria | 3297 |
| 465 | Ga0207707_10352934 | 3300025912 | Bacteria | 1267 |
| 466 | Ga0207695_10001719 | 3300025913 | Bacteria | 35011 |
| 467 | Ga0207695_10001812 | 3300025913 | Bacteria | 33654 |
| 468 | Ga0207695_10022151 | 3300025913 | Bacteria | 7225 |
| 469 | Ga0207695_10025188 | 3300025913 | Bacteria | 6669 |
| 470 | Ga0207695_10050386 | 3300025913 | Bacteria | 4381 |
| 471 | Ga0207695_10147925 | 3300025913 | Bacteria | 2291 |
| 472 | Ga0207695_10385794 | 3300025913 | Bacteria | 1286 |
| 473 | Ga0207671_10008038 | 3300025914 | Bacteria | 9019 |
| 474 | Ga0207671_10026849 | 3300025914 | Bacteria | 4308 |
| 475 | Ga0207671_10027204 | 3300025914 | Bacteria | 4276 |
| 476 | Ga0207671_10156673 | 3300025914 | Bacteria | 1762 |
| 477 | Ga0207671_10249092 | 3300025914 | Bacteria | 1396 |
| 478 | Ga0207671_10369300 | 3300025914 | Bacteria | 1139 |
| 479 | Ga0207693_10073136 | 3300025915 | Bacteria | 2683 |
| 480 | Ga0207693_10149159 | 3300025915 | Bacteria | 1839 |
| 481 | Ga0207663_10005557 | 3300025916 | Bacteria | 6364 |
| 482 | Ga0207663_10016904 | 3300025916 | Bacteria | 4057 |
| 483 | Ga0207663_10125820 | 3300025916 | Bacteria | 1763 |
| 484 | Ga0207663_10261042 | 3300025916 | Bacteria | 1279 |
| 485 | Ga0207663_10721485 | 3300025916 | Bacteria | 790 |
| 486 | Ga0207660_10007065 | 3300025917 | Bacteria | 7274 |
| 487 | Ga0207660_10025784 | 3300025917 | Bacteria | 3995 |
| 488 | Ga0207660_10033152 | 3300025917 | Bacteria | 3570 |
| 489 | Ga0207660_10051559 | 3300025917 | Bacteria | 2926 |
| 490 | Ga0207660_10180680 | 3300025917 | Bacteria | 1638 |
| 491 | Ga0207660_10201690 | 3300025917 | Bacteria | 1554 |
| 492 | Ga0207660_10431375 | 3300025917 | Bacteria | 1064 |
| 493 | Ga0207662_10077224 | 3300025918 | Bacteria | 2025 |
| 494 | Ga0207662_10408770 | 3300025918 | Bacteria | 922 |
| 495 | Ga0207657_10001786 | 3300025919 | Bacteria | 23206 |
| 496 | Ga0207657_10008840 | 3300025919 | Bacteria | 10189 |
| 497 | Ga0207657_10119096 | 3300025919 | Bacteria | 2173 |
| 498 | Ga0207657_10285756 | 3300025919 | Bacteria | 1309 |
| 499 | Ga0207649_10045765 | 3300025920 | Bacteria | 2684 |
| 500 | Ga0207649_10111834 | 3300025920 | Bacteria | 1826 |
| 501 | Ga0207649_10464696 | 3300025920 | Bacteria | 957 |
| 502 | Ga0207652_10004315 | 3300025921 | Bacteria | 11591 |
| 503 | Ga0207652_10038882 | 3300025921 | Bacteria | 4035 |
| 504 | Ga0207652_10088110 | 3300025921 | Bacteria | 2723 |
| 505 | Ga0207652_10102017 | 3300025921 | Bacteria | 2535 |
| 506 | Ga0207652_10111939 | 3300025921 | Bacteria | 2421 |
| 507 | Ga0207652_10245070 | 3300025921 | Bacteria | 1616 |
| 508 | Ga0207694_10000157 | 3300025924 | Bacteria | 70076 |
| 509 | Ga0207694_10012829 | 3300025924 | Bacteria | 6311 |
| 510 | Ga0207694_10055535 | 3300025924 | Bacteria | 3074 |
| 511 | Ga0207694_10151191 | 3300025924 | Bacteria | 1870 |
| 512 | Ga0207694_10154625 | 3300025924 | Bacteria | 1849 |
| 513 | Ga0207694_10385136 | 3300025924 | Bacteria | 1164 |
| 514 | Ga0207650_10320479 | 3300025925 | Bacteria | 1269 |
| 515 | Ga0207650_10337568 | 3300025925 | Bacteria | 1237 |
| 516 | Ga0207687_10028220 | 3300025927 | Bacteria | 3770 |
| 517 | Ga0207687_10165424 | 3300025927 | Bacteria | 1701 |
| 518 | Ga0207687_10215116 | 3300025927 | Bacteria | 1510 |
| 519 | Ga0207687_10276648 | 3300025927 | Bacteria | 1344 |
| 520 | Ga0207687_10340549 | 3300025927 | Bacteria | 1219 |
| 521 | Ga0207700_10006113 | 3300025928 | Bacteria | 7250 |
| 522 | Ga0207700_10021515 | 3300025928 | Bacteria | 4405 |
| 523 | Ga0207700_10185652 | 3300025928 | Bacteria | 1744 |
| 524 | Ga0207664_10177434 | 3300025929 | Bacteria | 1827 |
| 525 | Ga0207644_10205569 | 3300025931 | Bacteria | 1555 |
| 526 | Ga0207644_10436088 | 3300025931 | Bacteria | 1075 |
| 527 | Ga0207690_10515508 | 3300025932 | Bacteria | 968 |
| 528 | Ga0207706_10108562 | 3300025933 | Bacteria | 2442 |
| 529 | Ga0207706_10115913 | 3300025933 | Bacteria | 2356 |
| 530 | Ga0207706_10666964 | 3300025933 | Bacteria | 890 |
| 531 | Ga0207686_10119430 | 3300025934 | Bacteria | 1792 |
| 532 | Ga0207686_10382088 | 3300025934 | Bacteria | 1068 |
| 533 | Ga0207709_10011280 | 3300025935 | Bacteria | 4929 |
| 534 | Ga0207709_10369264 | 3300025935 | Bacteria | 1088 |
| 535 | Ga0207670_10030483 | 3300025936 | Bacteria | 3446 |
| 536 | Ga0207670_10498721 | 3300025936 | Bacteria | 988 |
| 537 | Ga0207670_10528863 | 3300025936 | Bacteria | 961 |
| 538 | Ga0207669_10025941 | 3300025937 | Bacteria | 3178 |
| 539 | Ga0207669_10289370 | 3300025937 | Bacteria | 1240 |
| 540 | Ga0207704_10013820 | 3300025938 | Bacteria | 4055 |
| 541 | Ga0207704_10102744 | 3300025938 | Bacteria | 1910 |
| 542 | Ga0207665_10001402 | 3300025939 | Bacteria | 16207 |
| 543 | Ga0207665_10087694 | 3300025939 | Bacteria | 2151 |
| 544 | Ga0207665_10117920 | 3300025939 | Bacteria | 1872 |
| 545 | Ga0207665_10166867 | 3300025939 | Bacteria | 1588 |
| 546 | Ga0207665_10184538 | 3300025939 | Bacteria | 1512 |
| 547 | Ga0207665_10297906 | 3300025939 | Bacteria | 1205 |
| 548 | Ga0207665_10400204 | 3300025939 | Bacteria | 1045 |
| 549 | Ga0207665_10439645 | 3300025939 | Bacteria | 999 |
| 550 | Ga0207691_10140759 | 3300025940 | Bacteria | 2126 |
| 551 | Ga0207691_10167997 | 3300025940 | Bacteria | 1922 |
| 552 | Ga0207691_10232160 | 3300025940 | Bacteria | 1597 |
| 553 | Ga0207691_10344342 | 3300025940 | Bacteria | 1276 |
| 554 | Ga0207711_10029828 | 3300025941 | Bacteria | 4601 |
| 555 | Ga0207711_10190825 | 3300025941 | Bacteria | 1867 |
| 556 | Ga0207711_10425561 | 3300025941 | Bacteria | 1235 |
| 557 | Ga0207689_10144622 | 3300025942 | Bacteria | 1959 |
| 558 | Ga0207689_10342191 | 3300025942 | Bacteria | 1242 |
| 559 | Ga0207661_10001379 | 3300025944 | Bacteria | 16309 |
| 560 | Ga0207661_10012609 | 3300025944 | Bacteria | 6151 |
| 561 | Ga0207679_10132374 | 3300025945 | Bacteria | 2002 |
| 562 | Ga0207667_10008116 | 3300025949 | Bacteria | 12512 |
| 563 | Ga0207667_10012664 | 3300025949 | Bacteria | 9692 |
| 564 | Ga0207667_10072054 | 3300025949 | Bacteria | 3591 |
| 565 | Ga0207667_10077912 | 3300025949 | Bacteria | 3436 |
| 566 | Ga0207667_10141144 | 3300025949 | Bacteria | 2480 |
| 567 | Ga0207667_10187735 | 3300025949 | Bacteria | 2121 |
| 568 | Ga0207667_10389079 | 3300025949 | Bacteria | 1420 |
| 569 | Ga0207667_10457502 | 3300025949 | Bacteria | 1296 |
| 570 | Ga0207667_10529320 | 3300025949 | Bacteria | 1193 |
| 571 | Ga0207651_10076518 | 3300025960 | Bacteria | 2393 |
| 572 | Ga0207651_10286324 | 3300025960 | Bacteria | 1364 |
| 573 | Ga0207651_10348077 | 3300025960 | Bacteria | 1247 |
| 574 | Ga0207712_10102342 | 3300025961 | Bacteria | 2132 |
| 575 | Ga0207712_10147690 | 3300025961 | Bacteria | 1812 |
| 576 | Ga0207712_10261523 | 3300025961 | Bacteria | 1404 |
| 577 | Ga0207668_10045275 | 3300025972 | Bacteria | 2999 |
| 578 | Ga0207668_10045547 | 3300025972 | Bacteria | 2992 |
| 579 | Ga0207640_10154249 | 3300025981 | Bacteria | 1691 |
| 580 | Ga0207640_10206684 | 3300025981 | Bacteria | 1492 |
| 581 | Ga0207658_10333093 | 3300025986 | Bacteria | 1317 |
| 582 | Ga0207677_10070485 | 3300026023 | Bacteria | 2464 |
| 583 | Ga0207677_10409386 | 3300026023 | Bacteria | 1152 |
| 584 | Ga0207703_10037329 | 3300026035 | Bacteria | 3870 |
| 585 | Ga0207703_10062253 | 3300026035 | Bacteria | 3057 |
| 586 | Ga0207703_10306444 | 3300026035 | Bacteria | 1450 |
| 587 | Ga0207703_10327967 | 3300026035 | Bacteria | 1403 |
| 588 | Ga0207703_10495043 | 3300026035 | Bacteria | 1147 |
| 589 | Ga0207703_10905668 | 3300026035 | Bacteria | 844 |
| 590 | Ga0207639_10010722 | 3300026041 | Bacteria | 6347 |
| 591 | Ga0207639_10076718 | 3300026041 | Bacteria | 2632 |
| 592 | Ga0207639_10113242 | 3300026041 | Bacteria | 2215 |
| 593 | Ga0207639_10294526 | 3300026041 | Bacteria | 1432 |
| 594 | Ga0207639_10509763 | 3300026041 | Bacteria | 1100 |
| 595 | Ga0207678_10014420 | 3300026067 | Bacteria | 6948 |
| 596 | Ga0207678_10036160 | 3300026067 | Bacteria | 4299 |
| 597 | Ga0207678_10037981 | 3300026067 | Bacteria | 4187 |
| 598 | Ga0207678_10098778 | 3300026067 | Bacteria | 2494 |
| 599 | Ga0207678_10155364 | 3300026067 | Bacteria | 1953 |
| 600 | Ga0207678_10161758 | 3300026067 | Bacteria | 1912 |
| 601 | Ga0207678_10178066 | 3300026067 | Bacteria | 1816 |
| 602 | Ga0207678_10254370 | 3300026067 | Bacteria | 1505 |
| 603 | Ga0207678_10276172 | 3300026067 | Bacteria | 1441 |
| 604 | Ga0207708_10126781 | 3300026075 | Bacteria | 1993 |
| 605 | Ga0207708_10225048 | 3300026075 | Bacteria | 1504 |
| 606 | Ga0207708_10630123 | 3300026075 | Bacteria | 911 |
| 607 | Ga0207708_10692215 | 3300026075 | Bacteria | 871 |
| 608 | Ga0207702_10000002 | 3300026078 | Bacteria | 491507 |
| 609 | Ga0207702_10000048 | 3300026078 | Bacteria | 143125 |
| 610 | Ga0207702_10096505 | 3300026078 | Bacteria | 2600 |
| 611 | Ga0207702_10243985 | 3300026078 | Bacteria | 1684 |
| 612 | Ga0207702_10727702 | 3300026078 | Bacteria | 979 |
| 613 | Ga0207648_10062317 | 3300026089 | Bacteria | 3251 |
| 614 | Ga0207648_10066627 | 3300026089 | Bacteria | 3140 |
| 615 | Ga0207676_10014722 | 3300026095 | Bacteria | 5634 |
| 616 | Ga0207676_10358072 | 3300026095 | Bacteria | 1351 |
| 617 | Ga0207676_10617158 | 3300026095 | Bacteria | 1043 |
| 618 | Ga0207676_10691250 | 3300026095 | Bacteria | 987 |
| 619 | Ga0207674_10006147 | 3300026116 | Bacteria | 14181 |
| 620 | Ga0207674_10049099 | 3300026116 | Bacteria | 4317 |
| 621 | Ga0207674_10128650 | 3300026116 | Bacteria | 2497 |
| 622 | Ga0207674_10132628 | 3300026116 | Bacteria | 2454 |
| 623 | Ga0207675_100021910 | 3300026118 | Bacteria | 5949 |
| 624 | Ga0207675_100067701 | 3300026118 | Bacteria | 3338 |
| 625 | Ga0207675_100077004 | 3300026118 | Bacteria | 3124 |
| 626 | Ga0207675_100540939 | 3300026118 | Bacteria | 1163 |
| 627 | Ga0207683_10068392 | 3300026121 | Bacteria | 3135 |
| 628 | Ga0207683_10174161 | 3300026121 | Bacteria | 1949 |
| 629 | Ga0207683_10259539 | 3300026121 | Bacteria | 1587 |
| 630 | Ga0207683_10325101 | 3300026121 | Bacteria | 1409 |
| 631 | Ga0207683_10443759 | 3300026121 | Bacteria | 1196 |
| 632 | Ga0207683_10505790 | 3300026121 | Bacteria | 1116 |
| 633 | Ga0207698_10017601 | 3300026142 | Bacteria | 4854 |
| 634 | Ga0207698_10139213 | 3300026142 | Bacteria | 2088 |
| 635 | Ga0207698_10146616 | 3300026142 | Bacteria | 2042 |
| 636 | Ga0207698_10205242 | 3300026142 | Bacteria | 1768 |
| 637 | Ga0207698_10330588 | 3300026142 | Bacteria | 1431 |
| 638 | Ga0209389_1000233 | 3300027296 | Bacteria | 36791 |
| 639 | Ga0209389_1010778 | 3300027296 | Bacteria | 8256 |
| 640 | Ga0209589_1000001 | 3300027357 | Bacteria | 794224 |
| 641 | Ga0209589_1001423 | 3300027357 | Bacteria | 39445 |
| 642 | Ga0209489_100001 | 3300027361 | Bacteria | 794224 |
| 643 | Ga0209489_102560 | 3300027361 | Bacteria | 36742 |
| 644 | Ga0209489_112041 | 3300027361 | Bacteria | 8257 |
| 645 | Ga0209700_100001 | 3300027363 | Bacteria | 794224 |
| 646 | Ga0209700_100062 | 3300027363 | Bacteria | 145471 |
| 647 | Ga0207428_10020898 | 3300027907 | Bacteria | 5551 |
| 648 | Ga0207428_10048417 | 3300027907 | Bacteria | 3410 |
| 649 | Ga0268266_10008946 | 3300028379 | Bacteria | 8862 |
| 650 | Ga0268266_10022518 | 3300028379 | Bacteria | 5369 |
| 651 | Ga0268266_10029812 | 3300028379 | Bacteria | 4635 |
| 652 | Ga0268266_10059181 | 3300028379 | Bacteria | 3300 |
| 653 | Ga0268266_10139420 | 3300028379 | Bacteria | 2175 |
| 654 | Ga0268266_10143830 | 3300028379 | Bacteria | 2142 |
| 655 | Ga0268266_10175211 | 3300028379 | Bacteria | 1949 |
| 656 | Ga0268266_10486490 | 3300028379 | Bacteria | 1177 |
| 657 | Ga0268266_10588223 | 3300028379 | Bacteria | 1068 |
| 658 | Ga0268265_10000603 | 3300028380 | Bacteria | 36135 |
| 659 | Ga0268265_10269350 | 3300028380 | Bacteria | 1518 |
| 660 | Ga0268265_10301961 | 3300028380 | Bacteria | 1442 |
| 661 | Ga0268265_10588685 | 3300028380 | Bacteria | 1061 |
| 662 | Ga0268264_10000430 | 3300028381 | Bacteria | 58144 |
| 663 | Ga0268264_10000660 | 3300028381 | Bacteria | 40456 |
| 664 | Ga0268264_10318191 | 3300028381 | Bacteria | 1470 |
| 665 | Ga0268264_10590034 | 3300028381 | Bacteria | 1094 |
| 666 | Ga0268264_10922820 | 3300028381 | Bacteria | 877 |
| 667 | Ga0265319_1038153 | 3300028563 | Bacteria | 1634 |
| 668 | Ga0265323_10002533 | 3300028653 | Bacteria | 8326 |
| 669 | Ga0265322_10020623 | 3300028654 | Bacteria | 1888 |
| 670 | Ga0265336_10001363 | 3300028666 | Bacteria | 11301 |
| 671 | Ga0307517_10000772 | 3300028786 | Bacteria | 55020 |
| 672 | Ga0307515_10032886 | 3300028794 | Bacteria | 8566 |
| 673 | Ga0265338_10000086 | 3300028800 | Bacteria | 175026 |
| 674 | Ga0265324_10004123 | 3300029957 | Bacteria | 6651 |
| 675 | Ga0307511_10034642 | 3300030521 | Bacteria | 4426 |
| 676 | Ga0307512_10209715 | 3300030522 | Bacteria | 1038 |
| 677 | Ga0265330_10015512 | 3300031235 | Bacteria | 3523 |
| 678 | Ga0265330_10025688 | 3300031235 | Bacteria | 2669 |
| 679 | Ga0265330_10062916 | 3300031235 | Bacteria | 1613 |
| 680 | Ga0265328_10021772 | 3300031239 | Bacteria | 2444 |
| 681 | Ga0265325_10001325 | 3300031241 | Bacteria | 17530 |
| 682 | Ga0265325_10022969 | 3300031241 | Bacteria | 3411 |
| 683 | Ga0265340_10003545 | 3300031247 | Bacteria | 8783 |
| 684 | Ga0265339_10004010 | 3300031249 | Bacteria | 10180 |
| 685 | Ga0265339_10103891 | 3300031249 | Bacteria | 1475 |
| 686 | Ga0265339_10167279 | 3300031249 | Bacteria | 1103 |
| 687 | Ga0265339_10190466 | 3300031249 | Bacteria | 1017 |
| 688 | Ga0265331_10082432 | 3300031250 | Bacteria | 1492 |
| 689 | Ga0265331_10140782 | 3300031250 | Bacteria | 1097 |
| 690 | Ga0265327_10001131 | 3300031251 | Bacteria | 36638 |
| 691 | Ga0307509_10108318 | 3300031507 | Bacteria | 2791 |
| 692 | Ga0307509_10523715 | 3300031507 | Bacteria | 866 |
| 693 | Ga0307408_100347845 | 3300031548 | Bacteria | 1257 |
| 694 | Ga0307408_100364843 | 3300031548 | Bacteria | 1230 |
| 695 | Ga0265313_10009642 | 3300031595 | Bacteria | 6238 |
| 696 | Ga0307508_10000009 | 3300031616 | Bacteria | 256966 |
| 697 | Ga0307508_10035294 | 3300031616 | Bacteria | 4507 |
| 698 | Ga0307508_10059744 | 3300031616 | Bacteria | 3371 |
| 699 | Ga0307508_10516871 | 3300031616 | Bacteria | 790 |
| 700 | Ga0316575_10008085 | 3300031665 | Bacteria | 3824 |
| 701 | Ga0265314_10097683 | 3300031711 | Bacteria | 1896 |
| 702 | Ga0265342_10023565 | 3300031712 | Bacteria | 3894 |
| 703 | Ga0265342_10101215 | 3300031712 | Bacteria | 1641 |
| 704 | Ga0307516_10033789 | 3300031730 | Bacteria | 5145 |
| 705 | Ga0307516_10355669 | 3300031730 | Bacteria | 1129 |
| 706 | Ga0307413_10111217 | 3300031824 | Bacteria | 1834 |
| 707 | Ga0307410_10054864 | 3300031852 | Bacteria | 2703 |
| 708 | Ga0307410_10432699 | 3300031852 | Bacteria | 1070 |
| 709 | Ga0307406_10229220 | 3300031901 | Bacteria | 1386 |
| 710 | Ga0307406_10284929 | 3300031901 | Bacteria | 1262 |
| 711 | Ga0307407_10073614 | 3300031903 | Bacteria | 2042 |
| 712 | Ga0307416_100925289 | 3300032002 | Bacteria | 973 |
| 713 | Ga0307411_10023083 | 3300032005 | Bacteria | 3677 |
| 714 | Ga0307411_10056429 | 3300032005 | Bacteria | 2589 |
| 715 | Ga0307415_100097693 | 3300032126 | Bacteria | 2144 |
| 716 | Ga0307415_100153561 | 3300032126 | Bacteria | 1775 |
| 717 | Ga0307415_100231745 | 3300032126 | Bacteria | 1488 |
| 718 | Ga0307507_10061608 | 3300033179 | Bacteria | 3492 |
| 719 | Ga0307510_10009821 | 3300033180 | Bacteria | 11388 |
| 720 | Ga0307510_10025487 | 3300033180 | Bacteria | 6817 |
| 721 | Ga0307510_10150825 | 3300033180 | Bacteria | 1944 |
| 722 | Ga0315911_1000001 | 3300033442 | Bacteria | 1088602 |
| 723 | Ga0373958_0008632 | 3300034819 | Bacteria | 1657 |
| 724 | Ga0373959_0051830 | 3300034820 | Bacteria | 888 |
| 725 | Ga0373926_0021182 | 3300035083 | Bacteria | 2250 |
| 726 | Ga0373926_0070555 | 3300035083 | Bacteria | 1283 |
| 727 | Ga0373929_0048161 | 3300035085 | Bacteria | 967 |
| 728 | Ga0373934_0033722 | 3300035086 | Bacteria | 2010 |
| 729 | Ga0373934_0056566 | 3300035086 | Bacteria | 1560 |
| 730 | Ga0373940_0025623 | 3300035088 | Bacteria | 1537 |
| 731 | Ga0373949_0012402 | 3300035090 | Bacteria | 1885 |
| 732 | Ga0373952_0087362 | 3300035092 | Bacteria | 805 |
| 733 | Ga0373923_0028040 | 3300035111 | Bacteria | 2250 |
| 734 | Ga0373923_0178218 | 3300035111 | Bacteria | 975 |
| 735 | Ga0373936_0006503 | 3300035113 | Bacteria | 4406 |
| 736 | Ga0373936_0014005 | 3300035113 | Bacteria | 3063 |
| 737 | Ga0373939_0004462 | 3300035114 | Bacteria | 3312 |
| 738 | Ga0373939_0004484 | 3300035114 | Bacteria | 3306 |
| 739 | Ga0373941_0004526 | 3300035115 | Bacteria | 3218 |
| 740 | Ga0373945_0106979 | 3300035116 | Bacteria | 1100 |
| 741 | Ga0373953_0051764 | 3300035117 | Bacteria | 1661 |
| 742 | Ga0373954_0000070 | 3300035118 | Bacteria | 36271 |
| 743 | Ga0373954_0010716 | 3300035118 | Bacteria | 4052 |
| 744 | Ga0373956_0001764 | 3300035119 | Bacteria | 8915 |
| 745 | Ga0373957_0002936 | 3300035120 | Bacteria | 4940 |
| 746 | Ga0373957_0007409 | 3300035120 | Bacteria | 3511 |
| 747 | Ga0373943_0007891 | 3300035170 | Bacteria | 4778 |
| 748 | Ga0373943_0012028 | 3300035170 | Bacteria | 3896 |
| 749 | Ga0373946_0003425 | 3300035171 | Bacteria | 5631 |
| 750 | Ga0373946_0129457 | 3300035171 | Bacteria | 1160 |
| 751 | Ga0373955_0000771 | 3300035172 | Bacteria | 13748 |
| 752 | Ga0373955_0304793 | 3300035172 | Bacteria | 961 |
| 753 | Ga0373942_0010230 | 3300035207 | Bacteria | 2204 |
| 754 | Ga0373961_0004030 | 3300035241 | Bacteria | 3577 |
| 755 | Ga0373961_0083272 | 3300035241 | Bacteria | 1010 |
| 756 | Ga0373962_0008952 | 3300035242 | Bacteria | 2473 |
| 757 | Ga0373962_0010848 | 3300035242 | Bacteria | 2278 |
| 758 | Ga0373962_0023849 | 3300035242 | Bacteria | 1632 |
| 759 | Ga0316574_0035235 | 3300035398 | Bacteria | 3057 |
| 760 | Ga0373931_0000607 | 3300035691 | Bacteria | 14829 |
| 761 | Ga0373931_0001266 | 3300035691 | Bacteria | 10806 |
| 762 | Ga0373931_0007703 | 3300035691 | Bacteria | 5083 |
| 763 | Ga0373931_0314573 | 3300035691 | Bacteria | 971 |
| 764 | Ga0373935_0011212 | 3300035692 | Bacteria | 5381 |
| 765 | Ga0373935_0051066 | 3300035692 | Bacteria | 2625 |
| 766 | Ga0373927_0010404 | 3300035695 | Bacteria | 6205 |
| 767 | Ga0373927_0014740 | 3300035695 | Bacteria | 5168 |
| 768 | Ga0373927_0017386 | 3300035695 | Bacteria | 4733 |
| 769 | Ga0373927_0026380 | 3300035695 | Bacteria | 3797 |
| 770 | Ga0373933_0000041 | 3300035724 | Bacteria | 79805 |
| 771 | Ga0373933_0006540 | 3300035724 | Bacteria | 6349 |
| 772 | Ga0373933_0059443 | 3300035724 | Bacteria | 2302 |
| 773 | Ga0373947_0002972 | 3300035725 | Bacteria | 10113 |
| 774 | Ga0373947_0014554 | 3300035725 | Bacteria | 4513 |
| 775 | Ga0373947_0106310 | 3300035725 | Bacteria | 1769 |
| 776 | Ga0373937_0094288 | 3300036401 | Bacteria | 2775 |
| 777 | Ga0316582_0245184 | 3300036647 | Bacteria | 1228 |
| 778 | Ga0316584_0040425 | 3300036712 | Bacteria | 3474 |
| 779 | Ga0373925_0009598 | 3300037068 | Bacteria | 7051 |
| 780 | Ga0373925_0020921 | 3300037068 | Bacteria | 4767 |
| 781 | Ga0373925_0041246 | 3300037068 | Bacteria | 3421 |
| 782 | Ga0373925_0066262 | 3300037068 | Bacteria | 2722 |
| 783 | Ga0373925_0197742 | 3300037068 | Bacteria | 1598 |
| 784 | Ga0373925_0293945 | 3300037068 | Bacteria | 1310 |
| 785 | Ga0395900_0001120 | 3300037418 | Bacteria | 33947 |
| 786 | Ga0395900_0045947 | 3300037418 | Bacteria | 4498 |
| 787 | Ga0395900_0129059 | 3300037418 | Bacteria | 2592 |
| 788 | Ga0395898_0045273 | 3300037466 | Bacteria | 4326 |
| 789 | Ga0395898_0069867 | 3300037466 | Bacteria | 3397 |
| 790 | Ga0395898_0479053 | 3300037466 | Bacteria | 1184 |
| 791 | Ga0395905_0018125 | 3300037471 | Bacteria | 6681 |
| 792 | Ga0395905_0106818 | 3300037471 | Bacteria | 2628 |
| 793 | Ga0395905_0148343 | 3300037471 | Bacteria | 2207 |
| 794 | Ga0395905_0390657 | 3300037471 | Bacteria | 1286 |
| 795 | Ga0436364_0170010 | 3300037853 | Bacteria | 1953 |
| 796 | Ga0436364_1378120 | 3300037853 | Bacteria | 7250 |
| 797 | Ga0395901_0125452 | 3300038443 | Bacteria | 2698 |
| 798 | Ga0395901_0196564 | 3300038443 | Bacteria | 2115 |
| 799 | Ga0395901_0204691 | 3300038443 | Bacteria | 2068 |
| 800 | Ga0436365_1136865 | 3300039437 | Bacteria | 22786 |
| 801 | Ga0436365_1391201 | 3300039437 | Bacteria | 1975 |
| 802 | Ga0436363_0476889 | 3300039450 | Bacteria | 1244 |
| 803 | Ga0436363_1445688 | 3300039450 | Bacteria | 2152 |
| 804 | Ga0436363_1599995 | 3300039450 | Bacteria | 2189 |
| 805 | Ga0436362_0188545 | 3300039453 | Bacteria | 4150 |
| 806 | Ga0439465_0048874 | 3300041413 | Bacteria | 1381 |
| 807 | Ga0451793_1390476 | 3300041452 | Bacteria | 1061 |
| 808 | Ga0451793_1584115 | 3300041452 | Bacteria | 1916 |
| 809 | Ga0466972_0000343 | 3300044658 | Bacteria | 25524 |
| 810 | Ga0466972_0005717 | 3300044658 | Bacteria | 6232 |
| 811 | Ga0466965_0286029 | 3300044683 | Bacteria | 891 |
| 812 | Ga0466966_0002698 | 3300044684 | Bacteria | 11633 |
| 813 | Ga0466966_0141667 | 3300044684 | Bacteria | 1469 |
| 814 | Ga0466966_0417255 | 3300044684 | Bacteria | 807 |
| 815 | Ga0466961_0002716 | 3300044693 | Bacteria | 11002 |
| 816 | Ga0466961_0016750 | 3300044693 | Bacteria | 4711 |
| 817 | Ga0466961_0073816 | 3300044693 | Bacteria | 2163 |
| 818 | Ga0466963_0065538 | 3300044694 | Bacteria | 2435 |
| 819 | Ga0466963_0083015 | 3300044694 | Bacteria | 2173 |
| 820 | Ga0466963_0256953 | 3300044694 | Bacteria | 1226 |
| 821 | Ga0466964_0112908 | 3300044706 | Bacteria | 1214 |
| 822 | Ga0453684_0156891 | 3300044712 | Bacteria | 2697 |
| 823 | Ga0466968_0011434 | 3300044735 | Bacteria | 3457 |
| 824 | Ga0466968_0264899 | 3300044735 | Bacteria | 819 |
| 825 | Ga0466957_0115508 | 3300044842 | Bacteria | 1706 |
| 826 | Ga0466957_0190507 | 3300044842 | Bacteria | 1343 |
| 827 | Ga0466957_0472714 | 3300044842 | Bacteria | 866 |
| 828 | Ga0466960_0008985 | 3300044901 | Bacteria | 4107 |
| 829 | Ga0466959_0006245 | 3300045049 | Bacteria | 8234 |
| 830 | Ga0451576_0000023 | 3300045051 | Bacteria | 477965 |
| 831 | Ga0451576_0336055 | 3300045051 | Bacteria | 1581 |
| 832 | Ga0466967_0099058 | 3300045976 | Bacteria | 2662 |
| 833 | Ga0495617_084534 | 3300046452 | Bacteria | 1038 |
| 834 | Ga0495592_0002858 | 3300046454 | Bacteria | 12270 |
| 835 | Ga0495603_0094425 | 3300046455 | Bacteria | 1747 |
| 836 | Ga0495603_0150649 | 3300046455 | Bacteria | 1351 |
| 837 | Ga0495603_0202268 | 3300046455 | Bacteria | 1148 |
| 838 | Ga0495603_0250360 | 3300046455 | Bacteria | 1020 |
| 839 | Ga0495590_0070647 | 3300046457 | Bacteria | 1225 |
| 840 | Ga0495629_0002263 | 3300046459 | Bacteria | 14836 |
| 841 | Ga0495629_0006304 | 3300046459 | Bacteria | 8802 |
| 842 | Ga0495629_0176313 | 3300046459 | Bacteria | 1482 |
| 843 | Ga0495638_0039968 | 3300046460 | Bacteria | 2974 |
| 844 | Ga0495651_0001805 | 3300046462 | Bacteria | 16510 |
| 845 | Ga0495651_0063762 | 3300046462 | Bacteria | 2816 |
| 846 | Ga0495651_0233251 | 3300046462 | Bacteria | 1266 |
| 847 | Ga0495653_0003677 | 3300046463 | Bacteria | 12388 |
| 848 | Ga0495650_0059622 | 3300046471 | Bacteria | 1536 |
| 849 | Ga0495580_0017033 | 3300046472 | Bacteria | 5445 |
| 850 | Ga0495580_0321688 | 3300046472 | Bacteria | 1051 |
| 851 | Ga0495582_0119538 | 3300046473 | Bacteria | 1484 |
| 852 | Ga0495582_0192093 | 3300046473 | Bacteria | 1165 |
| 853 | Ga0495605_0095641 | 3300046474 | Bacteria | 1371 |
| 854 | Ga0495639_0021582 | 3300046475 | Bacteria | 2820 |
| 855 | Ga0495664_0006016 | 3300046477 | Bacteria | 6688 |
| 856 | Ga0495584_0100820 | 3300046491 | Bacteria | 1459 |
| 857 | Ga0495585_0033013 | 3300046492 | Bacteria | 2932 |
| 858 | Ga0495585_0091044 | 3300046492 | Bacteria | 1643 |
| 859 | Ga0495596_0136870 | 3300046500 | Bacteria | 951 |
| 860 | Ga0495607_0094820 | 3300046501 | Bacteria | 1609 |
| 861 | Ga0495583_0158801 | 3300046506 | Bacteria | 934 |
| 862 | Ga0495606_0075148 | 3300046507 | Bacteria | 2115 |
| 863 | Ga0495606_0138931 | 3300046507 | Bacteria | 1436 |
| 864 | Ga0495606_0336310 | 3300046507 | Bacteria | 806 |
| 865 | Ga0495608_0001870 | 3300046511 | Bacteria | 15052 |
| 866 | Ga0495608_0163141 | 3300046511 | Bacteria | 1416 |
| 867 | Ga0495616_0059886 | 3300046513 | Bacteria | 1871 |
| 868 | Ga0495618_0006298 | 3300046514 | Bacteria | 7205 |
| 869 | Ga0495618_0096966 | 3300046514 | Bacteria | 1886 |
| 870 | Ga0495628_0002643 | 3300046516 | Bacteria | 16072 |
| 871 | Ga0495628_0036298 | 3300046516 | Bacteria | 3957 |
| 872 | Ga0495628_0108425 | 3300046516 | Bacteria | 2138 |
| 873 | Ga0495628_0266364 | 3300046516 | Bacteria | 1276 |
| 874 | Ga0495631_0024517 | 3300046518 | Bacteria | 2785 |
| 875 | Ga0495632_0089371 | 3300046519 | Bacteria | 1462 |
| 876 | Ga0495632_0125868 | 3300046519 | Bacteria | 1195 |
| 877 | Ga0495643_0104353 | 3300046522 | Bacteria | 1449 |
| 878 | Ga0495644_0044125 | 3300046523 | Bacteria | 1677 |
| 879 | Ga0495648_0015942 | 3300046524 | Bacteria | 5429 |
| 880 | Ga0495652_0038928 | 3300046529 | Bacteria | 4114 |
| 881 | Ga0495652_0100660 | 3300046529 | Bacteria | 2344 |
| 882 | Ga0495652_0243593 | 3300046529 | Bacteria | 1336 |
| 883 | Ga0495652_0267992 | 3300046529 | Bacteria | 1257 |
| 884 | Ga0495652_0393937 | 3300046529 | Bacteria | 982 |
| 885 | Ga0495665_0008508 | 3300046531 | Bacteria | 5570 |
| 886 | Ga0495640_0054419 | 3300046533 | Bacteria | 2741 |
| 887 | Ga0495640_0209956 | 3300046533 | Bacteria | 1231 |
| 888 | Ga0495640_0256587 | 3300046533 | Bacteria | 1093 |
| 889 | Ga0495640_0393737 | 3300046533 | Bacteria | 851 |
| 890 | Ga0495586_0034154 | 3300046535 | Bacteria | 2731 |
| 891 | Ga0495587_0001351 | 3300046536 | Bacteria | 16275 |
| 892 | Ga0495587_0008371 | 3300046536 | Bacteria | 6655 |
| 893 | Ga0495598_0015089 | 3300046537 | Bacteria | 1943 |
| 894 | Ga0495609_0035714 | 3300046538 | Bacteria | 2248 |
| 895 | Ga0495621_0042112 | 3300046539 | Bacteria | 1606 |
| 896 | Ga0495621_0105451 | 3300046539 | Bacteria | 1076 |
| 897 | Ga0495597_0070740 | 3300046542 | Bacteria | 1503 |
| 898 | Ga0495645_0003263 | 3300046543 | Bacteria | 11010 |
| 899 | Ga0495622_0004261 | 3300046557 | Bacteria | 6657 |
| 900 | Ga0495622_0011772 | 3300046557 | Bacteria | 4044 |
| 901 | Ga0495622_0070335 | 3300046557 | Bacteria | 1615 |
| 902 | Ga0495633_0046592 | 3300046558 | Bacteria | 2050 |
| 903 | Ga0495667_0000926 | 3300046559 | Bacteria | 18989 |
| 904 | Ga0495667_0057163 | 3300046559 | Bacteria | 2565 |
| 905 | Ga0495656_0046205 | 3300046615 | Bacteria | 1841 |
| 906 | Ga0495656_0088311 | 3300046615 | Bacteria | 1413 |
| 907 | Ga0495656_0089501 | 3300046615 | Bacteria | 1405 |
| 908 | Ga0495668_0159410 | 3300046616 | Bacteria | 1236 |
| 909 | Ga0495668_0220075 | 3300046616 | Bacteria | 1039 |
| 910 | Ga0495634_0007605 | 3300046642 | Bacteria | 8118 |
| 911 | Ga0495634_0029043 | 3300046642 | Bacteria | 3832 |
| 912 | Ga0495611_0101163 | 3300046648 | Bacteria | 1338 |
| 913 | Ga0495611_0107006 | 3300046648 | Bacteria | 1301 |
| 914 | Ga0495625_0121577 | 3300046660 | Bacteria | 1776 |
| 915 | Ga0495635_0004483 | 3300046663 | Bacteria | 9674 |
| 916 | Ga0495635_0008512 | 3300046663 | Bacteria | 7164 |
| 917 | Ga0495635_0034757 | 3300046663 | Bacteria | 3496 |
| 918 | Ga0495659_0056929 | 3300046664 | Bacteria | 1435 |
| 919 | Ga0495661_0197379 | 3300046665 | Bacteria | 1056 |
| 920 | Ga0495588_0033061 | 3300046674 | Bacteria | 2610 |
| 921 | Ga0495657_0001016 | 3300046675 | Bacteria | 24742 |
| 922 | Ga0495657_0020802 | 3300046675 | Bacteria | 4716 |
| 923 | Ga0495599_0000637 | 3300046678 | Bacteria | 19794 |
| 924 | Ga0495623_0005023 | 3300046679 | Bacteria | 8674 |
| 925 | Ga0495623_0210682 | 3300046679 | Bacteria | 1113 |
| 926 | Ga0495646_0001926 | 3300046680 | Bacteria | 12482 |
| 927 | Ga0495646_0111828 | 3300046680 | Bacteria | 1554 |
| 928 | Ga0495646_0136898 | 3300046680 | Bacteria | 1373 |
| 929 | Ga0495647_0033614 | 3300046681 | Bacteria | 1917 |
| 930 | Ga0495647_0180150 | 3300046681 | Bacteria | 919 |
| 931 | Ga0495658_0018165 | 3300046683 | Bacteria | 3650 |
| 932 | Ga0495669_0006671 | 3300046684 | Bacteria | 4829 |
| 933 | Ga0495613_0076601 | 3300046689 | Bacteria | 2434 |
| 934 | Ga0495613_0220345 | 3300046689 | Bacteria | 1332 |
| 935 | Ga0495624_0090063 | 3300046690 | Bacteria | 1893 |
| 936 | Ga0495624_0338162 | 3300046690 | Bacteria | 906 |
| 937 | Ga0495670_0163712 | 3300046691 | Bacteria | 1169 |
| 938 | Ga0495671_0188418 | 3300046692 | Bacteria | 1002 |
| 939 | Ga0495649_0101666 | 3300046694 | Bacteria | 1527 |
| 940 | Ga0495649_0133514 | 3300046694 | Bacteria | 1309 |
| 941 | Ga0495589_0252077 | 3300046794 | Bacteria | 824 |
| 942 | Ga0495600_0000352 | 3300046809 | Bacteria | 24397 |
| 943 | Ga0495600_0002398 | 3300046809 | Bacteria | 10736 |
| 944 | Ga0495581_0033070 | 3300047315 | Bacteria | 2994 |
| 945 | Ga0495581_0214543 | 3300047315 | Bacteria | 1125 |
| 946 | Ga0495581_0223691 | 3300047315 | Bacteria | 1101 |
| 947 | Ga0495604_0013258 | 3300047317 | Bacteria | 6565 |
| 948 | Ga0495604_0028514 | 3300047317 | Bacteria | 4441 |
| 949 | Ga0495604_0030928 | 3300047317 | Bacteria | 4248 |
| 950 | Ga0495604_0177442 | 3300047317 | Bacteria | 1492 |
| 951 | Ga0495604_0264562 | 3300047317 | Bacteria | 1168 |
| 952 | Ga0495674_0075372 | 3300047319 | Bacteria | 2903 |
| 953 | Ga0495674_0111988 | 3300047319 | Bacteria | 2313 |
| 954 | Ga0495674_0261177 | 3300047319 | Bacteria | 1423 |
| 955 | Ga0495672_0115619 | 3300047320 | Bacteria | 1433 |
| 956 | Ga0495672_0199726 | 3300047320 | Bacteria | 1001 |
| 957 | Ga0495676_0036897 | 3300047321 | Bacteria | 4076 |
| 958 | Ga0495680_0004188 | 3300047322 | Bacteria | 13854 |
| 959 | Ga0495680_0008983 | 3300047322 | Bacteria | 9028 |
| 960 | Ga0495680_0173717 | 3300047322 | Bacteria | 1559 |
| 961 | Ga0495683_0231937 | 3300047323 | Bacteria | 818 |
| 962 | Ga0495687_005957 | 3300047443 | Bacteria | 7606 |
| 963 | Ga0495675_0001543 | 3300047444 | Bacteria | 13904 |
| 964 | Ga0495675_0031466 | 3300047444 | Bacteria | 3387 |
| 965 | Ga0495679_053390 | 3300047446 | Bacteria | 1207 |
| 966 | Ga0495673_0019085 | 3300047469 | Bacteria | 3442 |
| 967 | Ga0495684_0000380 | 3300047471 | Bacteria | 36351 |
| 968 | Ga0495684_0008788 | 3300047471 | Bacteria | 7807 |
| 969 | Ga0495684_0043964 | 3300047471 | Bacteria | 3420 |
| 970 | Ga0495684_0066211 | 3300047471 | Bacteria | 2747 |
| 971 | Ga0495593_0001866 | 3300047673 | Bacteria | 12550 |
| 972 | Ga0495593_0006778 | 3300047673 | Bacteria | 6705 |
| 973 | Ga0495602_0021117 | 3300048088 | Bacteria | 6417 |
| 974 | Ga0495602_0036833 | 3300048088 | Bacteria | 4547 |
| 975 | Ga0495602_0167084 | 3300048088 | Bacteria | 1711 |
| 976 | Ga0495602_0230709 | 3300048088 | Bacteria | 1391 |
| 977 | Ga0495602_0370307 | 3300048088 | Bacteria | 1029 |
| 978 | Ga0495614_0080726 | 3300048089 | Bacteria | 1409 |
| 979 | Ga0496100_0002783 | 3300048903 | Bacteria | 8949 |
| 980 | Ga0496100_0071960 | 3300048903 | Bacteria | 2310 |
| 981 | Ga0496100_0116730 | 3300048903 | Bacteria | 1863 |
| 982 | Ga0496100_0139341 | 3300048903 | Bacteria | 1717 |
| 983 | Ga0496100_0158901 | 3300048903 | Bacteria | 1619 |
| 984 | Ga0496100_0192259 | 3300048903 | Bacteria | 1482 |
| 985 | Ga0496100_0273941 | 3300048903 | Bacteria | 1256 |
| 986 | Ga0496100_0492231 | 3300048903 | Bacteria | 944 |
| 987 | Ga0496101_0001858 | 3300048904 | Bacteria | 12748 |
| 988 | Ga0496101_0027459 | 3300048904 | Bacteria | 3966 |
| 989 | Ga0496101_0036410 | 3300048904 | Bacteria | 3486 |
| 990 | Ga0496101_0051498 | 3300048904 | Bacteria | 2967 |
| 991 | Ga0496101_0094130 | 3300048904 | Bacteria | 2232 |
| 992 | Ga0496101_0128539 | 3300048904 | Bacteria | 1922 |
| 993 | Ga0496101_0215932 | 3300048904 | Bacteria | 1487 |
| 994 | Ga0496102_0003736 | 3300048905 | Bacteria | 12868 |
| 995 | Ga0496102_0007094 | 3300048905 | Bacteria | 9566 |
| 996 | Ga0496102_0067848 | 3300048905 | Bacteria | 3272 |
| 997 | Ga0496102_0068168 | 3300048905 | Bacteria | 3264 |
| 998 | Ga0496102_0073184 | 3300048905 | Bacteria | 3149 |
| 999 | Ga0496102_0103319 | 3300048905 | Bacteria | 2650 |
| 1000 | Ga0496102_0148180 | 3300048905 | Bacteria | 2204 |
| 1001 | Ga0496102_0185345 | 3300048905 | Bacteria | 1961 |
| 1002 | Ga0496102_0369674 | 3300048905 | Bacteria | 1350 |
| 1003 | Ga0496102_0467678 | 3300048905 | Bacteria | 1182 |
| 1004 | Ga0496102_0554667 | 3300048905 | Bacteria | 1072 |
| 1005 | Ga0496102_0596754 | 3300048905 | Bacteria | 1027 |
| 1006 | Ga0496103_0002281 | 3300048906 | Bacteria | 12123 |
| 1007 | Ga0496103_0019281 | 3300048906 | Bacteria | 4096 |
| 1008 | Ga0496103_0041350 | 3300048906 | Bacteria | 2834 |
| 1009 | Ga0496103_0499854 | 3300048906 | Bacteria | 778 |
| 1010 | Ga0496104_0002223 | 3300048907 | Bacteria | 16751 |
| 1011 | Ga0496104_0004213 | 3300048907 | Bacteria | 12488 |
| 1012 | Ga0496104_0011555 | 3300048907 | Bacteria | 7911 |
| 1013 | Ga0496104_0026939 | 3300048907 | Bacteria | 5314 |
| 1014 | Ga0496104_0088307 | 3300048907 | Bacteria | 2961 |
| 1015 | Ga0496105_0001630 | 3300048908 | Bacteria | 15962 |
| 1016 | Ga0496105_0013806 | 3300048908 | Bacteria | 6415 |
| 1017 | Ga0496105_0015284 | 3300048908 | Bacteria | 6113 |
| 1018 | Ga0496105_0102731 | 3300048908 | Bacteria | 2360 |
| 1019 | Ga0496105_0118488 | 3300048908 | Bacteria | 2184 |
| 1020 | Ga0496105_0194084 | 3300048908 | Bacteria | 1659 |
| 1021 | Ga0496105_0209711 | 3300048908 | Bacteria | 1588 |
| 1022 | Ga0496105_0328596 | 3300048908 | Bacteria | 1224 |
| 1023 | Ga0496106_0000423 | 3300048909 | Bacteria | 30107 |
| 1024 | Ga0496106_0000804 | 3300048909 | Bacteria | 22734 |
| 1025 | Ga0496106_0000855 | 3300048909 | Bacteria | 22094 |
| 1026 | Ga0496106_0100710 | 3300048909 | Bacteria | 2240 |
| 1027 | Ga0496106_0250935 | 3300048909 | Bacteria | 1414 |
| 1028 | Ga0496106_0267167 | 3300048909 | Bacteria | 1369 |
| 1029 | Ga0496106_0454142 | 3300048909 | Bacteria | 1029 |
| 1030 | Ga0496106_0611555 | 3300048909 | Bacteria | 872 |
| 1031 | Ga0496107_0005141 | 3300048910 | Bacteria | 8928 |
| 1032 | Ga0496107_0013617 | 3300048910 | Bacteria | 5685 |
| 1033 | Ga0496107_0015807 | 3300048910 | Bacteria | 5294 |
| 1034 | Ga0496107_0048963 | 3300048910 | Bacteria | 3045 |
| 1035 | Ga0496107_0094132 | 3300048910 | Bacteria | 2192 |
| 1036 | Ga0496107_0261969 | 3300048910 | Bacteria | 1286 |
| 1037 | Ga0496107_0606995 | 3300048910 | Bacteria | 808 |
| 1038 | Ga0496108_0009189 | 3300048911 | Bacteria | 8000 |
| 1039 | Ga0496108_0039504 | 3300048911 | Bacteria | 3934 |
| 1040 | Ga0496108_0042755 | 3300048911 | Bacteria | 3783 |
| 1041 | Ga0496108_0060594 | 3300048911 | Bacteria | 3184 |
| 1042 | Ga0496108_0080674 | 3300048911 | Bacteria | 2756 |
| 1043 | Ga0496108_0190707 | 3300048911 | Bacteria | 1776 |
| 1044 | Ga0496109_0000393 | 3300048912 | Bacteria | 39750 |
| 1045 | Ga0496109_0015089 | 3300048912 | Bacteria | 6724 |
| 1046 | Ga0496109_0071997 | 3300048912 | Bacteria | 3174 |
| 1047 | Ga0496109_0143959 | 3300048912 | Bacteria | 2229 |
| 1048 | Ga0496109_0485686 | 3300048912 | Bacteria | 1166 |
| 1049 | Ga0496109_0515970 | 3300048912 | Bacteria | 1128 |
| 1050 | Ga0496109_0610735 | 3300048912 | Bacteria | 1027 |
| 1051 | Ga0496109_0730386 | 3300048912 | Bacteria | 928 |
| 1052 | Ga0496110_0030127 | 3300048913 | Bacteria | 4676 |
| 1053 | Ga0496110_0041310 | 3300048913 | Bacteria | 4023 |
| 1054 | Ga0496110_0041319 | 3300048913 | Bacteria | 4023 |
| 1055 | Ga0496110_0086825 | 3300048913 | Bacteria | 2793 |
| 1056 | Ga0496110_0125847 | 3300048913 | Bacteria | 2312 |
| 1057 | Ga0496110_0163723 | 3300048913 | Bacteria | 2016 |
| 1058 | Ga0496110_0228679 | 3300048913 | Bacteria | 1691 |
| 1059 | Ga0496110_0336364 | 3300048913 | Bacteria | 1375 |
| 1060 | Ga0496110_0440488 | 3300048913 | Bacteria | 1187 |
| 1061 | Ga0496110_0613564 | 3300048913 | Bacteria | 986 |
| 1062 | Ga0496111_0014960 | 3300048914 | Bacteria | 5315 |
| 1063 | Ga0496111_0288845 | 3300048914 | Bacteria | 1216 |
| 1064 | Ga0496111_0421523 | 3300048914 | Bacteria | 986 |
| 1065 | Ga0496112_0000021 | 3300048915 | Bacteria | 156561 |
| 1066 | Ga0496112_0002518 | 3300048915 | Bacteria | 14792 |
| 1067 | Ga0496112_0036381 | 3300048915 | Bacteria | 4802 |
| 1068 | Ga0496112_0194986 | 3300048915 | Bacteria | 1986 |
| 1069 | Ga0496112_0212293 | 3300048915 | Bacteria | 1892 |
| 1070 | Ga0496112_0586528 | 3300048915 | Bacteria | 1047 |
| 1071 | Ga0496113_0004330 | 3300048916 | Bacteria | 8699 |
| 1072 | Ga0496113_0020931 | 3300048916 | Bacteria | 4608 |
| 1073 | Ga0496113_0263297 | 3300048916 | Bacteria | 1377 |
| 1074 | Ga0496114_0013575 | 3300048917 | Bacteria | 6535 |
| 1075 | Ga0496114_0056707 | 3300048917 | Bacteria | 3270 |
| 1076 | Ga0496114_0125008 | 3300048917 | Bacteria | 2216 |
| 1077 | Ga0496114_0282791 | 3300048917 | Bacteria | 1463 |
| 1078 | Ga0496114_0400891 | 3300048917 | Bacteria | 1215 |
| 1079 | Ga0496115_0001490 | 3300048918 | Bacteria | 16832 |
| 1080 | Ga0496115_0004939 | 3300048918 | Bacteria | 9688 |
| 1081 | Ga0496115_0027232 | 3300048918 | Bacteria | 4469 |
| 1082 | Ga0496115_0033127 | 3300048918 | Bacteria | 4078 |
| 1083 | Ga0496115_0036328 | 3300048918 | Bacteria | 3900 |
| 1084 | Ga0496115_0096997 | 3300048918 | Bacteria | 2414 |
| 1085 | Ga0496115_0166225 | 3300048918 | Bacteria | 1824 |
| 1086 | Ga0496115_0483188 | 3300048918 | Bacteria | 997 |
| 1087 | Ga0496116_0059283 | 3300048919 | Bacteria | 2491 |
| 1088 | Ga0496117_0081333 | 3300048920 | Bacteria | 2126 |
| 1089 | Ga0496118_0006945 | 3300048921 | Bacteria | 12237 |
| 1090 | Ga0496118_0155077 | 3300048921 | Bacteria | 1426 |
| 1091 | Ga0496118_0205827 | 3300048921 | Bacteria | 1160 |
| 1092 | Ga0496118_0251253 | 3300048921 | Bacteria | 1005 |
| 1093 | Ga0496119_0013974 | 3300048922 | Bacteria | 6328 |
| 1094 | Ga0496119_0099425 | 3300048922 | Bacteria | 1636 |
| 1095 | Ga0496120_0048913 | 3300048923 | Bacteria | 2430 |
| 1096 | Ga0496121_0001335 | 3300048924 | Bacteria | 42241 |
| 1097 | Ga0496121_0004369 | 3300048924 | Bacteria | 19105 |
| 1098 | Ga0496121_0030188 | 3300048924 | Bacteria | 4984 |
| 1099 | Ga0496121_0079960 | 3300048924 | Bacteria | 2593 |
| 1100 | Ga0496121_0112460 | 3300048924 | Bacteria | 2074 |
| 1101 | Ga0496121_0141908 | 3300048924 | Bacteria | 1780 |
| 1102 | Ga0496121_0207768 | 3300048924 | Bacteria | 1389 |
| 1103 | Ga0496121_0228373 | 3300048924 | Bacteria | 1305 |
| 1104 | Ga0496121_0253991 | 3300048924 | Bacteria | 1217 |
| 1105 | Ga0496121_0302030 | 3300048924 | Bacteria | 1086 |
| 1106 | Ga0496121_0380760 | 3300048924 | Bacteria | 930 |
| 1107 | Ga0496124_0004332 | 3300048927 | Bacteria | 16626 |
| 1108 | Ga0496125_0050828 | 3300048928 | Bacteria | 3427 |
| 1109 | Ga0496125_0115226 | 3300048928 | Bacteria | 1933 |
| 1110 | Ga0496125_0141205 | 3300048928 | Bacteria | 1674 |
| 1111 | Ga0496125_0146064 | 3300048928 | Bacteria | 1634 |
| 1112 | Ga0496125_0153610 | 3300048928 | Bacteria | 1576 |
| 1113 | Ga0496126_0006091 | 3300048929 | Bacteria | 13526 |
| 1114 | Ga0496126_0006946 | 3300048929 | Bacteria | 12532 |
| 1115 | Ga0496126_0012554 | 3300048929 | Bacteria | 8671 |
| 1116 | Ga0496126_0046312 | 3300048929 | Bacteria | 3990 |
| 1117 | Ga0496126_0066660 | 3300048929 | Bacteria | 3218 |
| 1118 | Ga0496126_0113492 | 3300048929 | Bacteria | 2358 |
| 1119 | Ga0496126_0303484 | 3300048929 | Bacteria | 1316 |
| 1120 | Ga0496126_0375631 | 3300048929 | Bacteria | 1158 |
| 1121 | Ga0496126_0481923 | 3300048929 | Bacteria | 994 |
| 1122 | Ga0495682_0010318 | 3300049460 | Bacteria | 3621 |
| 1123 | Ga0501031_0000645 | 3300049568 | Bacteria | 20696 |
| 1124 | Ga0501031_0050097 | 3300049568 | Bacteria | 2721 |
| 1125 | Ga0501031_0137365 | 3300049568 | Bacteria | 1597 |
| 1126 | Ga0501031_0303441 | 3300049568 | Bacteria | 1035 |
| 1127 | Ga0501032_0000129 | 3300049569 | Bacteria | 62082 |
| 1128 | Ga0501032_0093877 | 3300049569 | Bacteria | 1989 |
| 1129 | Ga0501033_0000113 | 3300049570 | Bacteria | 78028 |
| 1130 | Ga0501033_0000983 | 3300049570 | Bacteria | 25917 |
| 1131 | Ga0501034_0000503 | 3300049571 | Bacteria | 63099 |
| 1132 | Ga0501036_0000232 | 3300049572 | Bacteria | 37236 |
| 1133 | Ga0501036_0077945 | 3300049572 | Bacteria | 2804 |
| 1134 | Ga0501036_0331001 | 3300049572 | Bacteria | 1272 |
| 1135 | Ga0501036_0378918 | 3300049572 | Bacteria | 1181 |
| 1136 | Ga0501037_0000106 | 3300049573 | Bacteria | 79430 |
| 1137 | Ga0501037_0002045 | 3300049573 | Bacteria | 14624 |
| 1138 | Ga0501038_0000108 | 3300049574 | Bacteria | 70323 |
| 1139 | Ga0501038_0252645 | 3300049574 | Bacteria | 1396 |
| 1140 | Ga0501039_0000460 | 3300049575 | Bacteria | 29614 |
| 1141 | Ga0501039_0029454 | 3300049575 | Bacteria | 4229 |
| 1142 | Ga0501039_0075573 | 3300049575 | Bacteria | 2619 |
| 1143 | Ga0501039_0145068 | 3300049575 | Bacteria | 1865 |
| 1144 | Ga0501039_0295127 | 3300049575 | Bacteria | 1274 |
| 1145 | Ga0501040_0008115 | 3300049576 | Bacteria | 6821 |
| 1146 | Ga0501040_0125050 | 3300049576 | Bacteria | 1806 |
| 1147 | Ga0501041_0171081 | 3300049577 | Bacteria | 1359 |
| 1148 | Ga0501041_0294764 | 3300049577 | Bacteria | 1022 |
| 1149 | Ga0501041_0365624 | 3300049577 | Bacteria | 912 |
| 1150 | Ga0501042_0031122 | 3300049578 | Bacteria | 3775 |
| 1151 | Ga0501042_0486005 | 3300049578 | Bacteria | 896 |
| 1152 | Ga0501043_0000035 | 3300049579 | Bacteria | 133200 |
| 1153 | Ga0501043_0102436 | 3300049579 | Bacteria | 2250 |
| 1154 | Ga0501043_0506866 | 3300049579 | Bacteria | 901 |
| 1155 | Ga0501046_0027551 | 3300049580 | Bacteria | 4634 |
| 1156 | Ga0501046_0032152 | 3300049580 | Bacteria | 4250 |
| 1157 | Ga0501046_0045172 | 3300049580 | Bacteria | 3500 |
| 1158 | Ga0501046_0060099 | 3300049580 | Bacteria | 2975 |
| 1159 | Ga0501046_0141250 | 3300049580 | Bacteria | 1822 |
| 1160 | Ga0501047_0000792 | 3300049581 | Bacteria | 33063 |
| 1161 | Ga0501047_0029142 | 3300049581 | Bacteria | 5323 |
| 1162 | Ga0501048_0000116 | 3300049582 | Bacteria | 45512 |
| 1163 | Ga0501048_0293564 | 3300049582 | Bacteria | 1156 |
| 1164 | Ga0501048_0391153 | 3300049582 | Bacteria | 993 |
| 1165 | Ga0501067_0001402 | 3300049583 | Bacteria | 13081 |
| 1166 | Ga0501067_0022473 | 3300049583 | Bacteria | 3491 |
| 1167 | Ga0501067_0040323 | 3300049583 | Bacteria | 2594 |
| 1168 | Ga0501068_0000014 | 3300049584 | Bacteria | 62762 |
| 1169 | Ga0501068_0298048 | 3300049584 | Bacteria | 1032 |
| 1170 | Ga0501069_0021145 | 3300049585 | Bacteria | 3529 |
| 1171 | Ga0501071_0039219 | 3300049587 | Bacteria | 3388 |
| 1172 | Ga0501071_0042501 | 3300049587 | Bacteria | 3257 |
| 1173 | Ga0501071_0218478 | 3300049587 | Bacteria | 1434 |
| 1174 | Ga0501072_0000367 | 3300049588 | Bacteria | 32192 |
| 1175 | Ga0501072_0111154 | 3300049588 | Bacteria | 2181 |
| 1176 | Ga0501072_0216851 | 3300049588 | Bacteria | 1525 |
| 1177 | Ga0501073_0000368 | 3300049589 | Bacteria | 30350 |
| 1178 | Ga0501073_0042293 | 3300049589 | Bacteria | 3216 |
| 1179 | Ga0501073_0076392 | 3300049589 | Bacteria | 2331 |
| 1180 | Ga0501074_0001037 | 3300049590 | Bacteria | 18048 |
| 1181 | Ga0501074_0007065 | 3300049590 | Bacteria | 8112 |
| 1182 | Ga0501074_0238840 | 3300049590 | Bacteria | 1293 |
| 1183 | Ga0501074_0310490 | 3300049590 | Bacteria | 1120 |
| 1184 | Ga0501075_0096517 | 3300049591 | Bacteria | 2243 |
| 1185 | Ga0501075_0139355 | 3300049591 | Bacteria | 1848 |
| 1186 | Ga0501075_0151471 | 3300049591 | Bacteria | 1768 |
| 1187 | Ga0501075_0171042 | 3300049591 | Bacteria | 1658 |
| 1188 | Ga0501075_0446889 | 3300049591 | Bacteria | 986 |
| 1189 | Ga0501076_0015465 | 3300049592 | Bacteria | 5767 |
| 1190 | Ga0501076_0079891 | 3300049592 | Bacteria | 2625 |
| 1191 | Ga0501076_0290632 | 3300049592 | Bacteria | 1339 |
| 1192 | Ga0501076_0297003 | 3300049592 | Bacteria | 1324 |
| 1193 | Ga0501077_0006376 | 3300049593 | Bacteria | 7234 |
| 1194 | Ga0501077_0402434 | 3300049593 | Bacteria | 875 |
| 1195 | Ga0501079_0005691 | 3300049741 | Bacteria | 9309 |
| 1196 | Ga0501079_0006966 | 3300049741 | Bacteria | 8518 |
| 1197 | Ga0501079_0035935 | 3300049741 | Bacteria | 3815 |
| 1198 | Ga0501079_0045958 | 3300049741 | Bacteria | 3369 |
| 1199 | Ga0501079_0351092 | 3300049741 | Bacteria | 1156 |
| 1200 | Ga0501079_0572487 | 3300049741 | Bacteria | 888 |
| 1201 | Ga0501080_0000332 | 3300049742 | Bacteria | 36151 |
| 1202 | Ga0501080_0013737 | 3300049742 | Bacteria | 7455 |
| 1203 | Ga0501080_0019600 | 3300049742 | Bacteria | 6267 |
| 1204 | Ga0501080_0094780 | 3300049742 | Bacteria | 2772 |
| 1205 | Ga0501080_0240268 | 3300049742 | Bacteria | 1653 |
| 1206 | Ga0501080_0710075 | 3300049742 | Bacteria | 886 |
| 1207 | Ga0501081_0026875 | 3300049743 | Bacteria | 3884 |
| 1208 | Ga0501081_0043029 | 3300049743 | Bacteria | 3097 |
| 1209 | Ga0501081_0067213 | 3300049743 | Bacteria | 2494 |
| 1210 | Ga0501081_0312410 | 3300049743 | Bacteria | 1154 |
| 1211 | Ga0501081_0576480 | 3300049743 | Bacteria | 841 |
| 1212 | Ga0501083_0003499 | 3300049744 | Bacteria | 10992 |
| 1213 | Ga0501035_0011457 | 3300049822 | Bacteria | 8221 |
| 1214 | Ga0501035_0017102 | 3300049822 | Bacteria | 6682 |
| 1215 | Ga0501044_0000051 | 3300049823 | Bacteria | 143658 |
| 1216 | Ga0501044_0049072 | 3300049823 | Bacteria | 4357 |
| 1217 | Ga0501044_0060999 | 3300049823 | Bacteria | 3859 |
| 1218 | Ga0501045_0002440 | 3300049824 | Bacteria | 12638 |
| 1219 | Ga0501045_0039923 | 3300049824 | Bacteria | 3415 |
| 1220 | Ga0501045_0062651 | 3300049824 | Bacteria | 2729 |
| 1221 | Ga0501045_0439709 | 3300049824 | Bacteria | 970 |
| 1222 | nmdc:mga03683_174190_c1 | 3300050489 | Bacteria | 979 |
| 1223 | nmdc:mga03683_244494_c1 | 3300050489 | Bacteria | 832 |
| 1224 | nmdc:mga03n38_5710_c1 | 3300050490 | Bacteria | 4264 |
| 1225 | nmdc:mga03n38_59835_c1 | 3300050490 | Bacteria | 1730 |
| 1226 | nmdc:mga00v17_257907_c1 | 3300050491 | Bacteria | 1131 |
| 1227 | nmdc:mga00v17_73327_c1 | 3300050491 | Bacteria | 2126 |
| 1228 | nmdc:mga0yw44_167143_c1 | 3300050492 | Bacteria | 1443 |
| 1229 | nmdc:mga0yw44_197784_c1 | 3300050492 | Bacteria | 1327 |
| 1230 | nmdc:mga0yw44_222687_c1 | 3300050492 | Bacteria | 1251 |
| 1231 | nmdc:mga0yw44_52649_c1 | 3300050492 | Bacteria | 2469 |
| 1232 | nmdc:mga0k408_185814_c1 | 3300050493 | Bacteria | 1240 |
| 1233 | nmdc:mga0k408_222913_c1 | 3300050493 | Bacteria | 1126 |
| 1234 | nmdc:mga0k408_62872_c1 | 3300050493 | Bacteria | 2159 |
| 1235 | nmdc:mga06z11_175774_c1 | 3300050494 | Bacteria | 1232 |
| 1236 | nmdc:mga06z11_21836_c1 | 3300050494 | Bacteria | 2980 |
| 1237 | nmdc:mga06z11_218477_c1 | 3300050494 | Bacteria | 1113 |
| 1238 | nmdc:mga04h51_22765_c1 | 3300050495 | Bacteria | 1900 |
| 1239 | nmdc:mga07m45_121932_c1 | 3300050496 | Bacteria | 1506 |
| 1240 | nmdc:mga07m45_186818_c1 | 3300050496 | Bacteria | 1205 |
| 1241 | nmdc:mga07m45_59246_c1 | 3300050496 | Bacteria | 2167 |
| 1242 | nmdc:mga07m45_74206_c1 | 3300050496 | Bacteria | 1938 |
| 1243 | nmdc:mga05p37_6789_c1 | 3300050507 | Bacteria | 13487 |
| 1244 | nmdc:mga05p37_81855_c1 | 3300050507 | Bacteria | 3977 |
| 1245 | nmdc:mga09592_178784_c1 | 3300050508 | Bacteria | 1835 |
| 1246 | nmdc:mga09592_535495_c1 | 3300050508 | Bacteria | 1006 |
| 1247 | nmdc:mga0qj67_1791_c1 | 3300050509 | Bacteria | 15187 |
| 1248 | nmdc:mga0qj67_912746_c1 | 3300050509 | Bacteria | 692 |
| 1249 | nmdc:mga06r32_1075_c1 | 3300050510 | Bacteria | 24529 |
| 1250 | nmdc:mga06r32_155564_c1 | 3300050510 | Bacteria | 2267 |
| 1251 | nmdc:mga06r32_326574_c1 | 3300050510 | Bacteria | 1519 |
| 1252 | nmdc:mga06r32_3555_c1 | 3300050510 | Bacteria | 13921 |
| 1253 | nmdc:mga06r32_42782_c1 | 3300050510 | Bacteria | 4309 |
| 1254 | nmdc:mga08y16_127561_c1 | 3300050511 | Bacteria | 2646 |
| 1255 | nmdc:mga08y16_448288_c1 | 3300050511 | Bacteria | 1316 |
| 1256 | nmdc:mga08y16_61270_c1 | 3300050511 | Bacteria | 3929 |
| 1257 | nmdc:mga0n895_42627_c1 | 3300050512 | Bacteria | 4416 |
| 1258 | nmdc:mga0n895_53114_c1 | 3300050512 | Bacteria | 3980 |
| 1259 | nmdc:mga0rr50_113428_c1 | 3300050513 | Bacteria | 2148 |
| 1260 | nmdc:mga0rr50_277170_c1 | 3300050513 | Bacteria | 1399 |
| 1261 | nmdc:mga08x19_227468_c1 | 3300050514 | Bacteria | 1283 |
| 1262 | nmdc:mga0a205_114429_c1 | 3300050515 | Bacteria | 2596 |
| 1263 | nmdc:mga0a205_44187_c1 | 3300050515 | Bacteria | 4294 |
| 1264 | nmdc:mga0a205_449493_c1 | 3300050515 | Bacteria | 1148 |
| 1265 | Ga0495601_0040237 | 3300053077 | Bacteria | 2928 |
| 1266 | Ga0495612_0048299 | 3300053078 | Bacteria | 1745 |
| 1267 | Ga0500610_0088184 | 3300053079 | Bacteria | 1613 |
| 1268 | Ga0500610_0100993 | 3300053079 | Bacteria | 1493 |
| 1269 | Ga0500635_0001265 | 3300053080 | Bacteria | 6036 |
| 1270 | Ga0500635_0006375 | 3300053080 | Bacteria | 3148 |
| 1271 | Ga0495655_0001686 | 3300053083 | Bacteria | 3421 |
| 1272 | Ga0495655_0021533 | 3300053083 | Bacteria | 1461 |
| 1273 | Ga0495655_0028819 | 3300053083 | Bacteria | 1330 |
| 1274 | Ga0495655_0054911 | 3300053083 | Bacteria | 1067 |
| 1275 | Ga0495595_0021261 | 3300053084 | Bacteria | 2833 |
| 1276 | Ga0495595_0030388 | 3300053084 | Bacteria | 2423 |
| 1277 | Ga0495619_0000355 | 3300053085 | Bacteria | 32054 |
| 1278 | Ga0495619_0075033 | 3300053085 | Bacteria | 2269 |
| 1279 | Ga0495619_0230882 | 3300053085 | Bacteria | 1282 |
| 1280 | Ga0495619_0366377 | 3300053085 | Bacteria | 996 |
| 1281 | Ga0500578_0086926 | 3300053086 | Bacteria | 1986 |
| 1282 | Ga0500578_0121475 | 3300053086 | Bacteria | 1642 |
| 1283 | Ga0500578_0191153 | 3300053086 | Bacteria | 1257 |
| 1284 | Ga0500643_000032 | 3300053087 | Bacteria | 200350 |
| 1285 | Ga0500647_0100739 | 3300053091 | Bacteria | 1379 |
| 1286 | Ga0500583_0091857 | 3300053092 | Bacteria | 1478 |
| 1287 | Ga0500566_0000026 | 3300053094 | Bacteria | 77138 |
| 1288 | Ga0500566_0001584 | 3300053094 | Bacteria | 13387 |
| 1289 | Ga0500566_0005873 | 3300053094 | Bacteria | 7295 |
| 1290 | Ga0500566_0194899 | 3300053094 | Bacteria | 1028 |
| 1291 | Ga0500640_002218 | 3300053095 | Bacteria | 6337 |
| 1292 | Ga0500641_0143999 | 3300053096 | Bacteria | 1030 |
| 1293 | Ga0500648_116176 | 3300053097 | Bacteria | 1471 |
| 1294 | Ga0500650_0148713 | 3300053098 | Bacteria | 1084 |
| 1295 | Ga0500556_0077074 | 3300053104 | Bacteria | 1254 |
| 1296 | Ga0500557_000087 | 3300053105 | Bacteria | 32155 |
| 1297 | Ga0500562_012186 | 3300053108 | Bacteria | 2185 |
| 1298 | Ga0500569_108113 | 3300053109 | Bacteria | 917 |
| 1299 | Ga0500572_001308 | 3300053111 | Bacteria | 6949 |
| 1300 | Ga0500572_005714 | 3300053111 | Bacteria | 2828 |
| 1301 | Ga0500572_009314 | 3300053111 | Bacteria | 2319 |
| 1302 | Ga0500582_086169 | 3300053114 | Bacteria | 1083 |
| 1303 | Ga0500591_065022 | 3300053115 | Bacteria | 1670 |
| 1304 | Ga0500595_002640 | 3300053119 | Bacteria | 8722 |
| 1305 | Ga0500595_009653 | 3300053119 | Bacteria | 3885 |
| 1306 | Ga0500595_012338 | 3300053119 | Bacteria | 3309 |
| 1307 | Ga0500595_012635 | 3300053119 | Bacteria | 3258 |
| 1308 | Ga0500595_039261 | 3300053119 | Bacteria | 1532 |
| 1309 | Ga0500597_125856 | 3300053120 | Bacteria | 1109 |
| 1310 | Ga0500608_003190 | 3300053122 | Bacteria | 6097 |
| 1311 | Ga0500608_199228 | 3300053122 | Bacteria | 829 |
| 1312 | Ga0500614_000135 | 3300053123 | Bacteria | 18032 |
| 1313 | Ga0500642_0001017 | 3300053130 | Bacteria | 8061 |
| 1314 | Ga0500642_0096705 | 3300053130 | Bacteria | 1369 |
| 1315 | Ga0500655_012393 | 3300053133 | Bacteria | 1550 |
| 1316 | Ga0500559_0000081 | 3300053136 | Bacteria | 75262 |
| 1317 | Ga0500559_0009036 | 3300053136 | Bacteria | 4330 |
| 1318 | Ga0500559_0010760 | 3300053136 | Bacteria | 3922 |
| 1319 | Ga0500559_0021965 | 3300053136 | Bacteria | 2706 |
| 1320 | Ga0500559_0093710 | 3300053136 | Bacteria | 1377 |
| 1321 | Ga0500564_023225 | 3300053138 | Bacteria | 2841 |
| 1322 | Ga0500568_0040631 | 3300053139 | Bacteria | 1871 |
| 1323 | Ga0500573_0035456 | 3300053140 | Bacteria | 2878 |
| 1324 | Ga0500588_0031973 | 3300053146 | Bacteria | 1522 |
| 1325 | Ga0500589_093460 | 3300053147 | Bacteria | 1320 |
| 1326 | Ga0500590_011029 | 3300053148 | Bacteria | 4574 |
| 1327 | Ga0500603_000591 | 3300053150 | Bacteria | 9040 |
| 1328 | Ga0500604_0051330 | 3300053151 | Bacteria | 1273 |
| 1329 | Ga0500619_003290 | 3300053154 | Bacteria | 3284 |
| 1330 | Ga0500619_069727 | 3300053154 | Bacteria | 1168 |
| 1331 | Ga0500620_001971 | 3300053155 | Bacteria | 3983 |
| 1332 | Ga0500622_0004721 | 3300053156 | Bacteria | 8421 |
| 1333 | Ga0500630_000362 | 3300053159 | Bacteria | 19136 |
| 1334 | Ga0500638_033440 | 3300053162 | Bacteria | 2486 |
| 1335 | Ga0500638_050884 | 3300053162 | Bacteria | 2003 |
| 1336 | Ga0500638_071520 | 3300053162 | Bacteria | 1657 |
| 1337 | Ga0500638_109955 | 3300053162 | Bacteria | 1274 |
| 1338 | Ga0500639_000939 | 3300053163 | Bacteria | 14837 |
| 1339 | Ga0500639_070182 | 3300053163 | Bacteria | 1787 |
| 1340 | Ga0500636_0000276 | 3300053177 | Bacteria | 28456 |
| 1341 | Ga0500636_0169880 | 3300053177 | Bacteria | 1180 |
| 1342 | Ga0500637_0000122 | 3300053178 | Bacteria | 28103 |
| 1343 | Ga0500637_0014625 | 3300053178 | Bacteria | 4142 |
| 1344 | Ga0500576_023847 | 3300053725 | Bacteria | 2794 |
| 1345 | Ga0500657_017820 | 3300053728 | Bacteria | 3359 |
| 1346 | Ga0500625_007369 | 3300053729 | Bacteria | 4780 |
| 1347 | Ga0500609_002995 | 3300053731 | Bacteria | 2402 |
| 1348 | Ga0500552_000509 | 3300053733 | Bacteria | 3597 |
| 1349 | Ga0500596_000713 | 3300053735 | Bacteria | 6500 |
| 1350 | Ga0500596_002113 | 3300053735 | Bacteria | 3960 |
| 1351 | Ga0500599_003652 | 3300053736 | Bacteria | 1886 |
| 1352 | Ga0501084_0000773 | 3300054114 | Bacteria | 24332 |
| 1353 | Ga0501084_0004881 | 3300054114 | Bacteria | 10952 |
| 1354 | Ga0501084_0016443 | 3300054114 | Bacteria | 6145 |
| 1355 | Ga0501084_0108206 | 3300054114 | Bacteria | 2335 |
| 1356 | Ga0501084_0163826 | 3300054114 | Bacteria | 1876 |
| 1357 | Ga0500661_000317 | 3300055283 | Bacteria | 8830 |
| 1358 | Ga0501082_0000965 | 3300060353 | Bacteria | 25410 |
| 1359 | Ga0501082_0007269 | 3300060353 | Bacteria | 9554 |
| 1360 | Ga0501082_0013892 | 3300060353 | Bacteria | 6923 |
| 1361 | Ga0501082_0081609 | 3300060353 | Bacteria | 2790 |
| 1362 | Ga0501082_0160668 | 3300060353 | Bacteria | 1952 |
| 1363 | Ga0501082_0223502 | 3300060353 | Bacteria | 1638 |
| 1364 | Ga0501082_0867418 | 3300060353 | Bacteria | 790 |
| 1365 | Ga0466962_0010405 | 3300061719 | Bacteria | 4471 |
| 1366 | Ga0530510_0018748 | 3300061734 | Bacteria | 4908 |
| 1367 | Ga0530510_0029015 | 3300061734 | Bacteria | 3969 |
| 1368 | Ga0530510_0105275 | 3300061734 | Bacteria | 2064 |
| 1369 | Ga0530510_0159248 | 3300061734 | Bacteria | 1669 |
| 1370 | Ga0530510_0244493 | 3300061734 | Bacteria | 1336 |
| 1371 | Ga0530510_0415839 | 3300061734 | Bacteria | 1015 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006846 | Ga0075430_100000460 | Ga0075430_10000046014 | 211 |
| 2 | 3300006847 | Ga0075431_100000618 | Ga0075431_10000061813 | 211 |
| 3 | 3300006880 | Ga0075429_100235466 | Ga0075429_1002354662 | 211 |
| 4 | 3300050507 | nmdc:mga05p37_6789_c1 | nmdc:mga05p37_6789_c1_2261_3016 | 211 |
| 5 | 3300050508 | nmdc:mga09592_178784_c1 | nmdc:mga09592_178784_c1_754_1509 | 211 |
| 6 | 3300050509 | nmdc:mga0qj67_1791_c1 | nmdc:mga0qj67_1791_c1_7182_7937 | 211 |
| 7 | 3300050510 | nmdc:mga06r32_42782_c1 | nmdc:mga06r32_42782_c1_493_1248 | 211 |
| 8 | 3300050509 | nmdc:mga0qj67_912746_c1 | nmdc:mga0qj67_912746_c1_34_681 | 213 |
| 9 | 3300006844 | Ga0075428_100096395 | Ga0075428_1000963954 | 215 |
| 10 | 3300009147 | Ga0114129_10092734 | Ga0114129_100927343 | 215 |
| 11 | 3300031249 | Ga0265339_10004010 | Ga0265339_100040108 | 224 |
| 12 | 3300031241 | Ga0265325_10001325 | Ga0265325_100013256 | 225 |
| 13 | 3300031595 | Ga0265313_10009642 | Ga0265313_100096425 | 225 |
| 14 | 3300046477 | Ga0495664_0006016 | Ga0495664_0006016_5133_5870 | 225 |
| 15 | 3300053077 | Ga0495601_0040237 | Ga0495601_0040237_1424_2161 | 225 |
| 16 | 3300049579 | Ga0501043_0506866 | Ga0501043_0506866_28_765 | 227 |
| 17 | 3300005340 | Ga0070689_100388345 | Ga0070689_1003883451 | 228 |
| 18 | 3300005341 | Ga0070691_10040873 | Ga0070691_100408732 | 228 |
| 19 | 3300005356 | Ga0070674_100451175 | Ga0070674_1004511752 | 228 |
| 20 | 3300005456 | Ga0070678_100057626 | Ga0070678_1000576263 | 228 |
| 21 | 3300005544 | Ga0070686_100251212 | Ga0070686_1002512121 | 228 |
| 22 | 3300005548 | Ga0070665_100273328 | Ga0070665_1002733283 | 228 |
| 23 | 3300009094 | Ga0111539_10052427 | Ga0111539_100524273 | 228 |
| 24 | 3300009553 | Ga0105249_10095847 | Ga0105249_100958473 | 228 |
| 25 | 3300013306 | Ga0163162_10279967 | Ga0163162_102799672 | 228 |
| 26 | 3300014968 | Ga0157379_10521856 | Ga0157379_105218561 | 228 |
| 27 | 3300025899 | Ga0207642_10115630 | Ga0207642_101156301 | 228 |
| 28 | 3300025907 | Ga0207645_10101658 | Ga0207645_101016582 | 228 |
| 29 | 3300025919 | Ga0207657_10285756 | Ga0207657_102857561 | 228 |
| 30 | 3300025933 | Ga0207706_10108562 | Ga0207706_101085622 | 228 |
| 31 | 3300025936 | Ga0207670_10498721 | Ga0207670_104987211 | 228 |
| 32 | 3300025937 | Ga0207669_10025941 | Ga0207669_100259414 | 228 |
| 33 | 3300025960 | Ga0207651_10286324 | Ga0207651_102863241 | 228 |
| 34 | 3300025961 | Ga0207712_10102342 | Ga0207712_101023421 | 228 |
| 35 | 3300026121 | Ga0207683_10505790 | Ga0207683_105057901 | 228 |
| 36 | 3300028379 | Ga0268266_10143830 | Ga0268266_101438302 | 228 |
| 37 | 3300028380 | Ga0268265_10588685 | Ga0268265_105886851 | 228 |
| 38 | 3300046474 | Ga0495605_0095641 | Ga0495605_0095641_540_1277 | 228 |
| 39 | 3300046684 | Ga0495669_0006671 | Ga0495669_0006671_1515_2252 | 228 |
| 40 | 3300046691 | Ga0495670_0163712 | Ga0495670_0163712_106_843 | 228 |
| 41 | 3300046694 | Ga0495649_0133514 | Ga0495649_0133514_306_1043 | 228 |
| 42 | 3300049568 | Ga0501031_0137365 | Ga0501031_0137365_367_1104 | 229 |
| 43 | 3300049743 | Ga0501081_0576480 | Ga0501081_0576480_89_826 | 229 |
| 44 | 3300005327 | Ga0070658_10109433 | Ga0070658_101094332 | 230 |
| 45 | 3300005365 | Ga0070688_100069711 | Ga0070688_1000697113 | 230 |
| 46 | 3300005367 | Ga0070667_100044451 | Ga0070667_1000444513 | 230 |
| 47 | 3300005548 | Ga0070665_100030276 | Ga0070665_1000302764 | 230 |
| 48 | 3300005614 | Ga0068856_100126813 | Ga0068856_1001268133 | 230 |
| 49 | 3300005617 | Ga0068859_100392746 | Ga0068859_1003927462 | 230 |
| 50 | 3300005843 | Ga0068860_100179282 | Ga0068860_1001792822 | 230 |
| 51 | 3300006931 | Ga0097620_100392713 | Ga0097620_1003927132 | 230 |
| 52 | 3300009101 | Ga0105247_10015353 | Ga0105247_100153532 | 230 |
| 53 | 3300009177 | Ga0105248_10199477 | Ga0105248_101994772 | 230 |
| 54 | 3300013297 | Ga0157378_10103182 | Ga0157378_101031823 | 230 |
| 55 | 3300013308 | Ga0157375_10000681 | Ga0157375_1000068110 | 230 |
| 56 | 3300014326 | Ga0157380_10086801 | Ga0157380_100868012 | 230 |
| 57 | 3300014968 | Ga0157379_10041047 | Ga0157379_100410476 | 230 |
| 58 | 3300014969 | Ga0157376_10014965 | Ga0157376_100149653 | 230 |
| 59 | 3300025900 | Ga0207710_10008551 | Ga0207710_100085514 | 230 |
| 60 | 3300025931 | Ga0207644_10205569 | Ga0207644_102055692 | 230 |
| 61 | 3300025936 | Ga0207670_10030483 | Ga0207670_100304833 | 230 |
| 62 | 3300025940 | Ga0207691_10232160 | Ga0207691_102321603 | 230 |
| 63 | 3300026078 | Ga0207702_10727702 | Ga0207702_107277021 | 230 |
| 64 | 3300028379 | Ga0268266_10022518 | Ga0268266_100225184 | 230 |
| 65 | 3300028381 | Ga0268264_10318191 | Ga0268264_103181912 | 230 |
| 66 | 3300048903 | Ga0496100_0002783 | Ga0496100_0002783_5217_5954 | 230 |
| 67 | 3300048904 | Ga0496101_0001858 | Ga0496101_0001858_1278_2015 | 230 |
| 68 | 3300048907 | Ga0496104_0011555 | Ga0496104_0011555_3850_4587 | 230 |
| 69 | 3300048908 | Ga0496105_0001630 | Ga0496105_0001630_9215_9952 | 230 |
| 70 | 3300048910 | Ga0496107_0013617 | Ga0496107_0013617_1917_2654 | 230 |
| 71 | 3300048911 | Ga0496108_0060594 | Ga0496108_0060594_641_1378 | 230 |
| 72 | 3300048912 | Ga0496109_0143959 | Ga0496109_0143959_851_1588 | 230 |
| 73 | 3300048917 | Ga0496114_0013575 | Ga0496114_0013575_2700_3437 | 230 |
| 74 | 3300048918 | Ga0496115_0036328 | Ga0496115_0036328_2550_3287 | 230 |
| 75 | iso_pu_bacteria | 2874590934 | 2874596253 | 233 |
| 76 | iso_pu_bacteria | 2874645413 | 2874650240 | 233 |
| 77 | iso_pu_bacteria | 2876771140 | 2876776718 | 233 |
| 78 | iso_pu_bacteria | 2876818435 | 2876824508 | 233 |
| 79 | iso_pu_bacteria | 2879074833 | 2879080855 | 233 |
| 80 | iso_pu_bacteria | 2879127579 | 2879133700 | 233 |
| 81 | iso_pu_bacteria | 2879142872 | 2879148202 | 233 |
| 82 | iso_pu_bacteria | 2966598605 | 2966603532 | 233 |
| 83 | 3300010375 | Ga0105239_10219870 | Ga0105239_102198703 | 234 |
| 84 | 3300031251 | Ga0265327_10001131 | Ga0265327_1000113113 | 234 |
| 85 | 3300031665 | Ga0316575_10008085 | Ga0316575_100080854 | 234 |
| 86 | 3300035398 | Ga0316574_0035235 | Ga0316574_0035235_1560_2300 | 234 |
| 87 | 3300037466 | Ga0395898_0479053 | Ga0395898_0479053_184_924 | 234 |
| 88 | 3300045051 | Ga0451576_0336055 | Ga0451576_0336055_276_1016 | 234 |
| 89 | 3300036647 | Ga0316582_0245184 | Ga0316582_0245184_13_726 | 235 |
| 90 | 3300046507 | Ga0495606_0075148 | Ga0495606_0075148_351_1058 | 235 |
| 91 | 3300049575 | Ga0501039_0145068 | Ga0501039_0145068_11_718 | 235 |
| 92 | 3300060353 | Ga0501082_0867418 | Ga0501082_0867418_19_729 | 235 |
| 93 | 3300013297 | Ga0157378_10163265 | Ga0157378_101632652 | 236 |
| 94 | 3300032005 | Ga0307411_10023083 | Ga0307411_100230833 | 236 |
| 95 | iso_pu_bacteria | 2616644941 | 2616899668 | 236 |
| 96 | iso_pu_bacteria | 2643221548 | 2643759516 | 236 |
| 97 | iso_pu_bacteria | 2870721527 | 2870730181 | 236 |
| 98 | iso_pu_bacteria | 8047710418 | 8047718241 | 236 |
| 99 | 3300044694 | Ga0466963_0256953 | Ga0466963_0256953_112_849 | 237 |
| 100 | 3300046648 | Ga0495611_0107006 | Ga0495611_0107006_279_992 | 237 |
| 101 | 3300025928 | Ga0207700_10006113 | Ga0207700_100061135 | 238 |
| 102 | 3300046679 | Ga0495623_0005023 | Ga0495623_0005023_7783_8499 | 238 |
| 103 | 3300049581 | Ga0501047_0029142 | Ga0501047_0029142_1184_1921 | 238 |
| 104 | 3300049582 | Ga0501048_0391153 | Ga0501048_0391153_258_980 | 238 |
| 105 | 3300049589 | Ga0501073_0042293 | Ga0501073_0042293_1512_2249 | 238 |
| 106 | 3300049590 | Ga0501074_0007065 | Ga0501074_0007065_4169_4906 | 238 |
| 107 | 3300049742 | Ga0501080_0013737 | Ga0501080_0013737_3364_4101 | 238 |
| 108 | 3300049823 | Ga0501044_0049072 | Ga0501044_0049072_1014_1751 | 238 |
| 109 | 3300049591 | Ga0501075_0171042 | Ga0501075_0171042_378_1196 | 240 |
| 110 | iso_pu_bacteria | 8016511872 | 8016522187 | 240 |
| 111 | iso_pu_bacteria | 2507262055 | 2507508459 | 241 |
| 112 | iso_pu_bacteria | 2508501009 | 2508542526 | 241 |
| 113 | iso_pu_bacteria | 2508501042 | 2508691701 | 241 |
| 114 | iso_pu_bacteria | 2508501128 | 2509150576 | 241 |
| 115 | iso_pu_bacteria | 2511231028 | 2511393925 | 241 |
| 116 | iso_pu_bacteria | 2513237092 | 2513625503 | 241 |
| 117 | iso_pu_bacteria | 2513237094 | 2513644500 | 241 |
| 118 | iso_pu_bacteria | 2513237095 | 2513645718 | 241 |
| 119 | iso_pu_bacteria | 2513237096 | 2513658047 | 241 |
| 120 | iso_pu_bacteria | 2513237098 | 2513674916 | 241 |
| 121 | iso_pu_bacteria | 2513237101 | 2513692688 | 241 |
| 122 | iso_pu_bacteria | 2513237102 | 2513703765 | 241 |
| 123 | iso_pu_bacteria | 2513237104 | 2513717174 | 241 |
| 124 | iso_pu_bacteria | 2513237137 | 2513855751 | 241 |
| 125 | iso_pu_bacteria | 2513237139 | 2513872893 | 241 |
| 126 | iso_pu_bacteria | 2513237141 | 2513894008 | 241 |
| 127 | iso_pu_bacteria | 2513237145 | 2513919859 | 241 |
| 128 | iso_pu_bacteria | 2513237161 | 2514013653 | 241 |
| 129 | iso_pu_bacteria | 2515154112 | 2515627051 | 241 |
| 130 | iso_pu_bacteria | 2517093001 | 2517107452 | 241 |
| 131 | iso_pu_bacteria | 2517572143 | 2517892289 | 241 |
| 132 | iso_pu_bacteria | 2524023205 | 2524437471 | 241 |
| 133 | iso_pu_bacteria | 2524023210 | 2524470616 | 241 |
| 134 | iso_pu_bacteria | 2524023228 | 2524540276 | 241 |
| 135 | iso_pu_bacteria | 2528768022 | 2528849945 | 241 |
| 136 | iso_pu_bacteria | 2617270735 | 2617347391 | 241 |
| 137 | iso_pu_bacteria | 2617270741 | 2617375642 | 241 |
| 138 | iso_pu_bacteria | 2667528175 | 2671120463 | 241 |
| 139 | iso_pu_bacteria | 2721755755 | 2723844933 | 241 |
| 140 | iso_pu_bacteria | 2728368998 | 2728747356 | 241 |
| 141 | iso_pu_bacteria | 2744054633 | 2745076537 | 241 |
| 142 | iso_pu_bacteria | 2791355196 | 2793065386 | 241 |
| 143 | iso_pu_bacteria | 2791355197 | 2793072368 | 241 |
| 144 | iso_pu_bacteria | 2791355199 | 2793082195 | 241 |
| 145 | iso_pu_bacteria | 2802429603 | 2805915209 | 241 |
| 146 | iso_pu_bacteria | 2816332527 | 2818238761 | 241 |
| 147 | iso_pu_bacteria | 2824600985 | 2824608907 | 241 |
| 148 | iso_pu_bacteria | 2824609381 | 2824617682 | 241 |
| 149 | iso_pu_bacteria | 2824617872 | 2824626135 | 241 |
| 150 | iso_pu_bacteria | 2824626560 | 2824635068 | 241 |
| 151 | iso_pu_bacteria | 2824635225 | 2824643805 | 241 |
| 152 | iso_pu_bacteria | 2824644064 | 2824652496 | 241 |
| 153 | iso_pu_bacteria | 2824653114 | 2824661116 | 241 |
| 154 | iso_pu_bacteria | 2824661429 | 2824670954 | 241 |
| 155 | iso_pu_bacteria | 2824671348 | 2824678769 | 241 |
| 156 | iso_pu_bacteria | 2824679649 | 2824686733 | 241 |
| 157 | iso_pu_bacteria | 2824687955 | 2824695238 | 241 |
| 158 | iso_pu_bacteria | 2824696289 | 2824703548 | 241 |
| 159 | iso_pu_bacteria | 2824704595 | 2824712487 | 241 |
| 160 | iso_pu_bacteria | 2824714736 | 2824722985 | 241 |
| 161 | iso_pu_bacteria | 2824723954 | 2824731793 | 241 |
| 162 | iso_pu_bacteria | 2824732956 | 2824739440 | 241 |
| 163 | iso_pu_bacteria | 2824746037 | 2824753444 | 241 |
| 164 | iso_pu_bacteria | 2824753945 | 2824763252 | 241 |
| 165 | iso_pu_bacteria | 2824763712 | 2824769964 | 241 |
| 166 | iso_pu_bacteria | 2824773399 | 2824781261 | 241 |
| 167 | iso_pu_bacteria | 2838122688 | 2838123616 | 241 |
| 168 | iso_pu_bacteria | 2841941048 | 2841946740 | 241 |
| 169 | iso_pu_bacteria | 2841949485 | 2841949715 | 241 |
| 170 | iso_pu_bacteria | 2841957949 | 2841958788 | 241 |
| 171 | iso_pu_bacteria | 2841966195 | 2841971779 | 241 |
| 172 | iso_pu_bacteria | 2841974524 | 2841974876 | 241 |
| 173 | iso_pu_bacteria | 2841983080 | 2841983561 | 241 |
| 174 | iso_pu_bacteria | 2842038055 | 2842038935 | 241 |
| 175 | iso_pu_bacteria | 2842045827 | 2842048119 | 241 |
| 176 | iso_pu_bacteria | 2844315083 | 2844319202 | 241 |
| 177 | iso_pu_bacteria | 2847930680 | 2847936345 | 241 |
| 178 | iso_pu_bacteria | 2847939898 | 2847946692 | 241 |
| 179 | iso_pu_bacteria | 2849076700 | 2849079187 | 241 |
| 180 | iso_pu_bacteria | 2857509624 | 2857514181 | 241 |
| 181 | iso_pu_bacteria | 2874590934 | 2874598180 | 241 |
| 182 | iso_pu_bacteria | 2874604998 | 2874605349 | 241 |
| 183 | iso_pu_bacteria | 2874612657 | 2874615054 | 241 |
| 184 | iso_pu_bacteria | 2874620515 | 2874627709 | 241 |
| 185 | iso_pu_bacteria | 2874628541 | 2874631979 | 241 |
| 186 | iso_pu_bacteria | 2874645413 | 2874652764 | 241 |
| 187 | iso_pu_bacteria | 2876761206 | 2876764637 | 241 |
| 188 | iso_pu_bacteria | 2876771140 | 2876778342 | 241 |
| 189 | iso_pu_bacteria | 2876808645 | 2876811295 | 241 |
| 190 | iso_pu_bacteria | 2876818435 | 2876825789 | 241 |
| 191 | iso_pu_bacteria | 2879074833 | 2879082136 | 241 |
| 192 | iso_pu_bacteria | 2879083081 | 2879090579 | 241 |
| 193 | iso_pu_bacteria | 2879099564 | 2879105781 | 241 |
| 194 | iso_pu_bacteria | 2879110137 | 2879111330 | 241 |
| 195 | iso_pu_bacteria | 2879127579 | 2879135283 | 241 |
| 196 | iso_pu_bacteria | 2879142872 | 2879150492 | 241 |
| 197 | iso_pu_bacteria | 2881364244 | 2881368707 | 241 |
| 198 | iso_pu_bacteria | 2881665667 | 2881673548 | 241 |
| 199 | iso_pu_bacteria | 2885366525 | 2885373029 | 241 |
| 200 | iso_pu_bacteria | 2885374607 | 2885379529 | 241 |
| 201 | iso_pu_bacteria | 2885383462 | 2885388351 | 241 |
| 202 | iso_pu_bacteria | 2885409591 | 2885411377 | 241 |
| 203 | iso_pu_bacteria | 2888378607 | 2888384193 | 241 |
| 204 | iso_pu_bacteria | 2888388044 | 2888393681 | 241 |
| 205 | iso_pu_bacteria | 2888419890 | 2888424661 | 241 |
| 206 | iso_pu_bacteria | 2889033259 | 2889039700 | 241 |
| 207 | iso_pu_bacteria | 2903727486 | 2903731044 | 241 |
| 208 | iso_pu_bacteria | 2903748898 | 2903757523 | 241 |
| 209 | iso_pu_bacteria | 2903768456 | 2903777912 | 241 |
| 210 | iso_pu_bacteria | 2904666416 | 2904672971 | 241 |
| 211 | iso_pu_bacteria | 2904690495 | 2904694575 | 241 |
| 212 | iso_pu_bacteria | 2904699407 | 2904702461 | 241 |
| 213 | iso_pu_bacteria | 2904711408 | 2904714789 | 241 |
| 214 | iso_pu_bacteria | 2906602504 | 2906608175 | 241 |
| 215 | iso_pu_bacteria | 2906610324 | 2906618737 | 241 |
| 216 | iso_pu_bacteria | 2906626472 | 2906626936 | 241 |
| 217 | iso_pu_bacteria | 2906635258 | 2906637433 | 241 |
| 218 | iso_pu_bacteria | 2906643746 | 2906649205 | 241 |
| 219 | iso_pu_bacteria | 2906660503 | 2906666264 | 241 |
| 220 | iso_pu_bacteria | 2908739725 | 2908742577 | 241 |
| 221 | iso_pu_bacteria | 2908756301 | 2908760130 | 241 |
| 222 | iso_pu_bacteria | 2908775508 | 2908780309 | 241 |
| 223 | iso_pu_bacteria | 2922361189 | 2922365492 | 241 |
| 224 | iso_pu_bacteria | 2922368715 | 2922374534 | 241 |
| 225 | iso_pu_bacteria | 2922386360 | 2922391115 | 241 |
| 226 | iso_pu_bacteria | 2922393267 | 2922400670 | 241 |
| 227 | iso_pu_bacteria | 2922425934 | 2922430398 | 241 |
| 228 | iso_pu_bacteria | 2929615660 | 2929618200 | 241 |
| 229 | iso_pu_bacteria | 2929624759 | 2929632388 | 241 |
| 230 | iso_pu_bacteria | 2932784394 | 2932790494 | 241 |
| 231 | iso_pu_bacteria | 2932794094 | 2932799828 | 241 |
| 232 | iso_pu_bacteria | 2932801729 | 2932802669 | 241 |
| 233 | iso_pu_bacteria | 2932809354 | 2932810915 | 241 |
| 234 | iso_pu_bacteria | 2932818245 | 2932823755 | 241 |
| 235 | iso_pu_bacteria | 2932828146 | 2932830125 | 241 |
| 236 | iso_pu_bacteria | 2933577622 | 2933580128 | 241 |
| 237 | iso_pu_bacteria | 2935608549 | 2935609003 | 241 |
| 238 | iso_pu_bacteria | 2935616580 | 2935622649 | 241 |
| 239 | iso_pu_bacteria | 2935630451 | 2935631561 | 241 |
| 240 | iso_pu_bacteria | 2935638405 | 2935642551 | 241 |
| 241 | iso_pu_bacteria | 2935648319 | 2935653290 | 241 |
| 242 | iso_pu_bacteria | 2935656913 | 2935660239 | 241 |
| 243 | iso_pu_bacteria | 2935665750 | 2935668145 | 241 |
| 244 | iso_pu_bacteria | 2935675223 | 2935676179 | 241 |
| 245 | iso_pu_bacteria | 2935684952 | 2935686161 | 241 |
| 246 | iso_pu_bacteria | 2935694250 | 2935701212 | 241 |
| 247 | iso_pu_bacteria | 2935703347 | 2935706005 | 241 |
| 248 | iso_pu_bacteria | 2935713505 | 2935714713 | 241 |
| 249 | iso_pu_bacteria | 2935722832 | 2935725332 | 241 |
| 250 | iso_pu_bacteria | 2935732158 | 2935732308 | 241 |
| 251 | iso_pu_bacteria | 2935741537 | 2935741687 | 241 |
| 252 | iso_pu_bacteria | 2935750917 | 2935752126 | 241 |
| 253 | iso_pu_bacteria | 2935760218 | 2935766475 | 241 |
| 254 | iso_pu_bacteria | 2935769743 | 2935771921 | 241 |
| 255 | iso_pu_bacteria | 2935777560 | 2935778647 | 241 |
| 256 | iso_pu_bacteria | 2935785616 | 2935788967 | 241 |
| 257 | iso_pu_bacteria | 2935793552 | 2935795232 | 241 |
| 258 | iso_pu_bacteria | 2935801545 | 2935803004 | 241 |
| 259 | iso_pu_bacteria | 2935810662 | 2935814321 | 241 |
| 260 | iso_pu_bacteria | 2935819856 | 2935822163 | 241 |
| 261 | iso_pu_bacteria | 2935827899 | 2935831458 | 241 |
| 262 | iso_pu_bacteria | 2935837841 | 2935838318 | 241 |
| 263 | iso_pu_bacteria | 2935847175 | 2935847745 | 241 |
| 264 | iso_pu_bacteria | 2935855204 | 2935860898 | 241 |
| 265 | iso_pu_bacteria | 2935864058 | 2935869765 | 241 |
| 266 | iso_pu_bacteria | 2935873716 | 2935878816 | 241 |
| 267 | iso_pu_bacteria | 2935883170 | 2935886955 | 241 |
| 268 | iso_pu_bacteria | 2935908558 | 2935908983 | 241 |
| 269 | iso_pu_bacteria | 2935916978 | 2935919701 | 241 |
| 270 | iso_pu_bacteria | 2935926038 | 2935926443 | 241 |
| 271 | iso_pu_bacteria | 2935934488 | 2935934893 | 241 |
| 272 | iso_pu_bacteria | 2935942939 | 2935943343 | 241 |
| 273 | iso_pu_bacteria | 2935951376 | 2935951781 | 241 |
| 274 | iso_pu_bacteria | 2935959822 | 2935960534 | 241 |
| 275 | iso_pu_bacteria | 2935967501 | 2935967906 | 241 |
| 276 | iso_pu_bacteria | 2935975950 | 2935978533 | 241 |
| 277 | iso_pu_bacteria | 2935984226 | 2935991247 | 241 |
| 278 | iso_pu_bacteria | 2935992306 | 2935994788 | 241 |
| 279 | iso_pu_bacteria | 2936002035 | 2936003430 | 241 |
| 280 | iso_pu_bacteria | 2936011229 | 2936016160 | 241 |
| 281 | iso_pu_bacteria | 2936019824 | 2936024793 | 241 |
| 282 | iso_pu_bacteria | 2936028420 | 2936032041 | 241 |
| 283 | iso_pu_bacteria | 2936037263 | 2936039877 | 241 |
| 284 | iso_pu_bacteria | 2936046547 | 2936049902 | 241 |
| 285 | iso_pu_bacteria | 2936055302 | 2936060854 | 241 |
| 286 | iso_pu_bacteria | 2940556831 | 2940557071 | 241 |
| 287 | iso_pu_bacteria | 2941507105 | 2941511355 | 241 |
| 288 | iso_pu_bacteria | 2941515067 | 2941519056 | 241 |
| 289 | iso_pu_bacteria | 2941523033 | 2941526364 | 241 |
| 290 | iso_pu_bacteria | 2941531003 | 2941532946 | 241 |
| 291 | iso_pu_bacteria | 2941538514 | 2941539014 | 241 |
| 292 | iso_pu_bacteria | 3005474847 | 3005480316 | 241 |
| 293 | iso_pu_bacteria | 3005483717 | 3005484442 | 241 |
| 294 | iso_pu_bacteria | 3005506211 | 3005510451 | 241 |
| 295 | iso_pu_bacteria | 3005587118 | 3005587912 | 241 |
| 296 | iso_pu_bacteria | 3005594810 | 3005599367 | 241 |
| 297 | iso_pu_bacteria | 3005710791 | 3005715030 | 241 |
| 298 | iso_pu_bacteria | 3005718088 | 3005722444 | 241 |
| 299 | iso_pu_bacteria | 8006926726 | 8006931850 | 241 |
| 300 | iso_pu_bacteria | 8006933436 | 8006940564 | 241 |
| 301 | iso_pu_bacteria | 8006964411 | 8006967186 | 241 |
| 302 | iso_pu_bacteria | 8006973647 | 8006980252 | 241 |
| 303 | iso_pu_bacteria | 8006984368 | 8006986535 | 241 |
| 304 | iso_pu_bacteria | 8006994254 | 8006995880 | 241 |
| 305 | iso_pu_bacteria | 8016522445 | 8016529497 | 241 |
| 306 | iso_pu_bacteria | 8016530956 | 8016534707 | 241 |
| 307 | iso_pu_bacteria | 8016539877 | 8016547924 | 241 |
| 308 | iso_pu_bacteria | 8016548790 | 8016554206 | 241 |
| 309 | iso_pu_bacteria | 8016557553 | 8016562581 | 241 |
| 310 | iso_pu_bacteria | 8016566248 | 8016573057 | 241 |
| 311 | iso_pu_bacteria | 8016575299 | 8016577203 | 241 |
| 312 | iso_pu_bacteria | 8016583857 | 8016591607 | 241 |
| 313 | iso_pu_bacteria | 8016595262 | 8016600369 | 241 |
| 314 | iso_pu_bacteria | 8016603502 | 8016610369 | 241 |
| 315 | iso_pu_bacteria | 8016613128 | 8016614562 | 241 |
| 316 | iso_pu_bacteria | 8016622563 | 8016626438 | 241 |
| 317 | iso_pu_bacteria | 8016630954 | 8016640192 | 241 |
| 318 | iso_pu_bacteria | 8017057580 | 8017063483 | 241 |
| 319 | iso_pu_bacteria | 8019530166 | 8019534474 | 241 |
| 320 | iso_pu_bacteria | 8019538911 | 8019544998 | 241 |
| 321 | iso_pu_bacteria | 8019547302 | 8019553530 | 241 |
| 322 | iso_pu_bacteria | 8019555841 | 8019556629 | 241 |
| 323 | iso_pu_bacteria | 8019565922 | 8019568680 | 241 |
| 324 | iso_pu_bacteria | 8019576017 | 8019582802 | 241 |
| 325 | iso_pu_bacteria | 8019586578 | 8019590592 | 241 |
| 326 | iso_pu_bacteria | 8019597564 | 8019600760 | 241 |
| 327 | iso_pu_bacteria | 8019608314 | 8019617792 | 241 |
| 328 | iso_pu_bacteria | 8019619141 | 8019628312 | 241 |
| 329 | iso_pu_bacteria | 8019629233 | 8019634316 | 241 |
| 330 | iso_pu_bacteria | 8019648815 | 8019658538 | 241 |
| 331 | iso_pu_bacteria | 8019659431 | 8019662190 | 241 |
| 332 | iso_pu_bacteria | 8019668869 | 8019671705 | 241 |
| 333 | iso_pu_bacteria | 8019678201 | 8019684390 | 241 |
| 334 | iso_pu_bacteria | 8019687851 | 8019690203 | 241 |
| 335 | iso_pu_bacteria | 8055742211 | 8055746211 | 241 |
| 336 | iso_pu_bacteria | 8056673599 | 8056673720 | 241 |
| 337 | iso_pu_bacteria | 8056681323 | 8056686752 | 241 |
| 338 | iso_pu_bacteria | 8056689827 | 8056691396 | 241 |
| 339 | iso_pu_bacteria | 8056967851 | 8056968160 | 241 |
| 340 | 3300046529 | Ga0495652_0393937 | Ga0495652_0393937_132_863 | 242 |
| 341 | 3300044712 | Ga0453684_0156891 | Ga0453684_0156891_61_798 | 243 |
| 342 | 3300014745 | Ga0157377_10116747 | Ga0157377_101167472 | 244 |
| 343 | 3300049589 | Ga0501073_0076392 | Ga0501073_0076392_1154_1891 | 244 |
| 344 | 3300060353 | Ga0501082_0007269 | Ga0501082_0007269_4263_5000 | 244 |
| 345 | 3300001989 | JGI24739J22299_10011915 | JGI24739J22299_100119153 | 245 |
| 346 | 3300003203 | JGI25406J46586_10000152 | JGI25406J46586_100001524 | 245 |
| 347 | 3300003203 | JGI25406J46586_10001897 | JGI25406J46586_100018973 | 245 |
| 348 | 3300003215 | JGI25153J46596_10001484 | JGI25153J46596_100014846 | 245 |
| 349 | 3300003215 | JGI25153J46596_10007366 | JGI25153J46596_100073663 | 245 |
| 350 | 3300003215 | JGI25153J46596_10010783 | JGI25153J46596_100107831 | 245 |
| 351 | 3300003215 | JGI25153J46596_10010984 | JGI25153J46596_100109841 | 245 |
| 352 | 3300003354 | JGI25160J50197_1003224 | JGI25160J50197_10032248 | 245 |
| 353 | 3300003354 | JGI25160J50197_1020832 | JGI25160J50197_10208321 | 245 |
| 354 | 3300003659 | JGI25404J52841_10011149 | JGI25404J52841_100111493 | 245 |
| 355 | 3300003659 | JGI25404J52841_10012715 | JGI25404J52841_100127153 | 245 |
| 356 | 3300003794 | Ga0055531_10027686 | Ga0055531_100276863 | 245 |
| 357 | 3300005262 | Ga0065165_1006665 | Ga0065165_10066656 | 245 |
| 358 | 3300005262 | Ga0065165_1009480 | Ga0065165_10094804 | 245 |
| 359 | 3300005262 | Ga0065165_1016313 | Ga0065165_10163133 | 245 |
| 360 | 3300005262 | Ga0065165_1044199 | Ga0065165_10441991 | 245 |
| 361 | 3300005327 | Ga0070658_10085134 | Ga0070658_100851342 | 245 |
| 362 | 3300005328 | Ga0070676_10045474 | Ga0070676_100454743 | 245 |
| 363 | 3300005329 | Ga0070683_100009176 | Ga0070683_1000091769 | 245 |
| 364 | 3300005329 | Ga0070683_100092374 | Ga0070683_1000923743 | 245 |
| 365 | 3300005329 | Ga0070683_100421074 | Ga0070683_1004210742 | 245 |
| 366 | 3300005331 | Ga0070670_100140336 | Ga0070670_1001403362 | 245 |
| 367 | 3300005331 | Ga0070670_100444375 | Ga0070670_1004443751 | 245 |
| 368 | 3300005334 | Ga0068869_100015964 | Ga0068869_1000159645 | 245 |
| 369 | 3300005334 | Ga0068869_100099803 | Ga0068869_1000998032 | 245 |
| 370 | 3300005336 | Ga0070680_100010915 | Ga0070680_1000109152 | 245 |
| 371 | 3300005336 | Ga0070680_100016559 | Ga0070680_1000165594 | 245 |
| 372 | 3300005336 | Ga0070680_100045774 | Ga0070680_1000457742 | 245 |
| 373 | 3300005336 | Ga0070680_100058822 | Ga0070680_1000588221 | 245 |
| 374 | 3300005336 | Ga0070680_100094910 | Ga0070680_1000949102 | 245 |
| 375 | 3300005336 | Ga0070680_100289007 | Ga0070680_1002890072 | 245 |
| 376 | 3300005337 | Ga0070682_100015561 | Ga0070682_1000155614 | 245 |
| 377 | 3300005337 | Ga0070682_100136919 | Ga0070682_1001369191 | 245 |
| 378 | 3300005338 | Ga0068868_100030944 | Ga0068868_1000309443 | 245 |
| 379 | 3300005338 | Ga0068868_100063031 | Ga0068868_1000630313 | 245 |
| 380 | 3300005338 | Ga0068868_100309414 | Ga0068868_1003094142 | 245 |
| 381 | 3300005338 | Ga0068868_100329121 | Ga0068868_1003291212 | 245 |
| 382 | 3300005338 | Ga0068868_100599677 | Ga0068868_1005996771 | 245 |
| 383 | 3300005339 | Ga0070660_100015177 | Ga0070660_1000151775 | 245 |
| 384 | 3300005339 | Ga0070660_100636143 | Ga0070660_1006361431 | 245 |
| 385 | 3300005344 | Ga0070661_100068091 | Ga0070661_1000680913 | 245 |
| 386 | 3300005344 | Ga0070661_100243529 | Ga0070661_1002435292 | 245 |
| 387 | 3300005344 | Ga0070661_100519315 | Ga0070661_1005193152 | 245 |
| 388 | 3300005347 | Ga0070668_100062782 | Ga0070668_1000627823 | 245 |
| 389 | 3300005347 | Ga0070668_100283512 | Ga0070668_1002835122 | 245 |
| 390 | 3300005347 | Ga0070668_100361828 | Ga0070668_1003618282 | 245 |
| 391 | 3300005347 | Ga0070668_100635831 | Ga0070668_1006358311 | 245 |
| 392 | 3300005347 | Ga0070668_100785394 | Ga0070668_1007853941 | 245 |
| 393 | 3300005353 | Ga0070669_100138429 | Ga0070669_1001384292 | 245 |
| 394 | 3300005353 | Ga0070669_100187901 | Ga0070669_1001879012 | 245 |
| 395 | 3300005354 | Ga0070675_100153835 | Ga0070675_1001538352 | 245 |
| 396 | 3300005354 | Ga0070675_100681844 | Ga0070675_1006818441 | 245 |
| 397 | 3300005355 | Ga0070671_100055683 | Ga0070671_1000556833 | 245 |
| 398 | 3300005355 | Ga0070671_100221809 | Ga0070671_1002218091 | 245 |
| 399 | 3300005365 | Ga0070688_100023990 | Ga0070688_1000239902 | 245 |
| 400 | 3300005365 | Ga0070688_100219130 | Ga0070688_1002191302 | 245 |
| 401 | 3300005365 | Ga0070688_100413870 | Ga0070688_1004138702 | 245 |
| 402 | 3300005366 | Ga0070659_100448068 | Ga0070659_1004480681 | 245 |
| 403 | 3300005367 | Ga0070667_100192490 | Ga0070667_1001924901 | 245 |
| 404 | 3300005434 | Ga0070709_10000348 | Ga0070709_1000034821 | 245 |
| 405 | 3300005434 | Ga0070709_10389736 | Ga0070709_103897361 | 245 |
| 406 | 3300005434 | Ga0070709_10491369 | Ga0070709_104913691 | 245 |
| 407 | 3300005435 | Ga0070714_100185256 | Ga0070714_1001852563 | 245 |
| 408 | 3300005435 | Ga0070714_100372649 | Ga0070714_1003726492 | 245 |
| 409 | 3300005436 | Ga0070713_100030721 | Ga0070713_1000307214 | 245 |
| 410 | 3300005436 | Ga0070713_100131727 | Ga0070713_1001317272 | 245 |
| 411 | 3300005436 | Ga0070713_100159978 | Ga0070713_1001599782 | 245 |
| 412 | 3300005437 | Ga0070710_10001018 | Ga0070710_100010183 | 245 |
| 413 | 3300005437 | Ga0070710_10025298 | Ga0070710_100252983 | 245 |
| 414 | 3300005438 | Ga0070701_10001976 | Ga0070701_100019766 | 245 |
| 415 | 3300005439 | Ga0070711_100003777 | Ga0070711_1000037775 | 245 |
| 416 | 3300005439 | Ga0070711_100017214 | Ga0070711_1000172144 | 245 |
| 417 | 3300005439 | Ga0070711_100017253 | Ga0070711_1000172533 | 245 |
| 418 | 3300005439 | Ga0070711_100017385 | Ga0070711_1000173854 | 245 |
| 419 | 3300005439 | Ga0070711_100035090 | Ga0070711_1000350902 | 245 |
| 420 | 3300005440 | Ga0070705_100000184 | Ga0070705_10000018419 | 245 |
| 421 | 3300005440 | Ga0070705_100075838 | Ga0070705_1000758383 | 245 |
| 422 | 3300005440 | Ga0070705_100144563 | Ga0070705_1001445632 | 245 |
| 423 | 3300005441 | Ga0070700_100020538 | Ga0070700_1000205386 | 245 |
| 424 | 3300005441 | Ga0070700_100170257 | Ga0070700_1001702572 | 245 |
| 425 | 3300005441 | Ga0070700_100343007 | Ga0070700_1003430071 | 245 |
| 426 | 3300005444 | Ga0070694_100001319 | Ga0070694_1000013194 | 245 |
| 427 | 3300005444 | Ga0070694_100072822 | Ga0070694_1000728222 | 245 |
| 428 | 3300005445 | Ga0070708_100164554 | Ga0070708_1001645542 | 245 |
| 429 | 3300005455 | Ga0070663_100004200 | Ga0070663_10000420010 | 245 |
| 430 | 3300005455 | Ga0070663_100033806 | Ga0070663_1000338062 | 245 |
| 431 | 3300005455 | Ga0070663_100075413 | Ga0070663_1000754132 | 245 |
| 432 | 3300005455 | Ga0070663_100089460 | Ga0070663_1000894602 | 245 |
| 433 | 3300005455 | Ga0070663_100124014 | Ga0070663_1001240142 | 245 |
| 434 | 3300005455 | Ga0070663_100679846 | Ga0070663_1006798461 | 245 |
| 435 | 3300005456 | Ga0070678_100074209 | Ga0070678_1000742093 | 245 |
| 436 | 3300005456 | Ga0070678_100184789 | Ga0070678_1001847892 | 245 |
| 437 | 3300005456 | Ga0070678_100236001 | Ga0070678_1002360012 | 245 |
| 438 | 3300005456 | Ga0070678_100351573 | Ga0070678_1003515732 | 245 |
| 439 | 3300005457 | Ga0070662_100407110 | Ga0070662_1004071102 | 245 |
| 440 | 3300005458 | Ga0070681_10018832 | Ga0070681_100188325 | 245 |
| 441 | 3300005458 | Ga0070681_10032485 | Ga0070681_100324856 | 245 |
| 442 | 3300005458 | Ga0070681_10040909 | Ga0070681_100409094 | 245 |
| 443 | 3300005458 | Ga0070681_10072055 | Ga0070681_100720553 | 245 |
| 444 | 3300005458 | Ga0070681_10171363 | Ga0070681_101713631 | 245 |
| 445 | 3300005467 | Ga0070706_100439610 | Ga0070706_1004396101 | 245 |
| 446 | 3300005471 | Ga0070698_100110518 | Ga0070698_1001105182 | 245 |
| 447 | 3300005518 | Ga0070699_100006925 | Ga0070699_1000069258 | 245 |
| 448 | 3300005530 | Ga0070679_100070394 | Ga0070679_1000703942 | 245 |
| 449 | 3300005530 | Ga0070679_100096351 | Ga0070679_1000963512 | 245 |
| 450 | 3300005530 | Ga0070679_100101490 | Ga0070679_1001014903 | 245 |
| 451 | 3300005530 | Ga0070679_100135666 | Ga0070679_1001356662 | 245 |
| 452 | 3300005530 | Ga0070679_100212367 | Ga0070679_1002123672 | 245 |
| 453 | 3300005530 | Ga0070679_100392242 | Ga0070679_1003922422 | 245 |
| 454 | 3300005535 | Ga0070684_100000716 | Ga0070684_10000071611 | 245 |
| 455 | 3300005535 | Ga0070684_100013944 | Ga0070684_1000139444 | 245 |
| 456 | 3300005536 | Ga0070697_100004908 | Ga0070697_1000049089 | 245 |
| 457 | 3300005536 | Ga0070697_100021627 | Ga0070697_1000216274 | 245 |
| 458 | 3300005539 | Ga0068853_100037777 | Ga0068853_1000377772 | 245 |
| 459 | 3300005539 | Ga0068853_100303436 | Ga0068853_1003034362 | 245 |
| 460 | 3300005539 | Ga0068853_100332698 | Ga0068853_1003326982 | 245 |
| 461 | 3300005539 | Ga0068853_100420193 | Ga0068853_1004201931 | 245 |
| 462 | 3300005545 | Ga0070695_100000587 | Ga0070695_10000058712 | 245 |
| 463 | 3300005546 | Ga0070696_100001650 | Ga0070696_10000165014 | 245 |
| 464 | 3300005546 | Ga0070696_100110800 | Ga0070696_1001108003 | 245 |
| 465 | 3300005547 | Ga0070693_100133101 | Ga0070693_1001331011 | 245 |
| 466 | 3300005548 | Ga0070665_100055908 | Ga0070665_1000559084 | 245 |
| 467 | 3300005548 | Ga0070665_100062937 | Ga0070665_1000629374 | 245 |
| 468 | 3300005548 | Ga0070665_100075430 | Ga0070665_1000754302 | 245 |
| 469 | 3300005548 | Ga0070665_100148070 | Ga0070665_1001480702 | 245 |
| 470 | 3300005548 | Ga0070665_100371790 | Ga0070665_1003717901 | 245 |
| 471 | 3300005549 | Ga0070704_100000206 | Ga0070704_10000020613 | 245 |
| 472 | 3300005563 | Ga0068855_100016984 | Ga0068855_1000169844 | 245 |
| 473 | 3300005563 | Ga0068855_100019039 | Ga0068855_1000190392 | 245 |
| 474 | 3300005563 | Ga0068855_100058060 | Ga0068855_1000580602 | 245 |
| 475 | 3300005563 | Ga0068855_100089413 | Ga0068855_1000894133 | 245 |
| 476 | 3300005563 | Ga0068855_100093587 | Ga0068855_1000935871 | 245 |
| 477 | 3300005563 | Ga0068855_100157409 | Ga0068855_1001574092 | 245 |
| 478 | 3300005563 | Ga0068855_100164567 | Ga0068855_1001645672 | 245 |
| 479 | 3300005563 | Ga0068855_100186299 | Ga0068855_1001862994 | 245 |
| 480 | 3300005563 | Ga0068855_100209861 | Ga0068855_1002098612 | 245 |
| 481 | 3300005563 | Ga0068855_100367294 | Ga0068855_1003672943 | 245 |
| 482 | 3300005563 | Ga0068855_100720381 | Ga0068855_1007203812 | 245 |
| 483 | 3300005564 | Ga0070664_100195015 | Ga0070664_1001950152 | 245 |
| 484 | 3300005577 | Ga0068857_100002509 | Ga0068857_1000025092 | 245 |
| 485 | 3300005577 | Ga0068857_100003141 | Ga0068857_1000031413 | 245 |
| 486 | 3300005577 | Ga0068857_100037702 | Ga0068857_1000377024 | 245 |
| 487 | 3300005577 | Ga0068857_100106490 | Ga0068857_1001064903 | 245 |
| 488 | 3300005577 | Ga0068857_100354273 | Ga0068857_1003542732 | 245 |
| 489 | 3300005578 | Ga0068854_100234774 | Ga0068854_1002347742 | 245 |
| 490 | 3300005614 | Ga0068856_100000205 | Ga0068856_10000020541 | 245 |
| 491 | 3300005614 | Ga0068856_100033304 | Ga0068856_1000333043 | 245 |
| 492 | 3300005614 | Ga0068856_100066935 | Ga0068856_1000669355 | 245 |
| 493 | 3300005614 | Ga0068856_100121604 | Ga0068856_1001216042 | 245 |
| 494 | 3300005614 | Ga0068856_100244008 | Ga0068856_1002440082 | 245 |
| 495 | 3300005614 | Ga0068856_100352890 | Ga0068856_1003528901 | 245 |
| 496 | 3300005614 | Ga0068856_100435430 | Ga0068856_1004354302 | 245 |
| 497 | 3300005615 | Ga0070702_100048741 | Ga0070702_1000487411 | 245 |
| 498 | 3300005616 | Ga0068852_100041102 | Ga0068852_1000411022 | 245 |
| 499 | 3300005616 | Ga0068852_100188264 | Ga0068852_1001882642 | 245 |
| 500 | 3300005616 | Ga0068852_100400846 | Ga0068852_1004008461 | 245 |
| 501 | 3300005616 | Ga0068852_100461050 | Ga0068852_1004610502 | 245 |
| 502 | 3300005616 | Ga0068852_100773042 | Ga0068852_1007730421 | 245 |
| 503 | 3300005617 | Ga0068859_100072341 | Ga0068859_1000723412 | 245 |
| 504 | 3300005617 | Ga0068859_100092646 | Ga0068859_1000926462 | 245 |
| 505 | 3300005617 | Ga0068859_100713107 | Ga0068859_1007131072 | 245 |
| 506 | 3300005618 | Ga0068864_100027216 | Ga0068864_1000272165 | 245 |
| 507 | 3300005618 | Ga0068864_100110644 | Ga0068864_1001106442 | 245 |
| 508 | 3300005618 | Ga0068864_100372035 | Ga0068864_1003720352 | 245 |
| 509 | 3300005618 | Ga0068864_100377671 | Ga0068864_1003776712 | 245 |
| 510 | 3300005618 | Ga0068864_100524381 | Ga0068864_1005243812 | 245 |
| 511 | 3300005719 | Ga0068861_100022098 | Ga0068861_1000220983 | 245 |
| 512 | 3300005719 | Ga0068861_100070911 | Ga0068861_1000709112 | 245 |
| 513 | 3300005719 | Ga0068861_100072212 | Ga0068861_1000722123 | 245 |
| 514 | 3300005719 | Ga0068861_100125966 | Ga0068861_1001259663 | 245 |
| 515 | 3300005719 | Ga0068861_100416924 | Ga0068861_1004169242 | 245 |
| 516 | 3300005719 | Ga0068861_100463597 | Ga0068861_1004635971 | 245 |
| 517 | 3300005834 | Ga0068851_10004835 | Ga0068851_100048353 | 245 |
| 518 | 3300005834 | Ga0068851_10008966 | Ga0068851_100089663 | 245 |
| 519 | 3300005834 | Ga0068851_10126831 | Ga0068851_101268312 | 245 |
| 520 | 3300005841 | Ga0068863_100377740 | Ga0068863_1003777401 | 245 |
| 521 | 3300005841 | Ga0068863_100807019 | Ga0068863_1008070191 | 245 |
| 522 | 3300005842 | Ga0068858_100240414 | Ga0068858_1002404142 | 245 |
| 523 | 3300005842 | Ga0068858_100258161 | Ga0068858_1002581612 | 245 |
| 524 | 3300005842 | Ga0068858_100480766 | Ga0068858_1004807661 | 245 |
| 525 | 3300005842 | Ga0068858_100513421 | Ga0068858_1005134212 | 245 |
| 526 | 3300005842 | Ga0068858_100595031 | Ga0068858_1005950312 | 245 |
| 527 | 3300005843 | Ga0068860_100000316 | Ga0068860_10000031639 | 245 |
| 528 | 3300005843 | Ga0068860_100002287 | Ga0068860_10000228715 | 245 |
| 529 | 3300005843 | Ga0068860_100113422 | Ga0068860_1001134223 | 245 |
| 530 | 3300005843 | Ga0068860_100238704 | Ga0068860_1002387042 | 245 |
| 531 | 3300005844 | Ga0068862_100000157 | Ga0068862_10000015712 | 245 |
| 532 | 3300005844 | Ga0068862_100178558 | Ga0068862_1001785582 | 245 |
| 533 | 3300005844 | Ga0068862_100299043 | Ga0068862_1002990433 | 245 |
| 534 | 3300005844 | Ga0068862_100302627 | Ga0068862_1003026272 | 245 |
| 535 | 3300005937 | Ga0081455_10000179 | Ga0081455_100001795 | 245 |
| 536 | 3300005937 | Ga0081455_10002652 | Ga0081455_1000265218 | 245 |
| 537 | 3300005937 | Ga0081455_10003466 | Ga0081455_1000346614 | 245 |
| 538 | 3300005937 | Ga0081455_10003832 | Ga0081455_1000383215 | 245 |
| 539 | 3300005937 | Ga0081455_10027258 | Ga0081455_100272584 | 245 |
| 540 | 3300005981 | Ga0081538_10082973 | Ga0081538_100829732 | 245 |
| 541 | 3300005983 | Ga0081540_1000500 | Ga0081540_100050010 | 245 |
| 542 | 3300005983 | Ga0081540_1005905 | Ga0081540_10059058 | 245 |
| 543 | 3300005983 | Ga0081540_1006800 | Ga0081540_10068001 | 245 |
| 544 | 3300005983 | Ga0081540_1009855 | Ga0081540_10098556 | 245 |
| 545 | 3300005983 | Ga0081540_1013838 | Ga0081540_10138382 | 245 |
| 546 | 3300005983 | Ga0081540_1015121 | Ga0081540_10151213 | 245 |
| 547 | 3300005983 | Ga0081540_1015390 | Ga0081540_10153902 | 245 |
| 548 | 3300005983 | Ga0081540_1015394 | Ga0081540_10153944 | 245 |
| 549 | 3300005983 | Ga0081540_1017128 | Ga0081540_10171281 | 245 |
| 550 | 3300005983 | Ga0081540_1041100 | Ga0081540_10411003 | 245 |
| 551 | 3300005983 | Ga0081540_1108864 | Ga0081540_11088641 | 245 |
| 552 | 3300005985 | Ga0081539_10000273 | Ga0081539_1000027367 | 245 |
| 553 | 3300005985 | Ga0081539_10000735 | Ga0081539_1000073527 | 245 |
| 554 | 3300005985 | Ga0081539_10013306 | Ga0081539_100133062 | 245 |
| 555 | 3300005985 | Ga0081539_10047212 | Ga0081539_100472123 | 245 |
| 556 | 3300006028 | Ga0070717_10001338 | Ga0070717_1000133812 | 245 |
| 557 | 3300006028 | Ga0070717_10082183 | Ga0070717_100821832 | 245 |
| 558 | 3300006038 | Ga0075365_10239715 | Ga0075365_102397152 | 245 |
| 559 | 3300006038 | Ga0075365_10243393 | Ga0075365_102433931 | 245 |
| 560 | 3300006038 | Ga0075365_10293262 | Ga0075365_102932622 | 245 |
| 561 | 3300006038 | Ga0075365_10358951 | Ga0075365_103589511 | 245 |
| 562 | 3300006042 | Ga0075368_10044167 | Ga0075368_100441672 | 245 |
| 563 | 3300006048 | Ga0075363_100009382 | Ga0075363_1000093821 | 245 |
| 564 | 3300006048 | Ga0075363_100016047 | Ga0075363_1000160472 | 245 |
| 565 | 3300006048 | Ga0075363_100072931 | Ga0075363_1000729312 | 245 |
| 566 | 3300006051 | Ga0075364_10251397 | Ga0075364_102513972 | 245 |
| 567 | 3300006051 | Ga0075364_10270098 | Ga0075364_102700982 | 245 |
| 568 | 3300006051 | Ga0075364_10328620 | Ga0075364_103286201 | 245 |
| 569 | 3300006163 | Ga0070715_10119267 | Ga0070715_101192672 | 245 |
| 570 | 3300006173 | Ga0070716_100001393 | Ga0070716_1000013932 | 245 |
| 571 | 3300006173 | Ga0070716_100053034 | Ga0070716_1000530343 | 245 |
| 572 | 3300006173 | Ga0070716_100091457 | Ga0070716_1000914573 | 245 |
| 573 | 3300006173 | Ga0070716_100156068 | Ga0070716_1001560682 | 245 |
| 574 | 3300006175 | Ga0070712_100003228 | Ga0070712_1000032288 | 245 |
| 575 | 3300006175 | Ga0070712_100205018 | Ga0070712_1002050181 | 245 |
| 576 | 3300006175 | Ga0070712_100276691 | Ga0070712_1002766912 | 245 |
| 577 | 3300006177 | Ga0075362_10124679 | Ga0075362_101246791 | 245 |
| 578 | 3300006178 | Ga0075367_10017879 | Ga0075367_100178795 | 245 |
| 579 | 3300006178 | Ga0075367_10162835 | Ga0075367_101628352 | 245 |
| 580 | 3300006178 | Ga0075367_10262457 | Ga0075367_102624572 | 245 |
| 581 | 3300006186 | Ga0075369_10068263 | Ga0075369_100682631 | 245 |
| 582 | 3300006195 | Ga0075366_10135616 | Ga0075366_101356162 | 245 |
| 583 | 3300006195 | Ga0075366_10136140 | Ga0075366_101361402 | 245 |
| 584 | 3300006195 | Ga0075366_10182887 | Ga0075366_101828872 | 245 |
| 585 | 3300006195 | Ga0075366_10355416 | Ga0075366_103554161 | 245 |
| 586 | 3300006237 | Ga0097621_100283602 | Ga0097621_1002836022 | 245 |
| 587 | 3300006353 | Ga0075370_10034969 | Ga0075370_100349691 | 245 |
| 588 | 3300006353 | Ga0075370_10166921 | Ga0075370_101669212 | 245 |
| 589 | 3300006358 | Ga0068871_100029523 | Ga0068871_1000295232 | 245 |
| 590 | 3300006358 | Ga0068871_100197001 | Ga0068871_1001970011 | 245 |
| 591 | 3300006844 | Ga0075428_100063252 | Ga0075428_1000632522 | 245 |
| 592 | 3300006844 | Ga0075428_100478331 | Ga0075428_1004783312 | 245 |
| 593 | 3300006846 | Ga0075430_100064268 | Ga0075430_1000642682 | 245 |
| 594 | 3300006847 | Ga0075431_100000844 | Ga0075431_10000084423 | 245 |
| 595 | 3300006847 | Ga0075431_100006976 | Ga0075431_1000069769 | 245 |
| 596 | 3300006847 | Ga0075431_100282644 | Ga0075431_1002826441 | 245 |
| 597 | 3300006847 | Ga0075431_100282684 | Ga0075431_1002826842 | 245 |
| 598 | 3300006847 | Ga0075431_100556640 | Ga0075431_1005566402 | 245 |
| 599 | 3300006852 | Ga0075433_10001926 | Ga0075433_100019263 | 245 |
| 600 | 3300006871 | Ga0075434_100000993 | Ga0075434_10000099320 | 245 |
| 601 | 3300006871 | Ga0075434_100016830 | Ga0075434_1000168307 | 245 |
| 602 | 3300006871 | Ga0075434_100130106 | Ga0075434_1001301063 | 245 |
| 603 | 3300006881 | Ga0068865_100542563 | Ga0068865_1005425632 | 245 |
| 604 | 3300006914 | Ga0075436_100042779 | Ga0075436_1000427792 | 245 |
| 605 | 3300006931 | Ga0097620_100072342 | Ga0097620_1000723422 | 245 |
| 606 | 3300006931 | Ga0097620_100092641 | Ga0097620_1000926413 | 245 |
| 607 | 3300006931 | Ga0097620_100713125 | Ga0097620_1007131252 | 245 |
| 608 | 3300006941 | Ga0099825_1036129 | Ga0099825_10361292 | 245 |
| 609 | 3300006942 | Ga0099824_1019396 | Ga0099824_10193961 | 245 |
| 610 | 3300006942 | Ga0099824_1044365 | Ga0099824_10443652 | 245 |
| 611 | 3300006943 | Ga0099822_1002380 | Ga0099822_100238013 | 245 |
| 612 | 3300007076 | Ga0075435_100125140 | Ga0075435_1001251402 | 245 |
| 613 | 3300007788 | Ga0099795_10109057 | Ga0099795_101090571 | 245 |
| 614 | 3300009092 | Ga0105250_10173880 | Ga0105250_101738801 | 245 |
| 615 | 3300009093 | Ga0105240_10008011 | Ga0105240_1000801120 | 245 |
| 616 | 3300009093 | Ga0105240_10035111 | Ga0105240_100351111 | 245 |
| 617 | 3300009093 | Ga0105240_10035437 | Ga0105240_100354372 | 245 |
| 618 | 3300009093 | Ga0105240_10036454 | Ga0105240_100364543 | 245 |
| 619 | 3300009093 | Ga0105240_10387695 | Ga0105240_103876952 | 245 |
| 620 | 3300009093 | Ga0105240_10406209 | Ga0105240_104062093 | 245 |
| 621 | 3300009094 | Ga0111539_10005028 | Ga0111539_1000502812 | 245 |
| 622 | 3300009094 | Ga0111539_10044229 | Ga0111539_100442295 | 245 |
| 623 | 3300009098 | Ga0105245_10372479 | Ga0105245_103724791 | 245 |
| 624 | 3300009098 | Ga0105245_10376463 | Ga0105245_103764631 | 245 |
| 625 | 3300009098 | Ga0105245_10660278 | Ga0105245_106602781 | 245 |
| 626 | 3300009101 | Ga0105247_10078191 | Ga0105247_100781912 | 245 |
| 627 | 3300009101 | Ga0105247_10232179 | Ga0105247_102321792 | 245 |
| 628 | 3300009147 | Ga0114129_10110252 | Ga0114129_101102521 | 245 |
| 629 | 3300009147 | Ga0114129_10135904 | Ga0114129_101359044 | 245 |
| 630 | 3300009148 | Ga0105243_10082405 | Ga0105243_100824052 | 245 |
| 631 | 3300009148 | Ga0105243_10689448 | Ga0105243_106894481 | 245 |
| 632 | 3300009174 | Ga0105241_10019598 | Ga0105241_100195983 | 245 |
| 633 | 3300009176 | Ga0105242_10566557 | Ga0105242_105665572 | 245 |
| 634 | 3300009176 | Ga0105242_10829096 | Ga0105242_108290961 | 245 |
| 635 | 3300009177 | Ga0105248_10130363 | Ga0105248_101303631 | 245 |
| 636 | 3300009177 | Ga0105248_10183906 | Ga0105248_101839063 | 245 |
| 637 | 3300009177 | Ga0105248_10265803 | Ga0105248_102658033 | 245 |
| 638 | 3300009177 | Ga0105248_10290770 | Ga0105248_102907701 | 245 |
| 639 | 3300009177 | Ga0105248_10685886 | Ga0105248_106858862 | 245 |
| 640 | 3300009545 | Ga0105237_10017852 | Ga0105237_100178524 | 245 |
| 641 | 3300009545 | Ga0105237_10023811 | Ga0105237_100238113 | 245 |
| 642 | 3300009545 | Ga0105237_10033114 | Ga0105237_100331145 | 245 |
| 643 | 3300009545 | Ga0105237_10059905 | Ga0105237_100599053 | 245 |
| 644 | 3300009545 | Ga0105237_10082613 | Ga0105237_100826132 | 245 |
| 645 | 3300009545 | Ga0105237_10281961 | Ga0105237_102819612 | 245 |
| 646 | 3300009545 | Ga0105237_10405931 | Ga0105237_104059312 | 245 |
| 647 | 3300009551 | Ga0105238_10002798 | Ga0105238_100027989 | 245 |
| 648 | 3300009551 | Ga0105238_10004789 | Ga0105238_100047892 | 245 |
| 649 | 3300009551 | Ga0105238_10059132 | Ga0105238_100591322 | 245 |
| 650 | 3300009551 | Ga0105238_10088391 | Ga0105238_100883912 | 245 |
| 651 | 3300009551 | Ga0105238_10167167 | Ga0105238_101671672 | 245 |
| 652 | 3300009551 | Ga0105238_10357917 | Ga0105238_103579172 | 245 |
| 653 | 3300009551 | Ga0105238_10478174 | Ga0105238_104781741 | 245 |
| 654 | 3300009551 | Ga0105238_10914560 | Ga0105238_109145601 | 245 |
| 655 | 3300009553 | Ga0105249_10004242 | Ga0105249_100042429 | 245 |
| 656 | 3300010375 | Ga0105239_10007959 | Ga0105239_100079592 | 245 |
| 657 | 3300010375 | Ga0105239_10072517 | Ga0105239_100725171 | 245 |
| 658 | 3300010375 | Ga0105239_10090645 | Ga0105239_100906451 | 245 |
| 659 | 3300010375 | Ga0105239_10109330 | Ga0105239_101093303 | 245 |
| 660 | 3300010375 | Ga0105239_10115086 | Ga0105239_101150863 | 245 |
| 661 | 3300010375 | Ga0105239_10144167 | Ga0105239_101441671 | 245 |
| 662 | 3300010375 | Ga0105239_10156564 | Ga0105239_101565642 | 245 |
| 663 | 3300010375 | Ga0105239_10161331 | Ga0105239_101613312 | 245 |
| 664 | 3300010375 | Ga0105239_10289885 | Ga0105239_102898852 | 245 |
| 665 | 3300010375 | Ga0105239_10379054 | Ga0105239_103790542 | 245 |
| 666 | 3300010375 | Ga0105239_10400619 | Ga0105239_104006191 | 245 |
| 667 | 3300010375 | Ga0105239_10623615 | Ga0105239_106236151 | 245 |
| 668 | 3300010375 | Ga0105239_10771880 | Ga0105239_107718801 | 245 |
| 669 | 3300011119 | Ga0105246_10036299 | Ga0105246_100362993 | 245 |
| 670 | 3300011119 | Ga0105246_10072125 | Ga0105246_100721253 | 245 |
| 671 | 3300011119 | Ga0105246_10308624 | Ga0105246_103086242 | 245 |
| 672 | 3300013100 | Ga0157373_10223971 | Ga0157373_102239712 | 245 |
| 673 | 3300013104 | Ga0157370_10015624 | Ga0157370_100156247 | 245 |
| 674 | 3300013104 | Ga0157370_10055142 | Ga0157370_100551422 | 245 |
| 675 | 3300013104 | Ga0157370_10296344 | Ga0157370_102963442 | 245 |
| 676 | 3300013105 | Ga0157369_10000996 | Ga0157369_1000099630 | 245 |
| 677 | 3300013105 | Ga0157369_10007824 | Ga0157369_1000782411 | 245 |
| 678 | 3300013105 | Ga0157369_10051549 | Ga0157369_100515494 | 245 |
| 679 | 3300013105 | Ga0157369_10112631 | Ga0157369_101126312 | 245 |
| 680 | 3300013105 | Ga0157369_10415169 | Ga0157369_104151692 | 245 |
| 681 | 3300013296 | Ga0157374_10013272 | Ga0157374_100132723 | 245 |
| 682 | 3300013296 | Ga0157374_10299631 | Ga0157374_102996311 | 245 |
| 683 | 3300013297 | Ga0157378_10700145 | Ga0157378_107001452 | 245 |
| 684 | 3300013297 | Ga0157378_10926882 | Ga0157378_109268822 | 245 |
| 685 | 3300013306 | Ga0163162_10177021 | Ga0163162_101770211 | 245 |
| 686 | 3300013307 | Ga0157372_10339872 | Ga0157372_103398721 | 245 |
| 687 | 3300013308 | Ga0157375_10036651 | Ga0157375_100366516 | 245 |
| 688 | 3300013308 | Ga0157375_10079068 | Ga0157375_100790681 | 245 |
| 689 | 3300014325 | Ga0163163_10006000 | Ga0163163_100060009 | 245 |
| 690 | 3300014325 | Ga0163163_10337601 | Ga0163163_103376011 | 245 |
| 691 | 3300014326 | Ga0157380_10118538 | Ga0157380_101185382 | 245 |
| 692 | 3300014326 | Ga0157380_10357420 | Ga0157380_103574202 | 245 |
| 693 | 3300014745 | Ga0157377_10091192 | Ga0157377_100911922 | 245 |
| 694 | 3300014968 | Ga0157379_10066997 | Ga0157379_100669973 | 245 |
| 695 | 3300014968 | Ga0157379_10226391 | Ga0157379_102263913 | 245 |
| 696 | 3300014968 | Ga0157379_10251519 | Ga0157379_102515192 | 245 |
| 697 | 3300014968 | Ga0157379_10713154 | Ga0157379_107131542 | 245 |
| 698 | 3300014969 | Ga0157376_10075405 | Ga0157376_100754053 | 245 |
| 699 | 3300017792 | Ga0163161_10244239 | Ga0163161_102442392 | 245 |
| 700 | 3300020070 | Ga0206356_10359229 | Ga0206356_103592292 | 245 |
| 701 | 3300021320 | Ga0214544_1000002 | Ga0214544_1000002307 | 245 |
| 702 | 3300021321 | Ga0214542_1000001 | Ga0214542_1000001657 | 245 |
| 703 | 3300021324 | Ga0214545_1000001 | Ga0214545_1000001723 | 245 |
| 704 | 3300021327 | Ga0214543_1000001 | Ga0214543_1000001472 | 245 |
| 705 | 3300021358 | Ga0213873_10003228 | Ga0213873_100032283 | 245 |
| 706 | 3300021384 | Ga0213876_10001215 | Ga0213876_100012154 | 245 |
| 707 | 3300021384 | Ga0213876_10198854 | Ga0213876_101988542 | 245 |
| 708 | 3300021388 | Ga0213875_10032072 | Ga0213875_100320722 | 245 |
| 709 | 3300021388 | Ga0213875_10132272 | Ga0213875_101322721 | 245 |
| 710 | 3300022467 | Ga0224712_10015360 | Ga0224712_100153603 | 245 |
| 711 | 3300025253 | Ga0209677_103425 | Ga0209677_1034254 | 245 |
| 712 | 3300025254 | Ga0209148_1000613 | Ga0209148_10006133 | 245 |
| 713 | 3300025254 | Ga0209148_1006070 | Ga0209148_10060703 | 245 |
| 714 | 3300025261 | Ga0209233_1005807 | Ga0209233_10058074 | 245 |
| 715 | 3300025261 | Ga0209233_1008575 | Ga0209233_10085752 | 245 |
| 716 | 3300025261 | Ga0209233_1021595 | Ga0209233_10215953 | 245 |
| 717 | 3300025261 | Ga0209233_1022933 | Ga0209233_10229332 | 245 |
| 718 | 3300025272 | Ga0209455_1005473 | Ga0209455_10054732 | 245 |
| 719 | 3300025272 | Ga0209455_1009401 | Ga0209455_10094011 | 245 |
| 720 | 3300025295 | Ga0209564_1015858 | Ga0209564_10158583 | 245 |
| 721 | 3300025297 | Ga0209758_1000140 | Ga0209758_1000140157 | 245 |
| 722 | 3300025297 | Ga0209758_1000947 | Ga0209758_100094725 | 245 |
| 723 | 3300025297 | Ga0209758_1003609 | Ga0209758_100360916 | 245 |
| 724 | 3300025297 | Ga0209758_1004382 | Ga0209758_10043823 | 245 |
| 725 | 3300025297 | Ga0209758_1005082 | Ga0209758_100508210 | 245 |
| 726 | 3300025297 | Ga0209758_1007936 | Ga0209758_10079362 | 245 |
| 727 | 3300025297 | Ga0209758_1016825 | Ga0209758_10168254 | 245 |
| 728 | 3300025299 | Ga0209256_1023531 | Ga0209256_10235312 | 245 |
| 729 | 3300025302 | Ga0207426_1000626 | Ga0207426_100062646 | 245 |
| 730 | 3300025302 | Ga0207426_1000892 | Ga0207426_10008922 | 245 |
| 731 | 3300025302 | Ga0207426_1005341 | Ga0207426_10053416 | 245 |
| 732 | 3300025302 | Ga0207426_1027317 | Ga0207426_10273172 | 245 |
| 733 | 3300025302 | Ga0207426_1050027 | Ga0207426_10500271 | 245 |
| 734 | 3300025304 | Ga0209257_1007293 | Ga0209257_10072931 | 245 |
| 735 | 3300025304 | Ga0209257_1022286 | Ga0209257_10222862 | 245 |
| 736 | 3300025315 | Ga0207697_10012580 | Ga0207697_100125802 | 245 |
| 737 | 3300025315 | Ga0207697_10051545 | Ga0207697_100515451 | 245 |
| 738 | 3300025315 | Ga0207697_10135181 | Ga0207697_101351812 | 245 |
| 739 | 3300025321 | Ga0207656_10008091 | Ga0207656_100080913 | 245 |
| 740 | 3300025321 | Ga0207656_10013293 | Ga0207656_100132933 | 245 |
| 741 | 3300025321 | Ga0207656_10125020 | Ga0207656_101250202 | 245 |
| 742 | 3300025321 | Ga0207656_10162756 | Ga0207656_101627561 | 245 |
| 743 | 3300025711 | Ga0207696_1042465 | Ga0207696_10424651 | 245 |
| 744 | 3300025885 | Ga0207653_10000536 | Ga0207653_100005369 | 245 |
| 745 | 3300025885 | Ga0207653_10002803 | Ga0207653_100028035 | 245 |
| 746 | 3300025898 | Ga0207692_10000116 | Ga0207692_100001164 | 245 |
| 747 | 3300025898 | Ga0207692_10030959 | Ga0207692_100309593 | 245 |
| 748 | 3300025900 | Ga0207710_10007078 | Ga0207710_100070782 | 245 |
| 749 | 3300025900 | Ga0207710_10062029 | Ga0207710_100620293 | 245 |
| 750 | 3300025901 | Ga0207688_10205981 | Ga0207688_102059811 | 245 |
| 751 | 3300025904 | Ga0207647_10011073 | Ga0207647_100110733 | 245 |
| 752 | 3300025904 | Ga0207647_10023846 | Ga0207647_100238463 | 245 |
| 753 | 3300025904 | Ga0207647_10025616 | Ga0207647_100256162 | 245 |
| 754 | 3300025904 | Ga0207647_10204172 | Ga0207647_102041721 | 245 |
| 755 | 3300025905 | Ga0207685_10107587 | Ga0207685_101075871 | 245 |
| 756 | 3300025905 | Ga0207685_10193965 | Ga0207685_101939652 | 245 |
| 757 | 3300025906 | Ga0207699_10000958 | Ga0207699_100009583 | 245 |
| 758 | 3300025906 | Ga0207699_10090766 | Ga0207699_100907663 | 245 |
| 759 | 3300025906 | Ga0207699_10165628 | Ga0207699_101656281 | 245 |
| 760 | 3300025906 | Ga0207699_10342268 | Ga0207699_103422682 | 245 |
| 761 | 3300025906 | Ga0207699_10550578 | Ga0207699_105505781 | 245 |
| 762 | 3300025908 | Ga0207643_10153888 | Ga0207643_101538881 | 245 |
| 763 | 3300025909 | Ga0207705_10058216 | Ga0207705_100582162 | 245 |
| 764 | 3300025910 | Ga0207684_10221856 | Ga0207684_102218562 | 245 |
| 765 | 3300025910 | Ga0207684_10340482 | Ga0207684_103404822 | 245 |
| 766 | 3300025911 | Ga0207654_10000308 | Ga0207654_1000030828 | 245 |
| 767 | 3300025911 | Ga0207654_10165481 | Ga0207654_101654812 | 245 |
| 768 | 3300025911 | Ga0207654_10302430 | Ga0207654_103024302 | 245 |
| 769 | 3300025912 | Ga0207707_10000713 | Ga0207707_1000071325 | 245 |
| 770 | 3300025912 | Ga0207707_10001623 | Ga0207707_1000162324 | 245 |
| 771 | 3300025912 | Ga0207707_10005494 | Ga0207707_1000549413 | 245 |
| 772 | 3300025912 | Ga0207707_10060434 | Ga0207707_100604342 | 245 |
| 773 | 3300025912 | Ga0207707_10352934 | Ga0207707_103529342 | 245 |
| 774 | 3300025913 | Ga0207695_10001719 | Ga0207695_100017197 | 245 |
| 775 | 3300025913 | Ga0207695_10001812 | Ga0207695_1000181220 | 245 |
| 776 | 3300025913 | Ga0207695_10022151 | Ga0207695_100221516 | 245 |
| 777 | 3300025913 | Ga0207695_10025188 | Ga0207695_100251885 | 245 |
| 778 | 3300025913 | Ga0207695_10050386 | Ga0207695_100503863 | 245 |
| 779 | 3300025913 | Ga0207695_10147925 | Ga0207695_101479251 | 245 |
| 780 | 3300025913 | Ga0207695_10385794 | Ga0207695_103857942 | 245 |
| 781 | 3300025914 | Ga0207671_10008038 | Ga0207671_100080385 | 245 |
| 782 | 3300025914 | Ga0207671_10026849 | Ga0207671_100268493 | 245 |
| 783 | 3300025914 | Ga0207671_10027204 | Ga0207671_100272044 | 245 |
| 784 | 3300025914 | Ga0207671_10156673 | Ga0207671_101566732 | 245 |
| 785 | 3300025914 | Ga0207671_10249092 | Ga0207671_102490922 | 245 |
| 786 | 3300025914 | Ga0207671_10369300 | Ga0207671_103693002 | 245 |
| 787 | 3300025915 | Ga0207693_10073136 | Ga0207693_100731362 | 245 |
| 788 | 3300025915 | Ga0207693_10149159 | Ga0207693_101491593 | 245 |
| 789 | 3300025916 | Ga0207663_10005557 | Ga0207663_100055575 | 245 |
| 790 | 3300025916 | Ga0207663_10016904 | Ga0207663_100169043 | 245 |
| 791 | 3300025916 | Ga0207663_10125820 | Ga0207663_101258203 | 245 |
| 792 | 3300025916 | Ga0207663_10261042 | Ga0207663_102610422 | 245 |
| 793 | 3300025916 | Ga0207663_10721485 | Ga0207663_107214851 | 245 |
| 794 | 3300025917 | Ga0207660_10007065 | Ga0207660_100070657 | 245 |
| 795 | 3300025917 | Ga0207660_10025784 | Ga0207660_100257844 | 245 |
| 796 | 3300025917 | Ga0207660_10033152 | Ga0207660_100331523 | 245 |
| 797 | 3300025917 | Ga0207660_10051559 | Ga0207660_100515592 | 245 |
| 798 | 3300025917 | Ga0207660_10180680 | Ga0207660_101806801 | 245 |
| 799 | 3300025917 | Ga0207660_10201690 | Ga0207660_102016901 | 245 |
| 800 | 3300025917 | Ga0207660_10431375 | Ga0207660_104313751 | 245 |
| 801 | 3300025918 | Ga0207662_10077224 | Ga0207662_100772242 | 245 |
| 802 | 3300025918 | Ga0207662_10408770 | Ga0207662_104087701 | 245 |
| 803 | 3300025919 | Ga0207657_10001786 | Ga0207657_1000178617 | 245 |
| 804 | 3300025919 | Ga0207657_10008840 | Ga0207657_100088402 | 245 |
| 805 | 3300025919 | Ga0207657_10119096 | Ga0207657_101190962 | 245 |
| 806 | 3300025920 | Ga0207649_10045765 | Ga0207649_100457652 | 245 |
| 807 | 3300025920 | Ga0207649_10111834 | Ga0207649_101118342 | 245 |
| 808 | 3300025920 | Ga0207649_10464696 | Ga0207649_104646961 | 245 |
| 809 | 3300025921 | Ga0207652_10004315 | Ga0207652_100043158 | 245 |
| 810 | 3300025921 | Ga0207652_10038882 | Ga0207652_100388821 | 245 |
| 811 | 3300025921 | Ga0207652_10088110 | Ga0207652_100881103 | 245 |
| 812 | 3300025921 | Ga0207652_10102017 | Ga0207652_101020173 | 245 |
| 813 | 3300025921 | Ga0207652_10111939 | Ga0207652_101119392 | 245 |
| 814 | 3300025921 | Ga0207652_10245070 | Ga0207652_102450703 | 245 |
| 815 | 3300025924 | Ga0207694_10000157 | Ga0207694_1000015744 | 245 |
| 816 | 3300025924 | Ga0207694_10012829 | Ga0207694_100128297 | 245 |
| 817 | 3300025924 | Ga0207694_10055535 | Ga0207694_100555352 | 245 |
| 818 | 3300025924 | Ga0207694_10151191 | Ga0207694_101511912 | 245 |
| 819 | 3300025924 | Ga0207694_10154625 | Ga0207694_101546251 | 245 |
| 820 | 3300025924 | Ga0207694_10385136 | Ga0207694_103851362 | 245 |
| 821 | 3300025925 | Ga0207650_10320479 | Ga0207650_103204792 | 245 |
| 822 | 3300025925 | Ga0207650_10337568 | Ga0207650_103375681 | 245 |
| 823 | 3300025927 | Ga0207687_10028220 | Ga0207687_100282201 | 245 |
| 824 | 3300025927 | Ga0207687_10165424 | Ga0207687_101654242 | 245 |
| 825 | 3300025927 | Ga0207687_10215116 | Ga0207687_102151161 | 245 |
| 826 | 3300025927 | Ga0207687_10276648 | Ga0207687_102766482 | 245 |
| 827 | 3300025927 | Ga0207687_10340549 | Ga0207687_103405491 | 245 |
| 828 | 3300025928 | Ga0207700_10021515 | Ga0207700_100215152 | 245 |
| 829 | 3300025928 | Ga0207700_10185652 | Ga0207700_101856522 | 245 |
| 830 | 3300025929 | Ga0207664_10177434 | Ga0207664_101774343 | 245 |
| 831 | 3300025931 | Ga0207644_10436088 | Ga0207644_104360881 | 245 |
| 832 | 3300025932 | Ga0207690_10515508 | Ga0207690_105155081 | 245 |
| 833 | 3300025933 | Ga0207706_10115913 | Ga0207706_101159133 | 245 |
| 834 | 3300025933 | Ga0207706_10666964 | Ga0207706_106669641 | 245 |
| 835 | 3300025934 | Ga0207686_10119430 | Ga0207686_101194303 | 245 |
| 836 | 3300025934 | Ga0207686_10382088 | Ga0207686_103820881 | 245 |
| 837 | 3300025935 | Ga0207709_10011280 | Ga0207709_100112806 | 245 |
| 838 | 3300025935 | Ga0207709_10369264 | Ga0207709_103692641 | 245 |
| 839 | 3300025936 | Ga0207670_10528863 | Ga0207670_105288632 | 245 |
| 840 | 3300025937 | Ga0207669_10289370 | Ga0207669_102893702 | 245 |
| 841 | 3300025938 | Ga0207704_10013820 | Ga0207704_100138203 | 245 |
| 842 | 3300025938 | Ga0207704_10102744 | Ga0207704_101027442 | 245 |
| 843 | 3300025939 | Ga0207665_10001402 | Ga0207665_1000140212 | 245 |
| 844 | 3300025939 | Ga0207665_10087694 | Ga0207665_100876941 | 245 |
| 845 | 3300025939 | Ga0207665_10117920 | Ga0207665_101179201 | 245 |
| 846 | 3300025939 | Ga0207665_10166867 | Ga0207665_101668671 | 245 |
| 847 | 3300025939 | Ga0207665_10184538 | Ga0207665_101845383 | 245 |
| 848 | 3300025939 | Ga0207665_10297906 | Ga0207665_102979061 | 245 |
| 849 | 3300025939 | Ga0207665_10400204 | Ga0207665_104002041 | 245 |
| 850 | 3300025939 | Ga0207665_10439645 | Ga0207665_104396451 | 245 |
| 851 | 3300025940 | Ga0207691_10140759 | Ga0207691_101407591 | 245 |
| 852 | 3300025940 | Ga0207691_10167997 | Ga0207691_101679973 | 245 |
| 853 | 3300025940 | Ga0207691_10344342 | Ga0207691_103443422 | 245 |
| 854 | 3300025941 | Ga0207711_10029828 | Ga0207711_100298281 | 245 |
| 855 | 3300025941 | Ga0207711_10190825 | Ga0207711_101908252 | 245 |
| 856 | 3300025941 | Ga0207711_10425561 | Ga0207711_104255612 | 245 |
| 857 | 3300025942 | Ga0207689_10144622 | Ga0207689_101446222 | 245 |
| 858 | 3300025942 | Ga0207689_10342191 | Ga0207689_103421911 | 245 |
| 859 | 3300025944 | Ga0207661_10001379 | Ga0207661_1000137910 | 245 |
| 860 | 3300025944 | Ga0207661_10012609 | Ga0207661_100126091 | 245 |
| 861 | 3300025945 | Ga0207679_10132374 | Ga0207679_101323743 | 245 |
| 862 | 3300025949 | Ga0207667_10008116 | Ga0207667_1000811610 | 245 |
| 863 | 3300025949 | Ga0207667_10012664 | Ga0207667_1001266410 | 245 |
| 864 | 3300025949 | Ga0207667_10072054 | Ga0207667_100720542 | 245 |
| 865 | 3300025949 | Ga0207667_10077912 | Ga0207667_100779121 | 245 |
| 866 | 3300025949 | Ga0207667_10141144 | Ga0207667_101411443 | 245 |
| 867 | 3300025949 | Ga0207667_10187735 | Ga0207667_101877351 | 245 |
| 868 | 3300025949 | Ga0207667_10389079 | Ga0207667_103890792 | 245 |
| 869 | 3300025949 | Ga0207667_10457502 | Ga0207667_104575021 | 245 |
| 870 | 3300025949 | Ga0207667_10529320 | Ga0207667_105293201 | 245 |
| 871 | 3300025960 | Ga0207651_10076518 | Ga0207651_100765183 | 245 |
| 872 | 3300025960 | Ga0207651_10348077 | Ga0207651_103480772 | 245 |
| 873 | 3300025961 | Ga0207712_10147690 | Ga0207712_101476901 | 245 |
| 874 | 3300025961 | Ga0207712_10261523 | Ga0207712_102615232 | 245 |
| 875 | 3300025972 | Ga0207668_10045275 | Ga0207668_100452754 | 245 |
| 876 | 3300025972 | Ga0207668_10045547 | Ga0207668_100455473 | 245 |
| 877 | 3300025981 | Ga0207640_10154249 | Ga0207640_101542492 | 245 |
| 878 | 3300025981 | Ga0207640_10206684 | Ga0207640_102066842 | 245 |
| 879 | 3300025986 | Ga0207658_10333093 | Ga0207658_103330931 | 245 |
| 880 | 3300026023 | Ga0207677_10070485 | Ga0207677_100704852 | 245 |
| 881 | 3300026023 | Ga0207677_10409386 | Ga0207677_104093861 | 245 |
| 882 | 3300026035 | Ga0207703_10037329 | Ga0207703_100373294 | 245 |
| 883 | 3300026035 | Ga0207703_10062253 | Ga0207703_100622531 | 245 |
| 884 | 3300026035 | Ga0207703_10306444 | Ga0207703_103064442 | 245 |
| 885 | 3300026035 | Ga0207703_10327967 | Ga0207703_103279671 | 245 |
| 886 | 3300026035 | Ga0207703_10495043 | Ga0207703_104950431 | 245 |
| 887 | 3300026035 | Ga0207703_10905668 | Ga0207703_109056681 | 245 |
| 888 | 3300026041 | Ga0207639_10010722 | Ga0207639_100107224 | 245 |
| 889 | 3300026041 | Ga0207639_10076718 | Ga0207639_100767183 | 245 |
| 890 | 3300026041 | Ga0207639_10113242 | Ga0207639_101132422 | 245 |
| 891 | 3300026041 | Ga0207639_10294526 | Ga0207639_102945261 | 245 |
| 892 | 3300026041 | Ga0207639_10509763 | Ga0207639_105097631 | 245 |
| 893 | 3300026067 | Ga0207678_10014420 | Ga0207678_100144202 | 245 |
| 894 | 3300026067 | Ga0207678_10036160 | Ga0207678_100361604 | 245 |
| 895 | 3300026067 | Ga0207678_10037981 | Ga0207678_100379814 | 245 |
| 896 | 3300026067 | Ga0207678_10098778 | Ga0207678_100987781 | 245 |
| 897 | 3300026067 | Ga0207678_10155364 | Ga0207678_101553642 | 245 |
| 898 | 3300026067 | Ga0207678_10161758 | Ga0207678_101617581 | 245 |
| 899 | 3300026067 | Ga0207678_10178066 | Ga0207678_101780662 | 245 |
| 900 | 3300026067 | Ga0207678_10254370 | Ga0207678_102543702 | 245 |
| 901 | 3300026067 | Ga0207678_10276172 | Ga0207678_102761722 | 245 |
| 902 | 3300026075 | Ga0207708_10126781 | Ga0207708_101267812 | 245 |
| 903 | 3300026075 | Ga0207708_10225048 | Ga0207708_102250482 | 245 |
| 904 | 3300026075 | Ga0207708_10630123 | Ga0207708_106301231 | 245 |
| 905 | 3300026075 | Ga0207708_10692215 | Ga0207708_106922151 | 245 |
| 906 | 3300026078 | Ga0207702_10000002 | Ga0207702_10000002300 | 245 |
| 907 | 3300026078 | Ga0207702_10000048 | Ga0207702_10000048116 | 245 |
| 908 | 3300026078 | Ga0207702_10096505 | Ga0207702_100965052 | 245 |
| 909 | 3300026078 | Ga0207702_10243985 | Ga0207702_102439853 | 245 |
| 910 | 3300026089 | Ga0207648_10062317 | Ga0207648_100623174 | 245 |
| 911 | 3300026089 | Ga0207648_10066627 | Ga0207648_100666272 | 245 |
| 912 | 3300026095 | Ga0207676_10014722 | Ga0207676_100147222 | 245 |
| 913 | 3300026095 | Ga0207676_10358072 | Ga0207676_103580722 | 245 |
| 914 | 3300026095 | Ga0207676_10617158 | Ga0207676_106171582 | 245 |
| 915 | 3300026095 | Ga0207676_10691250 | Ga0207676_106912501 | 245 |
| 916 | 3300026116 | Ga0207674_10006147 | Ga0207674_100061474 | 245 |
| 917 | 3300026116 | Ga0207674_10049099 | Ga0207674_100490992 | 245 |
| 918 | 3300026116 | Ga0207674_10128650 | Ga0207674_101286502 | 245 |
| 919 | 3300026116 | Ga0207674_10132628 | Ga0207674_101326282 | 245 |
| 920 | 3300026118 | Ga0207675_100021910 | Ga0207675_1000219104 | 245 |
| 921 | 3300026118 | Ga0207675_100067701 | Ga0207675_1000677012 | 245 |
| 922 | 3300026118 | Ga0207675_100077004 | Ga0207675_1000770043 | 245 |
| 923 | 3300026118 | Ga0207675_100540939 | Ga0207675_1005409392 | 245 |
| 924 | 3300026121 | Ga0207683_10068392 | Ga0207683_100683923 | 245 |
| 925 | 3300026121 | Ga0207683_10174161 | Ga0207683_101741613 | 245 |
| 926 | 3300026121 | Ga0207683_10259539 | Ga0207683_102595392 | 245 |
| 927 | 3300026121 | Ga0207683_10325101 | Ga0207683_103251011 | 245 |
| 928 | 3300026121 | Ga0207683_10443759 | Ga0207683_104437591 | 245 |
| 929 | 3300026142 | Ga0207698_10017601 | Ga0207698_100176011 | 245 |
| 930 | 3300026142 | Ga0207698_10139213 | Ga0207698_101392133 | 245 |
| 931 | 3300026142 | Ga0207698_10146616 | Ga0207698_101466161 | 245 |
| 932 | 3300026142 | Ga0207698_10205242 | Ga0207698_102052423 | 245 |
| 933 | 3300026142 | Ga0207698_10330588 | Ga0207698_103305881 | 245 |
| 934 | 3300027296 | Ga0209389_1000233 | Ga0209389_10002331 | 245 |
| 935 | 3300027296 | Ga0209389_1010778 | Ga0209389_10107781 | 245 |
| 936 | 3300027357 | Ga0209589_1000001 | Ga0209589_100000142 | 245 |
| 937 | 3300027357 | Ga0209589_1001423 | Ga0209589_100142310 | 245 |
| 938 | 3300027361 | Ga0209489_100001 | Ga0209489_10000142 | 245 |
| 939 | 3300027361 | Ga0209489_102560 | Ga0209489_1025601 | 245 |
| 940 | 3300027361 | Ga0209489_112041 | Ga0209489_11204110 | 245 |
| 941 | 3300027363 | Ga0209700_100001 | Ga0209700_10000142 | 245 |
| 942 | 3300027363 | Ga0209700_100062 | Ga0209700_100062114 | 245 |
| 943 | 3300027907 | Ga0207428_10020898 | Ga0207428_100208987 | 245 |
| 944 | 3300027907 | Ga0207428_10048417 | Ga0207428_100484173 | 245 |
| 945 | 3300028379 | Ga0268266_10008946 | Ga0268266_100089464 | 245 |
| 946 | 3300028379 | Ga0268266_10029812 | Ga0268266_100298122 | 245 |
| 947 | 3300028379 | Ga0268266_10059181 | Ga0268266_100591813 | 245 |
| 948 | 3300028379 | Ga0268266_10139420 | Ga0268266_101394202 | 245 |
| 949 | 3300028379 | Ga0268266_10175211 | Ga0268266_101752112 | 245 |
| 950 | 3300028379 | Ga0268266_10486490 | Ga0268266_104864901 | 245 |
| 951 | 3300028379 | Ga0268266_10588223 | Ga0268266_105882232 | 245 |
| 952 | 3300028380 | Ga0268265_10000603 | Ga0268265_100006032 | 245 |
| 953 | 3300028380 | Ga0268265_10269350 | Ga0268265_102693501 | 245 |
| 954 | 3300028380 | Ga0268265_10301961 | Ga0268265_103019611 | 245 |
| 955 | 3300028381 | Ga0268264_10000430 | Ga0268264_1000043039 | 245 |
| 956 | 3300028381 | Ga0268264_10000660 | Ga0268264_1000066027 | 245 |
| 957 | 3300028381 | Ga0268264_10590034 | Ga0268264_105900341 | 245 |
| 958 | 3300028381 | Ga0268264_10922820 | Ga0268264_109228202 | 245 |
| 959 | 3300028563 | Ga0265319_1038153 | Ga0265319_10381531 | 245 |
| 960 | 3300028653 | Ga0265323_10002533 | Ga0265323_100025334 | 245 |
| 961 | 3300028654 | Ga0265322_10020623 | Ga0265322_100206232 | 245 |
| 962 | 3300028666 | Ga0265336_10001363 | Ga0265336_100013637 | 245 |
| 963 | 3300028786 | Ga0307517_10000772 | Ga0307517_1000077210 | 245 |
| 964 | 3300028794 | Ga0307515_10032886 | Ga0307515_100328866 | 245 |
| 965 | 3300028800 | Ga0265338_10000086 | Ga0265338_10000086168 | 245 |
| 966 | 3300029957 | Ga0265324_10004123 | Ga0265324_100041237 | 245 |
| 967 | 3300030521 | Ga0307511_10034642 | Ga0307511_100346424 | 245 |
| 968 | 3300030522 | Ga0307512_10209715 | Ga0307512_102097152 | 245 |
| 969 | 3300031235 | Ga0265330_10015512 | Ga0265330_100155124 | 245 |
| 970 | 3300031235 | Ga0265330_10025688 | Ga0265330_100256881 | 245 |
| 971 | 3300031235 | Ga0265330_10062916 | Ga0265330_100629162 | 245 |
| 972 | 3300031239 | Ga0265328_10021772 | Ga0265328_100217722 | 245 |
| 973 | 3300031241 | Ga0265325_10022969 | Ga0265325_100229692 | 245 |
| 974 | 3300031247 | Ga0265340_10003545 | Ga0265340_100035453 | 245 |
| 975 | 3300031249 | Ga0265339_10103891 | Ga0265339_101038911 | 245 |
| 976 | 3300031249 | Ga0265339_10167279 | Ga0265339_101672791 | 245 |
| 977 | 3300031249 | Ga0265339_10190466 | Ga0265339_101904661 | 245 |
| 978 | 3300031250 | Ga0265331_10082432 | Ga0265331_100824322 | 245 |
| 979 | 3300031250 | Ga0265331_10140782 | Ga0265331_101407821 | 245 |
| 980 | 3300031507 | Ga0307509_10108318 | Ga0307509_101083183 | 245 |
| 981 | 3300031507 | Ga0307509_10523715 | Ga0307509_105237152 | 245 |
| 982 | 3300031548 | Ga0307408_100347845 | Ga0307408_1003478452 | 245 |
| 983 | 3300031548 | Ga0307408_100364843 | Ga0307408_1003648431 | 245 |
| 984 | 3300031616 | Ga0307508_10000009 | Ga0307508_10000009116 | 245 |
| 985 | 3300031616 | Ga0307508_10035294 | Ga0307508_100352941 | 245 |
| 986 | 3300031616 | Ga0307508_10059744 | Ga0307508_100597444 | 245 |
| 987 | 3300031616 | Ga0307508_10516871 | Ga0307508_105168711 | 245 |
| 988 | 3300031711 | Ga0265314_10097683 | Ga0265314_100976833 | 245 |
| 989 | 3300031712 | Ga0265342_10023565 | Ga0265342_100235651 | 245 |
| 990 | 3300031712 | Ga0265342_10101215 | Ga0265342_101012152 | 245 |
| 991 | 3300031730 | Ga0307516_10033789 | Ga0307516_100337892 | 245 |
| 992 | 3300031730 | Ga0307516_10355669 | Ga0307516_103556691 | 245 |
| 993 | 3300031824 | Ga0307413_10111217 | Ga0307413_101112173 | 245 |
| 994 | 3300031852 | Ga0307410_10054864 | Ga0307410_100548643 | 245 |
| 995 | 3300031852 | Ga0307410_10432699 | Ga0307410_104326991 | 245 |
| 996 | 3300031901 | Ga0307406_10229220 | Ga0307406_102292202 | 245 |
| 997 | 3300031901 | Ga0307406_10284929 | Ga0307406_102849292 | 245 |
| 998 | 3300031903 | Ga0307407_10073614 | Ga0307407_100736142 | 245 |
| 999 | 3300032002 | Ga0307416_100925289 | Ga0307416_1009252892 | 245 |
| 1000 | 3300032005 | Ga0307411_10056429 | Ga0307411_100564292 | 245 |
| 1001 | 3300032126 | Ga0307415_100097693 | Ga0307415_1000976932 | 245 |
| 1002 | 3300032126 | Ga0307415_100153561 | Ga0307415_1001535613 | 245 |
| 1003 | 3300032126 | Ga0307415_100231745 | Ga0307415_1002317452 | 245 |
| 1004 | 3300033179 | Ga0307507_10061608 | Ga0307507_100616082 | 245 |
| 1005 | 3300033180 | Ga0307510_10009821 | Ga0307510_1000982113 | 245 |
| 1006 | 3300033180 | Ga0307510_10025487 | Ga0307510_100254874 | 245 |
| 1007 | 3300033180 | Ga0307510_10150825 | Ga0307510_101508253 | 245 |
| 1008 | 3300033442 | Ga0315911_1000001 | Ga0315911_100000135 | 245 |
| 1009 | 3300034819 | Ga0373958_0008632 | Ga0373958_0008632_591_1334 | 245 |
| 1010 | 3300034820 | Ga0373959_0051830 | Ga0373959_0051830_77_814 | 245 |
| 1011 | 3300035083 | Ga0373926_0021182 | Ga0373926_0021182_699_1436 | 245 |
| 1012 | 3300035083 | Ga0373926_0070555 | Ga0373926_0070555_282_1022 | 245 |
| 1013 | 3300035085 | Ga0373929_0048161 | Ga0373929_0048161_67_804 | 245 |
| 1014 | 3300035086 | Ga0373934_0033722 | Ga0373934_0033722_984_1721 | 245 |
| 1015 | 3300035086 | Ga0373934_0056566 | Ga0373934_0056566_175_912 | 245 |
| 1016 | 3300035088 | Ga0373940_0025623 | Ga0373940_0025623_691_1434 | 245 |
| 1017 | 3300035090 | Ga0373949_0012402 | Ga0373949_0012402_122_865 | 245 |
| 1018 | 3300035092 | Ga0373952_0087362 | Ga0373952_0087362_36_773 | 245 |
| 1019 | 3300035111 | Ga0373923_0028040 | Ga0373923_0028040_203_940 | 245 |
| 1020 | 3300035111 | Ga0373923_0178218 | Ga0373923_0178218_175_912 | 245 |
| 1021 | 3300035113 | Ga0373936_0006503 | Ga0373936_0006503_2702_3439 | 245 |
| 1022 | 3300035113 | Ga0373936_0014005 | Ga0373936_0014005_1239_1976 | 245 |
| 1023 | 3300035114 | Ga0373939_0004462 | Ga0373939_0004462_59_802 | 245 |
| 1024 | 3300035114 | Ga0373939_0004484 | Ga0373939_0004484_566_1309 | 245 |
| 1025 | 3300035115 | Ga0373941_0004526 | Ga0373941_0004526_337_1080 | 245 |
| 1026 | 3300035116 | Ga0373945_0106979 | Ga0373945_0106979_322_1062 | 245 |
| 1027 | 3300035117 | Ga0373953_0051764 | Ga0373953_0051764_114_851 | 245 |
| 1028 | 3300035118 | Ga0373954_0000070 | Ga0373954_0000070_13657_14394 | 245 |
| 1029 | 3300035118 | Ga0373954_0010716 | Ga0373954_0010716_562_1299 | 245 |
| 1030 | 3300035119 | Ga0373956_0001764 | Ga0373956_0001764_1323_2060 | 245 |
| 1031 | 3300035120 | Ga0373957_0002936 | Ga0373957_0002936_1309_2046 | 245 |
| 1032 | 3300035120 | Ga0373957_0007409 | Ga0373957_0007409_2761_3498 | 245 |
| 1033 | 3300035170 | Ga0373943_0007891 | Ga0373943_0007891_175_912 | 245 |
| 1034 | 3300035170 | Ga0373943_0012028 | Ga0373943_0012028_121_864 | 245 |
| 1035 | 3300035171 | Ga0373946_0003425 | Ga0373946_0003425_2987_3724 | 245 |
| 1036 | 3300035171 | Ga0373946_0129457 | Ga0373946_0129457_399_1142 | 245 |
| 1037 | 3300035172 | Ga0373955_0000771 | Ga0373955_0000771_8243_8980 | 245 |
| 1038 | 3300035172 | Ga0373955_0304793 | Ga0373955_0304793_54_794 | 245 |
| 1039 | 3300035207 | Ga0373942_0010230 | Ga0373942_0010230_1324_2067 | 245 |
| 1040 | 3300035241 | Ga0373961_0004030 | Ga0373961_0004030_985_1728 | 245 |
| 1041 | 3300035241 | Ga0373961_0083272 | Ga0373961_0083272_76_861 | 245 |
| 1042 | 3300035242 | Ga0373962_0008952 | Ga0373962_0008952_103_840 | 245 |
| 1043 | 3300035242 | Ga0373962_0010848 | Ga0373962_0010848_391_1134 | 245 |
| 1044 | 3300035242 | Ga0373962_0023849 | Ga0373962_0023849_448_1185 | 245 |
| 1045 | 3300035691 | Ga0373931_0000607 | Ga0373931_0000607_6718_7461 | 245 |
| 1046 | 3300035691 | Ga0373931_0001266 | Ga0373931_0001266_2705_3448 | 245 |
| 1047 | 3300035691 | Ga0373931_0007703 | Ga0373931_0007703_4002_4739 | 245 |
| 1048 | 3300035691 | Ga0373931_0314573 | Ga0373931_0314573_139_876 | 245 |
| 1049 | 3300035692 | Ga0373935_0011212 | Ga0373935_0011212_4219_4956 | 245 |
| 1050 | 3300035692 | Ga0373935_0051066 | Ga0373935_0051066_409_1149 | 245 |
| 1051 | 3300035695 | Ga0373927_0010404 | Ga0373927_0010404_3265_4005 | 245 |
| 1052 | 3300035695 | Ga0373927_0014740 | Ga0373927_0014740_1185_1925 | 245 |
| 1053 | 3300035695 | Ga0373927_0017386 | Ga0373927_0017386_393_1136 | 245 |
| 1054 | 3300035695 | Ga0373927_0026380 | Ga0373927_0026380_332_1069 | 245 |
| 1055 | 3300035724 | Ga0373933_0000041 | Ga0373933_0000041_74884_75621 | 245 |
| 1056 | 3300035724 | Ga0373933_0006540 | Ga0373933_0006540_4211_4948 | 245 |
| 1057 | 3300035724 | Ga0373933_0059443 | Ga0373933_0059443_917_1654 | 245 |
| 1058 | 3300035725 | Ga0373947_0002972 | Ga0373947_0002972_4924_5661 | 245 |
| 1059 | 3300035725 | Ga0373947_0014554 | Ga0373947_0014554_2855_3598 | 245 |
| 1060 | 3300035725 | Ga0373947_0106310 | Ga0373947_0106310_858_1601 | 245 |
| 1061 | 3300036401 | Ga0373937_0094288 | Ga0373937_0094288_963_1700 | 245 |
| 1062 | 3300036712 | Ga0316584_0040425 | Ga0316584_0040425_774_1517 | 245 |
| 1063 | 3300037068 | Ga0373925_0009598 | Ga0373925_0009598_2972_3712 | 245 |
| 1064 | 3300037068 | Ga0373925_0020921 | Ga0373925_0020921_1416_2153 | 245 |
| 1065 | 3300037068 | Ga0373925_0041246 | Ga0373925_0041246_161_901 | 245 |
| 1066 | 3300037068 | Ga0373925_0066262 | Ga0373925_0066262_1081_1821 | 245 |
| 1067 | 3300037068 | Ga0373925_0197742 | Ga0373925_0197742_726_1463 | 245 |
| 1068 | 3300037068 | Ga0373925_0293945 | Ga0373925_0293945_238_975 | 245 |
| 1069 | 3300037418 | Ga0395900_0001120 | Ga0395900_0001120_26833_27570 | 245 |
| 1070 | 3300037418 | Ga0395900_0045947 | Ga0395900_0045947_3263_4000 | 245 |
| 1071 | 3300037418 | Ga0395900_0129059 | Ga0395900_0129059_1425_2162 | 245 |
| 1072 | 3300037466 | Ga0395898_0045273 | Ga0395898_0045273_2370_3107 | 245 |
| 1073 | 3300037466 | Ga0395898_0069867 | Ga0395898_0069867_2432_3169 | 245 |
| 1074 | 3300037471 | Ga0395905_0018125 | Ga0395905_0018125_137_874 | 245 |
| 1075 | 3300037471 | Ga0395905_0106818 | Ga0395905_0106818_670_1407 | 245 |
| 1076 | 3300037471 | Ga0395905_0148343 | Ga0395905_0148343_113_850 | 245 |
| 1077 | 3300037471 | Ga0395905_0390657 | Ga0395905_0390657_211_948 | 245 |
| 1078 | 3300037853 | Ga0436364_0170010 | Ga0436364_0170010_849_1586 | 245 |
| 1079 | 3300037853 | Ga0436364_1378120 | Ga0436364_1378120_1851_2588 | 245 |
| 1080 | 3300038443 | Ga0395901_0125452 | Ga0395901_0125452_1926_2663 | 245 |
| 1081 | 3300038443 | Ga0395901_0196564 | Ga0395901_0196564_262_999 | 245 |
| 1082 | 3300038443 | Ga0395901_0204691 | Ga0395901_0204691_1040_1777 | 245 |
| 1083 | 3300039437 | Ga0436365_1136865 | Ga0436365_1136865_12476_13216 | 245 |
| 1084 | 3300039437 | Ga0436365_1391201 | Ga0436365_1391201_1018_1755 | 245 |
| 1085 | 3300039450 | Ga0436363_0476889 | Ga0436363_0476889_307_1050 | 245 |
| 1086 | 3300039450 | Ga0436363_1445688 | Ga0436363_1445688_588_1325 | 245 |
| 1087 | 3300039450 | Ga0436363_1599995 | Ga0436363_1599995_1299_2039 | 245 |
| 1088 | 3300039453 | Ga0436362_0188545 | Ga0436362_0188545_803_1543 | 245 |
| 1089 | 3300041413 | Ga0439465_0048874 | Ga0439465_0048874_570_1307 | 245 |
| 1090 | 3300041452 | Ga0451793_1390476 | Ga0451793_1390476_100_837 | 245 |
| 1091 | 3300041452 | Ga0451793_1584115 | Ga0451793_1584115_307_1110 | 245 |
| 1092 | 3300044658 | Ga0466972_0000343 | Ga0466972_0000343_4100_4837 | 245 |
| 1093 | 3300044658 | Ga0466972_0005717 | Ga0466972_0005717_1979_2716 | 245 |
| 1094 | 3300044683 | Ga0466965_0286029 | Ga0466965_0286029_40_777 | 245 |
| 1095 | 3300044684 | Ga0466966_0002698 | Ga0466966_0002698_6326_7063 | 245 |
| 1096 | 3300044684 | Ga0466966_0141667 | Ga0466966_0141667_302_1039 | 245 |
| 1097 | 3300044684 | Ga0466966_0417255 | Ga0466966_0417255_35_772 | 245 |
| 1098 | 3300044693 | Ga0466961_0002716 | Ga0466961_0002716_241_978 | 245 |
| 1099 | 3300044693 | Ga0466961_0016750 | Ga0466961_0016750_225_962 | 245 |
| 1100 | 3300044693 | Ga0466961_0073816 | Ga0466961_0073816_124_861 | 245 |
| 1101 | 3300044694 | Ga0466963_0065538 | Ga0466963_0065538_53_790 | 245 |
| 1102 | 3300044694 | Ga0466963_0083015 | Ga0466963_0083015_642_1379 | 245 |
| 1103 | 3300044706 | Ga0466964_0112908 | Ga0466964_0112908_321_1154 | 245 |
| 1104 | 3300044735 | Ga0466968_0011434 | Ga0466968_0011434_2375_3112 | 245 |
| 1105 | 3300044735 | Ga0466968_0264899 | Ga0466968_0264899_42_779 | 245 |
| 1106 | 3300044842 | Ga0466957_0115508 | Ga0466957_0115508_952_1689 | 245 |
| 1107 | 3300044842 | Ga0466957_0190507 | Ga0466957_0190507_481_1242 | 245 |
| 1108 | 3300044842 | Ga0466957_0472714 | Ga0466957_0472714_79_816 | 245 |
| 1109 | 3300044901 | Ga0466960_0008985 | Ga0466960_0008985_3294_4031 | 245 |
| 1110 | 3300045049 | Ga0466959_0006245 | Ga0466959_0006245_2941_3678 | 245 |
| 1111 | 3300045051 | Ga0451576_0000023 | Ga0451576_0000023_170878_171642 | 245 |
| 1112 | 3300045976 | Ga0466967_0099058 | Ga0466967_0099058_836_1573 | 245 |
| 1113 | 3300046452 | Ga0495617_084534 | Ga0495617_084534_183_920 | 245 |
| 1114 | 3300046454 | Ga0495592_0002858 | Ga0495592_0002858_1523_2260 | 245 |
| 1115 | 3300046455 | Ga0495603_0094425 | Ga0495603_0094425_882_1619 | 245 |
| 1116 | 3300046455 | Ga0495603_0150649 | Ga0495603_0150649_23_760 | 245 |
| 1117 | 3300046455 | Ga0495603_0202268 | Ga0495603_0202268_232_975 | 245 |
| 1118 | 3300046455 | Ga0495603_0250360 | Ga0495603_0250360_28_765 | 245 |
| 1119 | 3300046457 | Ga0495590_0070647 | Ga0495590_0070647_154_891 | 245 |
| 1120 | 3300046459 | Ga0495629_0002263 | Ga0495629_0002263_10373_11110 | 245 |
| 1121 | 3300046459 | Ga0495629_0006304 | Ga0495629_0006304_3279_4016 | 245 |
| 1122 | 3300046459 | Ga0495629_0176313 | Ga0495629_0176313_523_1260 | 245 |
| 1123 | 3300046460 | Ga0495638_0039968 | Ga0495638_0039968_565_1302 | 245 |
| 1124 | 3300046462 | Ga0495651_0001805 | Ga0495651_0001805_12586_13323 | 245 |
| 1125 | 3300046462 | Ga0495651_0063762 | Ga0495651_0063762_238_975 | 245 |
| 1126 | 3300046462 | Ga0495651_0233251 | Ga0495651_0233251_344_1081 | 245 |
| 1127 | 3300046463 | Ga0495653_0003677 | Ga0495653_0003677_6717_7454 | 245 |
| 1128 | 3300046471 | Ga0495650_0059622 | Ga0495650_0059622_740_1477 | 245 |
| 1129 | 3300046472 | Ga0495580_0017033 | Ga0495580_0017033_3744_4481 | 245 |
| 1130 | 3300046472 | Ga0495580_0321688 | Ga0495580_0321688_235_978 | 245 |
| 1131 | 3300046473 | Ga0495582_0119538 | Ga0495582_0119538_393_1130 | 245 |
| 1132 | 3300046473 | Ga0495582_0192093 | Ga0495582_0192093_81_818 | 245 |
| 1133 | 3300046475 | Ga0495639_0021582 | Ga0495639_0021582_765_1502 | 245 |
| 1134 | 3300046491 | Ga0495584_0100820 | Ga0495584_0100820_21_764 | 245 |
| 1135 | 3300046492 | Ga0495585_0033013 | Ga0495585_0033013_934_1671 | 245 |
| 1136 | 3300046492 | Ga0495585_0091044 | Ga0495585_0091044_606_1409 | 245 |
| 1137 | 3300046500 | Ga0495596_0136870 | Ga0495596_0136870_185_922 | 245 |
| 1138 | 3300046501 | Ga0495607_0094820 | Ga0495607_0094820_180_917 | 245 |
| 1139 | 3300046506 | Ga0495583_0158801 | Ga0495583_0158801_77_814 | 245 |
| 1140 | 3300046507 | Ga0495606_0138931 | Ga0495606_0138931_468_1205 | 245 |
| 1141 | 3300046507 | Ga0495606_0336310 | Ga0495606_0336310_29_766 | 245 |
| 1142 | 3300046511 | Ga0495608_0001870 | Ga0495608_0001870_2213_2950 | 245 |
| 1143 | 3300046511 | Ga0495608_0163141 | Ga0495608_0163141_283_1020 | 245 |
| 1144 | 3300046513 | Ga0495616_0059886 | Ga0495616_0059886_1117_1854 | 245 |
| 1145 | 3300046514 | Ga0495618_0006298 | Ga0495618_0006298_3002_3739 | 245 |
| 1146 | 3300046514 | Ga0495618_0096966 | Ga0495618_0096966_136_873 | 245 |
| 1147 | 3300046516 | Ga0495628_0002643 | Ga0495628_0002643_1442_2179 | 245 |
| 1148 | 3300046516 | Ga0495628_0036298 | Ga0495628_0036298_121_858 | 245 |
| 1149 | 3300046516 | Ga0495628_0108425 | Ga0495628_0108425_427_1164 | 245 |
| 1150 | 3300046516 | Ga0495628_0266364 | Ga0495628_0266364_334_1071 | 245 |
| 1151 | 3300046518 | Ga0495631_0024517 | Ga0495631_0024517_175_912 | 245 |
| 1152 | 3300046519 | Ga0495632_0089371 | Ga0495632_0089371_296_1033 | 245 |
| 1153 | 3300046519 | Ga0495632_0125868 | Ga0495632_0125868_208_945 | 245 |
| 1154 | 3300046522 | Ga0495643_0104353 | Ga0495643_0104353_177_914 | 245 |
| 1155 | 3300046523 | Ga0495644_0044125 | Ga0495644_0044125_292_1029 | 245 |
| 1156 | 3300046524 | Ga0495648_0015942 | Ga0495648_0015942_1375_2112 | 245 |
| 1157 | 3300046529 | Ga0495652_0038928 | Ga0495652_0038928_323_1060 | 245 |
| 1158 | 3300046529 | Ga0495652_0100660 | Ga0495652_0100660_1166_1903 | 245 |
| 1159 | 3300046529 | Ga0495652_0243593 | Ga0495652_0243593_275_1012 | 245 |
| 1160 | 3300046529 | Ga0495652_0267992 | Ga0495652_0267992_292_1029 | 245 |
| 1161 | 3300046531 | Ga0495665_0008508 | Ga0495665_0008508_3320_4057 | 245 |
| 1162 | 3300046533 | Ga0495640_0054419 | Ga0495640_0054419_1132_1869 | 245 |
| 1163 | 3300046533 | Ga0495640_0209956 | Ga0495640_0209956_312_1049 | 245 |
| 1164 | 3300046533 | Ga0495640_0256587 | Ga0495640_0256587_247_984 | 245 |
| 1165 | 3300046533 | Ga0495640_0393737 | Ga0495640_0393737_85_822 | 245 |
| 1166 | 3300046535 | Ga0495586_0034154 | Ga0495586_0034154_357_1094 | 245 |
| 1167 | 3300046536 | Ga0495587_0001351 | Ga0495587_0001351_11425_12162 | 245 |
| 1168 | 3300046536 | Ga0495587_0008371 | Ga0495587_0008371_3126_3863 | 245 |
| 1169 | 3300046537 | Ga0495598_0015089 | Ga0495598_0015089_740_1477 | 245 |
| 1170 | 3300046538 | Ga0495609_0035714 | Ga0495609_0035714_1340_2077 | 245 |
| 1171 | 3300046539 | Ga0495621_0042112 | Ga0495621_0042112_70_807 | 245 |
| 1172 | 3300046539 | Ga0495621_0105451 | Ga0495621_0105451_56_805 | 245 |
| 1173 | 3300046542 | Ga0495597_0070740 | Ga0495597_0070740_299_1036 | 245 |
| 1174 | 3300046543 | Ga0495645_0003263 | Ga0495645_0003263_5174_5911 | 245 |
| 1175 | 3300046557 | Ga0495622_0004261 | Ga0495622_0004261_157_897 | 245 |
| 1176 | 3300046557 | Ga0495622_0011772 | Ga0495622_0011772_179_1012 | 245 |
| 1177 | 3300046557 | Ga0495622_0070335 | Ga0495622_0070335_764_1501 | 245 |
| 1178 | 3300046558 | Ga0495633_0046592 | Ga0495633_0046592_582_1319 | 245 |
| 1179 | 3300046559 | Ga0495667_0000926 | Ga0495667_0000926_14139_14876 | 245 |
| 1180 | 3300046559 | Ga0495667_0057163 | Ga0495667_0057163_543_1280 | 245 |
| 1181 | 3300046615 | Ga0495656_0046205 | Ga0495656_0046205_223_960 | 245 |
| 1182 | 3300046615 | Ga0495656_0088311 | Ga0495656_0088311_438_1175 | 245 |
| 1183 | 3300046615 | Ga0495656_0089501 | Ga0495656_0089501_158_910 | 245 |
| 1184 | 3300046616 | Ga0495668_0159410 | Ga0495668_0159410_474_1211 | 245 |
| 1185 | 3300046616 | Ga0495668_0220075 | Ga0495668_0220075_182_919 | 245 |
| 1186 | 3300046642 | Ga0495634_0007605 | Ga0495634_0007605_680_1417 | 245 |
| 1187 | 3300046642 | Ga0495634_0029043 | Ga0495634_0029043_127_864 | 245 |
| 1188 | 3300046648 | Ga0495611_0101163 | Ga0495611_0101163_20_757 | 245 |
| 1189 | 3300046660 | Ga0495625_0121577 | Ga0495625_0121577_498_1235 | 245 |
| 1190 | 3300046663 | Ga0495635_0004483 | Ga0495635_0004483_4986_5723 | 245 |
| 1191 | 3300046663 | Ga0495635_0008512 | Ga0495635_0008512_4953_5690 | 245 |
| 1192 | 3300046663 | Ga0495635_0034757 | Ga0495635_0034757_1567_2304 | 245 |
| 1193 | 3300046664 | Ga0495659_0056929 | Ga0495659_0056929_681_1418 | 245 |
| 1194 | 3300046665 | Ga0495661_0197379 | Ga0495661_0197379_107_844 | 245 |
| 1195 | 3300046674 | Ga0495588_0033061 | Ga0495588_0033061_1432_2169 | 245 |
| 1196 | 3300046675 | Ga0495657_0001016 | Ga0495657_0001016_16810_17547 | 245 |
| 1197 | 3300046675 | Ga0495657_0020802 | Ga0495657_0020802_3209_3946 | 245 |
| 1198 | 3300046678 | Ga0495599_0000637 | Ga0495599_0000637_4935_5672 | 245 |
| 1199 | 3300046679 | Ga0495623_0210682 | Ga0495623_0210682_80_820 | 245 |
| 1200 | 3300046680 | Ga0495646_0001926 | Ga0495646_0001926_9748_10485 | 245 |
| 1201 | 3300046680 | Ga0495646_0111828 | Ga0495646_0111828_246_983 | 245 |
| 1202 | 3300046680 | Ga0495646_0136898 | Ga0495646_0136898_325_1062 | 245 |
| 1203 | 3300046681 | Ga0495647_0033614 | Ga0495647_0033614_470_1207 | 245 |
| 1204 | 3300046681 | Ga0495647_0180150 | Ga0495647_0180150_123_860 | 245 |
| 1205 | 3300046683 | Ga0495658_0018165 | Ga0495658_0018165_2518_3255 | 245 |
| 1206 | 3300046689 | Ga0495613_0076601 | Ga0495613_0076601_206_946 | 245 |
| 1207 | 3300046689 | Ga0495613_0220345 | Ga0495613_0220345_291_1028 | 245 |
| 1208 | 3300046690 | Ga0495624_0090063 | Ga0495624_0090063_314_1057 | 245 |
| 1209 | 3300046690 | Ga0495624_0338162 | Ga0495624_0338162_150_887 | 245 |
| 1210 | 3300046692 | Ga0495671_0188418 | Ga0495671_0188418_163_900 | 245 |
| 1211 | 3300046694 | Ga0495649_0101666 | Ga0495649_0101666_712_1449 | 245 |
| 1212 | 3300046794 | Ga0495589_0252077 | Ga0495589_0252077_59_796 | 245 |
| 1213 | 3300046809 | Ga0495600_0000352 | Ga0495600_0000352_1397_2134 | 245 |
| 1214 | 3300046809 | Ga0495600_0002398 | Ga0495600_0002398_4322_5059 | 245 |
| 1215 | 3300047315 | Ga0495581_0033070 | Ga0495581_0033070_411_1148 | 245 |
| 1216 | 3300047315 | Ga0495581_0214543 | Ga0495581_0214543_39_776 | 245 |
| 1217 | 3300047315 | Ga0495581_0223691 | Ga0495581_0223691_167_949 | 245 |
| 1218 | 3300047317 | Ga0495604_0013258 | Ga0495604_0013258_366_1103 | 245 |
| 1219 | 3300047317 | Ga0495604_0028514 | Ga0495604_0028514_2444_3181 | 245 |
| 1220 | 3300047317 | Ga0495604_0030928 | Ga0495604_0030928_303_1040 | 245 |
| 1221 | 3300047317 | Ga0495604_0177442 | Ga0495604_0177442_107_844 | 245 |
| 1222 | 3300047317 | Ga0495604_0264562 | Ga0495604_0264562_119_856 | 245 |
| 1223 | 3300047319 | Ga0495674_0075372 | Ga0495674_0075372_296_1033 | 245 |
| 1224 | 3300047319 | Ga0495674_0111988 | Ga0495674_0111988_1020_1757 | 245 |
| 1225 | 3300047319 | Ga0495674_0261177 | Ga0495674_0261177_197_937 | 245 |
| 1226 | 3300047320 | Ga0495672_0115619 | Ga0495672_0115619_188_925 | 245 |
| 1227 | 3300047320 | Ga0495672_0199726 | Ga0495672_0199726_162_899 | 245 |
| 1228 | 3300047321 | Ga0495676_0036897 | Ga0495676_0036897_2688_3425 | 245 |
| 1229 | 3300047322 | Ga0495680_0004188 | Ga0495680_0004188_4769_5506 | 245 |
| 1230 | 3300047322 | Ga0495680_0008983 | Ga0495680_0008983_772_1509 | 245 |
| 1231 | 3300047322 | Ga0495680_0173717 | Ga0495680_0173717_449_1189 | 245 |
| 1232 | 3300047323 | Ga0495683_0231937 | Ga0495683_0231937_30_767 | 245 |
| 1233 | 3300047443 | Ga0495687_005957 | Ga0495687_005957_6806_7543 | 245 |
| 1234 | 3300047444 | Ga0495675_0001543 | Ga0495675_0001543_8846_9583 | 245 |
| 1235 | 3300047444 | Ga0495675_0031466 | Ga0495675_0031466_156_893 | 245 |
| 1236 | 3300047446 | Ga0495679_053390 | Ga0495679_053390_358_1095 | 245 |
| 1237 | 3300047469 | Ga0495673_0019085 | Ga0495673_0019085_2096_2833 | 245 |
| 1238 | 3300047471 | Ga0495684_0000380 | Ga0495684_0000380_23512_24249 | 245 |
| 1239 | 3300047471 | Ga0495684_0008788 | Ga0495684_0008788_3083_3820 | 245 |
| 1240 | 3300047471 | Ga0495684_0043964 | Ga0495684_0043964_2480_3217 | 245 |
| 1241 | 3300047471 | Ga0495684_0066211 | Ga0495684_0066211_1479_2216 | 245 |
| 1242 | 3300047673 | Ga0495593_0001866 | Ga0495593_0001866_8251_8988 | 245 |
| 1243 | 3300047673 | Ga0495593_0006778 | Ga0495593_0006778_5335_6072 | 245 |
| 1244 | 3300048088 | Ga0495602_0021117 | Ga0495602_0021117_4769_5506 | 245 |
| 1245 | 3300048088 | Ga0495602_0036833 | Ga0495602_0036833_3209_3946 | 245 |
| 1246 | 3300048088 | Ga0495602_0167084 | Ga0495602_0167084_818_1555 | 245 |
| 1247 | 3300048088 | Ga0495602_0230709 | Ga0495602_0230709_520_1257 | 245 |
| 1248 | 3300048088 | Ga0495602_0370307 | Ga0495602_0370307_204_941 | 245 |
| 1249 | 3300048089 | Ga0495614_0080726 | Ga0495614_0080726_374_1111 | 245 |
| 1250 | 3300048903 | Ga0496100_0071960 | Ga0496100_0071960_1176_1919 | 245 |
| 1251 | 3300048903 | Ga0496100_0116730 | Ga0496100_0116730_321_1058 | 245 |
| 1252 | 3300048903 | Ga0496100_0139341 | Ga0496100_0139341_341_1078 | 245 |
| 1253 | 3300048903 | Ga0496100_0158901 | Ga0496100_0158901_371_1111 | 245 |
| 1254 | 3300048903 | Ga0496100_0192259 | Ga0496100_0192259_296_1033 | 245 |
| 1255 | 3300048903 | Ga0496100_0273941 | Ga0496100_0273941_410_1150 | 245 |
| 1256 | 3300048903 | Ga0496100_0492231 | Ga0496100_0492231_143_886 | 245 |
| 1257 | 3300048904 | Ga0496101_0027459 | Ga0496101_0027459_2528_3271 | 245 |
| 1258 | 3300048904 | Ga0496101_0036410 | Ga0496101_0036410_2496_3236 | 245 |
| 1259 | 3300048904 | Ga0496101_0051498 | Ga0496101_0051498_1234_1971 | 245 |
| 1260 | 3300048904 | Ga0496101_0094130 | Ga0496101_0094130_553_1335 | 245 |
| 1261 | 3300048904 | Ga0496101_0128539 | Ga0496101_0128539_341_1126 | 245 |
| 1262 | 3300048904 | Ga0496101_0215932 | Ga0496101_0215932_540_1277 | 245 |
| 1263 | 3300048905 | Ga0496102_0003736 | Ga0496102_0003736_9995_10777 | 245 |
| 1264 | 3300048905 | Ga0496102_0007094 | Ga0496102_0007094_2550_3293 | 245 |
| 1265 | 3300048905 | Ga0496102_0067848 | Ga0496102_0067848_22_762 | 245 |
| 1266 | 3300048905 | Ga0496102_0068168 | Ga0496102_0068168_895_1632 | 245 |
| 1267 | 3300048905 | Ga0496102_0073184 | Ga0496102_0073184_389_1126 | 245 |
| 1268 | 3300048905 | Ga0496102_0103319 | Ga0496102_0103319_254_991 | 245 |
| 1269 | 3300048905 | Ga0496102_0148180 | Ga0496102_0148180_15_752 | 245 |
| 1270 | 3300048905 | Ga0496102_0185345 | Ga0496102_0185345_207_944 | 245 |
| 1271 | 3300048905 | Ga0496102_0369674 | Ga0496102_0369674_548_1288 | 245 |
| 1272 | 3300048905 | Ga0496102_0467678 | Ga0496102_0467678_431_1168 | 245 |
| 1273 | 3300048905 | Ga0496102_0554667 | Ga0496102_0554667_236_973 | 245 |
| 1274 | 3300048905 | Ga0496102_0596754 | Ga0496102_0596754_177_920 | 245 |
| 1275 | 3300048906 | Ga0496103_0002281 | Ga0496103_0002281_10942_11724 | 245 |
| 1276 | 3300048906 | Ga0496103_0019281 | Ga0496103_0019281_3051_3788 | 245 |
| 1277 | 3300048906 | Ga0496103_0041350 | Ga0496103_0041350_1512_2255 | 245 |
| 1278 | 3300048906 | Ga0496103_0499854 | Ga0496103_0499854_24_761 | 245 |
| 1279 | 3300048907 | Ga0496104_0002223 | Ga0496104_0002223_1386_2129 | 245 |
| 1280 | 3300048907 | Ga0496104_0004213 | Ga0496104_0004213_6533_7270 | 245 |
| 1281 | 3300048907 | Ga0496104_0026939 | Ga0496104_0026939_878_1618 | 245 |
| 1282 | 3300048907 | Ga0496104_0088307 | Ga0496104_0088307_1364_2101 | 245 |
| 1283 | 3300048908 | Ga0496105_0013806 | Ga0496105_0013806_3596_4333 | 245 |
| 1284 | 3300048908 | Ga0496105_0015284 | Ga0496105_0015284_5048_5785 | 245 |
| 1285 | 3300048908 | Ga0496105_0102731 | Ga0496105_0102731_289_1071 | 245 |
| 1286 | 3300048908 | Ga0496105_0118488 | Ga0496105_0118488_102_845 | 245 |
| 1287 | 3300048908 | Ga0496105_0194084 | Ga0496105_0194084_581_1318 | 245 |
| 1288 | 3300048908 | Ga0496105_0209711 | Ga0496105_0209711_346_1083 | 245 |
| 1289 | 3300048908 | Ga0496105_0328596 | Ga0496105_0328596_464_1201 | 245 |
| 1290 | 3300048909 | Ga0496106_0000423 | Ga0496106_0000423_23342_24079 | 245 |
| 1291 | 3300048909 | Ga0496106_0000804 | Ga0496106_0000804_9933_10676 | 245 |
| 1292 | 3300048909 | Ga0496106_0000855 | Ga0496106_0000855_7453_8193 | 245 |
| 1293 | 3300048909 | Ga0496106_0100710 | Ga0496106_0100710_1167_1904 | 245 |
| 1294 | 3300048909 | Ga0496106_0250935 | Ga0496106_0250935_315_1055 | 245 |
| 1295 | 3300048909 | Ga0496106_0267167 | Ga0496106_0267167_147_890 | 245 |
| 1296 | 3300048909 | Ga0496106_0454142 | Ga0496106_0454142_40_777 | 245 |
| 1297 | 3300048909 | Ga0496106_0611555 | Ga0496106_0611555_73_810 | 245 |
| 1298 | 3300048910 | Ga0496107_0005141 | Ga0496107_0005141_2845_3582 | 245 |
| 1299 | 3300048910 | Ga0496107_0015807 | Ga0496107_0015807_2374_3156 | 245 |
| 1300 | 3300048910 | Ga0496107_0048963 | Ga0496107_0048963_1186_1929 | 245 |
| 1301 | 3300048910 | Ga0496107_0094132 | Ga0496107_0094132_786_1526 | 245 |
| 1302 | 3300048910 | Ga0496107_0261969 | Ga0496107_0261969_119_856 | 245 |
| 1303 | 3300048910 | Ga0496107_0606995 | Ga0496107_0606995_33_770 | 245 |
| 1304 | 3300048911 | Ga0496108_0009189 | Ga0496108_0009189_1426_2163 | 245 |
| 1305 | 3300048911 | Ga0496108_0039504 | Ga0496108_0039504_2717_3457 | 245 |
| 1306 | 3300048911 | Ga0496108_0042755 | Ga0496108_0042755_2111_2893 | 245 |
| 1307 | 3300048911 | Ga0496108_0080674 | Ga0496108_0080674_211_948 | 245 |
| 1308 | 3300048911 | Ga0496108_0190707 | Ga0496108_0190707_549_1292 | 245 |
| 1309 | 3300048912 | Ga0496109_0000393 | Ga0496109_0000393_29936_30673 | 245 |
| 1310 | 3300048912 | Ga0496109_0015089 | Ga0496109_0015089_4040_4876 | 245 |
| 1311 | 3300048912 | Ga0496109_0071997 | Ga0496109_0071997_2424_3161 | 245 |
| 1312 | 3300048912 | Ga0496109_0485686 | Ga0496109_0485686_114_851 | 245 |
| 1313 | 3300048912 | Ga0496109_0515970 | Ga0496109_0515970_293_1036 | 245 |
| 1314 | 3300048912 | Ga0496109_0610735 | Ga0496109_0610735_260_997 | 245 |
| 1315 | 3300048912 | Ga0496109_0730386 | Ga0496109_0730386_53_796 | 245 |
| 1316 | 3300048913 | Ga0496110_0030127 | Ga0496110_0030127_2599_3336 | 245 |
| 1317 | 3300048913 | Ga0496110_0041310 | Ga0496110_0041310_2313_3056 | 245 |
| 1318 | 3300048913 | Ga0496110_0041319 | Ga0496110_0041319_1020_1760 | 245 |
| 1319 | 3300048913 | Ga0496110_0086825 | Ga0496110_0086825_850_1587 | 245 |
| 1320 | 3300048913 | Ga0496110_0125847 | Ga0496110_0125847_1330_2070 | 245 |
| 1321 | 3300048913 | Ga0496110_0163723 | Ga0496110_0163723_1074_1856 | 245 |
| 1322 | 3300048913 | Ga0496110_0228679 | Ga0496110_0228679_316_1101 | 245 |
| 1323 | 3300048913 | Ga0496110_0336364 | Ga0496110_0336364_291_1028 | 245 |
| 1324 | 3300048913 | Ga0496110_0440488 | Ga0496110_0440488_30_767 | 245 |
| 1325 | 3300048913 | Ga0496110_0613564 | Ga0496110_0613564_53_790 | 245 |
| 1326 | 3300048914 | Ga0496111_0014960 | Ga0496111_0014960_4556_5299 | 245 |
| 1327 | 3300048914 | Ga0496111_0288845 | Ga0496111_0288845_258_995 | 245 |
| 1328 | 3300048914 | Ga0496111_0421523 | Ga0496111_0421523_189_926 | 245 |
| 1329 | 3300048915 | Ga0496112_0000021 | Ga0496112_0000021_56244_56981 | 245 |
| 1330 | 3300048915 | Ga0496112_0002518 | Ga0496112_0002518_10718_11458 | 245 |
| 1331 | 3300048915 | Ga0496112_0036381 | Ga0496112_0036381_2667_3404 | 245 |
| 1332 | 3300048915 | Ga0496112_0194986 | Ga0496112_0194986_1179_1916 | 245 |
| 1333 | 3300048915 | Ga0496112_0212293 | Ga0496112_0212293_961_1698 | 245 |
| 1334 | 3300048915 | Ga0496112_0586528 | Ga0496112_0586528_54_791 | 245 |
| 1335 | 3300048916 | Ga0496113_0004330 | Ga0496113_0004330_1700_2437 | 245 |
| 1336 | 3300048916 | Ga0496113_0020931 | Ga0496113_0020931_2022_2762 | 245 |
| 1337 | 3300048916 | Ga0496113_0263297 | Ga0496113_0263297_145_927 | 245 |
| 1338 | 3300048917 | Ga0496114_0056707 | Ga0496114_0056707_382_1164 | 245 |
| 1339 | 3300048917 | Ga0496114_0125008 | Ga0496114_0125008_14_751 | 245 |
| 1340 | 3300048917 | Ga0496114_0282791 | Ga0496114_0282791_21_767 | 245 |
| 1341 | 3300048917 | Ga0496114_0400891 | Ga0496114_0400891_272_1009 | 245 |
| 1342 | 3300048918 | Ga0496115_0001490 | Ga0496115_0001490_8318_9100 | 245 |
| 1343 | 3300048918 | Ga0496115_0004939 | Ga0496115_0004939_8337_9080 | 245 |
| 1344 | 3300048918 | Ga0496115_0027232 | Ga0496115_0027232_2430_3167 | 245 |
| 1345 | 3300048918 | Ga0496115_0033127 | Ga0496115_0033127_593_1333 | 245 |
| 1346 | 3300048918 | Ga0496115_0096997 | Ga0496115_0096997_97_834 | 245 |
| 1347 | 3300048918 | Ga0496115_0166225 | Ga0496115_0166225_487_1224 | 245 |
| 1348 | 3300048918 | Ga0496115_0483188 | Ga0496115_0483188_200_937 | 245 |
| 1349 | 3300048919 | Ga0496116_0059283 | Ga0496116_0059283_1322_2059 | 245 |
| 1350 | 3300048920 | Ga0496117_0081333 | Ga0496117_0081333_69_809 | 245 |
| 1351 | 3300048921 | Ga0496118_0006945 | Ga0496118_0006945_8370_9110 | 245 |
| 1352 | 3300048921 | Ga0496118_0155077 | Ga0496118_0155077_594_1331 | 245 |
| 1353 | 3300048921 | Ga0496118_0205827 | Ga0496118_0205827_22_759 | 245 |
| 1354 | 3300048921 | Ga0496118_0251253 | Ga0496118_0251253_83_820 | 245 |
| 1355 | 3300048922 | Ga0496119_0013974 | Ga0496119_0013974_190_927 | 245 |
| 1356 | 3300048922 | Ga0496119_0099425 | Ga0496119_0099425_581_1318 | 245 |
| 1357 | 3300048923 | Ga0496120_0048913 | Ga0496120_0048913_798_1550 | 245 |
| 1358 | 3300048924 | Ga0496121_0001335 | Ga0496121_0001335_2670_3407 | 245 |
| 1359 | 3300048924 | Ga0496121_0004369 | Ga0496121_0004369_3150_3890 | 245 |
| 1360 | 3300048924 | Ga0496121_0030188 | Ga0496121_0030188_3107_3844 | 245 |
| 1361 | 3300048924 | Ga0496121_0079960 | Ga0496121_0079960_1428_2165 | 245 |
| 1362 | 3300048924 | Ga0496121_0112460 | Ga0496121_0112460_1034_1771 | 245 |
| 1363 | 3300048924 | Ga0496121_0141908 | Ga0496121_0141908_677_1414 | 245 |
| 1364 | 3300048924 | Ga0496121_0207768 | Ga0496121_0207768_640_1377 | 245 |
| 1365 | 3300048924 | Ga0496121_0228373 | Ga0496121_0228373_30_767 | 245 |
| 1366 | 3300048924 | Ga0496121_0253991 | Ga0496121_0253991_138_875 | 245 |
| 1367 | 3300048924 | Ga0496121_0302030 | Ga0496121_0302030_128_865 | 245 |
| 1368 | 3300048924 | Ga0496121_0380760 | Ga0496121_0380760_36_773 | 245 |
| 1369 | 3300048927 | Ga0496124_0004332 | Ga0496124_0004332_15007_15747 | 245 |
| 1370 | 3300048928 | Ga0496125_0050828 | Ga0496125_0050828_2524_3261 | 245 |
| 1371 | 3300048928 | Ga0496125_0115226 | Ga0496125_0115226_1181_1918 | 245 |
| 1372 | 3300048928 | Ga0496125_0141205 | Ga0496125_0141205_107_844 | 245 |
| 1373 | 3300048928 | Ga0496125_0146064 | Ga0496125_0146064_23_760 | 245 |
| 1374 | 3300048928 | Ga0496125_0153610 | Ga0496125_0153610_736_1473 | 245 |
| 1375 | 3300048929 | Ga0496126_0006091 | Ga0496126_0006091_3354_4091 | 245 |
| 1376 | 3300048929 | Ga0496126_0006946 | Ga0496126_0006946_6968_7729 | 245 |
| 1377 | 3300048929 | Ga0496126_0012554 | Ga0496126_0012554_6553_7290 | 245 |
| 1378 | 3300048929 | Ga0496126_0046312 | Ga0496126_0046312_1373_2113 | 245 |
| 1379 | 3300048929 | Ga0496126_0066660 | Ga0496126_0066660_2339_3076 | 245 |
| 1380 | 3300048929 | Ga0496126_0113492 | Ga0496126_0113492_324_1061 | 245 |
| 1381 | 3300048929 | Ga0496126_0303484 | Ga0496126_0303484_501_1277 | 245 |
| 1382 | 3300048929 | Ga0496126_0375631 | Ga0496126_0375631_61_798 | 245 |
| 1383 | 3300048929 | Ga0496126_0481923 | Ga0496126_0481923_163_900 | 245 |
| 1384 | 3300049460 | Ga0495682_0010318 | Ga0495682_0010318_2699_3436 | 245 |
| 1385 | 3300049568 | Ga0501031_0000645 | Ga0501031_0000645_16440_17177 | 245 |
| 1386 | 3300049568 | Ga0501031_0050097 | Ga0501031_0050097_121_858 | 245 |
| 1387 | 3300049568 | Ga0501031_0303441 | Ga0501031_0303441_233_970 | 245 |
| 1388 | 3300049569 | Ga0501032_0000129 | Ga0501032_0000129_9936_10673 | 245 |
| 1389 | 3300049569 | Ga0501032_0093877 | Ga0501032_0093877_653_1390 | 245 |
| 1390 | 3300049570 | Ga0501033_0000113 | Ga0501033_0000113_8870_9607 | 245 |
| 1391 | 3300049570 | Ga0501033_0000983 | Ga0501033_0000983_20110_20847 | 245 |
| 1392 | 3300049571 | Ga0501034_0000503 | Ga0501034_0000503_60163_60900 | 245 |
| 1393 | 3300049572 | Ga0501036_0000232 | Ga0501036_0000232_30123_30860 | 245 |
| 1394 | 3300049572 | Ga0501036_0077945 | Ga0501036_0077945_1290_2033 | 245 |
| 1395 | 3300049572 | Ga0501036_0331001 | Ga0501036_0331001_394_1131 | 245 |
| 1396 | 3300049572 | Ga0501036_0378918 | Ga0501036_0378918_193_930 | 245 |
| 1397 | 3300049573 | Ga0501037_0000106 | Ga0501037_0000106_26595_27332 | 245 |
| 1398 | 3300049573 | Ga0501037_0002045 | Ga0501037_0002045_3677_4414 | 245 |
| 1399 | 3300049574 | Ga0501038_0000108 | Ga0501038_0000108_32691_33428 | 245 |
| 1400 | 3300049574 | Ga0501038_0252645 | Ga0501038_0252645_221_958 | 245 |
| 1401 | 3300049575 | Ga0501039_0000460 | Ga0501039_0000460_18902_19639 | 245 |
| 1402 | 3300049575 | Ga0501039_0029454 | Ga0501039_0029454_1205_1942 | 245 |
| 1403 | 3300049575 | Ga0501039_0075573 | Ga0501039_0075573_1639_2376 | 245 |
| 1404 | 3300049575 | Ga0501039_0295127 | Ga0501039_0295127_341_1084 | 245 |
| 1405 | 3300049576 | Ga0501040_0008115 | Ga0501040_0008115_164_901 | 245 |
| 1406 | 3300049576 | Ga0501040_0125050 | Ga0501040_0125050_11_748 | 245 |
| 1407 | 3300049577 | Ga0501041_0171081 | Ga0501041_0171081_291_1028 | 245 |
| 1408 | 3300049577 | Ga0501041_0294764 | Ga0501041_0294764_194_931 | 245 |
| 1409 | 3300049577 | Ga0501041_0365624 | Ga0501041_0365624_66_809 | 245 |
| 1410 | 3300049578 | Ga0501042_0031122 | Ga0501042_0031122_2897_3634 | 245 |
| 1411 | 3300049578 | Ga0501042_0486005 | Ga0501042_0486005_44_787 | 245 |
| 1412 | 3300049579 | Ga0501043_0000035 | Ga0501043_0000035_96809_97546 | 245 |
| 1413 | 3300049579 | Ga0501043_0102436 | Ga0501043_0102436_253_990 | 245 |
| 1414 | 3300049580 | Ga0501046_0027551 | Ga0501046_0027551_2081_2818 | 245 |
| 1415 | 3300049580 | Ga0501046_0032152 | Ga0501046_0032152_144_887 | 245 |
| 1416 | 3300049580 | Ga0501046_0045172 | Ga0501046_0045172_668_1405 | 245 |
| 1417 | 3300049580 | Ga0501046_0060099 | Ga0501046_0060099_26_769 | 245 |
| 1418 | 3300049580 | Ga0501046_0141250 | Ga0501046_0141250_329_1066 | 245 |
| 1419 | 3300049581 | Ga0501047_0000792 | Ga0501047_0000792_14801_15538 | 245 |
| 1420 | 3300049582 | Ga0501048_0000116 | Ga0501048_0000116_17275_18012 | 245 |
| 1421 | 3300049582 | Ga0501048_0293564 | Ga0501048_0293564_316_1059 | 245 |
| 1422 | 3300049583 | Ga0501067_0001402 | Ga0501067_0001402_10465_11202 | 245 |
| 1423 | 3300049583 | Ga0501067_0022473 | Ga0501067_0022473_2449_3192 | 245 |
| 1424 | 3300049583 | Ga0501067_0040323 | Ga0501067_0040323_1566_2303 | 245 |
| 1425 | 3300049584 | Ga0501068_0000014 | Ga0501068_0000014_45419_46156 | 245 |
| 1426 | 3300049584 | Ga0501068_0298048 | Ga0501068_0298048_211_954 | 245 |
| 1427 | 3300049585 | Ga0501069_0021145 | Ga0501069_0021145_1318_2055 | 245 |
| 1428 | 3300049587 | Ga0501071_0039219 | Ga0501071_0039219_456_1193 | 245 |
| 1429 | 3300049587 | Ga0501071_0042501 | Ga0501071_0042501_545_1282 | 245 |
| 1430 | 3300049587 | Ga0501071_0218478 | Ga0501071_0218478_683_1420 | 245 |
| 1431 | 3300049588 | Ga0501072_0000367 | Ga0501072_0000367_9914_10651 | 245 |
| 1432 | 3300049588 | Ga0501072_0111154 | Ga0501072_0111154_1077_1814 | 245 |
| 1433 | 3300049588 | Ga0501072_0216851 | Ga0501072_0216851_163_906 | 245 |
| 1434 | 3300049589 | Ga0501073_0000368 | Ga0501073_0000368_9475_10212 | 245 |
| 1435 | 3300049590 | Ga0501074_0001037 | Ga0501074_0001037_6753_7490 | 245 |
| 1436 | 3300049590 | Ga0501074_0238840 | Ga0501074_0238840_378_1115 | 245 |
| 1437 | 3300049590 | Ga0501074_0310490 | Ga0501074_0310490_171_914 | 245 |
| 1438 | 3300049591 | Ga0501075_0096517 | Ga0501075_0096517_940_1683 | 245 |
| 1439 | 3300049591 | Ga0501075_0139355 | Ga0501075_0139355_199_942 | 245 |
| 1440 | 3300049591 | Ga0501075_0151471 | Ga0501075_0151471_257_994 | 245 |
| 1441 | 3300049591 | Ga0501075_0446889 | Ga0501075_0446889_31_768 | 245 |
| 1442 | 3300049592 | Ga0501076_0015465 | Ga0501076_0015465_986_1729 | 245 |
| 1443 | 3300049592 | Ga0501076_0079891 | Ga0501076_0079891_1004_1747 | 245 |
| 1444 | 3300049592 | Ga0501076_0290632 | Ga0501076_0290632_134_871 | 245 |
| 1445 | 3300049592 | Ga0501076_0297003 | Ga0501076_0297003_134_871 | 245 |
| 1446 | 3300049593 | Ga0501077_0006376 | Ga0501077_0006376_841_1584 | 245 |
| 1447 | 3300049593 | Ga0501077_0402434 | Ga0501077_0402434_55_792 | 245 |
| 1448 | 3300049741 | Ga0501079_0005691 | Ga0501079_0005691_1503_2246 | 245 |
| 1449 | 3300049741 | Ga0501079_0006966 | Ga0501079_0006966_872_1609 | 245 |
| 1450 | 3300049741 | Ga0501079_0035935 | Ga0501079_0035935_3001_3744 | 245 |
| 1451 | 3300049741 | Ga0501079_0045958 | Ga0501079_0045958_2128_2871 | 245 |
| 1452 | 3300049741 | Ga0501079_0351092 | Ga0501079_0351092_302_1039 | 245 |
| 1453 | 3300049741 | Ga0501079_0572487 | Ga0501079_0572487_46_789 | 245 |
| 1454 | 3300049742 | Ga0501080_0000332 | Ga0501080_0000332_18938_19675 | 245 |
| 1455 | 3300049742 | Ga0501080_0019600 | Ga0501080_0019600_2895_3638 | 245 |
| 1456 | 3300049742 | Ga0501080_0094780 | Ga0501080_0094780_1711_2448 | 245 |
| 1457 | 3300049742 | Ga0501080_0240268 | Ga0501080_0240268_30_767 | 245 |
| 1458 | 3300049742 | Ga0501080_0710075 | Ga0501080_0710075_112_849 | 245 |
| 1459 | 3300049743 | Ga0501081_0026875 | Ga0501081_0026875_2951_3694 | 245 |
| 1460 | 3300049743 | Ga0501081_0043029 | Ga0501081_0043029_2111_2854 | 245 |
| 1461 | 3300049743 | Ga0501081_0067213 | Ga0501081_0067213_312_1049 | 245 |
| 1462 | 3300049743 | Ga0501081_0312410 | Ga0501081_0312410_357_1094 | 245 |
| 1463 | 3300049744 | Ga0501083_0003499 | Ga0501083_0003499_7878_8615 | 245 |
| 1464 | 3300049822 | Ga0501035_0011457 | Ga0501035_0011457_2492_3229 | 245 |
| 1465 | 3300049822 | Ga0501035_0017102 | Ga0501035_0017102_4109_4846 | 245 |
| 1466 | 3300049823 | Ga0501044_0000051 | Ga0501044_0000051_90693_91430 | 245 |
| 1467 | 3300049823 | Ga0501044_0060999 | Ga0501044_0060999_854_1591 | 245 |
| 1468 | 3300049824 | Ga0501045_0002440 | Ga0501045_0002440_7048_7785 | 245 |
| 1469 | 3300049824 | Ga0501045_0039923 | Ga0501045_0039923_751_1488 | 245 |
| 1470 | 3300049824 | Ga0501045_0062651 | Ga0501045_0062651_1867_2610 | 245 |
| 1471 | 3300049824 | Ga0501045_0439709 | Ga0501045_0439709_73_810 | 245 |
| 1472 | 3300050489 | nmdc:mga03683_174190_c1 | nmdc:mga03683_174190_c1_23_760 | 245 |
| 1473 | 3300050489 | nmdc:mga03683_244494_c1 | nmdc:mga03683_244494_c1_77_814 | 245 |
| 1474 | 3300050490 | nmdc:mga03n38_5710_c1 | nmdc:mga03n38_5710_c1_3011_3748 | 245 |
| 1475 | 3300050490 | nmdc:mga03n38_59835_c1 | nmdc:mga03n38_59835_c1_880_1617 | 245 |
| 1476 | 3300050491 | nmdc:mga00v17_257907_c1 | nmdc:mga00v17_257907_c1_92_829 | 245 |
| 1477 | 3300050491 | nmdc:mga00v17_73327_c1 | nmdc:mga00v17_73327_c1_850_1587 | 245 |
| 1478 | 3300050492 | nmdc:mga0yw44_167143_c1 | nmdc:mga0yw44_167143_c1_354_1091 | 245 |
| 1479 | 3300050492 | nmdc:mga0yw44_197784_c1 | nmdc:mga0yw44_197784_c1_30_767 | 245 |
| 1480 | 3300050492 | nmdc:mga0yw44_222687_c1 | nmdc:mga0yw44_222687_c1_358_1095 | 245 |
| 1481 | 3300050492 | nmdc:mga0yw44_52649_c1 | nmdc:mga0yw44_52649_c1_1327_2064 | 245 |
| 1482 | 3300050493 | nmdc:mga0k408_185814_c1 | nmdc:mga0k408_185814_c1_375_1208 | 245 |
| 1483 | 3300050493 | nmdc:mga0k408_222913_c1 | nmdc:mga0k408_222913_c1_135_872 | 245 |
| 1484 | 3300050493 | nmdc:mga0k408_62872_c1 | nmdc:mga0k408_62872_c1_1170_1907 | 245 |
| 1485 | 3300050494 | nmdc:mga06z11_175774_c1 | nmdc:mga06z11_175774_c1_225_962 | 245 |
| 1486 | 3300050494 | nmdc:mga06z11_21836_c1 | nmdc:mga06z11_21836_c1_216_953 | 245 |
| 1487 | 3300050494 | nmdc:mga06z11_218477_c1 | nmdc:mga06z11_218477_c1_186_923 | 245 |
| 1488 | 3300050495 | nmdc:mga04h51_22765_c1 | nmdc:mga04h51_22765_c1_1152_1889 | 245 |
| 1489 | 3300050496 | nmdc:mga07m45_121932_c1 | nmdc:mga07m45_121932_c1_627_1364 | 245 |
| 1490 | 3300050496 | nmdc:mga07m45_186818_c1 | nmdc:mga07m45_186818_c1_254_991 | 245 |
| 1491 | 3300050496 | nmdc:mga07m45_59246_c1 | nmdc:mga07m45_59246_c1_1226_1963 | 245 |
| 1492 | 3300050496 | nmdc:mga07m45_74206_c1 | nmdc:mga07m45_74206_c1_341_1078 | 245 |
| 1493 | 3300050507 | nmdc:mga05p37_81855_c1 | nmdc:mga05p37_81855_c1_179_922 | 245 |
| 1494 | 3300050508 | nmdc:mga09592_535495_c1 | nmdc:mga09592_535495_c1_137_874 | 245 |
| 1495 | 3300050510 | nmdc:mga06r32_1075_c1 | nmdc:mga06r32_1075_c1_15431_16174 | 245 |
| 1496 | 3300050510 | nmdc:mga06r32_155564_c1 | nmdc:mga06r32_155564_c1_861_1598 | 245 |
| 1497 | 3300050510 | nmdc:mga06r32_326574_c1 | nmdc:mga06r32_326574_c1_33_770 | 245 |
| 1498 | 3300050510 | nmdc:mga06r32_3555_c1 | nmdc:mga06r32_3555_c1_3573_4319 | 245 |
| 1499 | 3300050511 | nmdc:mga08y16_127561_c1 | nmdc:mga08y16_127561_c1_130_873 | 245 |
| 1500 | 3300050511 | nmdc:mga08y16_448288_c1 | nmdc:mga08y16_448288_c1_529_1272 | 245 |
| 1501 | 3300050511 | nmdc:mga08y16_61270_c1 | nmdc:mga08y16_61270_c1_3135_3881 | 245 |
| 1502 | 3300050512 | nmdc:mga0n895_42627_c1 | nmdc:mga0n895_42627_c1_533_1276 | 245 |
| 1503 | 3300050512 | nmdc:mga0n895_53114_c1 | nmdc:mga0n895_53114_c1_872_1609 | 245 |
| 1504 | 3300050513 | nmdc:mga0rr50_113428_c1 | nmdc:mga0rr50_113428_c1_1094_1837 | 245 |
| 1505 | 3300050513 | nmdc:mga0rr50_277170_c1 | nmdc:mga0rr50_277170_c1_340_1131 | 245 |
| 1506 | 3300050514 | nmdc:mga08x19_227468_c1 | nmdc:mga08x19_227468_c1_419_1156 | 245 |
| 1507 | 3300050515 | nmdc:mga0a205_114429_c1 | nmdc:mga0a205_114429_c1_1629_2372 | 245 |
| 1508 | 3300050515 | nmdc:mga0a205_44187_c1 | nmdc:mga0a205_44187_c1_1636_2379 | 245 |
| 1509 | 3300050515 | nmdc:mga0a205_449493_c1 | nmdc:mga0a205_449493_c1_276_1013 | 245 |
| 1510 | 3300053078 | Ga0495612_0048299 | Ga0495612_0048299_397_1134 | 245 |
| 1511 | 3300053079 | Ga0500610_0088184 | Ga0500610_0088184_159_896 | 245 |
| 1512 | 3300053079 | Ga0500610_0100993 | Ga0500610_0100993_351_1088 | 245 |
| 1513 | 3300053080 | Ga0500635_0001265 | Ga0500635_0001265_2168_2908 | 245 |
| 1514 | 3300053080 | Ga0500635_0006375 | Ga0500635_0006375_1199_1936 | 245 |
| 1515 | 3300053083 | Ga0495655_0001686 | Ga0495655_0001686_2553_3386 | 245 |
| 1516 | 3300053083 | Ga0495655_0021533 | Ga0495655_0021533_334_1071 | 245 |
| 1517 | 3300053083 | Ga0495655_0028819 | Ga0495655_0028819_304_1041 | 245 |
| 1518 | 3300053083 | Ga0495655_0054911 | Ga0495655_0054911_71_808 | 245 |
| 1519 | 3300053084 | Ga0495595_0021261 | Ga0495595_0021261_343_1080 | 245 |
| 1520 | 3300053084 | Ga0495595_0030388 | Ga0495595_0030388_1663_2400 | 245 |
| 1521 | 3300053085 | Ga0495619_0000355 | Ga0495619_0000355_20111_20848 | 245 |
| 1522 | 3300053085 | Ga0495619_0075033 | Ga0495619_0075033_1214_1951 | 245 |
| 1523 | 3300053085 | Ga0495619_0230882 | Ga0495619_0230882_385_1122 | 245 |
| 1524 | 3300053085 | Ga0495619_0366377 | Ga0495619_0366377_156_893 | 245 |
| 1525 | 3300053086 | Ga0500578_0086926 | Ga0500578_0086926_944_1681 | 245 |
| 1526 | 3300053086 | Ga0500578_0121475 | Ga0500578_0121475_597_1334 | 245 |
| 1527 | 3300053086 | Ga0500578_0191153 | Ga0500578_0191153_73_810 | 245 |
| 1528 | 3300053087 | Ga0500643_000032 | Ga0500643_000032_131959_132696 | 245 |
| 1529 | 3300053091 | Ga0500647_0100739 | Ga0500647_0100739_227_967 | 245 |
| 1530 | 3300053092 | Ga0500583_0091857 | Ga0500583_0091857_354_1091 | 245 |
| 1531 | 3300053094 | Ga0500566_0000026 | Ga0500566_0000026_70871_71608 | 245 |
| 1532 | 3300053094 | Ga0500566_0001584 | Ga0500566_0001584_9457_10194 | 245 |
| 1533 | 3300053094 | Ga0500566_0005873 | Ga0500566_0005873_6150_6890 | 245 |
| 1534 | 3300053094 | Ga0500566_0194899 | Ga0500566_0194899_257_994 | 245 |
| 1535 | 3300053095 | Ga0500640_002218 | Ga0500640_002218_3293_4030 | 245 |
| 1536 | 3300053096 | Ga0500641_0143999 | Ga0500641_0143999_22_759 | 245 |
| 1537 | 3300053097 | Ga0500648_116176 | Ga0500648_116176_249_986 | 245 |
| 1538 | 3300053098 | Ga0500650_0148713 | Ga0500650_0148713_35_772 | 245 |
| 1539 | 3300053104 | Ga0500556_0077074 | Ga0500556_0077074_499_1236 | 245 |
| 1540 | 3300053105 | Ga0500557_000087 | Ga0500557_000087_29226_29963 | 245 |
| 1541 | 3300053108 | Ga0500562_012186 | Ga0500562_012186_1044_1781 | 245 |
| 1542 | 3300053109 | Ga0500569_108113 | Ga0500569_108113_12_749 | 245 |
| 1543 | 3300053111 | Ga0500572_001308 | Ga0500572_001308_2978_3748 | 245 |
| 1544 | 3300053111 | Ga0500572_005714 | Ga0500572_005714_1310_2047 | 245 |
| 1545 | 3300053111 | Ga0500572_009314 | Ga0500572_009314_1339_2076 | 245 |
| 1546 | 3300053114 | Ga0500582_086169 | Ga0500582_086169_284_1021 | 245 |
| 1547 | 3300053115 | Ga0500591_065022 | Ga0500591_065022_863_1600 | 245 |
| 1548 | 3300053119 | Ga0500595_002640 | Ga0500595_002640_5709_6449 | 245 |
| 1549 | 3300053119 | Ga0500595_009653 | Ga0500595_009653_2279_3016 | 245 |
| 1550 | 3300053119 | Ga0500595_012338 | Ga0500595_012338_1123_1866 | 245 |
| 1551 | 3300053119 | Ga0500595_012635 | Ga0500595_012635_2130_2870 | 245 |
| 1552 | 3300053119 | Ga0500595_039261 | Ga0500595_039261_366_1103 | 245 |
| 1553 | 3300053120 | Ga0500597_125856 | Ga0500597_125856_12_845 | 245 |
| 1554 | 3300053122 | Ga0500608_003190 | Ga0500608_003190_4272_5009 | 245 |
| 1555 | 3300053122 | Ga0500608_199228 | Ga0500608_199228_44_781 | 245 |
| 1556 | 3300053123 | Ga0500614_000135 | Ga0500614_000135_2021_2758 | 245 |
| 1557 | 3300053130 | Ga0500642_0001017 | Ga0500642_0001017_3467_4204 | 245 |
| 1558 | 3300053130 | Ga0500642_0096705 | Ga0500642_0096705_313_1050 | 245 |
| 1559 | 3300053133 | Ga0500655_012393 | Ga0500655_012393_32_769 | 245 |
| 1560 | 3300053136 | Ga0500559_0000081 | Ga0500559_0000081_24959_25729 | 245 |
| 1561 | 3300053136 | Ga0500559_0009036 | Ga0500559_0009036_1293_2033 | 245 |
| 1562 | 3300053136 | Ga0500559_0010760 | Ga0500559_0010760_3056_3793 | 245 |
| 1563 | 3300053136 | Ga0500559_0021965 | Ga0500559_0021965_1519_2256 | 245 |
| 1564 | 3300053136 | Ga0500559_0093710 | Ga0500559_0093710_214_954 | 245 |
| 1565 | 3300053138 | Ga0500564_023225 | Ga0500564_023225_743_1480 | 245 |
| 1566 | 3300053139 | Ga0500568_0040631 | Ga0500568_0040631_1099_1836 | 245 |
| 1567 | 3300053140 | Ga0500573_0035456 | Ga0500573_0035456_830_1570 | 245 |
| 1568 | 3300053146 | Ga0500588_0031973 | Ga0500588_0031973_504_1241 | 245 |
| 1569 | 3300053147 | Ga0500589_093460 | Ga0500589_093460_397_1134 | 245 |
| 1570 | 3300053148 | Ga0500590_011029 | Ga0500590_011029_3148_3885 | 245 |
| 1571 | 3300053150 | Ga0500603_000591 | Ga0500603_000591_6278_7015 | 245 |
| 1572 | 3300053151 | Ga0500604_0051330 | Ga0500604_0051330_63_800 | 245 |
| 1573 | 3300053154 | Ga0500619_003290 | Ga0500619_003290_2295_3032 | 245 |
| 1574 | 3300053154 | Ga0500619_069727 | Ga0500619_069727_271_1011 | 245 |
| 1575 | 3300053155 | Ga0500620_001971 | Ga0500620_001971_1145_1882 | 245 |
| 1576 | 3300053156 | Ga0500622_0004721 | Ga0500622_0004721_2695_3432 | 245 |
| 1577 | 3300053159 | Ga0500630_000362 | Ga0500630_000362_1686_2423 | 245 |
| 1578 | 3300053162 | Ga0500638_033440 | Ga0500638_033440_227_967 | 245 |
| 1579 | 3300053162 | Ga0500638_050884 | Ga0500638_050884_1102_1839 | 245 |
| 1580 | 3300053162 | Ga0500638_071520 | Ga0500638_071520_215_952 | 245 |
| 1581 | 3300053162 | Ga0500638_109955 | Ga0500638_109955_468_1208 | 245 |
| 1582 | 3300053163 | Ga0500639_000939 | Ga0500639_000939_9463_10200 | 245 |
| 1583 | 3300053163 | Ga0500639_070182 | Ga0500639_070182_386_1156 | 245 |
| 1584 | 3300053177 | Ga0500636_0000276 | Ga0500636_0000276_27370_28107 | 245 |
| 1585 | 3300053177 | Ga0500636_0169880 | Ga0500636_0169880_197_934 | 245 |
| 1586 | 3300053178 | Ga0500637_0000122 | Ga0500637_0000122_4796_5536 | 245 |
| 1587 | 3300053178 | Ga0500637_0014625 | Ga0500637_0014625_1797_2537 | 245 |
| 1588 | 3300053725 | Ga0500576_023847 | Ga0500576_023847_1382_2152 | 245 |
| 1589 | 3300053728 | Ga0500657_017820 | Ga0500657_017820_1935_2675 | 245 |
| 1590 | 3300053729 | Ga0500625_007369 | Ga0500625_007369_3013_3750 | 245 |
| 1591 | 3300053731 | Ga0500609_002995 | Ga0500609_002995_833_1570 | 245 |
| 1592 | 3300053733 | Ga0500552_000509 | Ga0500552_000509_2392_3132 | 245 |
| 1593 | 3300053735 | Ga0500596_000713 | Ga0500596_000713_878_1648 | 245 |
| 1594 | 3300053735 | Ga0500596_002113 | Ga0500596_002113_126_863 | 245 |
| 1595 | 3300053736 | Ga0500599_003652 | Ga0500599_003652_302_1039 | 245 |
| 1596 | 3300054114 | Ga0501084_0000773 | Ga0501084_0000773_18644_19381 | 245 |
| 1597 | 3300054114 | Ga0501084_0004881 | Ga0501084_0004881_7853_8596 | 245 |
| 1598 | 3300054114 | Ga0501084_0016443 | Ga0501084_0016443_677_1414 | 245 |
| 1599 | 3300054114 | Ga0501084_0108206 | Ga0501084_0108206_691_1428 | 245 |
| 1600 | 3300054114 | Ga0501084_0163826 | Ga0501084_0163826_201_944 | 245 |
| 1601 | 3300055283 | Ga0500661_000317 | Ga0500661_000317_227_967 | 245 |
| 1602 | 3300060353 | Ga0501082_0000965 | Ga0501082_0000965_21753_22490 | 245 |
| 1603 | 3300060353 | Ga0501082_0013892 | Ga0501082_0013892_1118_1861 | 245 |
| 1604 | 3300060353 | Ga0501082_0081609 | Ga0501082_0081609_1710_2447 | 245 |
| 1605 | 3300060353 | Ga0501082_0160668 | Ga0501082_0160668_1146_1889 | 245 |
| 1606 | 3300060353 | Ga0501082_0223502 | Ga0501082_0223502_461_1204 | 245 |
| 1607 | 3300061719 | Ga0466962_0010405 | Ga0466962_0010405_129_866 | 245 |
| 1608 | 3300061734 | Ga0530510_0018748 | Ga0530510_0018748_3605_4348 | 245 |
| 1609 | 3300061734 | Ga0530510_0029015 | Ga0530510_0029015_2456_3193 | 245 |
| 1610 | 3300061734 | Ga0530510_0105275 | Ga0530510_0105275_985_1728 | 245 |
| 1611 | 3300061734 | Ga0530510_0159248 | Ga0530510_0159248_269_1006 | 245 |
| 1612 | 3300061734 | Ga0530510_0244493 | Ga0530510_0244493_224_961 | 245 |
| 1613 | 3300061734 | Ga0530510_0415839 | Ga0530510_0415839_18_755 | 245 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3enn-assembly1.cif.gz_B | 2.1a crystal structure of glucose/ribitol dehydrogenase from brucella melitensis (p43212) | 0.9891 | 1 | 245 |
| 3emk-assembly1.cif.gz_D | 2.5a crystal structure of glucose/ribitol dehydrogenase from brucella melitensis | 0.9864 | 1 | 245 |
| 3emk-assembly1.cif.gz_C | 2.5a crystal structure of glucose/ribitol dehydrogenase from brucella melitensis | 0.9855 | 1 | 245 |
| 3emk-assembly1.cif.gz_B | 2.5a crystal structure of glucose/ribitol dehydrogenase from brucella melitensis | 0.9853 | 1 | 245 |
| 3grp-assembly1.cif.gz_D | 2.1 angstrom crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from bartonella henselae | 0.9848 | 1 | 243 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ennB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9891 | 1 | 245 | 3.40.50.720 |
| af_Q0JDU3_1_168_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9879 | 79 | 244 | 3.40.50.720 |
| 3grpC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9809 | 1 | 243 | 3.40.50.720 |
| 3ennB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9729 | 1 | 245 | 3.40.50.720 |
| 3grpC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9719 | 1 | 243 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S5MFR3-F1-model_v4 | Beta-ketoacyl-ACP reductase | 0.9918 | 82 | 245 |
GO:0016491
|
| AF-A0A7Y6MVD7-F1-model_v4 | 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) | 0.99 | 1 | 244 |
GO:0004316
GO:0006633 GO:0051287 |
| AF-A0A7Y6MVD7-F1-model_v4 | 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) | 0.986 | 1 | 244 |
GO:0004316
GO:0006633 GO:0051287 |
| AF-A0A2S5MFR3-F1-model_v4 | Beta-ketoacyl-ACP reductase | 0.9859 | 82 | 245 |
GO:0016491
|
| AF-A0A850V1U6-F1-model_v4 | 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) | 0.9841 | 164 | 244 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar