F495058

General Info

Members Datasets Scaffolds Average Seq Length
1613 759 1371 244

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10478174|Ga0105238_104781741
Length 277
Sequence MHWPLPSRLKFAHDLSGKPLHAFPDRALEEFSMFDLTGKKALVTGATGGIGNAIAQALHAQGATVAISGTRKEVLDELAGKLGERTHVLPCNLSKADEVEALVPAAEAAMGQVDILVANAGITRDNLFVQLRDEDWEEVININLTSTFRLARAATKLMMRKRFGRIIAITSIVGVTGNPGQGNYTASKAGLIGMIKTLGAEYAKRGVTANCIAPGFIKTPMTDALNDKQRETILTKVPAARLGTPEDIAAAAVYLSSNEAAYVTGQTIHVNGGMAMI

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
10 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
11 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
12 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
13 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
14 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
15 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
16 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
17 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
18 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
19 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
20 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
21 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
22 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
23 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
24 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
25 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
26 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
27 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
28 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
29 2643221548 Streptomyces sp. Root55 Isolate Unclassified
30 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
31 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
32 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
33 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
34 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
35 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
36 2791355199
37 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
38 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
39 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
40 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
41 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
42 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
43 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
44 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
45 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
46 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
47 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
48 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
49 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
50 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
51 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
52 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
53 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
54 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
55 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
56 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
57 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
58 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
59 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
60 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
61 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
62 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
63 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
64 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
65 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
66 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
67 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
68 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
69 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
70 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
71 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
72 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
73 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
74 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
75 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
76 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
77 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
78 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
79 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
80 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
81 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
82 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
83 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
84 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
85 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
86 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
87 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
88 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
89 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
90 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
91 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
92 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
93 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
94 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
95 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
96 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
97 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
98 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
99 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
100 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
101 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
102 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
103 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
104 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
105 2904699407
106 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
107 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
108 2906610324
109 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
110 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
111 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
112 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
113 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
114 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
115 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
116 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
117 2922368715
118 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
119 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
120 2922425934
121 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
122 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
123 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
124 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
125 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
126 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
127 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
128 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
129 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
130 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
131 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
132 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
133 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
134 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
135 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
136 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
137 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
138 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
139 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
140 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
141 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
142 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
143 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
144 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
145 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
146 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
147 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
148 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
149 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
150 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
151 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
152 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
153 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
154 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
155 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
156 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
157 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
158 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
159 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
160 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
161 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
162 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
163 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
164 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
165 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
166 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
167 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
168 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
169 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
170 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
171 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
172 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
173 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
174 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
175 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
176 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
177 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
178 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
179 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
180 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
181 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
182 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
183 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
184 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
185 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
186 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
187 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
188 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
189 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
190 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
191 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
192 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
193 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
194 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
195 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
196 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
197 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
198 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
199 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
200 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
201 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
202 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
203 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
204 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
205 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
206 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
207 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
208 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
209 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
210 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
211 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
212 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
213 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
214 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
215 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
216 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
217 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
218 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
219 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
220 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
221 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
222 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
223 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
224 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
225 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
226 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
227 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
228 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
229 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
230 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
231 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
232 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
233 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
234 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
235 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
236 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
237 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
238 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
239 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
240 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
241 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
242 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
243 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
244 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
245 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
246 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
247 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
248 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
249 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
250 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
251 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
252 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
253 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
254 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
255 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
256 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
257 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
258 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
259 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
260 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
261 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
262 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
263 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
264 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
265 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
266 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
267 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
268 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
269 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
270 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
271 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
272 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
273 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
274 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
275 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
276 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
277 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
278 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
279 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
280 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
281 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
282 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
283 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
284 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
285 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
286 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
287 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
288 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
289 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
290 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
291 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
292 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
293 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
294 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
295 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
296 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
297 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
298 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
299 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
300 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
301 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
302 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
303 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
304 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
305 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
306 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
307 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
308 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
309 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
310 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
311 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
312 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
313 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
314 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
315 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
316 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
317 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
318 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
319 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
320 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
321 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
322 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
323 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
324 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
325 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
326 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
327 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
328 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
329 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
330 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
331 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
332 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
333 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
334 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
335 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
336 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
337 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
338 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
339 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
340 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
341 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
342 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
394 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
395 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
396 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
398 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
399 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
400 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
401 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
402 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
403 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
404 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
405 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
406 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
407 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
408 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
409 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
410 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
411 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
412 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
413 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
414 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
415 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
416 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
417 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
418 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
419 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
420 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
421 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
422 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
423 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
424 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
425 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
426 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
427 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
428 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
429 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
430 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
431 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
432 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
433 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
434 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
435 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
436 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
437 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
438 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
439 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
440 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
441 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
442 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
443 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
444 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
445 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
446 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
447 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
448 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
449 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
450 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
451 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
452 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
453 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
454 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
455 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
456 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
457 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
458 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
459 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
460 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
461 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
462 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
463 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
464 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
465 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
466 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
467 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
468 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
469 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
470 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
471 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
472 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
473 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
474 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
475 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
476 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
477 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
478 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
479 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
480 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
481 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
482 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
483 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
484 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
485 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
486 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
487 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
488 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
489 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
490 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
491 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
492 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
493 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
494 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
495 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
496 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
497 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
498 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
499 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
500 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
501 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
502 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
503 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
504 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
505 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
506 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
507 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
508 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
509 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
510 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
511 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
512 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
513 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
514 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
515 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
516 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
517 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
518 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
519 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
520 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
521 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
522 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
523 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
524 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
525 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
526 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
527 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
528 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
529 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
530 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
531 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
532 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
533 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
534 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
535 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
536 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
537 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
538 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
539 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
540 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
541 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
542 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
543 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
544 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
545 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
546 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
547 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
548 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
549 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
550 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
551 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
552 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
553 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
554 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
555 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
556 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
557 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
558 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
559 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
560 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
561 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
562 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
563 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
564 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
565 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
566 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
567 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
568 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
569 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
570 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
571 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
572 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
573 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
574 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
575 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
576 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
577 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
578 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
579 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
580 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
581 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
582 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
583 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
584 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
585 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
586 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
587 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
588 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
589 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
590 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
591 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
592 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
593 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
594 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
595 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
596 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
597 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
598 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
599 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
600 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
601 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
602 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
603 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
604 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
605 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
606 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
607 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
608 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
609 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
610 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
611 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
612 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
613 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
614 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
615 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
616 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
617 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
618 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
619 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
620 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
621 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
622 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
623 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
624 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
625 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
626 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
627 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
628 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
629 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
630 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
631 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
632 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
633 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
634 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
635 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
636 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
637 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
638 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
639 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
640 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
641 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
642 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
643 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
644 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
645 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
646 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
647 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
648 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
649 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
650 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
651 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
652 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
653 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
654 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
655 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
656 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
657 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
658 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
659 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
660 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
661 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
662 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
663 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
664 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
665 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
666 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
667 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
668 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
669 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
670 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
671 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
672 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
673 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
674 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
675 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
676 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
677 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
678 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
679 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
680 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
681 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
682 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
683 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
684 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
685 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
686 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
687 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
688 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
689 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
690 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
691 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
692 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
693 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
694 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
695 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
696 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
697 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
698 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
699 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
700 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
701 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
702 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
703 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
704 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
705 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
706 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
707 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
708 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
709 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
710 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
711 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
712 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
713 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
714 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
715 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
716 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
717 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
718 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
719 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
720 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
721 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
722 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
723 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
724 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
725 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
726 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
727 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
728 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
729 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
730 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
731 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
732 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
733 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
734 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
735 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
736 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
737 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
738 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
739 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
740 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
741 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
742 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
743 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
744 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
745 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
746 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
747 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
748 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
749 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
750 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
751 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
752 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
753 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
754 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
755 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
756 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
757 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
758 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
759 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.14
Metatranscriptomes 0.12
Isolates 14.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.61
Nodule 11.9
Rhizoplane 6.88
Rhizosphere 63.86
Stem 0
Stem Tuber 0
Unclassified 7.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10011915 3300001989 Bacteria 3200
2 JGI25406J46586_10000152 3300003203 Bacteria 30382
3 JGI25406J46586_10001897 3300003203 Bacteria 9844
4 JGI25153J46596_10001484 3300003215 Bacteria 13977
5 JGI25153J46596_10007366 3300003215 Bacteria 5426
6 JGI25153J46596_10010783 3300003215 Bacteria 4102
7 JGI25153J46596_10010984 3300003215 Bacteria 4041
8 JGI25160J50197_1003224 3300003354 Bacteria 7367
9 JGI25160J50197_1020832 3300003354 Bacteria 1967
10 JGI25404J52841_10011149 3300003659 Bacteria 1936
11 JGI25404J52841_10012715 3300003659 Bacteria 1824
12 Ga0055531_10027686 3300003794 Bacteria 1980
13 Ga0065165_1006665 3300005262 Bacteria 5960
14 Ga0065165_1009480 3300005262 Bacteria 4358
15 Ga0065165_1016313 3300005262 Bacteria 2787
16 Ga0065165_1044199 3300005262 Bacteria 1304
17 Ga0070658_10085134 3300005327 Bacteria 2600
18 Ga0070658_10109433 3300005327 Bacteria 2288
19 Ga0070676_10045474 3300005328 Bacteria 2557
20 Ga0070683_100009176 3300005329 Bacteria 8445
21 Ga0070683_100092374 3300005329 Bacteria 2843
22 Ga0070683_100421074 3300005329 Bacteria 1274
23 Ga0070670_100140336 3300005331 Bacteria 2089
24 Ga0070670_100444375 3300005331 Bacteria 1148
25 Ga0068869_100015964 3300005334 Bacteria 5053
26 Ga0068869_100099803 3300005334 Bacteria 2194
27 Ga0070680_100010915 3300005336 Bacteria 7018
28 Ga0070680_100016559 3300005336 Bacteria 5800
29 Ga0070680_100045774 3300005336 Bacteria 3558
30 Ga0070680_100058822 3300005336 Bacteria 3144
31 Ga0070680_100094910 3300005336 Bacteria 2472
32 Ga0070680_100289007 3300005336 Bacteria 1389
33 Ga0070682_100015561 3300005337 Bacteria 4411
34 Ga0070682_100136919 3300005337 Bacteria 1664
35 Ga0068868_100030944 3300005338 Bacteria 4106
36 Ga0068868_100063031 3300005338 Bacteria 2940
37 Ga0068868_100309414 3300005338 Bacteria 1344
38 Ga0068868_100329121 3300005338 Bacteria 1303
39 Ga0068868_100599677 3300005338 Bacteria 976
40 Ga0070660_100015177 3300005339 Bacteria 5557
41 Ga0070660_100636143 3300005339 Bacteria 893
42 Ga0070689_100388345 3300005340 Bacteria 1178
43 Ga0070691_10040873 3300005341 Bacteria 2192
44 Ga0070661_100068091 3300005344 Bacteria 2617
45 Ga0070661_100243529 3300005344 Bacteria 1385
46 Ga0070661_100519315 3300005344 Bacteria 955
47 Ga0070668_100062782 3300005347 Bacteria 2879
48 Ga0070668_100283512 3300005347 Bacteria 1384
49 Ga0070668_100361828 3300005347 Bacteria 1230
50 Ga0070668_100635831 3300005347 Bacteria 936
51 Ga0070668_100785394 3300005347 Bacteria 845
52 Ga0070669_100138429 3300005353 Bacteria 1874
53 Ga0070669_100187901 3300005353 Bacteria 1619
54 Ga0070675_100153835 3300005354 Bacteria 1973
55 Ga0070675_100681844 3300005354 Bacteria 935
56 Ga0070671_100055683 3300005355 Bacteria 3289
57 Ga0070671_100221809 3300005355 Bacteria 1604
58 Ga0070674_100451175 3300005356 Bacteria 1061
59 Ga0070688_100023990 3300005365 Bacteria 3593
60 Ga0070688_100069711 3300005365 Bacteria 2246
61 Ga0070688_100219130 3300005365 Bacteria 1340
62 Ga0070688_100413870 3300005365 Bacteria 1000
63 Ga0070659_100448068 3300005366 Bacteria 1095
64 Ga0070667_100044451 3300005367 Bacteria 3731
65 Ga0070667_100192490 3300005367 Bacteria 1807
66 Ga0070709_10000348 3300005434 Bacteria 28698
67 Ga0070709_10389736 3300005434 Bacteria 1038
68 Ga0070709_10491369 3300005434 Bacteria 931
69 Ga0070714_100185256 3300005435 Bacteria 1896
70 Ga0070714_100372649 3300005435 Bacteria 1344
71 Ga0070713_100030721 3300005436 Bacteria 4270
72 Ga0070713_100131727 3300005436 Bacteria 2206
73 Ga0070713_100159978 3300005436 Bacteria 2009
74 Ga0070710_10001018 3300005437 Bacteria 13295
75 Ga0070710_10025298 3300005437 Bacteria 3143
76 Ga0070701_10001976 3300005438 Bacteria 7767
77 Ga0070711_100003777 3300005439 Bacteria 8882
78 Ga0070711_100017214 3300005439 Bacteria 4599
79 Ga0070711_100017253 3300005439 Bacteria 4595
80 Ga0070711_100017385 3300005439 Bacteria 4577
81 Ga0070711_100035090 3300005439 Bacteria 3350
82 Ga0070705_100000184 3300005440 Bacteria 36475
83 Ga0070705_100075838 3300005440 Bacteria 2048
84 Ga0070705_100144563 3300005440 Bacteria 1570
85 Ga0070700_100020538 3300005441 Bacteria 3827
86 Ga0070700_100170257 3300005441 Bacteria 1507
87 Ga0070700_100343007 3300005441 Bacteria 1105
88 Ga0070694_100001319 3300005444 Bacteria 14437
89 Ga0070694_100072822 3300005444 Bacteria 2371
90 Ga0070708_100164554 3300005445 Bacteria 2068
91 Ga0070663_100004200 3300005455 Bacteria 8424
92 Ga0070663_100033806 3300005455 Bacteria 3535
93 Ga0070663_100075413 3300005455 Bacteria 2465
94 Ga0070663_100089460 3300005455 Bacteria 2279
95 Ga0070663_100124014 3300005455 Bacteria 1954
96 Ga0070663_100679846 3300005455 Bacteria 873
97 Ga0070678_100057626 3300005456 Bacteria 2847
98 Ga0070678_100074209 3300005456 Bacteria 2556
99 Ga0070678_100184789 3300005456 Bacteria 1709
100 Ga0070678_100236001 3300005456 Bacteria 1527
101 Ga0070678_100351573 3300005456 Bacteria 1267
102 Ga0070662_100407110 3300005457 Bacteria 1123
103 Ga0070681_10018832 3300005458 Bacteria 6909
104 Ga0070681_10032485 3300005458 Bacteria 5238
105 Ga0070681_10040909 3300005458 Bacteria 4644
106 Ga0070681_10072055 3300005458 Bacteria 3418
107 Ga0070681_10171363 3300005458 Bacteria 2092
108 Ga0070706_100439610 3300005467 Bacteria 1214
109 Ga0070698_100110518 3300005471 Bacteria 2714
110 Ga0070699_100006925 3300005518 Bacteria 9856
111 Ga0070679_100070394 3300005530 Bacteria 3490
112 Ga0070679_100096351 3300005530 Bacteria 2946
113 Ga0070679_100101490 3300005530 Bacteria 2864
114 Ga0070679_100135666 3300005530 Bacteria 2442
115 Ga0070679_100212367 3300005530 Bacteria 1898
116 Ga0070679_100392242 3300005530 Bacteria 1334
117 Ga0070684_100000716 3300005535 Bacteria 22930
118 Ga0070684_100013944 3300005535 Bacteria 6495
119 Ga0070697_100004908 3300005536 Bacteria 10262
120 Ga0070697_100021627 3300005536 Bacteria 5099
121 Ga0068853_100037777 3300005539 Bacteria 4110
122 Ga0068853_100303436 3300005539 Bacteria 1476
123 Ga0068853_100332698 3300005539 Bacteria 1410
124 Ga0068853_100420193 3300005539 Bacteria 1254
125 Ga0070686_100251212 3300005544 Bacteria 1292
126 Ga0070695_100000587 3300005545 Bacteria 19221
127 Ga0070696_100001650 3300005546 Bacteria 14632
128 Ga0070696_100110800 3300005546 Bacteria 1976
129 Ga0070693_100133101 3300005547 Bacteria 1557
130 Ga0070665_100030276 3300005548 Bacteria 5447
131 Ga0070665_100055908 3300005548 Bacteria 3957
132 Ga0070665_100062937 3300005548 Bacteria 3720
133 Ga0070665_100075430 3300005548 Bacteria 3379
134 Ga0070665_100148070 3300005548 Bacteria 2350
135 Ga0070665_100273328 3300005548 Bacteria 1691
136 Ga0070665_100371790 3300005548 Bacteria 1436
137 Ga0070704_100000206 3300005549 Bacteria 24525
138 Ga0068855_100016984 3300005563 Bacteria 8753
139 Ga0068855_100019039 3300005563 Bacteria 8252
140 Ga0068855_100058060 3300005563 Bacteria 4533
141 Ga0068855_100089413 3300005563 Bacteria 3556
142 Ga0068855_100093587 3300005563 Bacteria 3465
143 Ga0068855_100157409 3300005563 Bacteria 2580
144 Ga0068855_100164567 3300005563 Bacteria 2515
145 Ga0068855_100186299 3300005563 Bacteria 2344
146 Ga0068855_100209861 3300005563 Bacteria 2189
147 Ga0068855_100367294 3300005563 Bacteria 1582
148 Ga0068855_100720381 3300005563 Bacteria 1066
149 Ga0070664_100195015 3300005564 Bacteria 1805
150 Ga0068857_100002509 3300005577 Bacteria 15020
151 Ga0068857_100003141 3300005577 Bacteria 13673
152 Ga0068857_100037702 3300005577 Bacteria 4283
153 Ga0068857_100106490 3300005577 Bacteria 2518
154 Ga0068857_100354273 3300005577 Bacteria 1359
155 Ga0068854_100234774 3300005578 Bacteria 1457
156 Ga0068856_100000205 3300005614 Bacteria 63226
157 Ga0068856_100033304 3300005614 Bacteria 5044
158 Ga0068856_100066935 3300005614 Bacteria 3550
159 Ga0068856_100121604 3300005614 Bacteria 2612
160 Ga0068856_100126813 3300005614 Bacteria 2556
161 Ga0068856_100244008 3300005614 Bacteria 1811
162 Ga0068856_100352890 3300005614 Bacteria 1489
163 Ga0068856_100435430 3300005614 Bacteria 1331
164 Ga0070702_100048741 3300005615 Bacteria 2412
165 Ga0068852_100041102 3300005616 Bacteria 3906
166 Ga0068852_100188264 3300005616 Bacteria 1945
167 Ga0068852_100400846 3300005616 Bacteria 1349
168 Ga0068852_100461050 3300005616 Bacteria 1260
169 Ga0068852_100773042 3300005616 Bacteria 973
170 Ga0068859_100072341 3300005617 Bacteria 3485
171 Ga0068859_100092646 3300005617 Bacteria 3073
172 Ga0068859_100392746 3300005617 Bacteria 1483
173 Ga0068859_100713107 3300005617 Bacteria 1093
174 Ga0068864_100027216 3300005618 Bacteria 4826
175 Ga0068864_100110644 3300005618 Bacteria 2446
176 Ga0068864_100372035 3300005618 Bacteria 1352
177 Ga0068864_100377671 3300005618 Bacteria 1342
178 Ga0068864_100524381 3300005618 Bacteria 1142
179 Ga0068861_100022098 3300005719 Bacteria 4579
180 Ga0068861_100070911 3300005719 Bacteria 2700
181 Ga0068861_100072212 3300005719 Bacteria 2677
182 Ga0068861_100125966 3300005719 Bacteria 2072
183 Ga0068861_100416924 3300005719 Bacteria 1195
184 Ga0068861_100463597 3300005719 Bacteria 1138
185 Ga0068851_10004835 3300005834 Bacteria 6095
186 Ga0068851_10008966 3300005834 Bacteria 4641
187 Ga0068851_10126831 3300005834 Bacteria 1377
188 Ga0068863_100377740 3300005841 Bacteria 1383
189 Ga0068863_100807019 3300005841 Bacteria 936
190 Ga0068858_100240414 3300005842 Bacteria 1718
191 Ga0068858_100258161 3300005842 Bacteria 1656
192 Ga0068858_100480766 3300005842 Bacteria 1199
193 Ga0068858_100513421 3300005842 Bacteria 1158
194 Ga0068858_100595031 3300005842 Bacteria 1073
195 Ga0068860_100000316 3300005843 Bacteria 65709
196 Ga0068860_100002287 3300005843 Bacteria 20134
197 Ga0068860_100113422 3300005843 Bacteria 2592
198 Ga0068860_100179282 3300005843 Bacteria 2048
199 Ga0068860_100238704 3300005843 Bacteria 1768
200 Ga0068862_100000157 3300005844 Bacteria 76001
201 Ga0068862_100178558 3300005844 Bacteria 1904
202 Ga0068862_100299043 3300005844 Bacteria 1480
203 Ga0068862_100302627 3300005844 Bacteria 1471
204 Ga0081455_10000179 3300005937 Bacteria 79869
205 Ga0081455_10002652 3300005937 Bacteria 21173
206 Ga0081455_10003466 3300005937 Bacteria 18131
207 Ga0081455_10003832 3300005937 Bacteria 17150
208 Ga0081455_10027258 3300005937 Bacteria 5236
209 Ga0081538_10082973 3300005981 Bacteria 1696
210 Ga0081540_1000500 3300005983 Bacteria 38559
211 Ga0081540_1005905 3300005983 Bacteria 9036
212 Ga0081540_1006800 3300005983 Bacteria 8265
213 Ga0081540_1009855 3300005983 Bacteria 6531
214 Ga0081540_1013838 3300005983 Bacteria 5218
215 Ga0081540_1015121 3300005983 Bacteria 4898
216 Ga0081540_1015390 3300005983 Bacteria 4845
217 Ga0081540_1015394 3300005983 Bacteria 4845
218 Ga0081540_1017128 3300005983 Bacteria 4498
219 Ga0081540_1041100 3300005983 Bacteria 2401
220 Ga0081540_1108864 3300005983 Bacteria 1177
221 Ga0081539_10000273 3300005985 Bacteria 117936
222 Ga0081539_10000735 3300005985 Bacteria 65597
223 Ga0081539_10013306 3300005985 Bacteria 6210
224 Ga0081539_10047212 3300005985 Bacteria 2461
225 Ga0070717_10001338 3300006028 Bacteria 16934
226 Ga0070717_10082183 3300006028 Bacteria 2706
227 Ga0075365_10239715 3300006038 Bacteria 1274
228 Ga0075365_10243393 3300006038 Bacteria 1263
229 Ga0075365_10293262 3300006038 Bacteria 1144
230 Ga0075365_10358951 3300006038 Bacteria 1027
231 Ga0075368_10044167 3300006042 Bacteria 1757
232 Ga0075363_100009382 3300006048 Bacteria 4599
233 Ga0075363_100016047 3300006048 Bacteria 3694
234 Ga0075363_100072931 3300006048 Bacteria 1867
235 Ga0075364_10251397 3300006051 Bacteria 1201
236 Ga0075364_10270098 3300006051 Bacteria 1157
237 Ga0075364_10328620 3300006051 Bacteria 1041
238 Ga0070715_10119267 3300006163 Bacteria 1255
239 Ga0070716_100001393 3300006173 Bacteria 10721
240 Ga0070716_100053034 3300006173 Bacteria 2311
241 Ga0070716_100091457 3300006173 Bacteria 1842
242 Ga0070716_100156068 3300006173 Bacteria 1474
243 Ga0070712_100003228 3300006175 Bacteria 10049
244 Ga0070712_100205018 3300006175 Bacteria 1552
245 Ga0070712_100276691 3300006175 Bacteria 1351
246 Ga0075362_10124679 3300006177 Bacteria 1221
247 Ga0075367_10017879 3300006178 Bacteria 3900
248 Ga0075367_10162835 3300006178 Bacteria 1387
249 Ga0075367_10262457 3300006178 Bacteria 1084
250 Ga0075369_10068263 3300006186 Bacteria 1562
251 Ga0075366_10135616 3300006195 Bacteria 1486
252 Ga0075366_10136140 3300006195 Bacteria 1483
253 Ga0075366_10182887 3300006195 Bacteria 1273
254 Ga0075366_10355416 3300006195 Bacteria 899
255 Ga0097621_100283602 3300006237 Bacteria 1458
256 Ga0075370_10034969 3300006353 Bacteria 2818
257 Ga0075370_10166921 3300006353 Bacteria 1293
258 Ga0068871_100029523 3300006358 Bacteria 4307
259 Ga0068871_100197001 3300006358 Bacteria 1738
260 Ga0075428_100063252 3300006844 Bacteria 4051
261 Ga0075428_100096395 3300006844 Bacteria 3224
262 Ga0075428_100478331 3300006844 Bacteria 1333
263 Ga0075430_100000460 3300006846 Bacteria 30410
264 Ga0075430_100064268 3300006846 Bacteria 3083
265 Ga0075431_100000618 3300006847 Bacteria 30007
266 Ga0075431_100000844 3300006847 Bacteria 26847
267 Ga0075431_100006976 3300006847 Bacteria 11232
268 Ga0075431_100282644 3300006847 Bacteria 1680
269 Ga0075431_100282684 3300006847 Bacteria 1680
270 Ga0075431_100556640 3300006847 Bacteria 1134
271 Ga0075433_10001926 3300006852 Bacteria 15619
272 Ga0075434_100000993 3300006871 Bacteria 22983
273 Ga0075434_100016830 3300006871 Bacteria 7034
274 Ga0075434_100130106 3300006871 Bacteria 2535
275 Ga0075429_100235466 3300006880 Bacteria 1604
276 Ga0068865_100542563 3300006881 Bacteria 975
277 Ga0075436_100042779 3300006914 Bacteria 3124
278 Ga0097620_100072342 3300006931 Bacteria 3485
279 Ga0097620_100092641 3300006931 Bacteria 3073
280 Ga0097620_100392713 3300006931 Bacteria 1483
281 Ga0097620_100713125 3300006931 Bacteria 1093
282 Ga0099825_1036129 3300006941 Bacteria 1721
283 Ga0099824_1019396 3300006942 Bacteria 5308
284 Ga0099824_1044365 3300006942 Bacteria 964
285 Ga0099822_1002380 3300006943 Bacteria 23355
286 Ga0075435_100125140 3300007076 Bacteria 2148
287 Ga0099795_10109057 3300007788 Bacteria 1095
288 Ga0105250_10173880 3300009092 Bacteria 902
289 Ga0105240_10008011 3300009093 Bacteria 15216
290 Ga0105240_10035111 3300009093 Bacteria 6465
291 Ga0105240_10035437 3300009093 Bacteria 6431
292 Ga0105240_10036454 3300009093 Bacteria 6326
293 Ga0105240_10387695 3300009093 Bacteria 1576
294 Ga0105240_10406209 3300009093 Bacteria 1533
295 Ga0111539_10005028 3300009094 Bacteria 17187
296 Ga0111539_10044229 3300009094 Bacteria 5335
297 Ga0111539_10052427 3300009094 Bacteria 4856
298 Ga0105245_10372479 3300009098 Bacteria 1420
299 Ga0105245_10376463 3300009098 Bacteria 1413
300 Ga0105245_10660278 3300009098 Bacteria 1076
301 Ga0105247_10015353 3300009101 Bacteria 4588
302 Ga0105247_10078191 3300009101 Bacteria 2080
303 Ga0105247_10232179 3300009101 Bacteria 1253
304 Ga0114129_10092734 3300009147 Bacteria 4184
305 Ga0114129_10110252 3300009147 Bacteria 3799
306 Ga0114129_10135904 3300009147 Bacteria 3373
307 Ga0105243_10082405 3300009148 Bacteria 2629
308 Ga0105243_10689448 3300009148 Bacteria 994
309 Ga0105241_10019598 3300009174 Bacteria 4990
310 Ga0105242_10566557 3300009176 Bacteria 1092
311 Ga0105242_10829096 3300009176 Bacteria 918
312 Ga0105248_10130363 3300009177 Bacteria 2837
313 Ga0105248_10183906 3300009177 Bacteria 2355
314 Ga0105248_10199477 3300009177 Bacteria 2254
315 Ga0105248_10265803 3300009177 Bacteria 1931
316 Ga0105248_10290770 3300009177 Bacteria 1840
317 Ga0105248_10685886 3300009177 Bacteria 1156
318 Ga0105237_10017852 3300009545 Bacteria 7354
319 Ga0105237_10023811 3300009545 Bacteria 6268
320 Ga0105237_10033114 3300009545 Bacteria 5235
321 Ga0105237_10059905 3300009545 Bacteria 3808
322 Ga0105237_10082613 3300009545 Bacteria 3203
323 Ga0105237_10281961 3300009545 Bacteria 1664
324 Ga0105237_10405931 3300009545 Bacteria 1367
325 Ga0105238_10002798 3300009551 Bacteria 17414
326 Ga0105238_10004789 3300009551 Bacteria 13388
327 Ga0105238_10059132 3300009551 Bacteria 3841
328 Ga0105238_10088391 3300009551 Bacteria 3085
329 Ga0105238_10167167 3300009551 Bacteria 2175
330 Ga0105238_10357917 3300009551 Bacteria 1449
331 Ga0105238_10478174 3300009551 Bacteria 1245
332 Ga0105238_10914560 3300009551 Bacteria 896
333 Ga0105249_10004242 3300009553 Bacteria 12399
334 Ga0105249_10095847 3300009553 Bacteria 2783
335 Ga0105239_10007959 3300010375 Bacteria 12109
336 Ga0105239_10072517 3300010375 Bacteria 3786
337 Ga0105239_10090645 3300010375 Bacteria 3373
338 Ga0105239_10109330 3300010375 Bacteria 3064
339 Ga0105239_10115086 3300010375 Bacteria 2983
340 Ga0105239_10144167 3300010375 Bacteria 2655
341 Ga0105239_10156564 3300010375 Bacteria 2544
342 Ga0105239_10161331 3300010375 Bacteria 2504
343 Ga0105239_10219870 3300010375 Bacteria 2130
344 Ga0105239_10289885 3300010375 Bacteria 1843
345 Ga0105239_10379054 3300010375 Bacteria 1599
346 Ga0105239_10400619 3300010375 Bacteria 1553
347 Ga0105239_10623615 3300010375 Bacteria 1231
348 Ga0105239_10771880 3300010375 Bacteria 1101
349 Ga0105246_10036299 3300011119 Bacteria 3301
350 Ga0105246_10072125 3300011119 Bacteria 2434
351 Ga0105246_10308624 3300011119 Bacteria 1281
352 Ga0157373_10223971 3300013100 Bacteria 1327
353 Ga0157370_10015624 3300013104 Bacteria 7711
354 Ga0157370_10055142 3300013104 Bacteria 3788
355 Ga0157370_10296344 3300013104 Bacteria 1493
356 Ga0157369_10000996 3300013105 Bacteria 35806
357 Ga0157369_10007824 3300013105 Bacteria 12302
358 Ga0157369_10051549 3300013105 Bacteria 4453
359 Ga0157369_10112631 3300013105 Bacteria 2890
360 Ga0157369_10415169 3300013105 Bacteria 1395
361 Ga0157374_10013272 3300013296 Bacteria 7188
362 Ga0157374_10299631 3300013296 Bacteria 1590
363 Ga0157378_10103182 3300013297 Bacteria 2605
364 Ga0157378_10163265 3300013297 Bacteria 2084
365 Ga0157378_10700145 3300013297 Bacteria 1032
366 Ga0157378_10926882 3300013297 Bacteria 903
367 Ga0163162_10177021 3300013306 Bacteria 2259
368 Ga0163162_10279967 3300013306 Bacteria 1800
369 Ga0157372_10339872 3300013307 Bacteria 1749
370 Ga0157375_10000681 3300013308 Bacteria 30065
371 Ga0157375_10036651 3300013308 Bacteria 4694
372 Ga0157375_10079068 3300013308 Bacteria 3323
373 Ga0163163_10006000 3300014325 Bacteria 10568
374 Ga0163163_10337601 3300014325 Bacteria 1562
375 Ga0157380_10086801 3300014326 Bacteria 2572
376 Ga0157380_10118538 3300014326 Bacteria 2238
377 Ga0157380_10357420 3300014326 Bacteria 1369
378 Ga0157377_10091192 3300014745 Bacteria 1800
379 Ga0157377_10116747 3300014745 Bacteria 1612
380 Ga0157379_10041047 3300014968 Bacteria 4130
381 Ga0157379_10066997 3300014968 Bacteria 3210
382 Ga0157379_10226391 3300014968 Bacteria 1695
383 Ga0157379_10251519 3300014968 Bacteria 1604
384 Ga0157379_10521856 3300014968 Bacteria 1103
385 Ga0157379_10713154 3300014968 Bacteria 942
386 Ga0157376_10014965 3300014969 Bacteria 5846
387 Ga0157376_10075405 3300014969 Bacteria 2878
388 Ga0163161_10244239 3300017792 Bacteria 1397
389 Ga0206356_10359229 3300020070 Bacteria 930
390 Ga0214544_1000002 3300021320 Bacteria 753857
391 Ga0214542_1000001 3300021321 Bacteria 1018696
392 Ga0214545_1000001 3300021324 Bacteria 1092817
393 Ga0214543_1000001 3300021327 Bacteria 776921
394 Ga0213873_10003228 3300021358 Bacteria 2917
395 Ga0213876_10001215 3300021384 Bacteria 16252
396 Ga0213876_10198854 3300021384 Bacteria 1065
397 Ga0213875_10032072 3300021388 Bacteria 2483
398 Ga0213875_10132272 3300021388 Bacteria 1167
399 Ga0224712_10015360 3300022467 Bacteria 2490
400 Ga0209677_103425 3300025253 Bacteria 5168
401 Ga0209148_1000613 3300025254 Bacteria 31818
402 Ga0209148_1006070 3300025254 Bacteria 2664
403 Ga0209233_1005807 3300025261 Bacteria 4055
404 Ga0209233_1008575 3300025261 Bacteria 3151
405 Ga0209233_1021595 3300025261 Bacteria 1663
406 Ga0209233_1022933 3300025261 Bacteria 1589
407 Ga0209455_1005473 3300025272 Bacteria 3917
408 Ga0209455_1009401 3300025272 Bacteria 2571
409 Ga0209564_1015858 3300025295 Bacteria 3041
410 Ga0209758_1000140 3300025297 Bacteria 174267
411 Ga0209758_1000947 3300025297 Bacteria 39101
412 Ga0209758_1003609 3300025297 Bacteria 13852
413 Ga0209758_1004382 3300025297 Bacteria 11794
414 Ga0209758_1005082 3300025297 Bacteria 10418
415 Ga0209758_1007936 3300025297 Bacteria 7040
416 Ga0209758_1016825 3300025297 Bacteria 3688
417 Ga0209256_1023531 3300025299 Bacteria 1835
418 Ga0207426_1000626 3300025302 Bacteria 44875
419 Ga0207426_1000892 3300025302 Bacteria 30213
420 Ga0207426_1005341 3300025302 Bacteria 5902
421 Ga0207426_1027317 3300025302 Bacteria 1902
422 Ga0207426_1050027 3300025302 Bacteria 1248
423 Ga0209257_1007293 3300025304 Bacteria 6731
424 Ga0209257_1022286 3300025304 Bacteria 2264
425 Ga0207697_10012580 3300025315 Bacteria 3545
426 Ga0207697_10051545 3300025315 Bacteria 1701
427 Ga0207697_10135181 3300025315 Bacteria 1067
428 Ga0207656_10008091 3300025321 Bacteria 3856
429 Ga0207656_10013293 3300025321 Bacteria 3143
430 Ga0207656_10125020 3300025321 Bacteria 1201
431 Ga0207656_10162756 3300025321 Bacteria 1063
432 Ga0207696_1042465 3300025711 Bacteria 1325
433 Ga0207653_10000536 3300025885 Bacteria 14219
434 Ga0207653_10002803 3300025885 Bacteria 5541
435 Ga0207692_10000116 3300025898 Bacteria 23998
436 Ga0207692_10030959 3300025898 Bacteria 2558
437 Ga0207642_10115630 3300025899 Bacteria 1374
438 Ga0207710_10007078 3300025900 Bacteria 4761
439 Ga0207710_10008551 3300025900 Bacteria 4315
440 Ga0207710_10062029 3300025900 Bacteria 1698
441 Ga0207688_10205981 3300025901 Bacteria 1181
442 Ga0207647_10011073 3300025904 Bacteria 6339
443 Ga0207647_10023846 3300025904 Bacteria 4041
444 Ga0207647_10025616 3300025904 Bacteria 3872
445 Ga0207647_10204172 3300025904 Bacteria 1143
446 Ga0207685_10107587 3300025905 Bacteria 1203
447 Ga0207685_10193965 3300025905 Bacteria 950
448 Ga0207699_10000958 3300025906 Bacteria 13749
449 Ga0207699_10090766 3300025906 Bacteria 1917
450 Ga0207699_10165628 3300025906 Bacteria 1475
451 Ga0207699_10342268 3300025906 Bacteria 1054
452 Ga0207699_10550578 3300025906 Bacteria 837
453 Ga0207645_10101658 3300025907 Bacteria 1855
454 Ga0207643_10153888 3300025908 Bacteria 1380
455 Ga0207705_10058216 3300025909 Bacteria 2788
456 Ga0207684_10221856 3300025910 Bacteria 1631
457 Ga0207684_10340482 3300025910 Bacteria 1292
458 Ga0207654_10000308 3300025911 Bacteria 29561
459 Ga0207654_10165481 3300025911 Bacteria 1432
460 Ga0207654_10302430 3300025911 Bacteria 1088
461 Ga0207707_10000713 3300025912 Bacteria 32997
462 Ga0207707_10001623 3300025912 Bacteria 20718
463 Ga0207707_10005494 3300025912 Bacteria 11083
464 Ga0207707_10060434 3300025912 Bacteria 3297
465 Ga0207707_10352934 3300025912 Bacteria 1267
466 Ga0207695_10001719 3300025913 Bacteria 35011
467 Ga0207695_10001812 3300025913 Bacteria 33654
468 Ga0207695_10022151 3300025913 Bacteria 7225
469 Ga0207695_10025188 3300025913 Bacteria 6669
470 Ga0207695_10050386 3300025913 Bacteria 4381
471 Ga0207695_10147925 3300025913 Bacteria 2291
472 Ga0207695_10385794 3300025913 Bacteria 1286
473 Ga0207671_10008038 3300025914 Bacteria 9019
474 Ga0207671_10026849 3300025914 Bacteria 4308
475 Ga0207671_10027204 3300025914 Bacteria 4276
476 Ga0207671_10156673 3300025914 Bacteria 1762
477 Ga0207671_10249092 3300025914 Bacteria 1396
478 Ga0207671_10369300 3300025914 Bacteria 1139
479 Ga0207693_10073136 3300025915 Bacteria 2683
480 Ga0207693_10149159 3300025915 Bacteria 1839
481 Ga0207663_10005557 3300025916 Bacteria 6364
482 Ga0207663_10016904 3300025916 Bacteria 4057
483 Ga0207663_10125820 3300025916 Bacteria 1763
484 Ga0207663_10261042 3300025916 Bacteria 1279
485 Ga0207663_10721485 3300025916 Bacteria 790
486 Ga0207660_10007065 3300025917 Bacteria 7274
487 Ga0207660_10025784 3300025917 Bacteria 3995
488 Ga0207660_10033152 3300025917 Bacteria 3570
489 Ga0207660_10051559 3300025917 Bacteria 2926
490 Ga0207660_10180680 3300025917 Bacteria 1638
491 Ga0207660_10201690 3300025917 Bacteria 1554
492 Ga0207660_10431375 3300025917 Bacteria 1064
493 Ga0207662_10077224 3300025918 Bacteria 2025
494 Ga0207662_10408770 3300025918 Bacteria 922
495 Ga0207657_10001786 3300025919 Bacteria 23206
496 Ga0207657_10008840 3300025919 Bacteria 10189
497 Ga0207657_10119096 3300025919 Bacteria 2173
498 Ga0207657_10285756 3300025919 Bacteria 1309
499 Ga0207649_10045765 3300025920 Bacteria 2684
500 Ga0207649_10111834 3300025920 Bacteria 1826
501 Ga0207649_10464696 3300025920 Bacteria 957
502 Ga0207652_10004315 3300025921 Bacteria 11591
503 Ga0207652_10038882 3300025921 Bacteria 4035
504 Ga0207652_10088110 3300025921 Bacteria 2723
505 Ga0207652_10102017 3300025921 Bacteria 2535
506 Ga0207652_10111939 3300025921 Bacteria 2421
507 Ga0207652_10245070 3300025921 Bacteria 1616
508 Ga0207694_10000157 3300025924 Bacteria 70076
509 Ga0207694_10012829 3300025924 Bacteria 6311
510 Ga0207694_10055535 3300025924 Bacteria 3074
511 Ga0207694_10151191 3300025924 Bacteria 1870
512 Ga0207694_10154625 3300025924 Bacteria 1849
513 Ga0207694_10385136 3300025924 Bacteria 1164
514 Ga0207650_10320479 3300025925 Bacteria 1269
515 Ga0207650_10337568 3300025925 Bacteria 1237
516 Ga0207687_10028220 3300025927 Bacteria 3770
517 Ga0207687_10165424 3300025927 Bacteria 1701
518 Ga0207687_10215116 3300025927 Bacteria 1510
519 Ga0207687_10276648 3300025927 Bacteria 1344
520 Ga0207687_10340549 3300025927 Bacteria 1219
521 Ga0207700_10006113 3300025928 Bacteria 7250
522 Ga0207700_10021515 3300025928 Bacteria 4405
523 Ga0207700_10185652 3300025928 Bacteria 1744
524 Ga0207664_10177434 3300025929 Bacteria 1827
525 Ga0207644_10205569 3300025931 Bacteria 1555
526 Ga0207644_10436088 3300025931 Bacteria 1075
527 Ga0207690_10515508 3300025932 Bacteria 968
528 Ga0207706_10108562 3300025933 Bacteria 2442
529 Ga0207706_10115913 3300025933 Bacteria 2356
530 Ga0207706_10666964 3300025933 Bacteria 890
531 Ga0207686_10119430 3300025934 Bacteria 1792
532 Ga0207686_10382088 3300025934 Bacteria 1068
533 Ga0207709_10011280 3300025935 Bacteria 4929
534 Ga0207709_10369264 3300025935 Bacteria 1088
535 Ga0207670_10030483 3300025936 Bacteria 3446
536 Ga0207670_10498721 3300025936 Bacteria 988
537 Ga0207670_10528863 3300025936 Bacteria 961
538 Ga0207669_10025941 3300025937 Bacteria 3178
539 Ga0207669_10289370 3300025937 Bacteria 1240
540 Ga0207704_10013820 3300025938 Bacteria 4055
541 Ga0207704_10102744 3300025938 Bacteria 1910
542 Ga0207665_10001402 3300025939 Bacteria 16207
543 Ga0207665_10087694 3300025939 Bacteria 2151
544 Ga0207665_10117920 3300025939 Bacteria 1872
545 Ga0207665_10166867 3300025939 Bacteria 1588
546 Ga0207665_10184538 3300025939 Bacteria 1512
547 Ga0207665_10297906 3300025939 Bacteria 1205
548 Ga0207665_10400204 3300025939 Bacteria 1045
549 Ga0207665_10439645 3300025939 Bacteria 999
550 Ga0207691_10140759 3300025940 Bacteria 2126
551 Ga0207691_10167997 3300025940 Bacteria 1922
552 Ga0207691_10232160 3300025940 Bacteria 1597
553 Ga0207691_10344342 3300025940 Bacteria 1276
554 Ga0207711_10029828 3300025941 Bacteria 4601
555 Ga0207711_10190825 3300025941 Bacteria 1867
556 Ga0207711_10425561 3300025941 Bacteria 1235
557 Ga0207689_10144622 3300025942 Bacteria 1959
558 Ga0207689_10342191 3300025942 Bacteria 1242
559 Ga0207661_10001379 3300025944 Bacteria 16309
560 Ga0207661_10012609 3300025944 Bacteria 6151
561 Ga0207679_10132374 3300025945 Bacteria 2002
562 Ga0207667_10008116 3300025949 Bacteria 12512
563 Ga0207667_10012664 3300025949 Bacteria 9692
564 Ga0207667_10072054 3300025949 Bacteria 3591
565 Ga0207667_10077912 3300025949 Bacteria 3436
566 Ga0207667_10141144 3300025949 Bacteria 2480
567 Ga0207667_10187735 3300025949 Bacteria 2121
568 Ga0207667_10389079 3300025949 Bacteria 1420
569 Ga0207667_10457502 3300025949 Bacteria 1296
570 Ga0207667_10529320 3300025949 Bacteria 1193
571 Ga0207651_10076518 3300025960 Bacteria 2393
572 Ga0207651_10286324 3300025960 Bacteria 1364
573 Ga0207651_10348077 3300025960 Bacteria 1247
574 Ga0207712_10102342 3300025961 Bacteria 2132
575 Ga0207712_10147690 3300025961 Bacteria 1812
576 Ga0207712_10261523 3300025961 Bacteria 1404
577 Ga0207668_10045275 3300025972 Bacteria 2999
578 Ga0207668_10045547 3300025972 Bacteria 2992
579 Ga0207640_10154249 3300025981 Bacteria 1691
580 Ga0207640_10206684 3300025981 Bacteria 1492
581 Ga0207658_10333093 3300025986 Bacteria 1317
582 Ga0207677_10070485 3300026023 Bacteria 2464
583 Ga0207677_10409386 3300026023 Bacteria 1152
584 Ga0207703_10037329 3300026035 Bacteria 3870
585 Ga0207703_10062253 3300026035 Bacteria 3057
586 Ga0207703_10306444 3300026035 Bacteria 1450
587 Ga0207703_10327967 3300026035 Bacteria 1403
588 Ga0207703_10495043 3300026035 Bacteria 1147
589 Ga0207703_10905668 3300026035 Bacteria 844
590 Ga0207639_10010722 3300026041 Bacteria 6347
591 Ga0207639_10076718 3300026041 Bacteria 2632
592 Ga0207639_10113242 3300026041 Bacteria 2215
593 Ga0207639_10294526 3300026041 Bacteria 1432
594 Ga0207639_10509763 3300026041 Bacteria 1100
595 Ga0207678_10014420 3300026067 Bacteria 6948
596 Ga0207678_10036160 3300026067 Bacteria 4299
597 Ga0207678_10037981 3300026067 Bacteria 4187
598 Ga0207678_10098778 3300026067 Bacteria 2494
599 Ga0207678_10155364 3300026067 Bacteria 1953
600 Ga0207678_10161758 3300026067 Bacteria 1912
601 Ga0207678_10178066 3300026067 Bacteria 1816
602 Ga0207678_10254370 3300026067 Bacteria 1505
603 Ga0207678_10276172 3300026067 Bacteria 1441
604 Ga0207708_10126781 3300026075 Bacteria 1993
605 Ga0207708_10225048 3300026075 Bacteria 1504
606 Ga0207708_10630123 3300026075 Bacteria 911
607 Ga0207708_10692215 3300026075 Bacteria 871
608 Ga0207702_10000002 3300026078 Bacteria 491507
609 Ga0207702_10000048 3300026078 Bacteria 143125
610 Ga0207702_10096505 3300026078 Bacteria 2600
611 Ga0207702_10243985 3300026078 Bacteria 1684
612 Ga0207702_10727702 3300026078 Bacteria 979
613 Ga0207648_10062317 3300026089 Bacteria 3251
614 Ga0207648_10066627 3300026089 Bacteria 3140
615 Ga0207676_10014722 3300026095 Bacteria 5634
616 Ga0207676_10358072 3300026095 Bacteria 1351
617 Ga0207676_10617158 3300026095 Bacteria 1043
618 Ga0207676_10691250 3300026095 Bacteria 987
619 Ga0207674_10006147 3300026116 Bacteria 14181
620 Ga0207674_10049099 3300026116 Bacteria 4317
621 Ga0207674_10128650 3300026116 Bacteria 2497
622 Ga0207674_10132628 3300026116 Bacteria 2454
623 Ga0207675_100021910 3300026118 Bacteria 5949
624 Ga0207675_100067701 3300026118 Bacteria 3338
625 Ga0207675_100077004 3300026118 Bacteria 3124
626 Ga0207675_100540939 3300026118 Bacteria 1163
627 Ga0207683_10068392 3300026121 Bacteria 3135
628 Ga0207683_10174161 3300026121 Bacteria 1949
629 Ga0207683_10259539 3300026121 Bacteria 1587
630 Ga0207683_10325101 3300026121 Bacteria 1409
631 Ga0207683_10443759 3300026121 Bacteria 1196
632 Ga0207683_10505790 3300026121 Bacteria 1116
633 Ga0207698_10017601 3300026142 Bacteria 4854
634 Ga0207698_10139213 3300026142 Bacteria 2088
635 Ga0207698_10146616 3300026142 Bacteria 2042
636 Ga0207698_10205242 3300026142 Bacteria 1768
637 Ga0207698_10330588 3300026142 Bacteria 1431
638 Ga0209389_1000233 3300027296 Bacteria 36791
639 Ga0209389_1010778 3300027296 Bacteria 8256
640 Ga0209589_1000001 3300027357 Bacteria 794224
641 Ga0209589_1001423 3300027357 Bacteria 39445
642 Ga0209489_100001 3300027361 Bacteria 794224
643 Ga0209489_102560 3300027361 Bacteria 36742
644 Ga0209489_112041 3300027361 Bacteria 8257
645 Ga0209700_100001 3300027363 Bacteria 794224
646 Ga0209700_100062 3300027363 Bacteria 145471
647 Ga0207428_10020898 3300027907 Bacteria 5551
648 Ga0207428_10048417 3300027907 Bacteria 3410
649 Ga0268266_10008946 3300028379 Bacteria 8862
650 Ga0268266_10022518 3300028379 Bacteria 5369
651 Ga0268266_10029812 3300028379 Bacteria 4635
652 Ga0268266_10059181 3300028379 Bacteria 3300
653 Ga0268266_10139420 3300028379 Bacteria 2175
654 Ga0268266_10143830 3300028379 Bacteria 2142
655 Ga0268266_10175211 3300028379 Bacteria 1949
656 Ga0268266_10486490 3300028379 Bacteria 1177
657 Ga0268266_10588223 3300028379 Bacteria 1068
658 Ga0268265_10000603 3300028380 Bacteria 36135
659 Ga0268265_10269350 3300028380 Bacteria 1518
660 Ga0268265_10301961 3300028380 Bacteria 1442
661 Ga0268265_10588685 3300028380 Bacteria 1061
662 Ga0268264_10000430 3300028381 Bacteria 58144
663 Ga0268264_10000660 3300028381 Bacteria 40456
664 Ga0268264_10318191 3300028381 Bacteria 1470
665 Ga0268264_10590034 3300028381 Bacteria 1094
666 Ga0268264_10922820 3300028381 Bacteria 877
667 Ga0265319_1038153 3300028563 Bacteria 1634
668 Ga0265323_10002533 3300028653 Bacteria 8326
669 Ga0265322_10020623 3300028654 Bacteria 1888
670 Ga0265336_10001363 3300028666 Bacteria 11301
671 Ga0307517_10000772 3300028786 Bacteria 55020
672 Ga0307515_10032886 3300028794 Bacteria 8566
673 Ga0265338_10000086 3300028800 Bacteria 175026
674 Ga0265324_10004123 3300029957 Bacteria 6651
675 Ga0307511_10034642 3300030521 Bacteria 4426
676 Ga0307512_10209715 3300030522 Bacteria 1038
677 Ga0265330_10015512 3300031235 Bacteria 3523
678 Ga0265330_10025688 3300031235 Bacteria 2669
679 Ga0265330_10062916 3300031235 Bacteria 1613
680 Ga0265328_10021772 3300031239 Bacteria 2444
681 Ga0265325_10001325 3300031241 Bacteria 17530
682 Ga0265325_10022969 3300031241 Bacteria 3411
683 Ga0265340_10003545 3300031247 Bacteria 8783
684 Ga0265339_10004010 3300031249 Bacteria 10180
685 Ga0265339_10103891 3300031249 Bacteria 1475
686 Ga0265339_10167279 3300031249 Bacteria 1103
687 Ga0265339_10190466 3300031249 Bacteria 1017
688 Ga0265331_10082432 3300031250 Bacteria 1492
689 Ga0265331_10140782 3300031250 Bacteria 1097
690 Ga0265327_10001131 3300031251 Bacteria 36638
691 Ga0307509_10108318 3300031507 Bacteria 2791
692 Ga0307509_10523715 3300031507 Bacteria 866
693 Ga0307408_100347845 3300031548 Bacteria 1257
694 Ga0307408_100364843 3300031548 Bacteria 1230
695 Ga0265313_10009642 3300031595 Bacteria 6238
696 Ga0307508_10000009 3300031616 Bacteria 256966
697 Ga0307508_10035294 3300031616 Bacteria 4507
698 Ga0307508_10059744 3300031616 Bacteria 3371
699 Ga0307508_10516871 3300031616 Bacteria 790
700 Ga0316575_10008085 3300031665 Bacteria 3824
701 Ga0265314_10097683 3300031711 Bacteria 1896
702 Ga0265342_10023565 3300031712 Bacteria 3894
703 Ga0265342_10101215 3300031712 Bacteria 1641
704 Ga0307516_10033789 3300031730 Bacteria 5145
705 Ga0307516_10355669 3300031730 Bacteria 1129
706 Ga0307413_10111217 3300031824 Bacteria 1834
707 Ga0307410_10054864 3300031852 Bacteria 2703
708 Ga0307410_10432699 3300031852 Bacteria 1070
709 Ga0307406_10229220 3300031901 Bacteria 1386
710 Ga0307406_10284929 3300031901 Bacteria 1262
711 Ga0307407_10073614 3300031903 Bacteria 2042
712 Ga0307416_100925289 3300032002 Bacteria 973
713 Ga0307411_10023083 3300032005 Bacteria 3677
714 Ga0307411_10056429 3300032005 Bacteria 2589
715 Ga0307415_100097693 3300032126 Bacteria 2144
716 Ga0307415_100153561 3300032126 Bacteria 1775
717 Ga0307415_100231745 3300032126 Bacteria 1488
718 Ga0307507_10061608 3300033179 Bacteria 3492
719 Ga0307510_10009821 3300033180 Bacteria 11388
720 Ga0307510_10025487 3300033180 Bacteria 6817
721 Ga0307510_10150825 3300033180 Bacteria 1944
722 Ga0315911_1000001 3300033442 Bacteria 1088602
723 Ga0373958_0008632 3300034819 Bacteria 1657
724 Ga0373959_0051830 3300034820 Bacteria 888
725 Ga0373926_0021182 3300035083 Bacteria 2250
726 Ga0373926_0070555 3300035083 Bacteria 1283
727 Ga0373929_0048161 3300035085 Bacteria 967
728 Ga0373934_0033722 3300035086 Bacteria 2010
729 Ga0373934_0056566 3300035086 Bacteria 1560
730 Ga0373940_0025623 3300035088 Bacteria 1537
731 Ga0373949_0012402 3300035090 Bacteria 1885
732 Ga0373952_0087362 3300035092 Bacteria 805
733 Ga0373923_0028040 3300035111 Bacteria 2250
734 Ga0373923_0178218 3300035111 Bacteria 975
735 Ga0373936_0006503 3300035113 Bacteria 4406
736 Ga0373936_0014005 3300035113 Bacteria 3063
737 Ga0373939_0004462 3300035114 Bacteria 3312
738 Ga0373939_0004484 3300035114 Bacteria 3306
739 Ga0373941_0004526 3300035115 Bacteria 3218
740 Ga0373945_0106979 3300035116 Bacteria 1100
741 Ga0373953_0051764 3300035117 Bacteria 1661
742 Ga0373954_0000070 3300035118 Bacteria 36271
743 Ga0373954_0010716 3300035118 Bacteria 4052
744 Ga0373956_0001764 3300035119 Bacteria 8915
745 Ga0373957_0002936 3300035120 Bacteria 4940
746 Ga0373957_0007409 3300035120 Bacteria 3511
747 Ga0373943_0007891 3300035170 Bacteria 4778
748 Ga0373943_0012028 3300035170 Bacteria 3896
749 Ga0373946_0003425 3300035171 Bacteria 5631
750 Ga0373946_0129457 3300035171 Bacteria 1160
751 Ga0373955_0000771 3300035172 Bacteria 13748
752 Ga0373955_0304793 3300035172 Bacteria 961
753 Ga0373942_0010230 3300035207 Bacteria 2204
754 Ga0373961_0004030 3300035241 Bacteria 3577
755 Ga0373961_0083272 3300035241 Bacteria 1010
756 Ga0373962_0008952 3300035242 Bacteria 2473
757 Ga0373962_0010848 3300035242 Bacteria 2278
758 Ga0373962_0023849 3300035242 Bacteria 1632
759 Ga0316574_0035235 3300035398 Bacteria 3057
760 Ga0373931_0000607 3300035691 Bacteria 14829
761 Ga0373931_0001266 3300035691 Bacteria 10806
762 Ga0373931_0007703 3300035691 Bacteria 5083
763 Ga0373931_0314573 3300035691 Bacteria 971
764 Ga0373935_0011212 3300035692 Bacteria 5381
765 Ga0373935_0051066 3300035692 Bacteria 2625
766 Ga0373927_0010404 3300035695 Bacteria 6205
767 Ga0373927_0014740 3300035695 Bacteria 5168
768 Ga0373927_0017386 3300035695 Bacteria 4733
769 Ga0373927_0026380 3300035695 Bacteria 3797
770 Ga0373933_0000041 3300035724 Bacteria 79805
771 Ga0373933_0006540 3300035724 Bacteria 6349
772 Ga0373933_0059443 3300035724 Bacteria 2302
773 Ga0373947_0002972 3300035725 Bacteria 10113
774 Ga0373947_0014554 3300035725 Bacteria 4513
775 Ga0373947_0106310 3300035725 Bacteria 1769
776 Ga0373937_0094288 3300036401 Bacteria 2775
777 Ga0316582_0245184 3300036647 Bacteria 1228
778 Ga0316584_0040425 3300036712 Bacteria 3474
779 Ga0373925_0009598 3300037068 Bacteria 7051
780 Ga0373925_0020921 3300037068 Bacteria 4767
781 Ga0373925_0041246 3300037068 Bacteria 3421
782 Ga0373925_0066262 3300037068 Bacteria 2722
783 Ga0373925_0197742 3300037068 Bacteria 1598
784 Ga0373925_0293945 3300037068 Bacteria 1310
785 Ga0395900_0001120 3300037418 Bacteria 33947
786 Ga0395900_0045947 3300037418 Bacteria 4498
787 Ga0395900_0129059 3300037418 Bacteria 2592
788 Ga0395898_0045273 3300037466 Bacteria 4326
789 Ga0395898_0069867 3300037466 Bacteria 3397
790 Ga0395898_0479053 3300037466 Bacteria 1184
791 Ga0395905_0018125 3300037471 Bacteria 6681
792 Ga0395905_0106818 3300037471 Bacteria 2628
793 Ga0395905_0148343 3300037471 Bacteria 2207
794 Ga0395905_0390657 3300037471 Bacteria 1286
795 Ga0436364_0170010 3300037853 Bacteria 1953
796 Ga0436364_1378120 3300037853 Bacteria 7250
797 Ga0395901_0125452 3300038443 Bacteria 2698
798 Ga0395901_0196564 3300038443 Bacteria 2115
799 Ga0395901_0204691 3300038443 Bacteria 2068
800 Ga0436365_1136865 3300039437 Bacteria 22786
801 Ga0436365_1391201 3300039437 Bacteria 1975
802 Ga0436363_0476889 3300039450 Bacteria 1244
803 Ga0436363_1445688 3300039450 Bacteria 2152
804 Ga0436363_1599995 3300039450 Bacteria 2189
805 Ga0436362_0188545 3300039453 Bacteria 4150
806 Ga0439465_0048874 3300041413 Bacteria 1381
807 Ga0451793_1390476 3300041452 Bacteria 1061
808 Ga0451793_1584115 3300041452 Bacteria 1916
809 Ga0466972_0000343 3300044658 Bacteria 25524
810 Ga0466972_0005717 3300044658 Bacteria 6232
811 Ga0466965_0286029 3300044683 Bacteria 891
812 Ga0466966_0002698 3300044684 Bacteria 11633
813 Ga0466966_0141667 3300044684 Bacteria 1469
814 Ga0466966_0417255 3300044684 Bacteria 807
815 Ga0466961_0002716 3300044693 Bacteria 11002
816 Ga0466961_0016750 3300044693 Bacteria 4711
817 Ga0466961_0073816 3300044693 Bacteria 2163
818 Ga0466963_0065538 3300044694 Bacteria 2435
819 Ga0466963_0083015 3300044694 Bacteria 2173
820 Ga0466963_0256953 3300044694 Bacteria 1226
821 Ga0466964_0112908 3300044706 Bacteria 1214
822 Ga0453684_0156891 3300044712 Bacteria 2697
823 Ga0466968_0011434 3300044735 Bacteria 3457
824 Ga0466968_0264899 3300044735 Bacteria 819
825 Ga0466957_0115508 3300044842 Bacteria 1706
826 Ga0466957_0190507 3300044842 Bacteria 1343
827 Ga0466957_0472714 3300044842 Bacteria 866
828 Ga0466960_0008985 3300044901 Bacteria 4107
829 Ga0466959_0006245 3300045049 Bacteria 8234
830 Ga0451576_0000023 3300045051 Bacteria 477965
831 Ga0451576_0336055 3300045051 Bacteria 1581
832 Ga0466967_0099058 3300045976 Bacteria 2662
833 Ga0495617_084534 3300046452 Bacteria 1038
834 Ga0495592_0002858 3300046454 Bacteria 12270
835 Ga0495603_0094425 3300046455 Bacteria 1747
836 Ga0495603_0150649 3300046455 Bacteria 1351
837 Ga0495603_0202268 3300046455 Bacteria 1148
838 Ga0495603_0250360 3300046455 Bacteria 1020
839 Ga0495590_0070647 3300046457 Bacteria 1225
840 Ga0495629_0002263 3300046459 Bacteria 14836
841 Ga0495629_0006304 3300046459 Bacteria 8802
842 Ga0495629_0176313 3300046459 Bacteria 1482
843 Ga0495638_0039968 3300046460 Bacteria 2974
844 Ga0495651_0001805 3300046462 Bacteria 16510
845 Ga0495651_0063762 3300046462 Bacteria 2816
846 Ga0495651_0233251 3300046462 Bacteria 1266
847 Ga0495653_0003677 3300046463 Bacteria 12388
848 Ga0495650_0059622 3300046471 Bacteria 1536
849 Ga0495580_0017033 3300046472 Bacteria 5445
850 Ga0495580_0321688 3300046472 Bacteria 1051
851 Ga0495582_0119538 3300046473 Bacteria 1484
852 Ga0495582_0192093 3300046473 Bacteria 1165
853 Ga0495605_0095641 3300046474 Bacteria 1371
854 Ga0495639_0021582 3300046475 Bacteria 2820
855 Ga0495664_0006016 3300046477 Bacteria 6688
856 Ga0495584_0100820 3300046491 Bacteria 1459
857 Ga0495585_0033013 3300046492 Bacteria 2932
858 Ga0495585_0091044 3300046492 Bacteria 1643
859 Ga0495596_0136870 3300046500 Bacteria 951
860 Ga0495607_0094820 3300046501 Bacteria 1609
861 Ga0495583_0158801 3300046506 Bacteria 934
862 Ga0495606_0075148 3300046507 Bacteria 2115
863 Ga0495606_0138931 3300046507 Bacteria 1436
864 Ga0495606_0336310 3300046507 Bacteria 806
865 Ga0495608_0001870 3300046511 Bacteria 15052
866 Ga0495608_0163141 3300046511 Bacteria 1416
867 Ga0495616_0059886 3300046513 Bacteria 1871
868 Ga0495618_0006298 3300046514 Bacteria 7205
869 Ga0495618_0096966 3300046514 Bacteria 1886
870 Ga0495628_0002643 3300046516 Bacteria 16072
871 Ga0495628_0036298 3300046516 Bacteria 3957
872 Ga0495628_0108425 3300046516 Bacteria 2138
873 Ga0495628_0266364 3300046516 Bacteria 1276
874 Ga0495631_0024517 3300046518 Bacteria 2785
875 Ga0495632_0089371 3300046519 Bacteria 1462
876 Ga0495632_0125868 3300046519 Bacteria 1195
877 Ga0495643_0104353 3300046522 Bacteria 1449
878 Ga0495644_0044125 3300046523 Bacteria 1677
879 Ga0495648_0015942 3300046524 Bacteria 5429
880 Ga0495652_0038928 3300046529 Bacteria 4114
881 Ga0495652_0100660 3300046529 Bacteria 2344
882 Ga0495652_0243593 3300046529 Bacteria 1336
883 Ga0495652_0267992 3300046529 Bacteria 1257
884 Ga0495652_0393937 3300046529 Bacteria 982
885 Ga0495665_0008508 3300046531 Bacteria 5570
886 Ga0495640_0054419 3300046533 Bacteria 2741
887 Ga0495640_0209956 3300046533 Bacteria 1231
888 Ga0495640_0256587 3300046533 Bacteria 1093
889 Ga0495640_0393737 3300046533 Bacteria 851
890 Ga0495586_0034154 3300046535 Bacteria 2731
891 Ga0495587_0001351 3300046536 Bacteria 16275
892 Ga0495587_0008371 3300046536 Bacteria 6655
893 Ga0495598_0015089 3300046537 Bacteria 1943
894 Ga0495609_0035714 3300046538 Bacteria 2248
895 Ga0495621_0042112 3300046539 Bacteria 1606
896 Ga0495621_0105451 3300046539 Bacteria 1076
897 Ga0495597_0070740 3300046542 Bacteria 1503
898 Ga0495645_0003263 3300046543 Bacteria 11010
899 Ga0495622_0004261 3300046557 Bacteria 6657
900 Ga0495622_0011772 3300046557 Bacteria 4044
901 Ga0495622_0070335 3300046557 Bacteria 1615
902 Ga0495633_0046592 3300046558 Bacteria 2050
903 Ga0495667_0000926 3300046559 Bacteria 18989
904 Ga0495667_0057163 3300046559 Bacteria 2565
905 Ga0495656_0046205 3300046615 Bacteria 1841
906 Ga0495656_0088311 3300046615 Bacteria 1413
907 Ga0495656_0089501 3300046615 Bacteria 1405
908 Ga0495668_0159410 3300046616 Bacteria 1236
909 Ga0495668_0220075 3300046616 Bacteria 1039
910 Ga0495634_0007605 3300046642 Bacteria 8118
911 Ga0495634_0029043 3300046642 Bacteria 3832
912 Ga0495611_0101163 3300046648 Bacteria 1338
913 Ga0495611_0107006 3300046648 Bacteria 1301
914 Ga0495625_0121577 3300046660 Bacteria 1776
915 Ga0495635_0004483 3300046663 Bacteria 9674
916 Ga0495635_0008512 3300046663 Bacteria 7164
917 Ga0495635_0034757 3300046663 Bacteria 3496
918 Ga0495659_0056929 3300046664 Bacteria 1435
919 Ga0495661_0197379 3300046665 Bacteria 1056
920 Ga0495588_0033061 3300046674 Bacteria 2610
921 Ga0495657_0001016 3300046675 Bacteria 24742
922 Ga0495657_0020802 3300046675 Bacteria 4716
923 Ga0495599_0000637 3300046678 Bacteria 19794
924 Ga0495623_0005023 3300046679 Bacteria 8674
925 Ga0495623_0210682 3300046679 Bacteria 1113
926 Ga0495646_0001926 3300046680 Bacteria 12482
927 Ga0495646_0111828 3300046680 Bacteria 1554
928 Ga0495646_0136898 3300046680 Bacteria 1373
929 Ga0495647_0033614 3300046681 Bacteria 1917
930 Ga0495647_0180150 3300046681 Bacteria 919
931 Ga0495658_0018165 3300046683 Bacteria 3650
932 Ga0495669_0006671 3300046684 Bacteria 4829
933 Ga0495613_0076601 3300046689 Bacteria 2434
934 Ga0495613_0220345 3300046689 Bacteria 1332
935 Ga0495624_0090063 3300046690 Bacteria 1893
936 Ga0495624_0338162 3300046690 Bacteria 906
937 Ga0495670_0163712 3300046691 Bacteria 1169
938 Ga0495671_0188418 3300046692 Bacteria 1002
939 Ga0495649_0101666 3300046694 Bacteria 1527
940 Ga0495649_0133514 3300046694 Bacteria 1309
941 Ga0495589_0252077 3300046794 Bacteria 824
942 Ga0495600_0000352 3300046809 Bacteria 24397
943 Ga0495600_0002398 3300046809 Bacteria 10736
944 Ga0495581_0033070 3300047315 Bacteria 2994
945 Ga0495581_0214543 3300047315 Bacteria 1125
946 Ga0495581_0223691 3300047315 Bacteria 1101
947 Ga0495604_0013258 3300047317 Bacteria 6565
948 Ga0495604_0028514 3300047317 Bacteria 4441
949 Ga0495604_0030928 3300047317 Bacteria 4248
950 Ga0495604_0177442 3300047317 Bacteria 1492
951 Ga0495604_0264562 3300047317 Bacteria 1168
952 Ga0495674_0075372 3300047319 Bacteria 2903
953 Ga0495674_0111988 3300047319 Bacteria 2313
954 Ga0495674_0261177 3300047319 Bacteria 1423
955 Ga0495672_0115619 3300047320 Bacteria 1433
956 Ga0495672_0199726 3300047320 Bacteria 1001
957 Ga0495676_0036897 3300047321 Bacteria 4076
958 Ga0495680_0004188 3300047322 Bacteria 13854
959 Ga0495680_0008983 3300047322 Bacteria 9028
960 Ga0495680_0173717 3300047322 Bacteria 1559
961 Ga0495683_0231937 3300047323 Bacteria 818
962 Ga0495687_005957 3300047443 Bacteria 7606
963 Ga0495675_0001543 3300047444 Bacteria 13904
964 Ga0495675_0031466 3300047444 Bacteria 3387
965 Ga0495679_053390 3300047446 Bacteria 1207
966 Ga0495673_0019085 3300047469 Bacteria 3442
967 Ga0495684_0000380 3300047471 Bacteria 36351
968 Ga0495684_0008788 3300047471 Bacteria 7807
969 Ga0495684_0043964 3300047471 Bacteria 3420
970 Ga0495684_0066211 3300047471 Bacteria 2747
971 Ga0495593_0001866 3300047673 Bacteria 12550
972 Ga0495593_0006778 3300047673 Bacteria 6705
973 Ga0495602_0021117 3300048088 Bacteria 6417
974 Ga0495602_0036833 3300048088 Bacteria 4547
975 Ga0495602_0167084 3300048088 Bacteria 1711
976 Ga0495602_0230709 3300048088 Bacteria 1391
977 Ga0495602_0370307 3300048088 Bacteria 1029
978 Ga0495614_0080726 3300048089 Bacteria 1409
979 Ga0496100_0002783 3300048903 Bacteria 8949
980 Ga0496100_0071960 3300048903 Bacteria 2310
981 Ga0496100_0116730 3300048903 Bacteria 1863
982 Ga0496100_0139341 3300048903 Bacteria 1717
983 Ga0496100_0158901 3300048903 Bacteria 1619
984 Ga0496100_0192259 3300048903 Bacteria 1482
985 Ga0496100_0273941 3300048903 Bacteria 1256
986 Ga0496100_0492231 3300048903 Bacteria 944
987 Ga0496101_0001858 3300048904 Bacteria 12748
988 Ga0496101_0027459 3300048904 Bacteria 3966
989 Ga0496101_0036410 3300048904 Bacteria 3486
990 Ga0496101_0051498 3300048904 Bacteria 2967
991 Ga0496101_0094130 3300048904 Bacteria 2232
992 Ga0496101_0128539 3300048904 Bacteria 1922
993 Ga0496101_0215932 3300048904 Bacteria 1487
994 Ga0496102_0003736 3300048905 Bacteria 12868
995 Ga0496102_0007094 3300048905 Bacteria 9566
996 Ga0496102_0067848 3300048905 Bacteria 3272
997 Ga0496102_0068168 3300048905 Bacteria 3264
998 Ga0496102_0073184 3300048905 Bacteria 3149
999 Ga0496102_0103319 3300048905 Bacteria 2650
1000 Ga0496102_0148180 3300048905 Bacteria 2204
1001 Ga0496102_0185345 3300048905 Bacteria 1961
1002 Ga0496102_0369674 3300048905 Bacteria 1350
1003 Ga0496102_0467678 3300048905 Bacteria 1182
1004 Ga0496102_0554667 3300048905 Bacteria 1072
1005 Ga0496102_0596754 3300048905 Bacteria 1027
1006 Ga0496103_0002281 3300048906 Bacteria 12123
1007 Ga0496103_0019281 3300048906 Bacteria 4096
1008 Ga0496103_0041350 3300048906 Bacteria 2834
1009 Ga0496103_0499854 3300048906 Bacteria 778
1010 Ga0496104_0002223 3300048907 Bacteria 16751
1011 Ga0496104_0004213 3300048907 Bacteria 12488
1012 Ga0496104_0011555 3300048907 Bacteria 7911
1013 Ga0496104_0026939 3300048907 Bacteria 5314
1014 Ga0496104_0088307 3300048907 Bacteria 2961
1015 Ga0496105_0001630 3300048908 Bacteria 15962
1016 Ga0496105_0013806 3300048908 Bacteria 6415
1017 Ga0496105_0015284 3300048908 Bacteria 6113
1018 Ga0496105_0102731 3300048908 Bacteria 2360
1019 Ga0496105_0118488 3300048908 Bacteria 2184
1020 Ga0496105_0194084 3300048908 Bacteria 1659
1021 Ga0496105_0209711 3300048908 Bacteria 1588
1022 Ga0496105_0328596 3300048908 Bacteria 1224
1023 Ga0496106_0000423 3300048909 Bacteria 30107
1024 Ga0496106_0000804 3300048909 Bacteria 22734
1025 Ga0496106_0000855 3300048909 Bacteria 22094
1026 Ga0496106_0100710 3300048909 Bacteria 2240
1027 Ga0496106_0250935 3300048909 Bacteria 1414
1028 Ga0496106_0267167 3300048909 Bacteria 1369
1029 Ga0496106_0454142 3300048909 Bacteria 1029
1030 Ga0496106_0611555 3300048909 Bacteria 872
1031 Ga0496107_0005141 3300048910 Bacteria 8928
1032 Ga0496107_0013617 3300048910 Bacteria 5685
1033 Ga0496107_0015807 3300048910 Bacteria 5294
1034 Ga0496107_0048963 3300048910 Bacteria 3045
1035 Ga0496107_0094132 3300048910 Bacteria 2192
1036 Ga0496107_0261969 3300048910 Bacteria 1286
1037 Ga0496107_0606995 3300048910 Bacteria 808
1038 Ga0496108_0009189 3300048911 Bacteria 8000
1039 Ga0496108_0039504 3300048911 Bacteria 3934
1040 Ga0496108_0042755 3300048911 Bacteria 3783
1041 Ga0496108_0060594 3300048911 Bacteria 3184
1042 Ga0496108_0080674 3300048911 Bacteria 2756
1043 Ga0496108_0190707 3300048911 Bacteria 1776
1044 Ga0496109_0000393 3300048912 Bacteria 39750
1045 Ga0496109_0015089 3300048912 Bacteria 6724
1046 Ga0496109_0071997 3300048912 Bacteria 3174
1047 Ga0496109_0143959 3300048912 Bacteria 2229
1048 Ga0496109_0485686 3300048912 Bacteria 1166
1049 Ga0496109_0515970 3300048912 Bacteria 1128
1050 Ga0496109_0610735 3300048912 Bacteria 1027
1051 Ga0496109_0730386 3300048912 Bacteria 928
1052 Ga0496110_0030127 3300048913 Bacteria 4676
1053 Ga0496110_0041310 3300048913 Bacteria 4023
1054 Ga0496110_0041319 3300048913 Bacteria 4023
1055 Ga0496110_0086825 3300048913 Bacteria 2793
1056 Ga0496110_0125847 3300048913 Bacteria 2312
1057 Ga0496110_0163723 3300048913 Bacteria 2016
1058 Ga0496110_0228679 3300048913 Bacteria 1691
1059 Ga0496110_0336364 3300048913 Bacteria 1375
1060 Ga0496110_0440488 3300048913 Bacteria 1187
1061 Ga0496110_0613564 3300048913 Bacteria 986
1062 Ga0496111_0014960 3300048914 Bacteria 5315
1063 Ga0496111_0288845 3300048914 Bacteria 1216
1064 Ga0496111_0421523 3300048914 Bacteria 986
1065 Ga0496112_0000021 3300048915 Bacteria 156561
1066 Ga0496112_0002518 3300048915 Bacteria 14792
1067 Ga0496112_0036381 3300048915 Bacteria 4802
1068 Ga0496112_0194986 3300048915 Bacteria 1986
1069 Ga0496112_0212293 3300048915 Bacteria 1892
1070 Ga0496112_0586528 3300048915 Bacteria 1047
1071 Ga0496113_0004330 3300048916 Bacteria 8699
1072 Ga0496113_0020931 3300048916 Bacteria 4608
1073 Ga0496113_0263297 3300048916 Bacteria 1377
1074 Ga0496114_0013575 3300048917 Bacteria 6535
1075 Ga0496114_0056707 3300048917 Bacteria 3270
1076 Ga0496114_0125008 3300048917 Bacteria 2216
1077 Ga0496114_0282791 3300048917 Bacteria 1463
1078 Ga0496114_0400891 3300048917 Bacteria 1215
1079 Ga0496115_0001490 3300048918 Bacteria 16832
1080 Ga0496115_0004939 3300048918 Bacteria 9688
1081 Ga0496115_0027232 3300048918 Bacteria 4469
1082 Ga0496115_0033127 3300048918 Bacteria 4078
1083 Ga0496115_0036328 3300048918 Bacteria 3900
1084 Ga0496115_0096997 3300048918 Bacteria 2414
1085 Ga0496115_0166225 3300048918 Bacteria 1824
1086 Ga0496115_0483188 3300048918 Bacteria 997
1087 Ga0496116_0059283 3300048919 Bacteria 2491
1088 Ga0496117_0081333 3300048920 Bacteria 2126
1089 Ga0496118_0006945 3300048921 Bacteria 12237
1090 Ga0496118_0155077 3300048921 Bacteria 1426
1091 Ga0496118_0205827 3300048921 Bacteria 1160
1092 Ga0496118_0251253 3300048921 Bacteria 1005
1093 Ga0496119_0013974 3300048922 Bacteria 6328
1094 Ga0496119_0099425 3300048922 Bacteria 1636
1095 Ga0496120_0048913 3300048923 Bacteria 2430
1096 Ga0496121_0001335 3300048924 Bacteria 42241
1097 Ga0496121_0004369 3300048924 Bacteria 19105
1098 Ga0496121_0030188 3300048924 Bacteria 4984
1099 Ga0496121_0079960 3300048924 Bacteria 2593
1100 Ga0496121_0112460 3300048924 Bacteria 2074
1101 Ga0496121_0141908 3300048924 Bacteria 1780
1102 Ga0496121_0207768 3300048924 Bacteria 1389
1103 Ga0496121_0228373 3300048924 Bacteria 1305
1104 Ga0496121_0253991 3300048924 Bacteria 1217
1105 Ga0496121_0302030 3300048924 Bacteria 1086
1106 Ga0496121_0380760 3300048924 Bacteria 930
1107 Ga0496124_0004332 3300048927 Bacteria 16626
1108 Ga0496125_0050828 3300048928 Bacteria 3427
1109 Ga0496125_0115226 3300048928 Bacteria 1933
1110 Ga0496125_0141205 3300048928 Bacteria 1674
1111 Ga0496125_0146064 3300048928 Bacteria 1634
1112 Ga0496125_0153610 3300048928 Bacteria 1576
1113 Ga0496126_0006091 3300048929 Bacteria 13526
1114 Ga0496126_0006946 3300048929 Bacteria 12532
1115 Ga0496126_0012554 3300048929 Bacteria 8671
1116 Ga0496126_0046312 3300048929 Bacteria 3990
1117 Ga0496126_0066660 3300048929 Bacteria 3218
1118 Ga0496126_0113492 3300048929 Bacteria 2358
1119 Ga0496126_0303484 3300048929 Bacteria 1316
1120 Ga0496126_0375631 3300048929 Bacteria 1158
1121 Ga0496126_0481923 3300048929 Bacteria 994
1122 Ga0495682_0010318 3300049460 Bacteria 3621
1123 Ga0501031_0000645 3300049568 Bacteria 20696
1124 Ga0501031_0050097 3300049568 Bacteria 2721
1125 Ga0501031_0137365 3300049568 Bacteria 1597
1126 Ga0501031_0303441 3300049568 Bacteria 1035
1127 Ga0501032_0000129 3300049569 Bacteria 62082
1128 Ga0501032_0093877 3300049569 Bacteria 1989
1129 Ga0501033_0000113 3300049570 Bacteria 78028
1130 Ga0501033_0000983 3300049570 Bacteria 25917
1131 Ga0501034_0000503 3300049571 Bacteria 63099
1132 Ga0501036_0000232 3300049572 Bacteria 37236
1133 Ga0501036_0077945 3300049572 Bacteria 2804
1134 Ga0501036_0331001 3300049572 Bacteria 1272
1135 Ga0501036_0378918 3300049572 Bacteria 1181
1136 Ga0501037_0000106 3300049573 Bacteria 79430
1137 Ga0501037_0002045 3300049573 Bacteria 14624
1138 Ga0501038_0000108 3300049574 Bacteria 70323
1139 Ga0501038_0252645 3300049574 Bacteria 1396
1140 Ga0501039_0000460 3300049575 Bacteria 29614
1141 Ga0501039_0029454 3300049575 Bacteria 4229
1142 Ga0501039_0075573 3300049575 Bacteria 2619
1143 Ga0501039_0145068 3300049575 Bacteria 1865
1144 Ga0501039_0295127 3300049575 Bacteria 1274
1145 Ga0501040_0008115 3300049576 Bacteria 6821
1146 Ga0501040_0125050 3300049576 Bacteria 1806
1147 Ga0501041_0171081 3300049577 Bacteria 1359
1148 Ga0501041_0294764 3300049577 Bacteria 1022
1149 Ga0501041_0365624 3300049577 Bacteria 912
1150 Ga0501042_0031122 3300049578 Bacteria 3775
1151 Ga0501042_0486005 3300049578 Bacteria 896
1152 Ga0501043_0000035 3300049579 Bacteria 133200
1153 Ga0501043_0102436 3300049579 Bacteria 2250
1154 Ga0501043_0506866 3300049579 Bacteria 901
1155 Ga0501046_0027551 3300049580 Bacteria 4634
1156 Ga0501046_0032152 3300049580 Bacteria 4250
1157 Ga0501046_0045172 3300049580 Bacteria 3500
1158 Ga0501046_0060099 3300049580 Bacteria 2975
1159 Ga0501046_0141250 3300049580 Bacteria 1822
1160 Ga0501047_0000792 3300049581 Bacteria 33063
1161 Ga0501047_0029142 3300049581 Bacteria 5323
1162 Ga0501048_0000116 3300049582 Bacteria 45512
1163 Ga0501048_0293564 3300049582 Bacteria 1156
1164 Ga0501048_0391153 3300049582 Bacteria 993
1165 Ga0501067_0001402 3300049583 Bacteria 13081
1166 Ga0501067_0022473 3300049583 Bacteria 3491
1167 Ga0501067_0040323 3300049583 Bacteria 2594
1168 Ga0501068_0000014 3300049584 Bacteria 62762
1169 Ga0501068_0298048 3300049584 Bacteria 1032
1170 Ga0501069_0021145 3300049585 Bacteria 3529
1171 Ga0501071_0039219 3300049587 Bacteria 3388
1172 Ga0501071_0042501 3300049587 Bacteria 3257
1173 Ga0501071_0218478 3300049587 Bacteria 1434
1174 Ga0501072_0000367 3300049588 Bacteria 32192
1175 Ga0501072_0111154 3300049588 Bacteria 2181
1176 Ga0501072_0216851 3300049588 Bacteria 1525
1177 Ga0501073_0000368 3300049589 Bacteria 30350
1178 Ga0501073_0042293 3300049589 Bacteria 3216
1179 Ga0501073_0076392 3300049589 Bacteria 2331
1180 Ga0501074_0001037 3300049590 Bacteria 18048
1181 Ga0501074_0007065 3300049590 Bacteria 8112
1182 Ga0501074_0238840 3300049590 Bacteria 1293
1183 Ga0501074_0310490 3300049590 Bacteria 1120
1184 Ga0501075_0096517 3300049591 Bacteria 2243
1185 Ga0501075_0139355 3300049591 Bacteria 1848
1186 Ga0501075_0151471 3300049591 Bacteria 1768
1187 Ga0501075_0171042 3300049591 Bacteria 1658
1188 Ga0501075_0446889 3300049591 Bacteria 986
1189 Ga0501076_0015465 3300049592 Bacteria 5767
1190 Ga0501076_0079891 3300049592 Bacteria 2625
1191 Ga0501076_0290632 3300049592 Bacteria 1339
1192 Ga0501076_0297003 3300049592 Bacteria 1324
1193 Ga0501077_0006376 3300049593 Bacteria 7234
1194 Ga0501077_0402434 3300049593 Bacteria 875
1195 Ga0501079_0005691 3300049741 Bacteria 9309
1196 Ga0501079_0006966 3300049741 Bacteria 8518
1197 Ga0501079_0035935 3300049741 Bacteria 3815
1198 Ga0501079_0045958 3300049741 Bacteria 3369
1199 Ga0501079_0351092 3300049741 Bacteria 1156
1200 Ga0501079_0572487 3300049741 Bacteria 888
1201 Ga0501080_0000332 3300049742 Bacteria 36151
1202 Ga0501080_0013737 3300049742 Bacteria 7455
1203 Ga0501080_0019600 3300049742 Bacteria 6267
1204 Ga0501080_0094780 3300049742 Bacteria 2772
1205 Ga0501080_0240268 3300049742 Bacteria 1653
1206 Ga0501080_0710075 3300049742 Bacteria 886
1207 Ga0501081_0026875 3300049743 Bacteria 3884
1208 Ga0501081_0043029 3300049743 Bacteria 3097
1209 Ga0501081_0067213 3300049743 Bacteria 2494
1210 Ga0501081_0312410 3300049743 Bacteria 1154
1211 Ga0501081_0576480 3300049743 Bacteria 841
1212 Ga0501083_0003499 3300049744 Bacteria 10992
1213 Ga0501035_0011457 3300049822 Bacteria 8221
1214 Ga0501035_0017102 3300049822 Bacteria 6682
1215 Ga0501044_0000051 3300049823 Bacteria 143658
1216 Ga0501044_0049072 3300049823 Bacteria 4357
1217 Ga0501044_0060999 3300049823 Bacteria 3859
1218 Ga0501045_0002440 3300049824 Bacteria 12638
1219 Ga0501045_0039923 3300049824 Bacteria 3415
1220 Ga0501045_0062651 3300049824 Bacteria 2729
1221 Ga0501045_0439709 3300049824 Bacteria 970
1222 nmdc:mga03683_174190_c1 3300050489 Bacteria 979
1223 nmdc:mga03683_244494_c1 3300050489 Bacteria 832
1224 nmdc:mga03n38_5710_c1 3300050490 Bacteria 4264
1225 nmdc:mga03n38_59835_c1 3300050490 Bacteria 1730
1226 nmdc:mga00v17_257907_c1 3300050491 Bacteria 1131
1227 nmdc:mga00v17_73327_c1 3300050491 Bacteria 2126
1228 nmdc:mga0yw44_167143_c1 3300050492 Bacteria 1443
1229 nmdc:mga0yw44_197784_c1 3300050492 Bacteria 1327
1230 nmdc:mga0yw44_222687_c1 3300050492 Bacteria 1251
1231 nmdc:mga0yw44_52649_c1 3300050492 Bacteria 2469
1232 nmdc:mga0k408_185814_c1 3300050493 Bacteria 1240
1233 nmdc:mga0k408_222913_c1 3300050493 Bacteria 1126
1234 nmdc:mga0k408_62872_c1 3300050493 Bacteria 2159
1235 nmdc:mga06z11_175774_c1 3300050494 Bacteria 1232
1236 nmdc:mga06z11_21836_c1 3300050494 Bacteria 2980
1237 nmdc:mga06z11_218477_c1 3300050494 Bacteria 1113
1238 nmdc:mga04h51_22765_c1 3300050495 Bacteria 1900
1239 nmdc:mga07m45_121932_c1 3300050496 Bacteria 1506
1240 nmdc:mga07m45_186818_c1 3300050496 Bacteria 1205
1241 nmdc:mga07m45_59246_c1 3300050496 Bacteria 2167
1242 nmdc:mga07m45_74206_c1 3300050496 Bacteria 1938
1243 nmdc:mga05p37_6789_c1 3300050507 Bacteria 13487
1244 nmdc:mga05p37_81855_c1 3300050507 Bacteria 3977
1245 nmdc:mga09592_178784_c1 3300050508 Bacteria 1835
1246 nmdc:mga09592_535495_c1 3300050508 Bacteria 1006
1247 nmdc:mga0qj67_1791_c1 3300050509 Bacteria 15187
1248 nmdc:mga0qj67_912746_c1 3300050509 Bacteria 692
1249 nmdc:mga06r32_1075_c1 3300050510 Bacteria 24529
1250 nmdc:mga06r32_155564_c1 3300050510 Bacteria 2267
1251 nmdc:mga06r32_326574_c1 3300050510 Bacteria 1519
1252 nmdc:mga06r32_3555_c1 3300050510 Bacteria 13921
1253 nmdc:mga06r32_42782_c1 3300050510 Bacteria 4309
1254 nmdc:mga08y16_127561_c1 3300050511 Bacteria 2646
1255 nmdc:mga08y16_448288_c1 3300050511 Bacteria 1316
1256 nmdc:mga08y16_61270_c1 3300050511 Bacteria 3929
1257 nmdc:mga0n895_42627_c1 3300050512 Bacteria 4416
1258 nmdc:mga0n895_53114_c1 3300050512 Bacteria 3980
1259 nmdc:mga0rr50_113428_c1 3300050513 Bacteria 2148
1260 nmdc:mga0rr50_277170_c1 3300050513 Bacteria 1399
1261 nmdc:mga08x19_227468_c1 3300050514 Bacteria 1283
1262 nmdc:mga0a205_114429_c1 3300050515 Bacteria 2596
1263 nmdc:mga0a205_44187_c1 3300050515 Bacteria 4294
1264 nmdc:mga0a205_449493_c1 3300050515 Bacteria 1148
1265 Ga0495601_0040237 3300053077 Bacteria 2928
1266 Ga0495612_0048299 3300053078 Bacteria 1745
1267 Ga0500610_0088184 3300053079 Bacteria 1613
1268 Ga0500610_0100993 3300053079 Bacteria 1493
1269 Ga0500635_0001265 3300053080 Bacteria 6036
1270 Ga0500635_0006375 3300053080 Bacteria 3148
1271 Ga0495655_0001686 3300053083 Bacteria 3421
1272 Ga0495655_0021533 3300053083 Bacteria 1461
1273 Ga0495655_0028819 3300053083 Bacteria 1330
1274 Ga0495655_0054911 3300053083 Bacteria 1067
1275 Ga0495595_0021261 3300053084 Bacteria 2833
1276 Ga0495595_0030388 3300053084 Bacteria 2423
1277 Ga0495619_0000355 3300053085 Bacteria 32054
1278 Ga0495619_0075033 3300053085 Bacteria 2269
1279 Ga0495619_0230882 3300053085 Bacteria 1282
1280 Ga0495619_0366377 3300053085 Bacteria 996
1281 Ga0500578_0086926 3300053086 Bacteria 1986
1282 Ga0500578_0121475 3300053086 Bacteria 1642
1283 Ga0500578_0191153 3300053086 Bacteria 1257
1284 Ga0500643_000032 3300053087 Bacteria 200350
1285 Ga0500647_0100739 3300053091 Bacteria 1379
1286 Ga0500583_0091857 3300053092 Bacteria 1478
1287 Ga0500566_0000026 3300053094 Bacteria 77138
1288 Ga0500566_0001584 3300053094 Bacteria 13387
1289 Ga0500566_0005873 3300053094 Bacteria 7295
1290 Ga0500566_0194899 3300053094 Bacteria 1028
1291 Ga0500640_002218 3300053095 Bacteria 6337
1292 Ga0500641_0143999 3300053096 Bacteria 1030
1293 Ga0500648_116176 3300053097 Bacteria 1471
1294 Ga0500650_0148713 3300053098 Bacteria 1084
1295 Ga0500556_0077074 3300053104 Bacteria 1254
1296 Ga0500557_000087 3300053105 Bacteria 32155
1297 Ga0500562_012186 3300053108 Bacteria 2185
1298 Ga0500569_108113 3300053109 Bacteria 917
1299 Ga0500572_001308 3300053111 Bacteria 6949
1300 Ga0500572_005714 3300053111 Bacteria 2828
1301 Ga0500572_009314 3300053111 Bacteria 2319
1302 Ga0500582_086169 3300053114 Bacteria 1083
1303 Ga0500591_065022 3300053115 Bacteria 1670
1304 Ga0500595_002640 3300053119 Bacteria 8722
1305 Ga0500595_009653 3300053119 Bacteria 3885
1306 Ga0500595_012338 3300053119 Bacteria 3309
1307 Ga0500595_012635 3300053119 Bacteria 3258
1308 Ga0500595_039261 3300053119 Bacteria 1532
1309 Ga0500597_125856 3300053120 Bacteria 1109
1310 Ga0500608_003190 3300053122 Bacteria 6097
1311 Ga0500608_199228 3300053122 Bacteria 829
1312 Ga0500614_000135 3300053123 Bacteria 18032
1313 Ga0500642_0001017 3300053130 Bacteria 8061
1314 Ga0500642_0096705 3300053130 Bacteria 1369
1315 Ga0500655_012393 3300053133 Bacteria 1550
1316 Ga0500559_0000081 3300053136 Bacteria 75262
1317 Ga0500559_0009036 3300053136 Bacteria 4330
1318 Ga0500559_0010760 3300053136 Bacteria 3922
1319 Ga0500559_0021965 3300053136 Bacteria 2706
1320 Ga0500559_0093710 3300053136 Bacteria 1377
1321 Ga0500564_023225 3300053138 Bacteria 2841
1322 Ga0500568_0040631 3300053139 Bacteria 1871
1323 Ga0500573_0035456 3300053140 Bacteria 2878
1324 Ga0500588_0031973 3300053146 Bacteria 1522
1325 Ga0500589_093460 3300053147 Bacteria 1320
1326 Ga0500590_011029 3300053148 Bacteria 4574
1327 Ga0500603_000591 3300053150 Bacteria 9040
1328 Ga0500604_0051330 3300053151 Bacteria 1273
1329 Ga0500619_003290 3300053154 Bacteria 3284
1330 Ga0500619_069727 3300053154 Bacteria 1168
1331 Ga0500620_001971 3300053155 Bacteria 3983
1332 Ga0500622_0004721 3300053156 Bacteria 8421
1333 Ga0500630_000362 3300053159 Bacteria 19136
1334 Ga0500638_033440 3300053162 Bacteria 2486
1335 Ga0500638_050884 3300053162 Bacteria 2003
1336 Ga0500638_071520 3300053162 Bacteria 1657
1337 Ga0500638_109955 3300053162 Bacteria 1274
1338 Ga0500639_000939 3300053163 Bacteria 14837
1339 Ga0500639_070182 3300053163 Bacteria 1787
1340 Ga0500636_0000276 3300053177 Bacteria 28456
1341 Ga0500636_0169880 3300053177 Bacteria 1180
1342 Ga0500637_0000122 3300053178 Bacteria 28103
1343 Ga0500637_0014625 3300053178 Bacteria 4142
1344 Ga0500576_023847 3300053725 Bacteria 2794
1345 Ga0500657_017820 3300053728 Bacteria 3359
1346 Ga0500625_007369 3300053729 Bacteria 4780
1347 Ga0500609_002995 3300053731 Bacteria 2402
1348 Ga0500552_000509 3300053733 Bacteria 3597
1349 Ga0500596_000713 3300053735 Bacteria 6500
1350 Ga0500596_002113 3300053735 Bacteria 3960
1351 Ga0500599_003652 3300053736 Bacteria 1886
1352 Ga0501084_0000773 3300054114 Bacteria 24332
1353 Ga0501084_0004881 3300054114 Bacteria 10952
1354 Ga0501084_0016443 3300054114 Bacteria 6145
1355 Ga0501084_0108206 3300054114 Bacteria 2335
1356 Ga0501084_0163826 3300054114 Bacteria 1876
1357 Ga0500661_000317 3300055283 Bacteria 8830
1358 Ga0501082_0000965 3300060353 Bacteria 25410
1359 Ga0501082_0007269 3300060353 Bacteria 9554
1360 Ga0501082_0013892 3300060353 Bacteria 6923
1361 Ga0501082_0081609 3300060353 Bacteria 2790
1362 Ga0501082_0160668 3300060353 Bacteria 1952
1363 Ga0501082_0223502 3300060353 Bacteria 1638
1364 Ga0501082_0867418 3300060353 Bacteria 790
1365 Ga0466962_0010405 3300061719 Bacteria 4471
1366 Ga0530510_0018748 3300061734 Bacteria 4908
1367 Ga0530510_0029015 3300061734 Bacteria 3969
1368 Ga0530510_0105275 3300061734 Bacteria 2064
1369 Ga0530510_0159248 3300061734 Bacteria 1669
1370 Ga0530510_0244493 3300061734 Bacteria 1336
1371 Ga0530510_0415839 3300061734 Bacteria 1015

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006846 Ga0075430_100000460 Ga0075430_10000046014 211
2 3300006847 Ga0075431_100000618 Ga0075431_10000061813 211
3 3300006880 Ga0075429_100235466 Ga0075429_1002354662 211
4 3300050507 nmdc:mga05p37_6789_c1 nmdc:mga05p37_6789_c1_2261_3016 211
5 3300050508 nmdc:mga09592_178784_c1 nmdc:mga09592_178784_c1_754_1509 211
6 3300050509 nmdc:mga0qj67_1791_c1 nmdc:mga0qj67_1791_c1_7182_7937 211
7 3300050510 nmdc:mga06r32_42782_c1 nmdc:mga06r32_42782_c1_493_1248 211
8 3300050509 nmdc:mga0qj67_912746_c1 nmdc:mga0qj67_912746_c1_34_681 213
9 3300006844 Ga0075428_100096395 Ga0075428_1000963954 215
10 3300009147 Ga0114129_10092734 Ga0114129_100927343 215
11 3300031249 Ga0265339_10004010 Ga0265339_100040108 224
12 3300031241 Ga0265325_10001325 Ga0265325_100013256 225
13 3300031595 Ga0265313_10009642 Ga0265313_100096425 225
14 3300046477 Ga0495664_0006016 Ga0495664_0006016_5133_5870 225
15 3300053077 Ga0495601_0040237 Ga0495601_0040237_1424_2161 225
16 3300049579 Ga0501043_0506866 Ga0501043_0506866_28_765 227
17 3300005340 Ga0070689_100388345 Ga0070689_1003883451 228
18 3300005341 Ga0070691_10040873 Ga0070691_100408732 228
19 3300005356 Ga0070674_100451175 Ga0070674_1004511752 228
20 3300005456 Ga0070678_100057626 Ga0070678_1000576263 228
21 3300005544 Ga0070686_100251212 Ga0070686_1002512121 228
22 3300005548 Ga0070665_100273328 Ga0070665_1002733283 228
23 3300009094 Ga0111539_10052427 Ga0111539_100524273 228
24 3300009553 Ga0105249_10095847 Ga0105249_100958473 228
25 3300013306 Ga0163162_10279967 Ga0163162_102799672 228
26 3300014968 Ga0157379_10521856 Ga0157379_105218561 228
27 3300025899 Ga0207642_10115630 Ga0207642_101156301 228
28 3300025907 Ga0207645_10101658 Ga0207645_101016582 228
29 3300025919 Ga0207657_10285756 Ga0207657_102857561 228
30 3300025933 Ga0207706_10108562 Ga0207706_101085622 228
31 3300025936 Ga0207670_10498721 Ga0207670_104987211 228
32 3300025937 Ga0207669_10025941 Ga0207669_100259414 228
33 3300025960 Ga0207651_10286324 Ga0207651_102863241 228
34 3300025961 Ga0207712_10102342 Ga0207712_101023421 228
35 3300026121 Ga0207683_10505790 Ga0207683_105057901 228
36 3300028379 Ga0268266_10143830 Ga0268266_101438302 228
37 3300028380 Ga0268265_10588685 Ga0268265_105886851 228
38 3300046474 Ga0495605_0095641 Ga0495605_0095641_540_1277 228
39 3300046684 Ga0495669_0006671 Ga0495669_0006671_1515_2252 228
40 3300046691 Ga0495670_0163712 Ga0495670_0163712_106_843 228
41 3300046694 Ga0495649_0133514 Ga0495649_0133514_306_1043 228
42 3300049568 Ga0501031_0137365 Ga0501031_0137365_367_1104 229
43 3300049743 Ga0501081_0576480 Ga0501081_0576480_89_826 229
44 3300005327 Ga0070658_10109433 Ga0070658_101094332 230
45 3300005365 Ga0070688_100069711 Ga0070688_1000697113 230
46 3300005367 Ga0070667_100044451 Ga0070667_1000444513 230
47 3300005548 Ga0070665_100030276 Ga0070665_1000302764 230
48 3300005614 Ga0068856_100126813 Ga0068856_1001268133 230
49 3300005617 Ga0068859_100392746 Ga0068859_1003927462 230
50 3300005843 Ga0068860_100179282 Ga0068860_1001792822 230
51 3300006931 Ga0097620_100392713 Ga0097620_1003927132 230
52 3300009101 Ga0105247_10015353 Ga0105247_100153532 230
53 3300009177 Ga0105248_10199477 Ga0105248_101994772 230
54 3300013297 Ga0157378_10103182 Ga0157378_101031823 230
55 3300013308 Ga0157375_10000681 Ga0157375_1000068110 230
56 3300014326 Ga0157380_10086801 Ga0157380_100868012 230
57 3300014968 Ga0157379_10041047 Ga0157379_100410476 230
58 3300014969 Ga0157376_10014965 Ga0157376_100149653 230
59 3300025900 Ga0207710_10008551 Ga0207710_100085514 230
60 3300025931 Ga0207644_10205569 Ga0207644_102055692 230
61 3300025936 Ga0207670_10030483 Ga0207670_100304833 230
62 3300025940 Ga0207691_10232160 Ga0207691_102321603 230
63 3300026078 Ga0207702_10727702 Ga0207702_107277021 230
64 3300028379 Ga0268266_10022518 Ga0268266_100225184 230
65 3300028381 Ga0268264_10318191 Ga0268264_103181912 230
66 3300048903 Ga0496100_0002783 Ga0496100_0002783_5217_5954 230
67 3300048904 Ga0496101_0001858 Ga0496101_0001858_1278_2015 230
68 3300048907 Ga0496104_0011555 Ga0496104_0011555_3850_4587 230
69 3300048908 Ga0496105_0001630 Ga0496105_0001630_9215_9952 230
70 3300048910 Ga0496107_0013617 Ga0496107_0013617_1917_2654 230
71 3300048911 Ga0496108_0060594 Ga0496108_0060594_641_1378 230
72 3300048912 Ga0496109_0143959 Ga0496109_0143959_851_1588 230
73 3300048917 Ga0496114_0013575 Ga0496114_0013575_2700_3437 230
74 3300048918 Ga0496115_0036328 Ga0496115_0036328_2550_3287 230
75 iso_pu_bacteria 2874590934 2874596253 233
76 iso_pu_bacteria 2874645413 2874650240 233
77 iso_pu_bacteria 2876771140 2876776718 233
78 iso_pu_bacteria 2876818435 2876824508 233
79 iso_pu_bacteria 2879074833 2879080855 233
80 iso_pu_bacteria 2879127579 2879133700 233
81 iso_pu_bacteria 2879142872 2879148202 233
82 iso_pu_bacteria 2966598605 2966603532 233
83 3300010375 Ga0105239_10219870 Ga0105239_102198703 234
84 3300031251 Ga0265327_10001131 Ga0265327_1000113113 234
85 3300031665 Ga0316575_10008085 Ga0316575_100080854 234
86 3300035398 Ga0316574_0035235 Ga0316574_0035235_1560_2300 234
87 3300037466 Ga0395898_0479053 Ga0395898_0479053_184_924 234
88 3300045051 Ga0451576_0336055 Ga0451576_0336055_276_1016 234
89 3300036647 Ga0316582_0245184 Ga0316582_0245184_13_726 235
90 3300046507 Ga0495606_0075148 Ga0495606_0075148_351_1058 235
91 3300049575 Ga0501039_0145068 Ga0501039_0145068_11_718 235
92 3300060353 Ga0501082_0867418 Ga0501082_0867418_19_729 235
93 3300013297 Ga0157378_10163265 Ga0157378_101632652 236
94 3300032005 Ga0307411_10023083 Ga0307411_100230833 236
95 iso_pu_bacteria 2616644941 2616899668 236
96 iso_pu_bacteria 2643221548 2643759516 236
97 iso_pu_bacteria 2870721527 2870730181 236
98 iso_pu_bacteria 8047710418 8047718241 236
99 3300044694 Ga0466963_0256953 Ga0466963_0256953_112_849 237
100 3300046648 Ga0495611_0107006 Ga0495611_0107006_279_992 237
101 3300025928 Ga0207700_10006113 Ga0207700_100061135 238
102 3300046679 Ga0495623_0005023 Ga0495623_0005023_7783_8499 238
103 3300049581 Ga0501047_0029142 Ga0501047_0029142_1184_1921 238
104 3300049582 Ga0501048_0391153 Ga0501048_0391153_258_980 238
105 3300049589 Ga0501073_0042293 Ga0501073_0042293_1512_2249 238
106 3300049590 Ga0501074_0007065 Ga0501074_0007065_4169_4906 238
107 3300049742 Ga0501080_0013737 Ga0501080_0013737_3364_4101 238
108 3300049823 Ga0501044_0049072 Ga0501044_0049072_1014_1751 238
109 3300049591 Ga0501075_0171042 Ga0501075_0171042_378_1196 240
110 iso_pu_bacteria 8016511872 8016522187 240
111 iso_pu_bacteria 2507262055 2507508459 241
112 iso_pu_bacteria 2508501009 2508542526 241
113 iso_pu_bacteria 2508501042 2508691701 241
114 iso_pu_bacteria 2508501128 2509150576 241
115 iso_pu_bacteria 2511231028 2511393925 241
116 iso_pu_bacteria 2513237092 2513625503 241
117 iso_pu_bacteria 2513237094 2513644500 241
118 iso_pu_bacteria 2513237095 2513645718 241
119 iso_pu_bacteria 2513237096 2513658047 241
120 iso_pu_bacteria 2513237098 2513674916 241
121 iso_pu_bacteria 2513237101 2513692688 241
122 iso_pu_bacteria 2513237102 2513703765 241
123 iso_pu_bacteria 2513237104 2513717174 241
124 iso_pu_bacteria 2513237137 2513855751 241
125 iso_pu_bacteria 2513237139 2513872893 241
126 iso_pu_bacteria 2513237141 2513894008 241
127 iso_pu_bacteria 2513237145 2513919859 241
128 iso_pu_bacteria 2513237161 2514013653 241
129 iso_pu_bacteria 2515154112 2515627051 241
130 iso_pu_bacteria 2517093001 2517107452 241
131 iso_pu_bacteria 2517572143 2517892289 241
132 iso_pu_bacteria 2524023205 2524437471 241
133 iso_pu_bacteria 2524023210 2524470616 241
134 iso_pu_bacteria 2524023228 2524540276 241
135 iso_pu_bacteria 2528768022 2528849945 241
136 iso_pu_bacteria 2617270735 2617347391 241
137 iso_pu_bacteria 2617270741 2617375642 241
138 iso_pu_bacteria 2667528175 2671120463 241
139 iso_pu_bacteria 2721755755 2723844933 241
140 iso_pu_bacteria 2728368998 2728747356 241
141 iso_pu_bacteria 2744054633 2745076537 241
142 iso_pu_bacteria 2791355196 2793065386 241
143 iso_pu_bacteria 2791355197 2793072368 241
144 iso_pu_bacteria 2791355199 2793082195 241
145 iso_pu_bacteria 2802429603 2805915209 241
146 iso_pu_bacteria 2816332527 2818238761 241
147 iso_pu_bacteria 2824600985 2824608907 241
148 iso_pu_bacteria 2824609381 2824617682 241
149 iso_pu_bacteria 2824617872 2824626135 241
150 iso_pu_bacteria 2824626560 2824635068 241
151 iso_pu_bacteria 2824635225 2824643805 241
152 iso_pu_bacteria 2824644064 2824652496 241
153 iso_pu_bacteria 2824653114 2824661116 241
154 iso_pu_bacteria 2824661429 2824670954 241
155 iso_pu_bacteria 2824671348 2824678769 241
156 iso_pu_bacteria 2824679649 2824686733 241
157 iso_pu_bacteria 2824687955 2824695238 241
158 iso_pu_bacteria 2824696289 2824703548 241
159 iso_pu_bacteria 2824704595 2824712487 241
160 iso_pu_bacteria 2824714736 2824722985 241
161 iso_pu_bacteria 2824723954 2824731793 241
162 iso_pu_bacteria 2824732956 2824739440 241
163 iso_pu_bacteria 2824746037 2824753444 241
164 iso_pu_bacteria 2824753945 2824763252 241
165 iso_pu_bacteria 2824763712 2824769964 241
166 iso_pu_bacteria 2824773399 2824781261 241
167 iso_pu_bacteria 2838122688 2838123616 241
168 iso_pu_bacteria 2841941048 2841946740 241
169 iso_pu_bacteria 2841949485 2841949715 241
170 iso_pu_bacteria 2841957949 2841958788 241
171 iso_pu_bacteria 2841966195 2841971779 241
172 iso_pu_bacteria 2841974524 2841974876 241
173 iso_pu_bacteria 2841983080 2841983561 241
174 iso_pu_bacteria 2842038055 2842038935 241
175 iso_pu_bacteria 2842045827 2842048119 241
176 iso_pu_bacteria 2844315083 2844319202 241
177 iso_pu_bacteria 2847930680 2847936345 241
178 iso_pu_bacteria 2847939898 2847946692 241
179 iso_pu_bacteria 2849076700 2849079187 241
180 iso_pu_bacteria 2857509624 2857514181 241
181 iso_pu_bacteria 2874590934 2874598180 241
182 iso_pu_bacteria 2874604998 2874605349 241
183 iso_pu_bacteria 2874612657 2874615054 241
184 iso_pu_bacteria 2874620515 2874627709 241
185 iso_pu_bacteria 2874628541 2874631979 241
186 iso_pu_bacteria 2874645413 2874652764 241
187 iso_pu_bacteria 2876761206 2876764637 241
188 iso_pu_bacteria 2876771140 2876778342 241
189 iso_pu_bacteria 2876808645 2876811295 241
190 iso_pu_bacteria 2876818435 2876825789 241
191 iso_pu_bacteria 2879074833 2879082136 241
192 iso_pu_bacteria 2879083081 2879090579 241
193 iso_pu_bacteria 2879099564 2879105781 241
194 iso_pu_bacteria 2879110137 2879111330 241
195 iso_pu_bacteria 2879127579 2879135283 241
196 iso_pu_bacteria 2879142872 2879150492 241
197 iso_pu_bacteria 2881364244 2881368707 241
198 iso_pu_bacteria 2881665667 2881673548 241
199 iso_pu_bacteria 2885366525 2885373029 241
200 iso_pu_bacteria 2885374607 2885379529 241
201 iso_pu_bacteria 2885383462 2885388351 241
202 iso_pu_bacteria 2885409591 2885411377 241
203 iso_pu_bacteria 2888378607 2888384193 241
204 iso_pu_bacteria 2888388044 2888393681 241
205 iso_pu_bacteria 2888419890 2888424661 241
206 iso_pu_bacteria 2889033259 2889039700 241
207 iso_pu_bacteria 2903727486 2903731044 241
208 iso_pu_bacteria 2903748898 2903757523 241
209 iso_pu_bacteria 2903768456 2903777912 241
210 iso_pu_bacteria 2904666416 2904672971 241
211 iso_pu_bacteria 2904690495 2904694575 241
212 iso_pu_bacteria 2904699407 2904702461 241
213 iso_pu_bacteria 2904711408 2904714789 241
214 iso_pu_bacteria 2906602504 2906608175 241
215 iso_pu_bacteria 2906610324 2906618737 241
216 iso_pu_bacteria 2906626472 2906626936 241
217 iso_pu_bacteria 2906635258 2906637433 241
218 iso_pu_bacteria 2906643746 2906649205 241
219 iso_pu_bacteria 2906660503 2906666264 241
220 iso_pu_bacteria 2908739725 2908742577 241
221 iso_pu_bacteria 2908756301 2908760130 241
222 iso_pu_bacteria 2908775508 2908780309 241
223 iso_pu_bacteria 2922361189 2922365492 241
224 iso_pu_bacteria 2922368715 2922374534 241
225 iso_pu_bacteria 2922386360 2922391115 241
226 iso_pu_bacteria 2922393267 2922400670 241
227 iso_pu_bacteria 2922425934 2922430398 241
228 iso_pu_bacteria 2929615660 2929618200 241
229 iso_pu_bacteria 2929624759 2929632388 241
230 iso_pu_bacteria 2932784394 2932790494 241
231 iso_pu_bacteria 2932794094 2932799828 241
232 iso_pu_bacteria 2932801729 2932802669 241
233 iso_pu_bacteria 2932809354 2932810915 241
234 iso_pu_bacteria 2932818245 2932823755 241
235 iso_pu_bacteria 2932828146 2932830125 241
236 iso_pu_bacteria 2933577622 2933580128 241
237 iso_pu_bacteria 2935608549 2935609003 241
238 iso_pu_bacteria 2935616580 2935622649 241
239 iso_pu_bacteria 2935630451 2935631561 241
240 iso_pu_bacteria 2935638405 2935642551 241
241 iso_pu_bacteria 2935648319 2935653290 241
242 iso_pu_bacteria 2935656913 2935660239 241
243 iso_pu_bacteria 2935665750 2935668145 241
244 iso_pu_bacteria 2935675223 2935676179 241
245 iso_pu_bacteria 2935684952 2935686161 241
246 iso_pu_bacteria 2935694250 2935701212 241
247 iso_pu_bacteria 2935703347 2935706005 241
248 iso_pu_bacteria 2935713505 2935714713 241
249 iso_pu_bacteria 2935722832 2935725332 241
250 iso_pu_bacteria 2935732158 2935732308 241
251 iso_pu_bacteria 2935741537 2935741687 241
252 iso_pu_bacteria 2935750917 2935752126 241
253 iso_pu_bacteria 2935760218 2935766475 241
254 iso_pu_bacteria 2935769743 2935771921 241
255 iso_pu_bacteria 2935777560 2935778647 241
256 iso_pu_bacteria 2935785616 2935788967 241
257 iso_pu_bacteria 2935793552 2935795232 241
258 iso_pu_bacteria 2935801545 2935803004 241
259 iso_pu_bacteria 2935810662 2935814321 241
260 iso_pu_bacteria 2935819856 2935822163 241
261 iso_pu_bacteria 2935827899 2935831458 241
262 iso_pu_bacteria 2935837841 2935838318 241
263 iso_pu_bacteria 2935847175 2935847745 241
264 iso_pu_bacteria 2935855204 2935860898 241
265 iso_pu_bacteria 2935864058 2935869765 241
266 iso_pu_bacteria 2935873716 2935878816 241
267 iso_pu_bacteria 2935883170 2935886955 241
268 iso_pu_bacteria 2935908558 2935908983 241
269 iso_pu_bacteria 2935916978 2935919701 241
270 iso_pu_bacteria 2935926038 2935926443 241
271 iso_pu_bacteria 2935934488 2935934893 241
272 iso_pu_bacteria 2935942939 2935943343 241
273 iso_pu_bacteria 2935951376 2935951781 241
274 iso_pu_bacteria 2935959822 2935960534 241
275 iso_pu_bacteria 2935967501 2935967906 241
276 iso_pu_bacteria 2935975950 2935978533 241
277 iso_pu_bacteria 2935984226 2935991247 241
278 iso_pu_bacteria 2935992306 2935994788 241
279 iso_pu_bacteria 2936002035 2936003430 241
280 iso_pu_bacteria 2936011229 2936016160 241
281 iso_pu_bacteria 2936019824 2936024793 241
282 iso_pu_bacteria 2936028420 2936032041 241
283 iso_pu_bacteria 2936037263 2936039877 241
284 iso_pu_bacteria 2936046547 2936049902 241
285 iso_pu_bacteria 2936055302 2936060854 241
286 iso_pu_bacteria 2940556831 2940557071 241
287 iso_pu_bacteria 2941507105 2941511355 241
288 iso_pu_bacteria 2941515067 2941519056 241
289 iso_pu_bacteria 2941523033 2941526364 241
290 iso_pu_bacteria 2941531003 2941532946 241
291 iso_pu_bacteria 2941538514 2941539014 241
292 iso_pu_bacteria 3005474847 3005480316 241
293 iso_pu_bacteria 3005483717 3005484442 241
294 iso_pu_bacteria 3005506211 3005510451 241
295 iso_pu_bacteria 3005587118 3005587912 241
296 iso_pu_bacteria 3005594810 3005599367 241
297 iso_pu_bacteria 3005710791 3005715030 241
298 iso_pu_bacteria 3005718088 3005722444 241
299 iso_pu_bacteria 8006926726 8006931850 241
300 iso_pu_bacteria 8006933436 8006940564 241
301 iso_pu_bacteria 8006964411 8006967186 241
302 iso_pu_bacteria 8006973647 8006980252 241
303 iso_pu_bacteria 8006984368 8006986535 241
304 iso_pu_bacteria 8006994254 8006995880 241
305 iso_pu_bacteria 8016522445 8016529497 241
306 iso_pu_bacteria 8016530956 8016534707 241
307 iso_pu_bacteria 8016539877 8016547924 241
308 iso_pu_bacteria 8016548790 8016554206 241
309 iso_pu_bacteria 8016557553 8016562581 241
310 iso_pu_bacteria 8016566248 8016573057 241
311 iso_pu_bacteria 8016575299 8016577203 241
312 iso_pu_bacteria 8016583857 8016591607 241
313 iso_pu_bacteria 8016595262 8016600369 241
314 iso_pu_bacteria 8016603502 8016610369 241
315 iso_pu_bacteria 8016613128 8016614562 241
316 iso_pu_bacteria 8016622563 8016626438 241
317 iso_pu_bacteria 8016630954 8016640192 241
318 iso_pu_bacteria 8017057580 8017063483 241
319 iso_pu_bacteria 8019530166 8019534474 241
320 iso_pu_bacteria 8019538911 8019544998 241
321 iso_pu_bacteria 8019547302 8019553530 241
322 iso_pu_bacteria 8019555841 8019556629 241
323 iso_pu_bacteria 8019565922 8019568680 241
324 iso_pu_bacteria 8019576017 8019582802 241
325 iso_pu_bacteria 8019586578 8019590592 241
326 iso_pu_bacteria 8019597564 8019600760 241
327 iso_pu_bacteria 8019608314 8019617792 241
328 iso_pu_bacteria 8019619141 8019628312 241
329 iso_pu_bacteria 8019629233 8019634316 241
330 iso_pu_bacteria 8019648815 8019658538 241
331 iso_pu_bacteria 8019659431 8019662190 241
332 iso_pu_bacteria 8019668869 8019671705 241
333 iso_pu_bacteria 8019678201 8019684390 241
334 iso_pu_bacteria 8019687851 8019690203 241
335 iso_pu_bacteria 8055742211 8055746211 241
336 iso_pu_bacteria 8056673599 8056673720 241
337 iso_pu_bacteria 8056681323 8056686752 241
338 iso_pu_bacteria 8056689827 8056691396 241
339 iso_pu_bacteria 8056967851 8056968160 241
340 3300046529 Ga0495652_0393937 Ga0495652_0393937_132_863 242
341 3300044712 Ga0453684_0156891 Ga0453684_0156891_61_798 243
342 3300014745 Ga0157377_10116747 Ga0157377_101167472 244
343 3300049589 Ga0501073_0076392 Ga0501073_0076392_1154_1891 244
344 3300060353 Ga0501082_0007269 Ga0501082_0007269_4263_5000 244
345 3300001989 JGI24739J22299_10011915 JGI24739J22299_100119153 245
346 3300003203 JGI25406J46586_10000152 JGI25406J46586_100001524 245
347 3300003203 JGI25406J46586_10001897 JGI25406J46586_100018973 245
348 3300003215 JGI25153J46596_10001484 JGI25153J46596_100014846 245
349 3300003215 JGI25153J46596_10007366 JGI25153J46596_100073663 245
350 3300003215 JGI25153J46596_10010783 JGI25153J46596_100107831 245
351 3300003215 JGI25153J46596_10010984 JGI25153J46596_100109841 245
352 3300003354 JGI25160J50197_1003224 JGI25160J50197_10032248 245
353 3300003354 JGI25160J50197_1020832 JGI25160J50197_10208321 245
354 3300003659 JGI25404J52841_10011149 JGI25404J52841_100111493 245
355 3300003659 JGI25404J52841_10012715 JGI25404J52841_100127153 245
356 3300003794 Ga0055531_10027686 Ga0055531_100276863 245
357 3300005262 Ga0065165_1006665 Ga0065165_10066656 245
358 3300005262 Ga0065165_1009480 Ga0065165_10094804 245
359 3300005262 Ga0065165_1016313 Ga0065165_10163133 245
360 3300005262 Ga0065165_1044199 Ga0065165_10441991 245
361 3300005327 Ga0070658_10085134 Ga0070658_100851342 245
362 3300005328 Ga0070676_10045474 Ga0070676_100454743 245
363 3300005329 Ga0070683_100009176 Ga0070683_1000091769 245
364 3300005329 Ga0070683_100092374 Ga0070683_1000923743 245
365 3300005329 Ga0070683_100421074 Ga0070683_1004210742 245
366 3300005331 Ga0070670_100140336 Ga0070670_1001403362 245
367 3300005331 Ga0070670_100444375 Ga0070670_1004443751 245
368 3300005334 Ga0068869_100015964 Ga0068869_1000159645 245
369 3300005334 Ga0068869_100099803 Ga0068869_1000998032 245
370 3300005336 Ga0070680_100010915 Ga0070680_1000109152 245
371 3300005336 Ga0070680_100016559 Ga0070680_1000165594 245
372 3300005336 Ga0070680_100045774 Ga0070680_1000457742 245
373 3300005336 Ga0070680_100058822 Ga0070680_1000588221 245
374 3300005336 Ga0070680_100094910 Ga0070680_1000949102 245
375 3300005336 Ga0070680_100289007 Ga0070680_1002890072 245
376 3300005337 Ga0070682_100015561 Ga0070682_1000155614 245
377 3300005337 Ga0070682_100136919 Ga0070682_1001369191 245
378 3300005338 Ga0068868_100030944 Ga0068868_1000309443 245
379 3300005338 Ga0068868_100063031 Ga0068868_1000630313 245
380 3300005338 Ga0068868_100309414 Ga0068868_1003094142 245
381 3300005338 Ga0068868_100329121 Ga0068868_1003291212 245
382 3300005338 Ga0068868_100599677 Ga0068868_1005996771 245
383 3300005339 Ga0070660_100015177 Ga0070660_1000151775 245
384 3300005339 Ga0070660_100636143 Ga0070660_1006361431 245
385 3300005344 Ga0070661_100068091 Ga0070661_1000680913 245
386 3300005344 Ga0070661_100243529 Ga0070661_1002435292 245
387 3300005344 Ga0070661_100519315 Ga0070661_1005193152 245
388 3300005347 Ga0070668_100062782 Ga0070668_1000627823 245
389 3300005347 Ga0070668_100283512 Ga0070668_1002835122 245
390 3300005347 Ga0070668_100361828 Ga0070668_1003618282 245
391 3300005347 Ga0070668_100635831 Ga0070668_1006358311 245
392 3300005347 Ga0070668_100785394 Ga0070668_1007853941 245
393 3300005353 Ga0070669_100138429 Ga0070669_1001384292 245
394 3300005353 Ga0070669_100187901 Ga0070669_1001879012 245
395 3300005354 Ga0070675_100153835 Ga0070675_1001538352 245
396 3300005354 Ga0070675_100681844 Ga0070675_1006818441 245
397 3300005355 Ga0070671_100055683 Ga0070671_1000556833 245
398 3300005355 Ga0070671_100221809 Ga0070671_1002218091 245
399 3300005365 Ga0070688_100023990 Ga0070688_1000239902 245
400 3300005365 Ga0070688_100219130 Ga0070688_1002191302 245
401 3300005365 Ga0070688_100413870 Ga0070688_1004138702 245
402 3300005366 Ga0070659_100448068 Ga0070659_1004480681 245
403 3300005367 Ga0070667_100192490 Ga0070667_1001924901 245
404 3300005434 Ga0070709_10000348 Ga0070709_1000034821 245
405 3300005434 Ga0070709_10389736 Ga0070709_103897361 245
406 3300005434 Ga0070709_10491369 Ga0070709_104913691 245
407 3300005435 Ga0070714_100185256 Ga0070714_1001852563 245
408 3300005435 Ga0070714_100372649 Ga0070714_1003726492 245
409 3300005436 Ga0070713_100030721 Ga0070713_1000307214 245
410 3300005436 Ga0070713_100131727 Ga0070713_1001317272 245
411 3300005436 Ga0070713_100159978 Ga0070713_1001599782 245
412 3300005437 Ga0070710_10001018 Ga0070710_100010183 245
413 3300005437 Ga0070710_10025298 Ga0070710_100252983 245
414 3300005438 Ga0070701_10001976 Ga0070701_100019766 245
415 3300005439 Ga0070711_100003777 Ga0070711_1000037775 245
416 3300005439 Ga0070711_100017214 Ga0070711_1000172144 245
417 3300005439 Ga0070711_100017253 Ga0070711_1000172533 245
418 3300005439 Ga0070711_100017385 Ga0070711_1000173854 245
419 3300005439 Ga0070711_100035090 Ga0070711_1000350902 245
420 3300005440 Ga0070705_100000184 Ga0070705_10000018419 245
421 3300005440 Ga0070705_100075838 Ga0070705_1000758383 245
422 3300005440 Ga0070705_100144563 Ga0070705_1001445632 245
423 3300005441 Ga0070700_100020538 Ga0070700_1000205386 245
424 3300005441 Ga0070700_100170257 Ga0070700_1001702572 245
425 3300005441 Ga0070700_100343007 Ga0070700_1003430071 245
426 3300005444 Ga0070694_100001319 Ga0070694_1000013194 245
427 3300005444 Ga0070694_100072822 Ga0070694_1000728222 245
428 3300005445 Ga0070708_100164554 Ga0070708_1001645542 245
429 3300005455 Ga0070663_100004200 Ga0070663_10000420010 245
430 3300005455 Ga0070663_100033806 Ga0070663_1000338062 245
431 3300005455 Ga0070663_100075413 Ga0070663_1000754132 245
432 3300005455 Ga0070663_100089460 Ga0070663_1000894602 245
433 3300005455 Ga0070663_100124014 Ga0070663_1001240142 245
434 3300005455 Ga0070663_100679846 Ga0070663_1006798461 245
435 3300005456 Ga0070678_100074209 Ga0070678_1000742093 245
436 3300005456 Ga0070678_100184789 Ga0070678_1001847892 245
437 3300005456 Ga0070678_100236001 Ga0070678_1002360012 245
438 3300005456 Ga0070678_100351573 Ga0070678_1003515732 245
439 3300005457 Ga0070662_100407110 Ga0070662_1004071102 245
440 3300005458 Ga0070681_10018832 Ga0070681_100188325 245
441 3300005458 Ga0070681_10032485 Ga0070681_100324856 245
442 3300005458 Ga0070681_10040909 Ga0070681_100409094 245
443 3300005458 Ga0070681_10072055 Ga0070681_100720553 245
444 3300005458 Ga0070681_10171363 Ga0070681_101713631 245
445 3300005467 Ga0070706_100439610 Ga0070706_1004396101 245
446 3300005471 Ga0070698_100110518 Ga0070698_1001105182 245
447 3300005518 Ga0070699_100006925 Ga0070699_1000069258 245
448 3300005530 Ga0070679_100070394 Ga0070679_1000703942 245
449 3300005530 Ga0070679_100096351 Ga0070679_1000963512 245
450 3300005530 Ga0070679_100101490 Ga0070679_1001014903 245
451 3300005530 Ga0070679_100135666 Ga0070679_1001356662 245
452 3300005530 Ga0070679_100212367 Ga0070679_1002123672 245
453 3300005530 Ga0070679_100392242 Ga0070679_1003922422 245
454 3300005535 Ga0070684_100000716 Ga0070684_10000071611 245
455 3300005535 Ga0070684_100013944 Ga0070684_1000139444 245
456 3300005536 Ga0070697_100004908 Ga0070697_1000049089 245
457 3300005536 Ga0070697_100021627 Ga0070697_1000216274 245
458 3300005539 Ga0068853_100037777 Ga0068853_1000377772 245
459 3300005539 Ga0068853_100303436 Ga0068853_1003034362 245
460 3300005539 Ga0068853_100332698 Ga0068853_1003326982 245
461 3300005539 Ga0068853_100420193 Ga0068853_1004201931 245
462 3300005545 Ga0070695_100000587 Ga0070695_10000058712 245
463 3300005546 Ga0070696_100001650 Ga0070696_10000165014 245
464 3300005546 Ga0070696_100110800 Ga0070696_1001108003 245
465 3300005547 Ga0070693_100133101 Ga0070693_1001331011 245
466 3300005548 Ga0070665_100055908 Ga0070665_1000559084 245
467 3300005548 Ga0070665_100062937 Ga0070665_1000629374 245
468 3300005548 Ga0070665_100075430 Ga0070665_1000754302 245
469 3300005548 Ga0070665_100148070 Ga0070665_1001480702 245
470 3300005548 Ga0070665_100371790 Ga0070665_1003717901 245
471 3300005549 Ga0070704_100000206 Ga0070704_10000020613 245
472 3300005563 Ga0068855_100016984 Ga0068855_1000169844 245
473 3300005563 Ga0068855_100019039 Ga0068855_1000190392 245
474 3300005563 Ga0068855_100058060 Ga0068855_1000580602 245
475 3300005563 Ga0068855_100089413 Ga0068855_1000894133 245
476 3300005563 Ga0068855_100093587 Ga0068855_1000935871 245
477 3300005563 Ga0068855_100157409 Ga0068855_1001574092 245
478 3300005563 Ga0068855_100164567 Ga0068855_1001645672 245
479 3300005563 Ga0068855_100186299 Ga0068855_1001862994 245
480 3300005563 Ga0068855_100209861 Ga0068855_1002098612 245
481 3300005563 Ga0068855_100367294 Ga0068855_1003672943 245
482 3300005563 Ga0068855_100720381 Ga0068855_1007203812 245
483 3300005564 Ga0070664_100195015 Ga0070664_1001950152 245
484 3300005577 Ga0068857_100002509 Ga0068857_1000025092 245
485 3300005577 Ga0068857_100003141 Ga0068857_1000031413 245
486 3300005577 Ga0068857_100037702 Ga0068857_1000377024 245
487 3300005577 Ga0068857_100106490 Ga0068857_1001064903 245
488 3300005577 Ga0068857_100354273 Ga0068857_1003542732 245
489 3300005578 Ga0068854_100234774 Ga0068854_1002347742 245
490 3300005614 Ga0068856_100000205 Ga0068856_10000020541 245
491 3300005614 Ga0068856_100033304 Ga0068856_1000333043 245
492 3300005614 Ga0068856_100066935 Ga0068856_1000669355 245
493 3300005614 Ga0068856_100121604 Ga0068856_1001216042 245
494 3300005614 Ga0068856_100244008 Ga0068856_1002440082 245
495 3300005614 Ga0068856_100352890 Ga0068856_1003528901 245
496 3300005614 Ga0068856_100435430 Ga0068856_1004354302 245
497 3300005615 Ga0070702_100048741 Ga0070702_1000487411 245
498 3300005616 Ga0068852_100041102 Ga0068852_1000411022 245
499 3300005616 Ga0068852_100188264 Ga0068852_1001882642 245
500 3300005616 Ga0068852_100400846 Ga0068852_1004008461 245
501 3300005616 Ga0068852_100461050 Ga0068852_1004610502 245
502 3300005616 Ga0068852_100773042 Ga0068852_1007730421 245
503 3300005617 Ga0068859_100072341 Ga0068859_1000723412 245
504 3300005617 Ga0068859_100092646 Ga0068859_1000926462 245
505 3300005617 Ga0068859_100713107 Ga0068859_1007131072 245
506 3300005618 Ga0068864_100027216 Ga0068864_1000272165 245
507 3300005618 Ga0068864_100110644 Ga0068864_1001106442 245
508 3300005618 Ga0068864_100372035 Ga0068864_1003720352 245
509 3300005618 Ga0068864_100377671 Ga0068864_1003776712 245
510 3300005618 Ga0068864_100524381 Ga0068864_1005243812 245
511 3300005719 Ga0068861_100022098 Ga0068861_1000220983 245
512 3300005719 Ga0068861_100070911 Ga0068861_1000709112 245
513 3300005719 Ga0068861_100072212 Ga0068861_1000722123 245
514 3300005719 Ga0068861_100125966 Ga0068861_1001259663 245
515 3300005719 Ga0068861_100416924 Ga0068861_1004169242 245
516 3300005719 Ga0068861_100463597 Ga0068861_1004635971 245
517 3300005834 Ga0068851_10004835 Ga0068851_100048353 245
518 3300005834 Ga0068851_10008966 Ga0068851_100089663 245
519 3300005834 Ga0068851_10126831 Ga0068851_101268312 245
520 3300005841 Ga0068863_100377740 Ga0068863_1003777401 245
521 3300005841 Ga0068863_100807019 Ga0068863_1008070191 245
522 3300005842 Ga0068858_100240414 Ga0068858_1002404142 245
523 3300005842 Ga0068858_100258161 Ga0068858_1002581612 245
524 3300005842 Ga0068858_100480766 Ga0068858_1004807661 245
525 3300005842 Ga0068858_100513421 Ga0068858_1005134212 245
526 3300005842 Ga0068858_100595031 Ga0068858_1005950312 245
527 3300005843 Ga0068860_100000316 Ga0068860_10000031639 245
528 3300005843 Ga0068860_100002287 Ga0068860_10000228715 245
529 3300005843 Ga0068860_100113422 Ga0068860_1001134223 245
530 3300005843 Ga0068860_100238704 Ga0068860_1002387042 245
531 3300005844 Ga0068862_100000157 Ga0068862_10000015712 245
532 3300005844 Ga0068862_100178558 Ga0068862_1001785582 245
533 3300005844 Ga0068862_100299043 Ga0068862_1002990433 245
534 3300005844 Ga0068862_100302627 Ga0068862_1003026272 245
535 3300005937 Ga0081455_10000179 Ga0081455_100001795 245
536 3300005937 Ga0081455_10002652 Ga0081455_1000265218 245
537 3300005937 Ga0081455_10003466 Ga0081455_1000346614 245
538 3300005937 Ga0081455_10003832 Ga0081455_1000383215 245
539 3300005937 Ga0081455_10027258 Ga0081455_100272584 245
540 3300005981 Ga0081538_10082973 Ga0081538_100829732 245
541 3300005983 Ga0081540_1000500 Ga0081540_100050010 245
542 3300005983 Ga0081540_1005905 Ga0081540_10059058 245
543 3300005983 Ga0081540_1006800 Ga0081540_10068001 245
544 3300005983 Ga0081540_1009855 Ga0081540_10098556 245
545 3300005983 Ga0081540_1013838 Ga0081540_10138382 245
546 3300005983 Ga0081540_1015121 Ga0081540_10151213 245
547 3300005983 Ga0081540_1015390 Ga0081540_10153902 245
548 3300005983 Ga0081540_1015394 Ga0081540_10153944 245
549 3300005983 Ga0081540_1017128 Ga0081540_10171281 245
550 3300005983 Ga0081540_1041100 Ga0081540_10411003 245
551 3300005983 Ga0081540_1108864 Ga0081540_11088641 245
552 3300005985 Ga0081539_10000273 Ga0081539_1000027367 245
553 3300005985 Ga0081539_10000735 Ga0081539_1000073527 245
554 3300005985 Ga0081539_10013306 Ga0081539_100133062 245
555 3300005985 Ga0081539_10047212 Ga0081539_100472123 245
556 3300006028 Ga0070717_10001338 Ga0070717_1000133812 245
557 3300006028 Ga0070717_10082183 Ga0070717_100821832 245
558 3300006038 Ga0075365_10239715 Ga0075365_102397152 245
559 3300006038 Ga0075365_10243393 Ga0075365_102433931 245
560 3300006038 Ga0075365_10293262 Ga0075365_102932622 245
561 3300006038 Ga0075365_10358951 Ga0075365_103589511 245
562 3300006042 Ga0075368_10044167 Ga0075368_100441672 245
563 3300006048 Ga0075363_100009382 Ga0075363_1000093821 245
564 3300006048 Ga0075363_100016047 Ga0075363_1000160472 245
565 3300006048 Ga0075363_100072931 Ga0075363_1000729312 245
566 3300006051 Ga0075364_10251397 Ga0075364_102513972 245
567 3300006051 Ga0075364_10270098 Ga0075364_102700982 245
568 3300006051 Ga0075364_10328620 Ga0075364_103286201 245
569 3300006163 Ga0070715_10119267 Ga0070715_101192672 245
570 3300006173 Ga0070716_100001393 Ga0070716_1000013932 245
571 3300006173 Ga0070716_100053034 Ga0070716_1000530343 245
572 3300006173 Ga0070716_100091457 Ga0070716_1000914573 245
573 3300006173 Ga0070716_100156068 Ga0070716_1001560682 245
574 3300006175 Ga0070712_100003228 Ga0070712_1000032288 245
575 3300006175 Ga0070712_100205018 Ga0070712_1002050181 245
576 3300006175 Ga0070712_100276691 Ga0070712_1002766912 245
577 3300006177 Ga0075362_10124679 Ga0075362_101246791 245
578 3300006178 Ga0075367_10017879 Ga0075367_100178795 245
579 3300006178 Ga0075367_10162835 Ga0075367_101628352 245
580 3300006178 Ga0075367_10262457 Ga0075367_102624572 245
581 3300006186 Ga0075369_10068263 Ga0075369_100682631 245
582 3300006195 Ga0075366_10135616 Ga0075366_101356162 245
583 3300006195 Ga0075366_10136140 Ga0075366_101361402 245
584 3300006195 Ga0075366_10182887 Ga0075366_101828872 245
585 3300006195 Ga0075366_10355416 Ga0075366_103554161 245
586 3300006237 Ga0097621_100283602 Ga0097621_1002836022 245
587 3300006353 Ga0075370_10034969 Ga0075370_100349691 245
588 3300006353 Ga0075370_10166921 Ga0075370_101669212 245
589 3300006358 Ga0068871_100029523 Ga0068871_1000295232 245
590 3300006358 Ga0068871_100197001 Ga0068871_1001970011 245
591 3300006844 Ga0075428_100063252 Ga0075428_1000632522 245
592 3300006844 Ga0075428_100478331 Ga0075428_1004783312 245
593 3300006846 Ga0075430_100064268 Ga0075430_1000642682 245
594 3300006847 Ga0075431_100000844 Ga0075431_10000084423 245
595 3300006847 Ga0075431_100006976 Ga0075431_1000069769 245
596 3300006847 Ga0075431_100282644 Ga0075431_1002826441 245
597 3300006847 Ga0075431_100282684 Ga0075431_1002826842 245
598 3300006847 Ga0075431_100556640 Ga0075431_1005566402 245
599 3300006852 Ga0075433_10001926 Ga0075433_100019263 245
600 3300006871 Ga0075434_100000993 Ga0075434_10000099320 245
601 3300006871 Ga0075434_100016830 Ga0075434_1000168307 245
602 3300006871 Ga0075434_100130106 Ga0075434_1001301063 245
603 3300006881 Ga0068865_100542563 Ga0068865_1005425632 245
604 3300006914 Ga0075436_100042779 Ga0075436_1000427792 245
605 3300006931 Ga0097620_100072342 Ga0097620_1000723422 245
606 3300006931 Ga0097620_100092641 Ga0097620_1000926413 245
607 3300006931 Ga0097620_100713125 Ga0097620_1007131252 245
608 3300006941 Ga0099825_1036129 Ga0099825_10361292 245
609 3300006942 Ga0099824_1019396 Ga0099824_10193961 245
610 3300006942 Ga0099824_1044365 Ga0099824_10443652 245
611 3300006943 Ga0099822_1002380 Ga0099822_100238013 245
612 3300007076 Ga0075435_100125140 Ga0075435_1001251402 245
613 3300007788 Ga0099795_10109057 Ga0099795_101090571 245
614 3300009092 Ga0105250_10173880 Ga0105250_101738801 245
615 3300009093 Ga0105240_10008011 Ga0105240_1000801120 245
616 3300009093 Ga0105240_10035111 Ga0105240_100351111 245
617 3300009093 Ga0105240_10035437 Ga0105240_100354372 245
618 3300009093 Ga0105240_10036454 Ga0105240_100364543 245
619 3300009093 Ga0105240_10387695 Ga0105240_103876952 245
620 3300009093 Ga0105240_10406209 Ga0105240_104062093 245
621 3300009094 Ga0111539_10005028 Ga0111539_1000502812 245
622 3300009094 Ga0111539_10044229 Ga0111539_100442295 245
623 3300009098 Ga0105245_10372479 Ga0105245_103724791 245
624 3300009098 Ga0105245_10376463 Ga0105245_103764631 245
625 3300009098 Ga0105245_10660278 Ga0105245_106602781 245
626 3300009101 Ga0105247_10078191 Ga0105247_100781912 245
627 3300009101 Ga0105247_10232179 Ga0105247_102321792 245
628 3300009147 Ga0114129_10110252 Ga0114129_101102521 245
629 3300009147 Ga0114129_10135904 Ga0114129_101359044 245
630 3300009148 Ga0105243_10082405 Ga0105243_100824052 245
631 3300009148 Ga0105243_10689448 Ga0105243_106894481 245
632 3300009174 Ga0105241_10019598 Ga0105241_100195983 245
633 3300009176 Ga0105242_10566557 Ga0105242_105665572 245
634 3300009176 Ga0105242_10829096 Ga0105242_108290961 245
635 3300009177 Ga0105248_10130363 Ga0105248_101303631 245
636 3300009177 Ga0105248_10183906 Ga0105248_101839063 245
637 3300009177 Ga0105248_10265803 Ga0105248_102658033 245
638 3300009177 Ga0105248_10290770 Ga0105248_102907701 245
639 3300009177 Ga0105248_10685886 Ga0105248_106858862 245
640 3300009545 Ga0105237_10017852 Ga0105237_100178524 245
641 3300009545 Ga0105237_10023811 Ga0105237_100238113 245
642 3300009545 Ga0105237_10033114 Ga0105237_100331145 245
643 3300009545 Ga0105237_10059905 Ga0105237_100599053 245
644 3300009545 Ga0105237_10082613 Ga0105237_100826132 245
645 3300009545 Ga0105237_10281961 Ga0105237_102819612 245
646 3300009545 Ga0105237_10405931 Ga0105237_104059312 245
647 3300009551 Ga0105238_10002798 Ga0105238_100027989 245
648 3300009551 Ga0105238_10004789 Ga0105238_100047892 245
649 3300009551 Ga0105238_10059132 Ga0105238_100591322 245
650 3300009551 Ga0105238_10088391 Ga0105238_100883912 245
651 3300009551 Ga0105238_10167167 Ga0105238_101671672 245
652 3300009551 Ga0105238_10357917 Ga0105238_103579172 245
653 3300009551 Ga0105238_10478174 Ga0105238_104781741 245
654 3300009551 Ga0105238_10914560 Ga0105238_109145601 245
655 3300009553 Ga0105249_10004242 Ga0105249_100042429 245
656 3300010375 Ga0105239_10007959 Ga0105239_100079592 245
657 3300010375 Ga0105239_10072517 Ga0105239_100725171 245
658 3300010375 Ga0105239_10090645 Ga0105239_100906451 245
659 3300010375 Ga0105239_10109330 Ga0105239_101093303 245
660 3300010375 Ga0105239_10115086 Ga0105239_101150863 245
661 3300010375 Ga0105239_10144167 Ga0105239_101441671 245
662 3300010375 Ga0105239_10156564 Ga0105239_101565642 245
663 3300010375 Ga0105239_10161331 Ga0105239_101613312 245
664 3300010375 Ga0105239_10289885 Ga0105239_102898852 245
665 3300010375 Ga0105239_10379054 Ga0105239_103790542 245
666 3300010375 Ga0105239_10400619 Ga0105239_104006191 245
667 3300010375 Ga0105239_10623615 Ga0105239_106236151 245
668 3300010375 Ga0105239_10771880 Ga0105239_107718801 245
669 3300011119 Ga0105246_10036299 Ga0105246_100362993 245
670 3300011119 Ga0105246_10072125 Ga0105246_100721253 245
671 3300011119 Ga0105246_10308624 Ga0105246_103086242 245
672 3300013100 Ga0157373_10223971 Ga0157373_102239712 245
673 3300013104 Ga0157370_10015624 Ga0157370_100156247 245
674 3300013104 Ga0157370_10055142 Ga0157370_100551422 245
675 3300013104 Ga0157370_10296344 Ga0157370_102963442 245
676 3300013105 Ga0157369_10000996 Ga0157369_1000099630 245
677 3300013105 Ga0157369_10007824 Ga0157369_1000782411 245
678 3300013105 Ga0157369_10051549 Ga0157369_100515494 245
679 3300013105 Ga0157369_10112631 Ga0157369_101126312 245
680 3300013105 Ga0157369_10415169 Ga0157369_104151692 245
681 3300013296 Ga0157374_10013272 Ga0157374_100132723 245
682 3300013296 Ga0157374_10299631 Ga0157374_102996311 245
683 3300013297 Ga0157378_10700145 Ga0157378_107001452 245
684 3300013297 Ga0157378_10926882 Ga0157378_109268822 245
685 3300013306 Ga0163162_10177021 Ga0163162_101770211 245
686 3300013307 Ga0157372_10339872 Ga0157372_103398721 245
687 3300013308 Ga0157375_10036651 Ga0157375_100366516 245
688 3300013308 Ga0157375_10079068 Ga0157375_100790681 245
689 3300014325 Ga0163163_10006000 Ga0163163_100060009 245
690 3300014325 Ga0163163_10337601 Ga0163163_103376011 245
691 3300014326 Ga0157380_10118538 Ga0157380_101185382 245
692 3300014326 Ga0157380_10357420 Ga0157380_103574202 245
693 3300014745 Ga0157377_10091192 Ga0157377_100911922 245
694 3300014968 Ga0157379_10066997 Ga0157379_100669973 245
695 3300014968 Ga0157379_10226391 Ga0157379_102263913 245
696 3300014968 Ga0157379_10251519 Ga0157379_102515192 245
697 3300014968 Ga0157379_10713154 Ga0157379_107131542 245
698 3300014969 Ga0157376_10075405 Ga0157376_100754053 245
699 3300017792 Ga0163161_10244239 Ga0163161_102442392 245
700 3300020070 Ga0206356_10359229 Ga0206356_103592292 245
701 3300021320 Ga0214544_1000002 Ga0214544_1000002307 245
702 3300021321 Ga0214542_1000001 Ga0214542_1000001657 245
703 3300021324 Ga0214545_1000001 Ga0214545_1000001723 245
704 3300021327 Ga0214543_1000001 Ga0214543_1000001472 245
705 3300021358 Ga0213873_10003228 Ga0213873_100032283 245
706 3300021384 Ga0213876_10001215 Ga0213876_100012154 245
707 3300021384 Ga0213876_10198854 Ga0213876_101988542 245
708 3300021388 Ga0213875_10032072 Ga0213875_100320722 245
709 3300021388 Ga0213875_10132272 Ga0213875_101322721 245
710 3300022467 Ga0224712_10015360 Ga0224712_100153603 245
711 3300025253 Ga0209677_103425 Ga0209677_1034254 245
712 3300025254 Ga0209148_1000613 Ga0209148_10006133 245
713 3300025254 Ga0209148_1006070 Ga0209148_10060703 245
714 3300025261 Ga0209233_1005807 Ga0209233_10058074 245
715 3300025261 Ga0209233_1008575 Ga0209233_10085752 245
716 3300025261 Ga0209233_1021595 Ga0209233_10215953 245
717 3300025261 Ga0209233_1022933 Ga0209233_10229332 245
718 3300025272 Ga0209455_1005473 Ga0209455_10054732 245
719 3300025272 Ga0209455_1009401 Ga0209455_10094011 245
720 3300025295 Ga0209564_1015858 Ga0209564_10158583 245
721 3300025297 Ga0209758_1000140 Ga0209758_1000140157 245
722 3300025297 Ga0209758_1000947 Ga0209758_100094725 245
723 3300025297 Ga0209758_1003609 Ga0209758_100360916 245
724 3300025297 Ga0209758_1004382 Ga0209758_10043823 245
725 3300025297 Ga0209758_1005082 Ga0209758_100508210 245
726 3300025297 Ga0209758_1007936 Ga0209758_10079362 245
727 3300025297 Ga0209758_1016825 Ga0209758_10168254 245
728 3300025299 Ga0209256_1023531 Ga0209256_10235312 245
729 3300025302 Ga0207426_1000626 Ga0207426_100062646 245
730 3300025302 Ga0207426_1000892 Ga0207426_10008922 245
731 3300025302 Ga0207426_1005341 Ga0207426_10053416 245
732 3300025302 Ga0207426_1027317 Ga0207426_10273172 245
733 3300025302 Ga0207426_1050027 Ga0207426_10500271 245
734 3300025304 Ga0209257_1007293 Ga0209257_10072931 245
735 3300025304 Ga0209257_1022286 Ga0209257_10222862 245
736 3300025315 Ga0207697_10012580 Ga0207697_100125802 245
737 3300025315 Ga0207697_10051545 Ga0207697_100515451 245
738 3300025315 Ga0207697_10135181 Ga0207697_101351812 245
739 3300025321 Ga0207656_10008091 Ga0207656_100080913 245
740 3300025321 Ga0207656_10013293 Ga0207656_100132933 245
741 3300025321 Ga0207656_10125020 Ga0207656_101250202 245
742 3300025321 Ga0207656_10162756 Ga0207656_101627561 245
743 3300025711 Ga0207696_1042465 Ga0207696_10424651 245
744 3300025885 Ga0207653_10000536 Ga0207653_100005369 245
745 3300025885 Ga0207653_10002803 Ga0207653_100028035 245
746 3300025898 Ga0207692_10000116 Ga0207692_100001164 245
747 3300025898 Ga0207692_10030959 Ga0207692_100309593 245
748 3300025900 Ga0207710_10007078 Ga0207710_100070782 245
749 3300025900 Ga0207710_10062029 Ga0207710_100620293 245
750 3300025901 Ga0207688_10205981 Ga0207688_102059811 245
751 3300025904 Ga0207647_10011073 Ga0207647_100110733 245
752 3300025904 Ga0207647_10023846 Ga0207647_100238463 245
753 3300025904 Ga0207647_10025616 Ga0207647_100256162 245
754 3300025904 Ga0207647_10204172 Ga0207647_102041721 245
755 3300025905 Ga0207685_10107587 Ga0207685_101075871 245
756 3300025905 Ga0207685_10193965 Ga0207685_101939652 245
757 3300025906 Ga0207699_10000958 Ga0207699_100009583 245
758 3300025906 Ga0207699_10090766 Ga0207699_100907663 245
759 3300025906 Ga0207699_10165628 Ga0207699_101656281 245
760 3300025906 Ga0207699_10342268 Ga0207699_103422682 245
761 3300025906 Ga0207699_10550578 Ga0207699_105505781 245
762 3300025908 Ga0207643_10153888 Ga0207643_101538881 245
763 3300025909 Ga0207705_10058216 Ga0207705_100582162 245
764 3300025910 Ga0207684_10221856 Ga0207684_102218562 245
765 3300025910 Ga0207684_10340482 Ga0207684_103404822 245
766 3300025911 Ga0207654_10000308 Ga0207654_1000030828 245
767 3300025911 Ga0207654_10165481 Ga0207654_101654812 245
768 3300025911 Ga0207654_10302430 Ga0207654_103024302 245
769 3300025912 Ga0207707_10000713 Ga0207707_1000071325 245
770 3300025912 Ga0207707_10001623 Ga0207707_1000162324 245
771 3300025912 Ga0207707_10005494 Ga0207707_1000549413 245
772 3300025912 Ga0207707_10060434 Ga0207707_100604342 245
773 3300025912 Ga0207707_10352934 Ga0207707_103529342 245
774 3300025913 Ga0207695_10001719 Ga0207695_100017197 245
775 3300025913 Ga0207695_10001812 Ga0207695_1000181220 245
776 3300025913 Ga0207695_10022151 Ga0207695_100221516 245
777 3300025913 Ga0207695_10025188 Ga0207695_100251885 245
778 3300025913 Ga0207695_10050386 Ga0207695_100503863 245
779 3300025913 Ga0207695_10147925 Ga0207695_101479251 245
780 3300025913 Ga0207695_10385794 Ga0207695_103857942 245
781 3300025914 Ga0207671_10008038 Ga0207671_100080385 245
782 3300025914 Ga0207671_10026849 Ga0207671_100268493 245
783 3300025914 Ga0207671_10027204 Ga0207671_100272044 245
784 3300025914 Ga0207671_10156673 Ga0207671_101566732 245
785 3300025914 Ga0207671_10249092 Ga0207671_102490922 245
786 3300025914 Ga0207671_10369300 Ga0207671_103693002 245
787 3300025915 Ga0207693_10073136 Ga0207693_100731362 245
788 3300025915 Ga0207693_10149159 Ga0207693_101491593 245
789 3300025916 Ga0207663_10005557 Ga0207663_100055575 245
790 3300025916 Ga0207663_10016904 Ga0207663_100169043 245
791 3300025916 Ga0207663_10125820 Ga0207663_101258203 245
792 3300025916 Ga0207663_10261042 Ga0207663_102610422 245
793 3300025916 Ga0207663_10721485 Ga0207663_107214851 245
794 3300025917 Ga0207660_10007065 Ga0207660_100070657 245
795 3300025917 Ga0207660_10025784 Ga0207660_100257844 245
796 3300025917 Ga0207660_10033152 Ga0207660_100331523 245
797 3300025917 Ga0207660_10051559 Ga0207660_100515592 245
798 3300025917 Ga0207660_10180680 Ga0207660_101806801 245
799 3300025917 Ga0207660_10201690 Ga0207660_102016901 245
800 3300025917 Ga0207660_10431375 Ga0207660_104313751 245
801 3300025918 Ga0207662_10077224 Ga0207662_100772242 245
802 3300025918 Ga0207662_10408770 Ga0207662_104087701 245
803 3300025919 Ga0207657_10001786 Ga0207657_1000178617 245
804 3300025919 Ga0207657_10008840 Ga0207657_100088402 245
805 3300025919 Ga0207657_10119096 Ga0207657_101190962 245
806 3300025920 Ga0207649_10045765 Ga0207649_100457652 245
807 3300025920 Ga0207649_10111834 Ga0207649_101118342 245
808 3300025920 Ga0207649_10464696 Ga0207649_104646961 245
809 3300025921 Ga0207652_10004315 Ga0207652_100043158 245
810 3300025921 Ga0207652_10038882 Ga0207652_100388821 245
811 3300025921 Ga0207652_10088110 Ga0207652_100881103 245
812 3300025921 Ga0207652_10102017 Ga0207652_101020173 245
813 3300025921 Ga0207652_10111939 Ga0207652_101119392 245
814 3300025921 Ga0207652_10245070 Ga0207652_102450703 245
815 3300025924 Ga0207694_10000157 Ga0207694_1000015744 245
816 3300025924 Ga0207694_10012829 Ga0207694_100128297 245
817 3300025924 Ga0207694_10055535 Ga0207694_100555352 245
818 3300025924 Ga0207694_10151191 Ga0207694_101511912 245
819 3300025924 Ga0207694_10154625 Ga0207694_101546251 245
820 3300025924 Ga0207694_10385136 Ga0207694_103851362 245
821 3300025925 Ga0207650_10320479 Ga0207650_103204792 245
822 3300025925 Ga0207650_10337568 Ga0207650_103375681 245
823 3300025927 Ga0207687_10028220 Ga0207687_100282201 245
824 3300025927 Ga0207687_10165424 Ga0207687_101654242 245
825 3300025927 Ga0207687_10215116 Ga0207687_102151161 245
826 3300025927 Ga0207687_10276648 Ga0207687_102766482 245
827 3300025927 Ga0207687_10340549 Ga0207687_103405491 245
828 3300025928 Ga0207700_10021515 Ga0207700_100215152 245
829 3300025928 Ga0207700_10185652 Ga0207700_101856522 245
830 3300025929 Ga0207664_10177434 Ga0207664_101774343 245
831 3300025931 Ga0207644_10436088 Ga0207644_104360881 245
832 3300025932 Ga0207690_10515508 Ga0207690_105155081 245
833 3300025933 Ga0207706_10115913 Ga0207706_101159133 245
834 3300025933 Ga0207706_10666964 Ga0207706_106669641 245
835 3300025934 Ga0207686_10119430 Ga0207686_101194303 245
836 3300025934 Ga0207686_10382088 Ga0207686_103820881 245
837 3300025935 Ga0207709_10011280 Ga0207709_100112806 245
838 3300025935 Ga0207709_10369264 Ga0207709_103692641 245
839 3300025936 Ga0207670_10528863 Ga0207670_105288632 245
840 3300025937 Ga0207669_10289370 Ga0207669_102893702 245
841 3300025938 Ga0207704_10013820 Ga0207704_100138203 245
842 3300025938 Ga0207704_10102744 Ga0207704_101027442 245
843 3300025939 Ga0207665_10001402 Ga0207665_1000140212 245
844 3300025939 Ga0207665_10087694 Ga0207665_100876941 245
845 3300025939 Ga0207665_10117920 Ga0207665_101179201 245
846 3300025939 Ga0207665_10166867 Ga0207665_101668671 245
847 3300025939 Ga0207665_10184538 Ga0207665_101845383 245
848 3300025939 Ga0207665_10297906 Ga0207665_102979061 245
849 3300025939 Ga0207665_10400204 Ga0207665_104002041 245
850 3300025939 Ga0207665_10439645 Ga0207665_104396451 245
851 3300025940 Ga0207691_10140759 Ga0207691_101407591 245
852 3300025940 Ga0207691_10167997 Ga0207691_101679973 245
853 3300025940 Ga0207691_10344342 Ga0207691_103443422 245
854 3300025941 Ga0207711_10029828 Ga0207711_100298281 245
855 3300025941 Ga0207711_10190825 Ga0207711_101908252 245
856 3300025941 Ga0207711_10425561 Ga0207711_104255612 245
857 3300025942 Ga0207689_10144622 Ga0207689_101446222 245
858 3300025942 Ga0207689_10342191 Ga0207689_103421911 245
859 3300025944 Ga0207661_10001379 Ga0207661_1000137910 245
860 3300025944 Ga0207661_10012609 Ga0207661_100126091 245
861 3300025945 Ga0207679_10132374 Ga0207679_101323743 245
862 3300025949 Ga0207667_10008116 Ga0207667_1000811610 245
863 3300025949 Ga0207667_10012664 Ga0207667_1001266410 245
864 3300025949 Ga0207667_10072054 Ga0207667_100720542 245
865 3300025949 Ga0207667_10077912 Ga0207667_100779121 245
866 3300025949 Ga0207667_10141144 Ga0207667_101411443 245
867 3300025949 Ga0207667_10187735 Ga0207667_101877351 245
868 3300025949 Ga0207667_10389079 Ga0207667_103890792 245
869 3300025949 Ga0207667_10457502 Ga0207667_104575021 245
870 3300025949 Ga0207667_10529320 Ga0207667_105293201 245
871 3300025960 Ga0207651_10076518 Ga0207651_100765183 245
872 3300025960 Ga0207651_10348077 Ga0207651_103480772 245
873 3300025961 Ga0207712_10147690 Ga0207712_101476901 245
874 3300025961 Ga0207712_10261523 Ga0207712_102615232 245
875 3300025972 Ga0207668_10045275 Ga0207668_100452754 245
876 3300025972 Ga0207668_10045547 Ga0207668_100455473 245
877 3300025981 Ga0207640_10154249 Ga0207640_101542492 245
878 3300025981 Ga0207640_10206684 Ga0207640_102066842 245
879 3300025986 Ga0207658_10333093 Ga0207658_103330931 245
880 3300026023 Ga0207677_10070485 Ga0207677_100704852 245
881 3300026023 Ga0207677_10409386 Ga0207677_104093861 245
882 3300026035 Ga0207703_10037329 Ga0207703_100373294 245
883 3300026035 Ga0207703_10062253 Ga0207703_100622531 245
884 3300026035 Ga0207703_10306444 Ga0207703_103064442 245
885 3300026035 Ga0207703_10327967 Ga0207703_103279671 245
886 3300026035 Ga0207703_10495043 Ga0207703_104950431 245
887 3300026035 Ga0207703_10905668 Ga0207703_109056681 245
888 3300026041 Ga0207639_10010722 Ga0207639_100107224 245
889 3300026041 Ga0207639_10076718 Ga0207639_100767183 245
890 3300026041 Ga0207639_10113242 Ga0207639_101132422 245
891 3300026041 Ga0207639_10294526 Ga0207639_102945261 245
892 3300026041 Ga0207639_10509763 Ga0207639_105097631 245
893 3300026067 Ga0207678_10014420 Ga0207678_100144202 245
894 3300026067 Ga0207678_10036160 Ga0207678_100361604 245
895 3300026067 Ga0207678_10037981 Ga0207678_100379814 245
896 3300026067 Ga0207678_10098778 Ga0207678_100987781 245
897 3300026067 Ga0207678_10155364 Ga0207678_101553642 245
898 3300026067 Ga0207678_10161758 Ga0207678_101617581 245
899 3300026067 Ga0207678_10178066 Ga0207678_101780662 245
900 3300026067 Ga0207678_10254370 Ga0207678_102543702 245
901 3300026067 Ga0207678_10276172 Ga0207678_102761722 245
902 3300026075 Ga0207708_10126781 Ga0207708_101267812 245
903 3300026075 Ga0207708_10225048 Ga0207708_102250482 245
904 3300026075 Ga0207708_10630123 Ga0207708_106301231 245
905 3300026075 Ga0207708_10692215 Ga0207708_106922151 245
906 3300026078 Ga0207702_10000002 Ga0207702_10000002300 245
907 3300026078 Ga0207702_10000048 Ga0207702_10000048116 245
908 3300026078 Ga0207702_10096505 Ga0207702_100965052 245
909 3300026078 Ga0207702_10243985 Ga0207702_102439853 245
910 3300026089 Ga0207648_10062317 Ga0207648_100623174 245
911 3300026089 Ga0207648_10066627 Ga0207648_100666272 245
912 3300026095 Ga0207676_10014722 Ga0207676_100147222 245
913 3300026095 Ga0207676_10358072 Ga0207676_103580722 245
914 3300026095 Ga0207676_10617158 Ga0207676_106171582 245
915 3300026095 Ga0207676_10691250 Ga0207676_106912501 245
916 3300026116 Ga0207674_10006147 Ga0207674_100061474 245
917 3300026116 Ga0207674_10049099 Ga0207674_100490992 245
918 3300026116 Ga0207674_10128650 Ga0207674_101286502 245
919 3300026116 Ga0207674_10132628 Ga0207674_101326282 245
920 3300026118 Ga0207675_100021910 Ga0207675_1000219104 245
921 3300026118 Ga0207675_100067701 Ga0207675_1000677012 245
922 3300026118 Ga0207675_100077004 Ga0207675_1000770043 245
923 3300026118 Ga0207675_100540939 Ga0207675_1005409392 245
924 3300026121 Ga0207683_10068392 Ga0207683_100683923 245
925 3300026121 Ga0207683_10174161 Ga0207683_101741613 245
926 3300026121 Ga0207683_10259539 Ga0207683_102595392 245
927 3300026121 Ga0207683_10325101 Ga0207683_103251011 245
928 3300026121 Ga0207683_10443759 Ga0207683_104437591 245
929 3300026142 Ga0207698_10017601 Ga0207698_100176011 245
930 3300026142 Ga0207698_10139213 Ga0207698_101392133 245
931 3300026142 Ga0207698_10146616 Ga0207698_101466161 245
932 3300026142 Ga0207698_10205242 Ga0207698_102052423 245
933 3300026142 Ga0207698_10330588 Ga0207698_103305881 245
934 3300027296 Ga0209389_1000233 Ga0209389_10002331 245
935 3300027296 Ga0209389_1010778 Ga0209389_10107781 245
936 3300027357 Ga0209589_1000001 Ga0209589_100000142 245
937 3300027357 Ga0209589_1001423 Ga0209589_100142310 245
938 3300027361 Ga0209489_100001 Ga0209489_10000142 245
939 3300027361 Ga0209489_102560 Ga0209489_1025601 245
940 3300027361 Ga0209489_112041 Ga0209489_11204110 245
941 3300027363 Ga0209700_100001 Ga0209700_10000142 245
942 3300027363 Ga0209700_100062 Ga0209700_100062114 245
943 3300027907 Ga0207428_10020898 Ga0207428_100208987 245
944 3300027907 Ga0207428_10048417 Ga0207428_100484173 245
945 3300028379 Ga0268266_10008946 Ga0268266_100089464 245
946 3300028379 Ga0268266_10029812 Ga0268266_100298122 245
947 3300028379 Ga0268266_10059181 Ga0268266_100591813 245
948 3300028379 Ga0268266_10139420 Ga0268266_101394202 245
949 3300028379 Ga0268266_10175211 Ga0268266_101752112 245
950 3300028379 Ga0268266_10486490 Ga0268266_104864901 245
951 3300028379 Ga0268266_10588223 Ga0268266_105882232 245
952 3300028380 Ga0268265_10000603 Ga0268265_100006032 245
953 3300028380 Ga0268265_10269350 Ga0268265_102693501 245
954 3300028380 Ga0268265_10301961 Ga0268265_103019611 245
955 3300028381 Ga0268264_10000430 Ga0268264_1000043039 245
956 3300028381 Ga0268264_10000660 Ga0268264_1000066027 245
957 3300028381 Ga0268264_10590034 Ga0268264_105900341 245
958 3300028381 Ga0268264_10922820 Ga0268264_109228202 245
959 3300028563 Ga0265319_1038153 Ga0265319_10381531 245
960 3300028653 Ga0265323_10002533 Ga0265323_100025334 245
961 3300028654 Ga0265322_10020623 Ga0265322_100206232 245
962 3300028666 Ga0265336_10001363 Ga0265336_100013637 245
963 3300028786 Ga0307517_10000772 Ga0307517_1000077210 245
964 3300028794 Ga0307515_10032886 Ga0307515_100328866 245
965 3300028800 Ga0265338_10000086 Ga0265338_10000086168 245
966 3300029957 Ga0265324_10004123 Ga0265324_100041237 245
967 3300030521 Ga0307511_10034642 Ga0307511_100346424 245
968 3300030522 Ga0307512_10209715 Ga0307512_102097152 245
969 3300031235 Ga0265330_10015512 Ga0265330_100155124 245
970 3300031235 Ga0265330_10025688 Ga0265330_100256881 245
971 3300031235 Ga0265330_10062916 Ga0265330_100629162 245
972 3300031239 Ga0265328_10021772 Ga0265328_100217722 245
973 3300031241 Ga0265325_10022969 Ga0265325_100229692 245
974 3300031247 Ga0265340_10003545 Ga0265340_100035453 245
975 3300031249 Ga0265339_10103891 Ga0265339_101038911 245
976 3300031249 Ga0265339_10167279 Ga0265339_101672791 245
977 3300031249 Ga0265339_10190466 Ga0265339_101904661 245
978 3300031250 Ga0265331_10082432 Ga0265331_100824322 245
979 3300031250 Ga0265331_10140782 Ga0265331_101407821 245
980 3300031507 Ga0307509_10108318 Ga0307509_101083183 245
981 3300031507 Ga0307509_10523715 Ga0307509_105237152 245
982 3300031548 Ga0307408_100347845 Ga0307408_1003478452 245
983 3300031548 Ga0307408_100364843 Ga0307408_1003648431 245
984 3300031616 Ga0307508_10000009 Ga0307508_10000009116 245
985 3300031616 Ga0307508_10035294 Ga0307508_100352941 245
986 3300031616 Ga0307508_10059744 Ga0307508_100597444 245
987 3300031616 Ga0307508_10516871 Ga0307508_105168711 245
988 3300031711 Ga0265314_10097683 Ga0265314_100976833 245
989 3300031712 Ga0265342_10023565 Ga0265342_100235651 245
990 3300031712 Ga0265342_10101215 Ga0265342_101012152 245
991 3300031730 Ga0307516_10033789 Ga0307516_100337892 245
992 3300031730 Ga0307516_10355669 Ga0307516_103556691 245
993 3300031824 Ga0307413_10111217 Ga0307413_101112173 245
994 3300031852 Ga0307410_10054864 Ga0307410_100548643 245
995 3300031852 Ga0307410_10432699 Ga0307410_104326991 245
996 3300031901 Ga0307406_10229220 Ga0307406_102292202 245
997 3300031901 Ga0307406_10284929 Ga0307406_102849292 245
998 3300031903 Ga0307407_10073614 Ga0307407_100736142 245
999 3300032002 Ga0307416_100925289 Ga0307416_1009252892 245
1000 3300032005 Ga0307411_10056429 Ga0307411_100564292 245
1001 3300032126 Ga0307415_100097693 Ga0307415_1000976932 245
1002 3300032126 Ga0307415_100153561 Ga0307415_1001535613 245
1003 3300032126 Ga0307415_100231745 Ga0307415_1002317452 245
1004 3300033179 Ga0307507_10061608 Ga0307507_100616082 245
1005 3300033180 Ga0307510_10009821 Ga0307510_1000982113 245
1006 3300033180 Ga0307510_10025487 Ga0307510_100254874 245
1007 3300033180 Ga0307510_10150825 Ga0307510_101508253 245
1008 3300033442 Ga0315911_1000001 Ga0315911_100000135 245
1009 3300034819 Ga0373958_0008632 Ga0373958_0008632_591_1334 245
1010 3300034820 Ga0373959_0051830 Ga0373959_0051830_77_814 245
1011 3300035083 Ga0373926_0021182 Ga0373926_0021182_699_1436 245
1012 3300035083 Ga0373926_0070555 Ga0373926_0070555_282_1022 245
1013 3300035085 Ga0373929_0048161 Ga0373929_0048161_67_804 245
1014 3300035086 Ga0373934_0033722 Ga0373934_0033722_984_1721 245
1015 3300035086 Ga0373934_0056566 Ga0373934_0056566_175_912 245
1016 3300035088 Ga0373940_0025623 Ga0373940_0025623_691_1434 245
1017 3300035090 Ga0373949_0012402 Ga0373949_0012402_122_865 245
1018 3300035092 Ga0373952_0087362 Ga0373952_0087362_36_773 245
1019 3300035111 Ga0373923_0028040 Ga0373923_0028040_203_940 245
1020 3300035111 Ga0373923_0178218 Ga0373923_0178218_175_912 245
1021 3300035113 Ga0373936_0006503 Ga0373936_0006503_2702_3439 245
1022 3300035113 Ga0373936_0014005 Ga0373936_0014005_1239_1976 245
1023 3300035114 Ga0373939_0004462 Ga0373939_0004462_59_802 245
1024 3300035114 Ga0373939_0004484 Ga0373939_0004484_566_1309 245
1025 3300035115 Ga0373941_0004526 Ga0373941_0004526_337_1080 245
1026 3300035116 Ga0373945_0106979 Ga0373945_0106979_322_1062 245
1027 3300035117 Ga0373953_0051764 Ga0373953_0051764_114_851 245
1028 3300035118 Ga0373954_0000070 Ga0373954_0000070_13657_14394 245
1029 3300035118 Ga0373954_0010716 Ga0373954_0010716_562_1299 245
1030 3300035119 Ga0373956_0001764 Ga0373956_0001764_1323_2060 245
1031 3300035120 Ga0373957_0002936 Ga0373957_0002936_1309_2046 245
1032 3300035120 Ga0373957_0007409 Ga0373957_0007409_2761_3498 245
1033 3300035170 Ga0373943_0007891 Ga0373943_0007891_175_912 245
1034 3300035170 Ga0373943_0012028 Ga0373943_0012028_121_864 245
1035 3300035171 Ga0373946_0003425 Ga0373946_0003425_2987_3724 245
1036 3300035171 Ga0373946_0129457 Ga0373946_0129457_399_1142 245
1037 3300035172 Ga0373955_0000771 Ga0373955_0000771_8243_8980 245
1038 3300035172 Ga0373955_0304793 Ga0373955_0304793_54_794 245
1039 3300035207 Ga0373942_0010230 Ga0373942_0010230_1324_2067 245
1040 3300035241 Ga0373961_0004030 Ga0373961_0004030_985_1728 245
1041 3300035241 Ga0373961_0083272 Ga0373961_0083272_76_861 245
1042 3300035242 Ga0373962_0008952 Ga0373962_0008952_103_840 245
1043 3300035242 Ga0373962_0010848 Ga0373962_0010848_391_1134 245
1044 3300035242 Ga0373962_0023849 Ga0373962_0023849_448_1185 245
1045 3300035691 Ga0373931_0000607 Ga0373931_0000607_6718_7461 245
1046 3300035691 Ga0373931_0001266 Ga0373931_0001266_2705_3448 245
1047 3300035691 Ga0373931_0007703 Ga0373931_0007703_4002_4739 245
1048 3300035691 Ga0373931_0314573 Ga0373931_0314573_139_876 245
1049 3300035692 Ga0373935_0011212 Ga0373935_0011212_4219_4956 245
1050 3300035692 Ga0373935_0051066 Ga0373935_0051066_409_1149 245
1051 3300035695 Ga0373927_0010404 Ga0373927_0010404_3265_4005 245
1052 3300035695 Ga0373927_0014740 Ga0373927_0014740_1185_1925 245
1053 3300035695 Ga0373927_0017386 Ga0373927_0017386_393_1136 245
1054 3300035695 Ga0373927_0026380 Ga0373927_0026380_332_1069 245
1055 3300035724 Ga0373933_0000041 Ga0373933_0000041_74884_75621 245
1056 3300035724 Ga0373933_0006540 Ga0373933_0006540_4211_4948 245
1057 3300035724 Ga0373933_0059443 Ga0373933_0059443_917_1654 245
1058 3300035725 Ga0373947_0002972 Ga0373947_0002972_4924_5661 245
1059 3300035725 Ga0373947_0014554 Ga0373947_0014554_2855_3598 245
1060 3300035725 Ga0373947_0106310 Ga0373947_0106310_858_1601 245
1061 3300036401 Ga0373937_0094288 Ga0373937_0094288_963_1700 245
1062 3300036712 Ga0316584_0040425 Ga0316584_0040425_774_1517 245
1063 3300037068 Ga0373925_0009598 Ga0373925_0009598_2972_3712 245
1064 3300037068 Ga0373925_0020921 Ga0373925_0020921_1416_2153 245
1065 3300037068 Ga0373925_0041246 Ga0373925_0041246_161_901 245
1066 3300037068 Ga0373925_0066262 Ga0373925_0066262_1081_1821 245
1067 3300037068 Ga0373925_0197742 Ga0373925_0197742_726_1463 245
1068 3300037068 Ga0373925_0293945 Ga0373925_0293945_238_975 245
1069 3300037418 Ga0395900_0001120 Ga0395900_0001120_26833_27570 245
1070 3300037418 Ga0395900_0045947 Ga0395900_0045947_3263_4000 245
1071 3300037418 Ga0395900_0129059 Ga0395900_0129059_1425_2162 245
1072 3300037466 Ga0395898_0045273 Ga0395898_0045273_2370_3107 245
1073 3300037466 Ga0395898_0069867 Ga0395898_0069867_2432_3169 245
1074 3300037471 Ga0395905_0018125 Ga0395905_0018125_137_874 245
1075 3300037471 Ga0395905_0106818 Ga0395905_0106818_670_1407 245
1076 3300037471 Ga0395905_0148343 Ga0395905_0148343_113_850 245
1077 3300037471 Ga0395905_0390657 Ga0395905_0390657_211_948 245
1078 3300037853 Ga0436364_0170010 Ga0436364_0170010_849_1586 245
1079 3300037853 Ga0436364_1378120 Ga0436364_1378120_1851_2588 245
1080 3300038443 Ga0395901_0125452 Ga0395901_0125452_1926_2663 245
1081 3300038443 Ga0395901_0196564 Ga0395901_0196564_262_999 245
1082 3300038443 Ga0395901_0204691 Ga0395901_0204691_1040_1777 245
1083 3300039437 Ga0436365_1136865 Ga0436365_1136865_12476_13216 245
1084 3300039437 Ga0436365_1391201 Ga0436365_1391201_1018_1755 245
1085 3300039450 Ga0436363_0476889 Ga0436363_0476889_307_1050 245
1086 3300039450 Ga0436363_1445688 Ga0436363_1445688_588_1325 245
1087 3300039450 Ga0436363_1599995 Ga0436363_1599995_1299_2039 245
1088 3300039453 Ga0436362_0188545 Ga0436362_0188545_803_1543 245
1089 3300041413 Ga0439465_0048874 Ga0439465_0048874_570_1307 245
1090 3300041452 Ga0451793_1390476 Ga0451793_1390476_100_837 245
1091 3300041452 Ga0451793_1584115 Ga0451793_1584115_307_1110 245
1092 3300044658 Ga0466972_0000343 Ga0466972_0000343_4100_4837 245
1093 3300044658 Ga0466972_0005717 Ga0466972_0005717_1979_2716 245
1094 3300044683 Ga0466965_0286029 Ga0466965_0286029_40_777 245
1095 3300044684 Ga0466966_0002698 Ga0466966_0002698_6326_7063 245
1096 3300044684 Ga0466966_0141667 Ga0466966_0141667_302_1039 245
1097 3300044684 Ga0466966_0417255 Ga0466966_0417255_35_772 245
1098 3300044693 Ga0466961_0002716 Ga0466961_0002716_241_978 245
1099 3300044693 Ga0466961_0016750 Ga0466961_0016750_225_962 245
1100 3300044693 Ga0466961_0073816 Ga0466961_0073816_124_861 245
1101 3300044694 Ga0466963_0065538 Ga0466963_0065538_53_790 245
1102 3300044694 Ga0466963_0083015 Ga0466963_0083015_642_1379 245
1103 3300044706 Ga0466964_0112908 Ga0466964_0112908_321_1154 245
1104 3300044735 Ga0466968_0011434 Ga0466968_0011434_2375_3112 245
1105 3300044735 Ga0466968_0264899 Ga0466968_0264899_42_779 245
1106 3300044842 Ga0466957_0115508 Ga0466957_0115508_952_1689 245
1107 3300044842 Ga0466957_0190507 Ga0466957_0190507_481_1242 245
1108 3300044842 Ga0466957_0472714 Ga0466957_0472714_79_816 245
1109 3300044901 Ga0466960_0008985 Ga0466960_0008985_3294_4031 245
1110 3300045049 Ga0466959_0006245 Ga0466959_0006245_2941_3678 245
1111 3300045051 Ga0451576_0000023 Ga0451576_0000023_170878_171642 245
1112 3300045976 Ga0466967_0099058 Ga0466967_0099058_836_1573 245
1113 3300046452 Ga0495617_084534 Ga0495617_084534_183_920 245
1114 3300046454 Ga0495592_0002858 Ga0495592_0002858_1523_2260 245
1115 3300046455 Ga0495603_0094425 Ga0495603_0094425_882_1619 245
1116 3300046455 Ga0495603_0150649 Ga0495603_0150649_23_760 245
1117 3300046455 Ga0495603_0202268 Ga0495603_0202268_232_975 245
1118 3300046455 Ga0495603_0250360 Ga0495603_0250360_28_765 245
1119 3300046457 Ga0495590_0070647 Ga0495590_0070647_154_891 245
1120 3300046459 Ga0495629_0002263 Ga0495629_0002263_10373_11110 245
1121 3300046459 Ga0495629_0006304 Ga0495629_0006304_3279_4016 245
1122 3300046459 Ga0495629_0176313 Ga0495629_0176313_523_1260 245
1123 3300046460 Ga0495638_0039968 Ga0495638_0039968_565_1302 245
1124 3300046462 Ga0495651_0001805 Ga0495651_0001805_12586_13323 245
1125 3300046462 Ga0495651_0063762 Ga0495651_0063762_238_975 245
1126 3300046462 Ga0495651_0233251 Ga0495651_0233251_344_1081 245
1127 3300046463 Ga0495653_0003677 Ga0495653_0003677_6717_7454 245
1128 3300046471 Ga0495650_0059622 Ga0495650_0059622_740_1477 245
1129 3300046472 Ga0495580_0017033 Ga0495580_0017033_3744_4481 245
1130 3300046472 Ga0495580_0321688 Ga0495580_0321688_235_978 245
1131 3300046473 Ga0495582_0119538 Ga0495582_0119538_393_1130 245
1132 3300046473 Ga0495582_0192093 Ga0495582_0192093_81_818 245
1133 3300046475 Ga0495639_0021582 Ga0495639_0021582_765_1502 245
1134 3300046491 Ga0495584_0100820 Ga0495584_0100820_21_764 245
1135 3300046492 Ga0495585_0033013 Ga0495585_0033013_934_1671 245
1136 3300046492 Ga0495585_0091044 Ga0495585_0091044_606_1409 245
1137 3300046500 Ga0495596_0136870 Ga0495596_0136870_185_922 245
1138 3300046501 Ga0495607_0094820 Ga0495607_0094820_180_917 245
1139 3300046506 Ga0495583_0158801 Ga0495583_0158801_77_814 245
1140 3300046507 Ga0495606_0138931 Ga0495606_0138931_468_1205 245
1141 3300046507 Ga0495606_0336310 Ga0495606_0336310_29_766 245
1142 3300046511 Ga0495608_0001870 Ga0495608_0001870_2213_2950 245
1143 3300046511 Ga0495608_0163141 Ga0495608_0163141_283_1020 245
1144 3300046513 Ga0495616_0059886 Ga0495616_0059886_1117_1854 245
1145 3300046514 Ga0495618_0006298 Ga0495618_0006298_3002_3739 245
1146 3300046514 Ga0495618_0096966 Ga0495618_0096966_136_873 245
1147 3300046516 Ga0495628_0002643 Ga0495628_0002643_1442_2179 245
1148 3300046516 Ga0495628_0036298 Ga0495628_0036298_121_858 245
1149 3300046516 Ga0495628_0108425 Ga0495628_0108425_427_1164 245
1150 3300046516 Ga0495628_0266364 Ga0495628_0266364_334_1071 245
1151 3300046518 Ga0495631_0024517 Ga0495631_0024517_175_912 245
1152 3300046519 Ga0495632_0089371 Ga0495632_0089371_296_1033 245
1153 3300046519 Ga0495632_0125868 Ga0495632_0125868_208_945 245
1154 3300046522 Ga0495643_0104353 Ga0495643_0104353_177_914 245
1155 3300046523 Ga0495644_0044125 Ga0495644_0044125_292_1029 245
1156 3300046524 Ga0495648_0015942 Ga0495648_0015942_1375_2112 245
1157 3300046529 Ga0495652_0038928 Ga0495652_0038928_323_1060 245
1158 3300046529 Ga0495652_0100660 Ga0495652_0100660_1166_1903 245
1159 3300046529 Ga0495652_0243593 Ga0495652_0243593_275_1012 245
1160 3300046529 Ga0495652_0267992 Ga0495652_0267992_292_1029 245
1161 3300046531 Ga0495665_0008508 Ga0495665_0008508_3320_4057 245
1162 3300046533 Ga0495640_0054419 Ga0495640_0054419_1132_1869 245
1163 3300046533 Ga0495640_0209956 Ga0495640_0209956_312_1049 245
1164 3300046533 Ga0495640_0256587 Ga0495640_0256587_247_984 245
1165 3300046533 Ga0495640_0393737 Ga0495640_0393737_85_822 245
1166 3300046535 Ga0495586_0034154 Ga0495586_0034154_357_1094 245
1167 3300046536 Ga0495587_0001351 Ga0495587_0001351_11425_12162 245
1168 3300046536 Ga0495587_0008371 Ga0495587_0008371_3126_3863 245
1169 3300046537 Ga0495598_0015089 Ga0495598_0015089_740_1477 245
1170 3300046538 Ga0495609_0035714 Ga0495609_0035714_1340_2077 245
1171 3300046539 Ga0495621_0042112 Ga0495621_0042112_70_807 245
1172 3300046539 Ga0495621_0105451 Ga0495621_0105451_56_805 245
1173 3300046542 Ga0495597_0070740 Ga0495597_0070740_299_1036 245
1174 3300046543 Ga0495645_0003263 Ga0495645_0003263_5174_5911 245
1175 3300046557 Ga0495622_0004261 Ga0495622_0004261_157_897 245
1176 3300046557 Ga0495622_0011772 Ga0495622_0011772_179_1012 245
1177 3300046557 Ga0495622_0070335 Ga0495622_0070335_764_1501 245
1178 3300046558 Ga0495633_0046592 Ga0495633_0046592_582_1319 245
1179 3300046559 Ga0495667_0000926 Ga0495667_0000926_14139_14876 245
1180 3300046559 Ga0495667_0057163 Ga0495667_0057163_543_1280 245
1181 3300046615 Ga0495656_0046205 Ga0495656_0046205_223_960 245
1182 3300046615 Ga0495656_0088311 Ga0495656_0088311_438_1175 245
1183 3300046615 Ga0495656_0089501 Ga0495656_0089501_158_910 245
1184 3300046616 Ga0495668_0159410 Ga0495668_0159410_474_1211 245
1185 3300046616 Ga0495668_0220075 Ga0495668_0220075_182_919 245
1186 3300046642 Ga0495634_0007605 Ga0495634_0007605_680_1417 245
1187 3300046642 Ga0495634_0029043 Ga0495634_0029043_127_864 245
1188 3300046648 Ga0495611_0101163 Ga0495611_0101163_20_757 245
1189 3300046660 Ga0495625_0121577 Ga0495625_0121577_498_1235 245
1190 3300046663 Ga0495635_0004483 Ga0495635_0004483_4986_5723 245
1191 3300046663 Ga0495635_0008512 Ga0495635_0008512_4953_5690 245
1192 3300046663 Ga0495635_0034757 Ga0495635_0034757_1567_2304 245
1193 3300046664 Ga0495659_0056929 Ga0495659_0056929_681_1418 245
1194 3300046665 Ga0495661_0197379 Ga0495661_0197379_107_844 245
1195 3300046674 Ga0495588_0033061 Ga0495588_0033061_1432_2169 245
1196 3300046675 Ga0495657_0001016 Ga0495657_0001016_16810_17547 245
1197 3300046675 Ga0495657_0020802 Ga0495657_0020802_3209_3946 245
1198 3300046678 Ga0495599_0000637 Ga0495599_0000637_4935_5672 245
1199 3300046679 Ga0495623_0210682 Ga0495623_0210682_80_820 245
1200 3300046680 Ga0495646_0001926 Ga0495646_0001926_9748_10485 245
1201 3300046680 Ga0495646_0111828 Ga0495646_0111828_246_983 245
1202 3300046680 Ga0495646_0136898 Ga0495646_0136898_325_1062 245
1203 3300046681 Ga0495647_0033614 Ga0495647_0033614_470_1207 245
1204 3300046681 Ga0495647_0180150 Ga0495647_0180150_123_860 245
1205 3300046683 Ga0495658_0018165 Ga0495658_0018165_2518_3255 245
1206 3300046689 Ga0495613_0076601 Ga0495613_0076601_206_946 245
1207 3300046689 Ga0495613_0220345 Ga0495613_0220345_291_1028 245
1208 3300046690 Ga0495624_0090063 Ga0495624_0090063_314_1057 245
1209 3300046690 Ga0495624_0338162 Ga0495624_0338162_150_887 245
1210 3300046692 Ga0495671_0188418 Ga0495671_0188418_163_900 245
1211 3300046694 Ga0495649_0101666 Ga0495649_0101666_712_1449 245
1212 3300046794 Ga0495589_0252077 Ga0495589_0252077_59_796 245
1213 3300046809 Ga0495600_0000352 Ga0495600_0000352_1397_2134 245
1214 3300046809 Ga0495600_0002398 Ga0495600_0002398_4322_5059 245
1215 3300047315 Ga0495581_0033070 Ga0495581_0033070_411_1148 245
1216 3300047315 Ga0495581_0214543 Ga0495581_0214543_39_776 245
1217 3300047315 Ga0495581_0223691 Ga0495581_0223691_167_949 245
1218 3300047317 Ga0495604_0013258 Ga0495604_0013258_366_1103 245
1219 3300047317 Ga0495604_0028514 Ga0495604_0028514_2444_3181 245
1220 3300047317 Ga0495604_0030928 Ga0495604_0030928_303_1040 245
1221 3300047317 Ga0495604_0177442 Ga0495604_0177442_107_844 245
1222 3300047317 Ga0495604_0264562 Ga0495604_0264562_119_856 245
1223 3300047319 Ga0495674_0075372 Ga0495674_0075372_296_1033 245
1224 3300047319 Ga0495674_0111988 Ga0495674_0111988_1020_1757 245
1225 3300047319 Ga0495674_0261177 Ga0495674_0261177_197_937 245
1226 3300047320 Ga0495672_0115619 Ga0495672_0115619_188_925 245
1227 3300047320 Ga0495672_0199726 Ga0495672_0199726_162_899 245
1228 3300047321 Ga0495676_0036897 Ga0495676_0036897_2688_3425 245
1229 3300047322 Ga0495680_0004188 Ga0495680_0004188_4769_5506 245
1230 3300047322 Ga0495680_0008983 Ga0495680_0008983_772_1509 245
1231 3300047322 Ga0495680_0173717 Ga0495680_0173717_449_1189 245
1232 3300047323 Ga0495683_0231937 Ga0495683_0231937_30_767 245
1233 3300047443 Ga0495687_005957 Ga0495687_005957_6806_7543 245
1234 3300047444 Ga0495675_0001543 Ga0495675_0001543_8846_9583 245
1235 3300047444 Ga0495675_0031466 Ga0495675_0031466_156_893 245
1236 3300047446 Ga0495679_053390 Ga0495679_053390_358_1095 245
1237 3300047469 Ga0495673_0019085 Ga0495673_0019085_2096_2833 245
1238 3300047471 Ga0495684_0000380 Ga0495684_0000380_23512_24249 245
1239 3300047471 Ga0495684_0008788 Ga0495684_0008788_3083_3820 245
1240 3300047471 Ga0495684_0043964 Ga0495684_0043964_2480_3217 245
1241 3300047471 Ga0495684_0066211 Ga0495684_0066211_1479_2216 245
1242 3300047673 Ga0495593_0001866 Ga0495593_0001866_8251_8988 245
1243 3300047673 Ga0495593_0006778 Ga0495593_0006778_5335_6072 245
1244 3300048088 Ga0495602_0021117 Ga0495602_0021117_4769_5506 245
1245 3300048088 Ga0495602_0036833 Ga0495602_0036833_3209_3946 245
1246 3300048088 Ga0495602_0167084 Ga0495602_0167084_818_1555 245
1247 3300048088 Ga0495602_0230709 Ga0495602_0230709_520_1257 245
1248 3300048088 Ga0495602_0370307 Ga0495602_0370307_204_941 245
1249 3300048089 Ga0495614_0080726 Ga0495614_0080726_374_1111 245
1250 3300048903 Ga0496100_0071960 Ga0496100_0071960_1176_1919 245
1251 3300048903 Ga0496100_0116730 Ga0496100_0116730_321_1058 245
1252 3300048903 Ga0496100_0139341 Ga0496100_0139341_341_1078 245
1253 3300048903 Ga0496100_0158901 Ga0496100_0158901_371_1111 245
1254 3300048903 Ga0496100_0192259 Ga0496100_0192259_296_1033 245
1255 3300048903 Ga0496100_0273941 Ga0496100_0273941_410_1150 245
1256 3300048903 Ga0496100_0492231 Ga0496100_0492231_143_886 245
1257 3300048904 Ga0496101_0027459 Ga0496101_0027459_2528_3271 245
1258 3300048904 Ga0496101_0036410 Ga0496101_0036410_2496_3236 245
1259 3300048904 Ga0496101_0051498 Ga0496101_0051498_1234_1971 245
1260 3300048904 Ga0496101_0094130 Ga0496101_0094130_553_1335 245
1261 3300048904 Ga0496101_0128539 Ga0496101_0128539_341_1126 245
1262 3300048904 Ga0496101_0215932 Ga0496101_0215932_540_1277 245
1263 3300048905 Ga0496102_0003736 Ga0496102_0003736_9995_10777 245
1264 3300048905 Ga0496102_0007094 Ga0496102_0007094_2550_3293 245
1265 3300048905 Ga0496102_0067848 Ga0496102_0067848_22_762 245
1266 3300048905 Ga0496102_0068168 Ga0496102_0068168_895_1632 245
1267 3300048905 Ga0496102_0073184 Ga0496102_0073184_389_1126 245
1268 3300048905 Ga0496102_0103319 Ga0496102_0103319_254_991 245
1269 3300048905 Ga0496102_0148180 Ga0496102_0148180_15_752 245
1270 3300048905 Ga0496102_0185345 Ga0496102_0185345_207_944 245
1271 3300048905 Ga0496102_0369674 Ga0496102_0369674_548_1288 245
1272 3300048905 Ga0496102_0467678 Ga0496102_0467678_431_1168 245
1273 3300048905 Ga0496102_0554667 Ga0496102_0554667_236_973 245
1274 3300048905 Ga0496102_0596754 Ga0496102_0596754_177_920 245
1275 3300048906 Ga0496103_0002281 Ga0496103_0002281_10942_11724 245
1276 3300048906 Ga0496103_0019281 Ga0496103_0019281_3051_3788 245
1277 3300048906 Ga0496103_0041350 Ga0496103_0041350_1512_2255 245
1278 3300048906 Ga0496103_0499854 Ga0496103_0499854_24_761 245
1279 3300048907 Ga0496104_0002223 Ga0496104_0002223_1386_2129 245
1280 3300048907 Ga0496104_0004213 Ga0496104_0004213_6533_7270 245
1281 3300048907 Ga0496104_0026939 Ga0496104_0026939_878_1618 245
1282 3300048907 Ga0496104_0088307 Ga0496104_0088307_1364_2101 245
1283 3300048908 Ga0496105_0013806 Ga0496105_0013806_3596_4333 245
1284 3300048908 Ga0496105_0015284 Ga0496105_0015284_5048_5785 245
1285 3300048908 Ga0496105_0102731 Ga0496105_0102731_289_1071 245
1286 3300048908 Ga0496105_0118488 Ga0496105_0118488_102_845 245
1287 3300048908 Ga0496105_0194084 Ga0496105_0194084_581_1318 245
1288 3300048908 Ga0496105_0209711 Ga0496105_0209711_346_1083 245
1289 3300048908 Ga0496105_0328596 Ga0496105_0328596_464_1201 245
1290 3300048909 Ga0496106_0000423 Ga0496106_0000423_23342_24079 245
1291 3300048909 Ga0496106_0000804 Ga0496106_0000804_9933_10676 245
1292 3300048909 Ga0496106_0000855 Ga0496106_0000855_7453_8193 245
1293 3300048909 Ga0496106_0100710 Ga0496106_0100710_1167_1904 245
1294 3300048909 Ga0496106_0250935 Ga0496106_0250935_315_1055 245
1295 3300048909 Ga0496106_0267167 Ga0496106_0267167_147_890 245
1296 3300048909 Ga0496106_0454142 Ga0496106_0454142_40_777 245
1297 3300048909 Ga0496106_0611555 Ga0496106_0611555_73_810 245
1298 3300048910 Ga0496107_0005141 Ga0496107_0005141_2845_3582 245
1299 3300048910 Ga0496107_0015807 Ga0496107_0015807_2374_3156 245
1300 3300048910 Ga0496107_0048963 Ga0496107_0048963_1186_1929 245
1301 3300048910 Ga0496107_0094132 Ga0496107_0094132_786_1526 245
1302 3300048910 Ga0496107_0261969 Ga0496107_0261969_119_856 245
1303 3300048910 Ga0496107_0606995 Ga0496107_0606995_33_770 245
1304 3300048911 Ga0496108_0009189 Ga0496108_0009189_1426_2163 245
1305 3300048911 Ga0496108_0039504 Ga0496108_0039504_2717_3457 245
1306 3300048911 Ga0496108_0042755 Ga0496108_0042755_2111_2893 245
1307 3300048911 Ga0496108_0080674 Ga0496108_0080674_211_948 245
1308 3300048911 Ga0496108_0190707 Ga0496108_0190707_549_1292 245
1309 3300048912 Ga0496109_0000393 Ga0496109_0000393_29936_30673 245
1310 3300048912 Ga0496109_0015089 Ga0496109_0015089_4040_4876 245
1311 3300048912 Ga0496109_0071997 Ga0496109_0071997_2424_3161 245
1312 3300048912 Ga0496109_0485686 Ga0496109_0485686_114_851 245
1313 3300048912 Ga0496109_0515970 Ga0496109_0515970_293_1036 245
1314 3300048912 Ga0496109_0610735 Ga0496109_0610735_260_997 245
1315 3300048912 Ga0496109_0730386 Ga0496109_0730386_53_796 245
1316 3300048913 Ga0496110_0030127 Ga0496110_0030127_2599_3336 245
1317 3300048913 Ga0496110_0041310 Ga0496110_0041310_2313_3056 245
1318 3300048913 Ga0496110_0041319 Ga0496110_0041319_1020_1760 245
1319 3300048913 Ga0496110_0086825 Ga0496110_0086825_850_1587 245
1320 3300048913 Ga0496110_0125847 Ga0496110_0125847_1330_2070 245
1321 3300048913 Ga0496110_0163723 Ga0496110_0163723_1074_1856 245
1322 3300048913 Ga0496110_0228679 Ga0496110_0228679_316_1101 245
1323 3300048913 Ga0496110_0336364 Ga0496110_0336364_291_1028 245
1324 3300048913 Ga0496110_0440488 Ga0496110_0440488_30_767 245
1325 3300048913 Ga0496110_0613564 Ga0496110_0613564_53_790 245
1326 3300048914 Ga0496111_0014960 Ga0496111_0014960_4556_5299 245
1327 3300048914 Ga0496111_0288845 Ga0496111_0288845_258_995 245
1328 3300048914 Ga0496111_0421523 Ga0496111_0421523_189_926 245
1329 3300048915 Ga0496112_0000021 Ga0496112_0000021_56244_56981 245
1330 3300048915 Ga0496112_0002518 Ga0496112_0002518_10718_11458 245
1331 3300048915 Ga0496112_0036381 Ga0496112_0036381_2667_3404 245
1332 3300048915 Ga0496112_0194986 Ga0496112_0194986_1179_1916 245
1333 3300048915 Ga0496112_0212293 Ga0496112_0212293_961_1698 245
1334 3300048915 Ga0496112_0586528 Ga0496112_0586528_54_791 245
1335 3300048916 Ga0496113_0004330 Ga0496113_0004330_1700_2437 245
1336 3300048916 Ga0496113_0020931 Ga0496113_0020931_2022_2762 245
1337 3300048916 Ga0496113_0263297 Ga0496113_0263297_145_927 245
1338 3300048917 Ga0496114_0056707 Ga0496114_0056707_382_1164 245
1339 3300048917 Ga0496114_0125008 Ga0496114_0125008_14_751 245
1340 3300048917 Ga0496114_0282791 Ga0496114_0282791_21_767 245
1341 3300048917 Ga0496114_0400891 Ga0496114_0400891_272_1009 245
1342 3300048918 Ga0496115_0001490 Ga0496115_0001490_8318_9100 245
1343 3300048918 Ga0496115_0004939 Ga0496115_0004939_8337_9080 245
1344 3300048918 Ga0496115_0027232 Ga0496115_0027232_2430_3167 245
1345 3300048918 Ga0496115_0033127 Ga0496115_0033127_593_1333 245
1346 3300048918 Ga0496115_0096997 Ga0496115_0096997_97_834 245
1347 3300048918 Ga0496115_0166225 Ga0496115_0166225_487_1224 245
1348 3300048918 Ga0496115_0483188 Ga0496115_0483188_200_937 245
1349 3300048919 Ga0496116_0059283 Ga0496116_0059283_1322_2059 245
1350 3300048920 Ga0496117_0081333 Ga0496117_0081333_69_809 245
1351 3300048921 Ga0496118_0006945 Ga0496118_0006945_8370_9110 245
1352 3300048921 Ga0496118_0155077 Ga0496118_0155077_594_1331 245
1353 3300048921 Ga0496118_0205827 Ga0496118_0205827_22_759 245
1354 3300048921 Ga0496118_0251253 Ga0496118_0251253_83_820 245
1355 3300048922 Ga0496119_0013974 Ga0496119_0013974_190_927 245
1356 3300048922 Ga0496119_0099425 Ga0496119_0099425_581_1318 245
1357 3300048923 Ga0496120_0048913 Ga0496120_0048913_798_1550 245
1358 3300048924 Ga0496121_0001335 Ga0496121_0001335_2670_3407 245
1359 3300048924 Ga0496121_0004369 Ga0496121_0004369_3150_3890 245
1360 3300048924 Ga0496121_0030188 Ga0496121_0030188_3107_3844 245
1361 3300048924 Ga0496121_0079960 Ga0496121_0079960_1428_2165 245
1362 3300048924 Ga0496121_0112460 Ga0496121_0112460_1034_1771 245
1363 3300048924 Ga0496121_0141908 Ga0496121_0141908_677_1414 245
1364 3300048924 Ga0496121_0207768 Ga0496121_0207768_640_1377 245
1365 3300048924 Ga0496121_0228373 Ga0496121_0228373_30_767 245
1366 3300048924 Ga0496121_0253991 Ga0496121_0253991_138_875 245
1367 3300048924 Ga0496121_0302030 Ga0496121_0302030_128_865 245
1368 3300048924 Ga0496121_0380760 Ga0496121_0380760_36_773 245
1369 3300048927 Ga0496124_0004332 Ga0496124_0004332_15007_15747 245
1370 3300048928 Ga0496125_0050828 Ga0496125_0050828_2524_3261 245
1371 3300048928 Ga0496125_0115226 Ga0496125_0115226_1181_1918 245
1372 3300048928 Ga0496125_0141205 Ga0496125_0141205_107_844 245
1373 3300048928 Ga0496125_0146064 Ga0496125_0146064_23_760 245
1374 3300048928 Ga0496125_0153610 Ga0496125_0153610_736_1473 245
1375 3300048929 Ga0496126_0006091 Ga0496126_0006091_3354_4091 245
1376 3300048929 Ga0496126_0006946 Ga0496126_0006946_6968_7729 245
1377 3300048929 Ga0496126_0012554 Ga0496126_0012554_6553_7290 245
1378 3300048929 Ga0496126_0046312 Ga0496126_0046312_1373_2113 245
1379 3300048929 Ga0496126_0066660 Ga0496126_0066660_2339_3076 245
1380 3300048929 Ga0496126_0113492 Ga0496126_0113492_324_1061 245
1381 3300048929 Ga0496126_0303484 Ga0496126_0303484_501_1277 245
1382 3300048929 Ga0496126_0375631 Ga0496126_0375631_61_798 245
1383 3300048929 Ga0496126_0481923 Ga0496126_0481923_163_900 245
1384 3300049460 Ga0495682_0010318 Ga0495682_0010318_2699_3436 245
1385 3300049568 Ga0501031_0000645 Ga0501031_0000645_16440_17177 245
1386 3300049568 Ga0501031_0050097 Ga0501031_0050097_121_858 245
1387 3300049568 Ga0501031_0303441 Ga0501031_0303441_233_970 245
1388 3300049569 Ga0501032_0000129 Ga0501032_0000129_9936_10673 245
1389 3300049569 Ga0501032_0093877 Ga0501032_0093877_653_1390 245
1390 3300049570 Ga0501033_0000113 Ga0501033_0000113_8870_9607 245
1391 3300049570 Ga0501033_0000983 Ga0501033_0000983_20110_20847 245
1392 3300049571 Ga0501034_0000503 Ga0501034_0000503_60163_60900 245
1393 3300049572 Ga0501036_0000232 Ga0501036_0000232_30123_30860 245
1394 3300049572 Ga0501036_0077945 Ga0501036_0077945_1290_2033 245
1395 3300049572 Ga0501036_0331001 Ga0501036_0331001_394_1131 245
1396 3300049572 Ga0501036_0378918 Ga0501036_0378918_193_930 245
1397 3300049573 Ga0501037_0000106 Ga0501037_0000106_26595_27332 245
1398 3300049573 Ga0501037_0002045 Ga0501037_0002045_3677_4414 245
1399 3300049574 Ga0501038_0000108 Ga0501038_0000108_32691_33428 245
1400 3300049574 Ga0501038_0252645 Ga0501038_0252645_221_958 245
1401 3300049575 Ga0501039_0000460 Ga0501039_0000460_18902_19639 245
1402 3300049575 Ga0501039_0029454 Ga0501039_0029454_1205_1942 245
1403 3300049575 Ga0501039_0075573 Ga0501039_0075573_1639_2376 245
1404 3300049575 Ga0501039_0295127 Ga0501039_0295127_341_1084 245
1405 3300049576 Ga0501040_0008115 Ga0501040_0008115_164_901 245
1406 3300049576 Ga0501040_0125050 Ga0501040_0125050_11_748 245
1407 3300049577 Ga0501041_0171081 Ga0501041_0171081_291_1028 245
1408 3300049577 Ga0501041_0294764 Ga0501041_0294764_194_931 245
1409 3300049577 Ga0501041_0365624 Ga0501041_0365624_66_809 245
1410 3300049578 Ga0501042_0031122 Ga0501042_0031122_2897_3634 245
1411 3300049578 Ga0501042_0486005 Ga0501042_0486005_44_787 245
1412 3300049579 Ga0501043_0000035 Ga0501043_0000035_96809_97546 245
1413 3300049579 Ga0501043_0102436 Ga0501043_0102436_253_990 245
1414 3300049580 Ga0501046_0027551 Ga0501046_0027551_2081_2818 245
1415 3300049580 Ga0501046_0032152 Ga0501046_0032152_144_887 245
1416 3300049580 Ga0501046_0045172 Ga0501046_0045172_668_1405 245
1417 3300049580 Ga0501046_0060099 Ga0501046_0060099_26_769 245
1418 3300049580 Ga0501046_0141250 Ga0501046_0141250_329_1066 245
1419 3300049581 Ga0501047_0000792 Ga0501047_0000792_14801_15538 245
1420 3300049582 Ga0501048_0000116 Ga0501048_0000116_17275_18012 245
1421 3300049582 Ga0501048_0293564 Ga0501048_0293564_316_1059 245
1422 3300049583 Ga0501067_0001402 Ga0501067_0001402_10465_11202 245
1423 3300049583 Ga0501067_0022473 Ga0501067_0022473_2449_3192 245
1424 3300049583 Ga0501067_0040323 Ga0501067_0040323_1566_2303 245
1425 3300049584 Ga0501068_0000014 Ga0501068_0000014_45419_46156 245
1426 3300049584 Ga0501068_0298048 Ga0501068_0298048_211_954 245
1427 3300049585 Ga0501069_0021145 Ga0501069_0021145_1318_2055 245
1428 3300049587 Ga0501071_0039219 Ga0501071_0039219_456_1193 245
1429 3300049587 Ga0501071_0042501 Ga0501071_0042501_545_1282 245
1430 3300049587 Ga0501071_0218478 Ga0501071_0218478_683_1420 245
1431 3300049588 Ga0501072_0000367 Ga0501072_0000367_9914_10651 245
1432 3300049588 Ga0501072_0111154 Ga0501072_0111154_1077_1814 245
1433 3300049588 Ga0501072_0216851 Ga0501072_0216851_163_906 245
1434 3300049589 Ga0501073_0000368 Ga0501073_0000368_9475_10212 245
1435 3300049590 Ga0501074_0001037 Ga0501074_0001037_6753_7490 245
1436 3300049590 Ga0501074_0238840 Ga0501074_0238840_378_1115 245
1437 3300049590 Ga0501074_0310490 Ga0501074_0310490_171_914 245
1438 3300049591 Ga0501075_0096517 Ga0501075_0096517_940_1683 245
1439 3300049591 Ga0501075_0139355 Ga0501075_0139355_199_942 245
1440 3300049591 Ga0501075_0151471 Ga0501075_0151471_257_994 245
1441 3300049591 Ga0501075_0446889 Ga0501075_0446889_31_768 245
1442 3300049592 Ga0501076_0015465 Ga0501076_0015465_986_1729 245
1443 3300049592 Ga0501076_0079891 Ga0501076_0079891_1004_1747 245
1444 3300049592 Ga0501076_0290632 Ga0501076_0290632_134_871 245
1445 3300049592 Ga0501076_0297003 Ga0501076_0297003_134_871 245
1446 3300049593 Ga0501077_0006376 Ga0501077_0006376_841_1584 245
1447 3300049593 Ga0501077_0402434 Ga0501077_0402434_55_792 245
1448 3300049741 Ga0501079_0005691 Ga0501079_0005691_1503_2246 245
1449 3300049741 Ga0501079_0006966 Ga0501079_0006966_872_1609 245
1450 3300049741 Ga0501079_0035935 Ga0501079_0035935_3001_3744 245
1451 3300049741 Ga0501079_0045958 Ga0501079_0045958_2128_2871 245
1452 3300049741 Ga0501079_0351092 Ga0501079_0351092_302_1039 245
1453 3300049741 Ga0501079_0572487 Ga0501079_0572487_46_789 245
1454 3300049742 Ga0501080_0000332 Ga0501080_0000332_18938_19675 245
1455 3300049742 Ga0501080_0019600 Ga0501080_0019600_2895_3638 245
1456 3300049742 Ga0501080_0094780 Ga0501080_0094780_1711_2448 245
1457 3300049742 Ga0501080_0240268 Ga0501080_0240268_30_767 245
1458 3300049742 Ga0501080_0710075 Ga0501080_0710075_112_849 245
1459 3300049743 Ga0501081_0026875 Ga0501081_0026875_2951_3694 245
1460 3300049743 Ga0501081_0043029 Ga0501081_0043029_2111_2854 245
1461 3300049743 Ga0501081_0067213 Ga0501081_0067213_312_1049 245
1462 3300049743 Ga0501081_0312410 Ga0501081_0312410_357_1094 245
1463 3300049744 Ga0501083_0003499 Ga0501083_0003499_7878_8615 245
1464 3300049822 Ga0501035_0011457 Ga0501035_0011457_2492_3229 245
1465 3300049822 Ga0501035_0017102 Ga0501035_0017102_4109_4846 245
1466 3300049823 Ga0501044_0000051 Ga0501044_0000051_90693_91430 245
1467 3300049823 Ga0501044_0060999 Ga0501044_0060999_854_1591 245
1468 3300049824 Ga0501045_0002440 Ga0501045_0002440_7048_7785 245
1469 3300049824 Ga0501045_0039923 Ga0501045_0039923_751_1488 245
1470 3300049824 Ga0501045_0062651 Ga0501045_0062651_1867_2610 245
1471 3300049824 Ga0501045_0439709 Ga0501045_0439709_73_810 245
1472 3300050489 nmdc:mga03683_174190_c1 nmdc:mga03683_174190_c1_23_760 245
1473 3300050489 nmdc:mga03683_244494_c1 nmdc:mga03683_244494_c1_77_814 245
1474 3300050490 nmdc:mga03n38_5710_c1 nmdc:mga03n38_5710_c1_3011_3748 245
1475 3300050490 nmdc:mga03n38_59835_c1 nmdc:mga03n38_59835_c1_880_1617 245
1476 3300050491 nmdc:mga00v17_257907_c1 nmdc:mga00v17_257907_c1_92_829 245
1477 3300050491 nmdc:mga00v17_73327_c1 nmdc:mga00v17_73327_c1_850_1587 245
1478 3300050492 nmdc:mga0yw44_167143_c1 nmdc:mga0yw44_167143_c1_354_1091 245
1479 3300050492 nmdc:mga0yw44_197784_c1 nmdc:mga0yw44_197784_c1_30_767 245
1480 3300050492 nmdc:mga0yw44_222687_c1 nmdc:mga0yw44_222687_c1_358_1095 245
1481 3300050492 nmdc:mga0yw44_52649_c1 nmdc:mga0yw44_52649_c1_1327_2064 245
1482 3300050493 nmdc:mga0k408_185814_c1 nmdc:mga0k408_185814_c1_375_1208 245
1483 3300050493 nmdc:mga0k408_222913_c1 nmdc:mga0k408_222913_c1_135_872 245
1484 3300050493 nmdc:mga0k408_62872_c1 nmdc:mga0k408_62872_c1_1170_1907 245
1485 3300050494 nmdc:mga06z11_175774_c1 nmdc:mga06z11_175774_c1_225_962 245
1486 3300050494 nmdc:mga06z11_21836_c1 nmdc:mga06z11_21836_c1_216_953 245
1487 3300050494 nmdc:mga06z11_218477_c1 nmdc:mga06z11_218477_c1_186_923 245
1488 3300050495 nmdc:mga04h51_22765_c1 nmdc:mga04h51_22765_c1_1152_1889 245
1489 3300050496 nmdc:mga07m45_121932_c1 nmdc:mga07m45_121932_c1_627_1364 245
1490 3300050496 nmdc:mga07m45_186818_c1 nmdc:mga07m45_186818_c1_254_991 245
1491 3300050496 nmdc:mga07m45_59246_c1 nmdc:mga07m45_59246_c1_1226_1963 245
1492 3300050496 nmdc:mga07m45_74206_c1 nmdc:mga07m45_74206_c1_341_1078 245
1493 3300050507 nmdc:mga05p37_81855_c1 nmdc:mga05p37_81855_c1_179_922 245
1494 3300050508 nmdc:mga09592_535495_c1 nmdc:mga09592_535495_c1_137_874 245
1495 3300050510 nmdc:mga06r32_1075_c1 nmdc:mga06r32_1075_c1_15431_16174 245
1496 3300050510 nmdc:mga06r32_155564_c1 nmdc:mga06r32_155564_c1_861_1598 245
1497 3300050510 nmdc:mga06r32_326574_c1 nmdc:mga06r32_326574_c1_33_770 245
1498 3300050510 nmdc:mga06r32_3555_c1 nmdc:mga06r32_3555_c1_3573_4319 245
1499 3300050511 nmdc:mga08y16_127561_c1 nmdc:mga08y16_127561_c1_130_873 245
1500 3300050511 nmdc:mga08y16_448288_c1 nmdc:mga08y16_448288_c1_529_1272 245
1501 3300050511 nmdc:mga08y16_61270_c1 nmdc:mga08y16_61270_c1_3135_3881 245
1502 3300050512 nmdc:mga0n895_42627_c1 nmdc:mga0n895_42627_c1_533_1276 245
1503 3300050512 nmdc:mga0n895_53114_c1 nmdc:mga0n895_53114_c1_872_1609 245
1504 3300050513 nmdc:mga0rr50_113428_c1 nmdc:mga0rr50_113428_c1_1094_1837 245
1505 3300050513 nmdc:mga0rr50_277170_c1 nmdc:mga0rr50_277170_c1_340_1131 245
1506 3300050514 nmdc:mga08x19_227468_c1 nmdc:mga08x19_227468_c1_419_1156 245
1507 3300050515 nmdc:mga0a205_114429_c1 nmdc:mga0a205_114429_c1_1629_2372 245
1508 3300050515 nmdc:mga0a205_44187_c1 nmdc:mga0a205_44187_c1_1636_2379 245
1509 3300050515 nmdc:mga0a205_449493_c1 nmdc:mga0a205_449493_c1_276_1013 245
1510 3300053078 Ga0495612_0048299 Ga0495612_0048299_397_1134 245
1511 3300053079 Ga0500610_0088184 Ga0500610_0088184_159_896 245
1512 3300053079 Ga0500610_0100993 Ga0500610_0100993_351_1088 245
1513 3300053080 Ga0500635_0001265 Ga0500635_0001265_2168_2908 245
1514 3300053080 Ga0500635_0006375 Ga0500635_0006375_1199_1936 245
1515 3300053083 Ga0495655_0001686 Ga0495655_0001686_2553_3386 245
1516 3300053083 Ga0495655_0021533 Ga0495655_0021533_334_1071 245
1517 3300053083 Ga0495655_0028819 Ga0495655_0028819_304_1041 245
1518 3300053083 Ga0495655_0054911 Ga0495655_0054911_71_808 245
1519 3300053084 Ga0495595_0021261 Ga0495595_0021261_343_1080 245
1520 3300053084 Ga0495595_0030388 Ga0495595_0030388_1663_2400 245
1521 3300053085 Ga0495619_0000355 Ga0495619_0000355_20111_20848 245
1522 3300053085 Ga0495619_0075033 Ga0495619_0075033_1214_1951 245
1523 3300053085 Ga0495619_0230882 Ga0495619_0230882_385_1122 245
1524 3300053085 Ga0495619_0366377 Ga0495619_0366377_156_893 245
1525 3300053086 Ga0500578_0086926 Ga0500578_0086926_944_1681 245
1526 3300053086 Ga0500578_0121475 Ga0500578_0121475_597_1334 245
1527 3300053086 Ga0500578_0191153 Ga0500578_0191153_73_810 245
1528 3300053087 Ga0500643_000032 Ga0500643_000032_131959_132696 245
1529 3300053091 Ga0500647_0100739 Ga0500647_0100739_227_967 245
1530 3300053092 Ga0500583_0091857 Ga0500583_0091857_354_1091 245
1531 3300053094 Ga0500566_0000026 Ga0500566_0000026_70871_71608 245
1532 3300053094 Ga0500566_0001584 Ga0500566_0001584_9457_10194 245
1533 3300053094 Ga0500566_0005873 Ga0500566_0005873_6150_6890 245
1534 3300053094 Ga0500566_0194899 Ga0500566_0194899_257_994 245
1535 3300053095 Ga0500640_002218 Ga0500640_002218_3293_4030 245
1536 3300053096 Ga0500641_0143999 Ga0500641_0143999_22_759 245
1537 3300053097 Ga0500648_116176 Ga0500648_116176_249_986 245
1538 3300053098 Ga0500650_0148713 Ga0500650_0148713_35_772 245
1539 3300053104 Ga0500556_0077074 Ga0500556_0077074_499_1236 245
1540 3300053105 Ga0500557_000087 Ga0500557_000087_29226_29963 245
1541 3300053108 Ga0500562_012186 Ga0500562_012186_1044_1781 245
1542 3300053109 Ga0500569_108113 Ga0500569_108113_12_749 245
1543 3300053111 Ga0500572_001308 Ga0500572_001308_2978_3748 245
1544 3300053111 Ga0500572_005714 Ga0500572_005714_1310_2047 245
1545 3300053111 Ga0500572_009314 Ga0500572_009314_1339_2076 245
1546 3300053114 Ga0500582_086169 Ga0500582_086169_284_1021 245
1547 3300053115 Ga0500591_065022 Ga0500591_065022_863_1600 245
1548 3300053119 Ga0500595_002640 Ga0500595_002640_5709_6449 245
1549 3300053119 Ga0500595_009653 Ga0500595_009653_2279_3016 245
1550 3300053119 Ga0500595_012338 Ga0500595_012338_1123_1866 245
1551 3300053119 Ga0500595_012635 Ga0500595_012635_2130_2870 245
1552 3300053119 Ga0500595_039261 Ga0500595_039261_366_1103 245
1553 3300053120 Ga0500597_125856 Ga0500597_125856_12_845 245
1554 3300053122 Ga0500608_003190 Ga0500608_003190_4272_5009 245
1555 3300053122 Ga0500608_199228 Ga0500608_199228_44_781 245
1556 3300053123 Ga0500614_000135 Ga0500614_000135_2021_2758 245
1557 3300053130 Ga0500642_0001017 Ga0500642_0001017_3467_4204 245
1558 3300053130 Ga0500642_0096705 Ga0500642_0096705_313_1050 245
1559 3300053133 Ga0500655_012393 Ga0500655_012393_32_769 245
1560 3300053136 Ga0500559_0000081 Ga0500559_0000081_24959_25729 245
1561 3300053136 Ga0500559_0009036 Ga0500559_0009036_1293_2033 245
1562 3300053136 Ga0500559_0010760 Ga0500559_0010760_3056_3793 245
1563 3300053136 Ga0500559_0021965 Ga0500559_0021965_1519_2256 245
1564 3300053136 Ga0500559_0093710 Ga0500559_0093710_214_954 245
1565 3300053138 Ga0500564_023225 Ga0500564_023225_743_1480 245
1566 3300053139 Ga0500568_0040631 Ga0500568_0040631_1099_1836 245
1567 3300053140 Ga0500573_0035456 Ga0500573_0035456_830_1570 245
1568 3300053146 Ga0500588_0031973 Ga0500588_0031973_504_1241 245
1569 3300053147 Ga0500589_093460 Ga0500589_093460_397_1134 245
1570 3300053148 Ga0500590_011029 Ga0500590_011029_3148_3885 245
1571 3300053150 Ga0500603_000591 Ga0500603_000591_6278_7015 245
1572 3300053151 Ga0500604_0051330 Ga0500604_0051330_63_800 245
1573 3300053154 Ga0500619_003290 Ga0500619_003290_2295_3032 245
1574 3300053154 Ga0500619_069727 Ga0500619_069727_271_1011 245
1575 3300053155 Ga0500620_001971 Ga0500620_001971_1145_1882 245
1576 3300053156 Ga0500622_0004721 Ga0500622_0004721_2695_3432 245
1577 3300053159 Ga0500630_000362 Ga0500630_000362_1686_2423 245
1578 3300053162 Ga0500638_033440 Ga0500638_033440_227_967 245
1579 3300053162 Ga0500638_050884 Ga0500638_050884_1102_1839 245
1580 3300053162 Ga0500638_071520 Ga0500638_071520_215_952 245
1581 3300053162 Ga0500638_109955 Ga0500638_109955_468_1208 245
1582 3300053163 Ga0500639_000939 Ga0500639_000939_9463_10200 245
1583 3300053163 Ga0500639_070182 Ga0500639_070182_386_1156 245
1584 3300053177 Ga0500636_0000276 Ga0500636_0000276_27370_28107 245
1585 3300053177 Ga0500636_0169880 Ga0500636_0169880_197_934 245
1586 3300053178 Ga0500637_0000122 Ga0500637_0000122_4796_5536 245
1587 3300053178 Ga0500637_0014625 Ga0500637_0014625_1797_2537 245
1588 3300053725 Ga0500576_023847 Ga0500576_023847_1382_2152 245
1589 3300053728 Ga0500657_017820 Ga0500657_017820_1935_2675 245
1590 3300053729 Ga0500625_007369 Ga0500625_007369_3013_3750 245
1591 3300053731 Ga0500609_002995 Ga0500609_002995_833_1570 245
1592 3300053733 Ga0500552_000509 Ga0500552_000509_2392_3132 245
1593 3300053735 Ga0500596_000713 Ga0500596_000713_878_1648 245
1594 3300053735 Ga0500596_002113 Ga0500596_002113_126_863 245
1595 3300053736 Ga0500599_003652 Ga0500599_003652_302_1039 245
1596 3300054114 Ga0501084_0000773 Ga0501084_0000773_18644_19381 245
1597 3300054114 Ga0501084_0004881 Ga0501084_0004881_7853_8596 245
1598 3300054114 Ga0501084_0016443 Ga0501084_0016443_677_1414 245
1599 3300054114 Ga0501084_0108206 Ga0501084_0108206_691_1428 245
1600 3300054114 Ga0501084_0163826 Ga0501084_0163826_201_944 245
1601 3300055283 Ga0500661_000317 Ga0500661_000317_227_967 245
1602 3300060353 Ga0501082_0000965 Ga0501082_0000965_21753_22490 245
1603 3300060353 Ga0501082_0013892 Ga0501082_0013892_1118_1861 245
1604 3300060353 Ga0501082_0081609 Ga0501082_0081609_1710_2447 245
1605 3300060353 Ga0501082_0160668 Ga0501082_0160668_1146_1889 245
1606 3300060353 Ga0501082_0223502 Ga0501082_0223502_461_1204 245
1607 3300061719 Ga0466962_0010405 Ga0466962_0010405_129_866 245
1608 3300061734 Ga0530510_0018748 Ga0530510_0018748_3605_4348 245
1609 3300061734 Ga0530510_0029015 Ga0530510_0029015_2456_3193 245
1610 3300061734 Ga0530510_0105275 Ga0530510_0105275_985_1728 245
1611 3300061734 Ga0530510_0159248 Ga0530510_0159248_269_1006 245
1612 3300061734 Ga0530510_0244493 Ga0530510_0244493_224_961 245
1613 3300061734 Ga0530510_0415839 Ga0530510_0415839_18_755 245

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

39

230

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

45

275

0.96

PF08659

KR

KR domain

40

219

0.87

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

41

211

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
3enn-assembly1.cif.gz_B 2.1a crystal structure of glucose/ribitol dehydrogenase from brucella melitensis (p43212) 0.9891 1 245
3emk-assembly1.cif.gz_D 2.5a crystal structure of glucose/ribitol dehydrogenase from brucella melitensis 0.9864 1 245
3emk-assembly1.cif.gz_C 2.5a crystal structure of glucose/ribitol dehydrogenase from brucella melitensis 0.9855 1 245
3emk-assembly1.cif.gz_B 2.5a crystal structure of glucose/ribitol dehydrogenase from brucella melitensis 0.9853 1 245
3grp-assembly1.cif.gz_D 2.1 angstrom crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from bartonella henselae 0.9848 1 243
ID Description Score Start End Superfamily
3ennB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9891 1 245 3.40.50.720
af_Q0JDU3_1_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9879 79 244 3.40.50.720
3grpC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9809 1 243 3.40.50.720
3ennB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9729 1 245 3.40.50.720
3grpC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9719 1 243 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2S5MFR3-F1-model_v4 Beta-ketoacyl-ACP reductase 0.9918 82 245 GO:0016491
AF-A0A7Y6MVD7-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) 0.99 1 244 GO:0004316
GO:0006633
GO:0051287
AF-A0A7Y6MVD7-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) 0.986 1 244 GO:0004316
GO:0006633
GO:0051287
AF-A0A2S5MFR3-F1-model_v4 Beta-ketoacyl-ACP reductase 0.9859 82 245 GO:0016491
AF-A0A850V1U6-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) 0.9841 164 244

Feature Viewer

pLDDT pTM Quality
95.27 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map