F495040

General Info

Members Datasets Scaffolds Average Seq Length
1609 421 1609 193

Family's Representative Sequence

Representative Sequence 3300005344|Ga0070661_100009578|Ga0070661_1000095785
Length 233
Sequence LGRHRKLPSQKTRTPPGFFTSSRQSMQHSSEKIVLNSGNQSEIMTEEAILQGCLANNAAAQKALYQKYSGKMLVVCYRYAHNREDAEDMLQEGFIKVFSQIHTFENRGALEGWIRRIIVHTCINHLKKNKRFNESVDIIHASSVQIREENIPSIIQAKEVVECIRMLPIGYRTVLNLYAIEGFSHREIASMLDVEESTSRSQYTRAKAMLEDILIRKNILYKPKEVLLAASGR

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
126 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
127 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
129 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
198 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
199 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
200 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
201 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
202 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
204 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
205 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
206 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
207 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
208 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
209 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
210 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
211 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
212 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
213 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
214 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
215 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
216 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
217 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
218 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
219 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
220 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
221 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
223 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
224 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
225 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
226 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
227 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
228 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
229 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
230 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
231 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
232 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
233 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
234 3300041445 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaT Metatranscriptome Rhizoplane
235 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
236 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
237 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
238 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
239 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
240 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
241 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
242 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
243 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
244 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
245 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
246 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
247 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
248 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
249 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
250 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
251 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
252 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
253 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
254 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
255 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
256 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
257 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
258 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
259 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
260 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
261 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
262 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
263 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
264 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
265 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
266 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
267 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
268 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
269 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
270 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
271 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
272 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
273 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
274 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
275 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
276 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
277 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
278 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
279 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
280 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
281 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
282 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
283 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
284 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
285 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
286 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
287 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
288 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
289 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
290 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
291 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
292 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
293 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
294 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
295 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
296 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
297 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
298 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
299 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
300 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
301 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
302 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
303 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
304 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
305 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
306 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
307 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
308 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
309 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
310 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
311 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
312 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
313 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
314 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
315 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
316 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
317 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
318 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
319 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
320 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
321 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
322 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
323 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
324 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
325 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
326 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
327 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
328 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
329 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
330 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
343 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
344 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
345 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
346 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
347 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
348 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
349 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
350 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
351 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
352 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
353 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
354 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
355 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
356 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
357 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
358 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
359 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
360 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
361 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
362 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
363 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
364 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
365 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
366 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
367 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
368 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
369 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
370 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
371 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
372 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
373 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
374 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
375 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
376 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
377 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
378 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
379 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
380 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
383 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
384 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
385 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
386 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
387 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
388 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
389 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
390 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
391 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
392 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
393 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
394 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
395 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
396 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
397 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
398 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
399 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
400 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
401 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
402 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
403 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
404 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
405 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
406 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
407 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
408 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
409 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
410 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
411 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
412 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
413 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
414 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
415 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
416 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
417 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
418 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
419 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
420 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.38
Metatranscriptomes 0.62
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.05
Nodule 0
Rhizoplane 1.31
Rhizosphere 93.78
Stem 0
Stem Tuber 0
Unclassified 1.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10000360 3300002459 Bacteria 15823
2 JGI25154J39366_1005894 3300002738 Bacteria 1876
3 JGI25406J46586_10000609 3300003203 Bacteria 16773
4 rootH2_10105229 3300003320 Bacteria 3073
5 rootH2_10287056 3300003320 Bacteria 1555
6 rootL2_10039832 3300003322 Bacteria 7394
7 rootL2_10232916 3300003322 Bacteria 1758
8 rootL2_10282654 3300003322 Bacteria 3151
9 rootH1_10095093 3300003323 Unclassified 2262
10 rootH1_10246374 3300003323 Bacteria 3389
11 Ga0058861_10057842 3300004800 Bacteria 861
12 Ga0065712_10022179 3300005290 Bacteria 1141
13 Ga0065712_10072726 3300005290 Bacteria 4639
14 Ga0065712_10112883 3300005290 Bacteria 1792
15 Ga0065712_10239023 3300005290 Unclassified 989
16 Ga0065712_10287644 3300005290 Bacteria 824
17 Ga0065715_10098512 3300005293 Bacteria 3537
18 Ga0065707_10128168 3300005295 Bacteria 1970
19 Ga0065707_10287444 3300005295 Unclassified 1024
20 Ga0065707_10378629 3300005295 Bacteria 880
21 Ga0070658_10021161 3300005327 Bacteria 5210
22 Ga0070658_10110174 3300005327 Unclassified 2280
23 Ga0070658_10116595 3300005327 Bacteria 2216
24 Ga0070658_10487656 3300005327 Archaea 1064
25 Ga0070658_10526686 3300005327 Bacteria 1022
26 Ga0070658_10778950 3300005327 Unclassified 831
27 Ga0070676_10000006 3300005328 Bacteria 72739
28 Ga0070676_10032766 3300005328 Bacteria 2979
29 Ga0070676_10064134 3300005328 Unclassified 2190
30 Ga0070676_10099297 3300005328 Bacteria 1796
31 Ga0070676_10111389 3300005328 Unclassified 1704
32 Ga0070683_100004078 3300005329 Bacteria 11973
33 Ga0070683_100005753 3300005329 Bacteria 10358
34 Ga0070683_100015684 3300005329 Bacteria 6662
35 Ga0070683_100019023 3300005329 Bacteria 6094
36 Ga0070683_100300823 3300005329 Bacteria 1526
37 Ga0070683_101318974 3300005329 Bacteria 694
38 Ga0070690_100002608 3300005330 Bacteria 9713
39 Ga0070690_100057770 3300005330 Bacteria 2490
40 Ga0070690_100347092 3300005330 Bacteria 1076
41 Ga0070670_100005255 3300005331 Bacteria 10908
42 Ga0070670_100015474 3300005331 Bacteria 6552
43 Ga0070670_100020307 3300005331 Bacteria 5708
44 Ga0070670_100076196 3300005331 Bacteria 2882
45 Ga0070670_100118408 3300005331 Bacteria 2284
46 Ga0070670_100198778 3300005331 Bacteria 1742
47 Ga0070670_100240628 3300005331 Bacteria 1576
48 Ga0070670_100275846 3300005331 Unclassified 1468
49 Ga0070670_100296213 3300005331 Bacteria 1414
50 Ga0070670_100425203 3300005331 Bacteria 1175
51 Ga0070670_100554154 3300005331 Bacteria 1026
52 Ga0070670_100631972 3300005331 Bacteria 959
53 Ga0070677_10008592 3300005333 Bacteria 3443
54 Ga0070677_10054548 3300005333 Bacteria 1628
55 Ga0070677_10066630 3300005333 Bacteria 1502
56 Ga0070677_10109314 3300005333 Bacteria 1232
57 Ga0068869_100003895 3300005334 Bacteria 9209
58 Ga0068869_100013324 3300005334 Bacteria 5466
59 Ga0068869_100057499 3300005334 Unclassified 2840
60 Ga0068869_100067378 3300005334 Unclassified 2641
61 Ga0068869_100087394 3300005334 Bacteria 2339
62 Ga0068869_100125885 3300005334 Unclassified 1965
63 Ga0068869_100196101 3300005334 Bacteria 1590
64 Ga0068869_100358868 3300005334 Unclassified 1189
65 Ga0068869_100373521 3300005334 Bacteria 1167
66 Ga0068869_100406638 3300005334 Unclassified 1121
67 Ga0068869_100560047 3300005334 Bacteria 961
68 Ga0068869_100907884 3300005334 Bacteria 763
69 Ga0070666_10000086 3300005335 Bacteria 66096
70 Ga0070666_10000694 3300005335 Bacteria 20427
71 Ga0070666_10130417 3300005335 Unclassified 1747
72 Ga0070666_10134316 3300005335 Bacteria 1720
73 Ga0070666_10221107 3300005335 Bacteria 1336
74 Ga0070666_10283600 3300005335 Bacteria 1178
75 Ga0070666_10786143 3300005335 Unclassified 700
76 Ga0070666_10918320 3300005335 Bacteria 648
77 Ga0070680_100006185 3300005336 Bacteria 9079
78 Ga0070680_100033585 3300005336 Bacteria 4136
79 Ga0070680_100090131 3300005336 Bacteria 2538
80 Ga0070682_100002732 3300005337 Bacteria 9779
81 Ga0070682_100139417 3300005337 Bacteria 1651
82 Ga0070682_100350391 3300005337 Bacteria 1101
83 Ga0070682_100851817 3300005337 Unclassified 745
84 Ga0068868_100000022 3300005338 Bacteria 85904
85 Ga0068868_100004473 3300005338 Bacteria 9804
86 Ga0068868_100004930 3300005338 Bacteria 9375
87 Ga0068868_100091163 3300005338 Bacteria 2456
88 Ga0068868_100097183 3300005338 Bacteria 2379
89 Ga0068868_100102720 3300005338 Bacteria 2315
90 Ga0068868_100239278 3300005338 Bacteria 1524
91 Ga0068868_100288029 3300005338 Bacteria 1392
92 Ga0068868_100368446 3300005338 Bacteria 1234
93 Ga0068868_100523329 3300005338 Unclassified 1041
94 Ga0068868_101413474 3300005338 Bacteria 649
95 Ga0070660_100005843 3300005339 Bacteria 8517
96 Ga0070660_100028097 3300005339 Bacteria 4205
97 Ga0070660_100159810 3300005339 Bacteria 1815
98 Ga0070660_100464586 3300005339 Bacteria 1051
99 Ga0070660_100535177 3300005339 Bacteria 976
100 Ga0070689_100005812 3300005340 Bacteria 8467
101 Ga0070689_100022565 3300005340 Bacteria 4701
102 Ga0070689_100054044 3300005340 Bacteria 3108
103 Ga0070689_100158140 3300005340 Unclassified 1830
104 Ga0070689_100222254 3300005340 Unclassified 1549
105 Ga0070689_100224528 3300005340 Bacteria 1542
106 Ga0070689_100696795 3300005340 Unclassified 887
107 Ga0070691_10017424 3300005341 Bacteria 3305
108 Ga0070687_100037360 3300005343 Bacteria 2427
109 Ga0070687_100159497 3300005343 Unclassified 1332
110 Ga0070687_100277285 3300005343 Bacteria 1054
111 Ga0070687_100371970 3300005343 Bacteria 928
112 Ga0070661_100000111 3300005344 Bacteria 68066
113 Ga0070661_100003323 3300005344 Bacteria 11110
114 Ga0070661_100009578 3300005344 Bacteria 6710
115 Ga0070661_100027276 3300005344 Bacteria 4110
116 Ga0070661_100040704 3300005344 Bacteria 3391
117 Ga0070661_101084664 3300005344 Bacteria 667
118 Ga0070692_10247256 3300005345 Bacteria 1066
119 Ga0070692_10358561 3300005345 Bacteria 908
120 Ga0070668_100000016 3300005347 Bacteria 104092
121 Ga0070668_100009821 3300005347 Bacteria 7091
122 Ga0070668_100020610 3300005347 Bacteria 4977
123 Ga0070668_100085581 3300005347 Bacteria 2478
124 Ga0070668_100180324 3300005347 Bacteria 1725
125 Ga0070668_100632878 3300005347 Bacteria 939
126 Ga0070668_100797619 3300005347 Bacteria 839
127 Ga0070669_100002767 3300005353 Bacteria 12650
128 Ga0070669_100091070 3300005353 Bacteria 2287
129 Ga0070669_100210170 3300005353 Bacteria 1535
130 Ga0070669_100329579 3300005353 Bacteria 1234
131 Ga0070669_100566155 3300005353 Bacteria 949
132 Ga0070669_100791426 3300005353 Bacteria 806
133 Ga0070675_100008236 3300005354 Bacteria 8086
134 Ga0070675_100030791 3300005354 Bacteria 4333
135 Ga0070675_100059730 3300005354 Bacteria 3146
136 Ga0070675_100123800 3300005354 Bacteria 2199
137 Ga0070675_100209628 3300005354 Unclassified 1693
138 Ga0070675_100286254 3300005354 Bacteria 1449
139 Ga0070675_100304730 3300005354 Bacteria 1404
140 Ga0070675_100353317 3300005354 Bacteria 1304
141 Ga0070675_100354799 3300005354 Bacteria 1301
142 Ga0070675_100391897 3300005354 Bacteria 1238
143 Ga0070675_100576184 3300005354 Archaea 1019
144 Ga0070671_100007792 3300005355 Bacteria 8553
145 Ga0070671_100031479 3300005355 Bacteria 4382
146 Ga0070671_100036282 3300005355 Bacteria 4087
147 Ga0070671_100079696 3300005355 Bacteria 2738
148 Ga0070671_100103149 3300005355 Bacteria 2393
149 Ga0070671_100107867 3300005355 Bacteria 2338
150 Ga0070671_100213291 3300005355 Bacteria 1637
151 Ga0070671_100316696 3300005355 Unclassified 1329
152 Ga0070671_100433442 3300005355 Bacteria 1126
153 Ga0070671_100639546 3300005355 Bacteria 921
154 Ga0070674_100014627 3300005356 Bacteria 4882
155 Ga0070674_100060673 3300005356 Bacteria 2637
156 Ga0070674_100354222 3300005356 Unclassified 1186
157 Ga0070673_100000647 3300005364 Bacteria 19063
158 Ga0070673_100006643 3300005364 Bacteria 7541
159 Ga0070673_100007801 3300005364 Bacteria 7085
160 Ga0070673_100024176 3300005364 Bacteria 4450
161 Ga0070673_100030971 3300005364 Bacteria 4010
162 Ga0070673_100166640 3300005364 Bacteria 1878
163 Ga0070673_100288537 3300005364 Unclassified 1441
164 Ga0070673_100292798 3300005364 Bacteria 1431
165 Ga0070673_100420652 3300005364 Archaea 1198
166 Ga0070673_100801347 3300005364 Bacteria 870
167 Ga0070673_100934709 3300005364 Bacteria 805
168 Ga0070688_100004492 3300005365 Bacteria 7271
169 Ga0070688_100073712 3300005365 Bacteria 2190
170 Ga0070688_100221521 3300005365 Bacteria 1333
171 Ga0070688_101046969 3300005365 Unclassified 650
172 Ga0070659_100003580 3300005366 Bacteria 11055
173 Ga0070659_100007898 3300005366 Bacteria 7749
174 Ga0070659_100008941 3300005366 Bacteria 7342
175 Ga0070659_100064852 3300005366 Bacteria 2892
176 Ga0070659_100375152 3300005366 Bacteria 1197
177 Ga0070659_100441635 3300005366 Bacteria 1102
178 Ga0070667_100000031 3300005367 Bacteria 177447
179 Ga0070667_100009085 3300005367 Bacteria 8223
180 Ga0070667_100012532 3300005367 Bacteria 7013
181 Ga0070667_100078833 3300005367 Unclassified 2815
182 Ga0070667_100118725 3300005367 Bacteria 2299
183 Ga0070667_100154354 3300005367 Bacteria 2019
184 Ga0070667_100234362 3300005367 Bacteria 1637
185 Ga0070667_100897805 3300005367 Unclassified 825
186 Ga0070667_101235548 3300005367 Bacteria 700
187 Ga0070667_101418353 3300005367 Unclassified 651
188 Ga0070713_101161547 3300005436 Bacteria 747
189 Ga0070701_10254354 3300005438 Bacteria 1062
190 Ga0070700_100066476 3300005441 Bacteria 2288
191 Ga0070700_100309939 3300005441 Bacteria 1155
192 Ga0070694_100498655 3300005444 Bacteria 968
193 Ga0070663_100089289 3300005455 Bacteria 2280
194 Ga0070663_100187111 3300005455 Bacteria 1609
195 Ga0070663_100219145 3300005455 Bacteria 1493
196 Ga0070663_100758318 3300005455 Bacteria 829
197 Ga0070678_100028680 3300005456 Bacteria 3800
198 Ga0070678_100052167 3300005456 Bacteria 2968
199 Ga0070678_100132433 3300005456 Unclassified 1983
200 Ga0070678_100152473 3300005456 Bacteria 1863
201 Ga0070678_100303827 3300005456 Bacteria 1357
202 Ga0070678_100418199 3300005456 Bacteria 1168
203 Ga0070678_100458804 3300005456 Bacteria 1117
204 Ga0070678_101306168 3300005456 Unclassified 675
205 Ga0070662_100006327 3300005457 Bacteria 7627
206 Ga0070662_100008324 3300005457 Bacteria 6758
207 Ga0070662_100034754 3300005457 Bacteria 3556
208 Ga0070662_100042448 3300005457 Bacteria 3248
209 Ga0070662_100197952 3300005457 Unclassified 1593
210 Ga0070662_100277439 3300005457 Bacteria 1355
211 Ga0070681_10017351 3300005458 Bacteria 7193
212 Ga0070681_10017596 3300005458 Bacteria 7141
213 Ga0070681_10041664 3300005458 Bacteria 4603
214 Ga0070681_11053957 3300005458 Bacteria 733
215 Ga0068867_100000137 3300005459 Bacteria 47177
216 Ga0068867_100007969 3300005459 Bacteria 7483
217 Ga0068867_100011614 3300005459 Bacteria 6218
218 Ga0068867_100011772 3300005459 Bacteria 6178
219 Ga0068867_100027792 3300005459 Bacteria 4069
220 Ga0068867_100056690 3300005459 Bacteria 2899
221 Ga0068867_100073064 3300005459 Bacteria 2568
222 Ga0068867_100081643 3300005459 Bacteria 2437
223 Ga0068867_100095264 3300005459 Bacteria 2265
224 Ga0068867_100152234 3300005459 Bacteria 1818
225 Ga0068867_100260796 3300005459 Bacteria 1413
226 Ga0068867_100272438 3300005459 Bacteria 1385
227 Ga0068867_100317110 3300005459 Bacteria 1290
228 Ga0068867_100514620 3300005459 Bacteria 1031
229 Ga0068867_100635729 3300005459 Bacteria 935
230 Ga0068867_101320011 3300005459 Bacteria 666
231 Ga0070685_10038748 3300005466 Bacteria 2704
232 Ga0070685_10161513 3300005466 Bacteria 1428
233 Ga0070685_10250184 3300005466 Unclassified 1174
234 Ga0070685_10327043 3300005466 Bacteria 1041
235 Ga0070685_10434375 3300005466 Bacteria 916
236 Ga0070698_100009628 3300005471 Bacteria 10336
237 Ga0070698_100015207 3300005471 Bacteria 8137
238 Ga0070698_100059728 3300005471 Bacteria 3850
239 Ga0070699_101261036 3300005518 Bacteria 678
240 Ga0070679_100004034 3300005530 Bacteria 13534
241 Ga0070679_100027505 3300005530 Bacteria 5598
242 Ga0070679_100042810 3300005530 Bacteria 4510
243 Ga0070679_100309604 3300005530 Bacteria 1529
244 Ga0070679_100587234 3300005530 Bacteria 1057
245 Ga0070684_100000105 3300005535 Bacteria 54272
246 Ga0070684_100008247 3300005535 Bacteria 8142
247 Ga0070684_100009084 3300005535 Bacteria 7814
248 Ga0070684_100009974 3300005535 Bacteria 7508
249 Ga0070684_100044558 3300005535 Bacteria 3838
250 Ga0070684_100770060 3300005535 Bacteria 899
251 Ga0068853_100005499 3300005539 Bacteria 9932
252 Ga0068853_100006051 3300005539 Bacteria 9572
253 Ga0068853_100018696 3300005539 Bacteria 5738
254 Ga0068853_100037373 3300005539 Bacteria 4131
255 Ga0068853_100072711 3300005539 Bacteria 2997
256 Ga0068853_100098211 3300005539 Bacteria 2586
257 Ga0068853_100189312 3300005539 Bacteria 1869
258 Ga0068853_100231400 3300005539 Bacteria 1691
259 Ga0068853_100240366 3300005539 Bacteria 1659
260 Ga0068853_101460312 3300005539 Bacteria 662
261 Ga0070672_100000002 3300005543 Bacteria 159809
262 Ga0070672_100026695 3300005543 Bacteria 4301
263 Ga0070672_100037943 3300005543 Bacteria 3679
264 Ga0070672_100039646 3300005543 Bacteria 3609
265 Ga0070672_100057200 3300005543 Bacteria 3061
266 Ga0070672_100157293 3300005543 Bacteria 1883
267 Ga0070672_100214404 3300005543 Bacteria 1613
268 Ga0070672_100261509 3300005543 Unclassified 1459
269 Ga0070672_100319399 3300005543 Bacteria 1320
270 Ga0070672_100372661 3300005543 Unclassified 1220
271 Ga0070686_100015194 3300005544 Bacteria 4452
272 Ga0070686_100065135 3300005544 Bacteria 2366
273 Ga0070686_100083477 3300005544 Bacteria 2121
274 Ga0070686_100184024 3300005544 Unclassified 1486
275 Ga0070686_100572591 3300005544 Bacteria 886
276 Ga0070696_100565385 3300005546 Unclassified 913
277 Ga0070693_100141007 3300005547 Unclassified 1517
278 Ga0070693_100323873 3300005547 Bacteria 1046
279 Ga0070693_100345161 3300005547 Unclassified 1017
280 Ga0070665_100002563 3300005548 Bacteria 19933
281 Ga0070665_100007232 3300005548 Bacteria 11278
282 Ga0070665_100135266 3300005548 Bacteria 2467
283 Ga0070665_101496358 3300005548 Bacteria 684
284 Ga0070665_101728941 3300005548 Unclassified 633
285 Ga0070704_100480440 3300005549 Bacteria 1075
286 Ga0068855_100000304 3300005563 Bacteria 61250
287 Ga0068855_100004731 3300005563 Bacteria 16624
288 Ga0068855_100018632 3300005563 Bacteria 8348
289 Ga0068855_100033881 3300005563 Bacteria 6092
290 Ga0068855_100041782 3300005563 Bacteria 5433
291 Ga0068855_100064439 3300005563 Bacteria 4274
292 Ga0068855_100123688 3300005563 Bacteria 2959
293 Ga0068855_100641134 3300005563 Bacteria 1142
294 Ga0068855_100652165 3300005563 Bacteria 1130
295 Ga0068855_100889888 3300005563 Unclassified 941
296 Ga0068855_101424401 3300005563 Bacteria 713
297 Ga0070664_100000243 3300005564 Bacteria 39166
298 Ga0070664_100002674 3300005564 Bacteria 14383
299 Ga0070664_100049708 3300005564 Bacteria 3546
300 Ga0070664_100052212 3300005564 Unclassified 3462
301 Ga0070664_100117527 3300005564 Bacteria 2326
302 Ga0070664_100311546 3300005564 Bacteria 1424
303 Ga0070664_100415447 3300005564 Bacteria 1232
304 Ga0070664_101023893 3300005564 Bacteria 776
305 Ga0068857_100001483 3300005577 Bacteria 18682
306 Ga0068857_100017217 3300005577 Bacteria 6332
307 Ga0068857_100036180 3300005577 Bacteria 4375
308 Ga0068857_100067733 3300005577 Bacteria 3177
309 Ga0068857_100093247 3300005577 Bacteria 2696
310 Ga0068857_100103396 3300005577 Unclassified 2557
311 Ga0068857_100128245 3300005577 Bacteria 2287
312 Ga0068857_101114107 3300005577 Bacteria 762
313 Ga0068857_101461922 3300005577 Bacteria 665
314 Ga0068854_100006676 3300005578 Bacteria 7355
315 Ga0068854_100031961 3300005578 Bacteria 3660
316 Ga0068854_100120998 3300005578 Bacteria 1987
317 Ga0068854_100152605 3300005578 Bacteria 1782
318 Ga0068854_100439686 3300005578 Unclassified 1087
319 Ga0068854_101049677 3300005578 Bacteria 724
320 Ga0068854_101116163 3300005578 Bacteria 703
321 Ga0068856_100010109 3300005614 Bacteria 9171
322 Ga0068856_100019904 3300005614 Bacteria 6514
323 Ga0068856_100075018 3300005614 Bacteria 3350
324 Ga0068856_101427193 3300005614 Bacteria 706
325 Ga0070702_100109243 3300005615 Bacteria 1711
326 Ga0070702_100304833 3300005615 Bacteria 1103
327 Ga0068852_100002957 3300005616 Bacteria 11805
328 Ga0068852_100006022 3300005616 Bacteria 8736
329 Ga0068852_100045468 3300005616 Bacteria 3734
330 Ga0068852_100159471 3300005616 Bacteria 2105
331 Ga0068852_100237214 3300005616 Bacteria 1741
332 Ga0068852_100285235 3300005616 Bacteria 1593
333 Ga0068852_100448115 3300005616 Bacteria 1277
334 Ga0068852_100605398 3300005616 Unclassified 1100
335 Ga0068852_100665291 3300005616 Bacteria 1050
336 Ga0068852_100912456 3300005616 Bacteria 896
337 Ga0068859_100000025 3300005617 Bacteria 191679
338 Ga0068859_100005715 3300005617 Bacteria 12653
339 Ga0068859_100007026 3300005617 Bacteria 11428
340 Ga0068859_100024673 3300005617 Bacteria 6034
341 Ga0068859_100044169 3300005617 Bacteria 4478
342 Ga0068859_100055221 3300005617 Bacteria 3996
343 Ga0068859_100069009 3300005617 Bacteria 3569
344 Ga0068859_100105576 3300005617 Bacteria 2876
345 Ga0068859_100226519 3300005617 Bacteria 1957
346 Ga0068859_100287546 3300005617 Bacteria 1737
347 Ga0068859_100414430 3300005617 Bacteria 1443
348 Ga0068859_100592271 3300005617 Bacteria 1202
349 Ga0068859_100992526 3300005617 Bacteria 922
350 Ga0068859_101307987 3300005617 Bacteria 799
351 Ga0068859_102093677 3300005617 Bacteria 625
352 Ga0068864_100002821 3300005618 Bacteria 14340
353 Ga0068864_100006400 3300005618 Bacteria 9651
354 Ga0068864_100012870 3300005618 Bacteria 6921
355 Ga0068864_100016974 3300005618 Bacteria 6065
356 Ga0068864_100019781 3300005618 Bacteria 5629
357 Ga0068864_100031973 3300005618 Bacteria 4468
358 Ga0068864_100051432 3300005618 Bacteria 3549
359 Ga0068864_100084704 3300005618 Bacteria 2786
360 Ga0068864_100096445 3300005618 Bacteria 2617
361 Ga0068864_100287882 3300005618 Unclassified 1535
362 Ga0068864_100495963 3300005618 Bacteria 1174
363 Ga0068864_100960327 3300005618 Bacteria 846
364 Ga0068864_101182318 3300005618 Bacteria 763
365 Ga0068866_10025452 3300005718 Bacteria 2782
366 Ga0068866_10036264 3300005718 Bacteria 2414
367 Ga0068866_10080813 3300005718 Bacteria 1744
368 Ga0068866_10087830 3300005718 Bacteria 1686
369 Ga0068866_10156950 3300005718 Unclassified 1323
370 Ga0068866_10312454 3300005718 Bacteria 985
371 Ga0068866_10588888 3300005718 Bacteria 749
372 Ga0068861_100004483 3300005719 Bacteria 9372
373 Ga0068861_100045634 3300005719 Bacteria 3301
374 Ga0068861_100127034 3300005719 Bacteria 2064
375 Ga0068861_100143592 3300005719 Bacteria 1951
376 Ga0068861_100233595 3300005719 Unclassified 1561
377 Ga0068861_100237197 3300005719 Bacteria 1550
378 Ga0068861_100319525 3300005719 Bacteria 1351
379 Ga0068861_100768189 3300005719 Bacteria 902
380 Ga0068861_101263180 3300005719 Unclassified 716
381 Ga0068851_10000480 3300005834 Bacteria 17599
382 Ga0068851_10036230 3300005834 Bacteria 2470
383 Ga0068851_10057111 3300005834 Bacteria 1992
384 Ga0068851_10219080 3300005834 Bacteria 1068
385 Ga0068851_10264846 3300005834 Bacteria 979
386 Ga0068851_10281951 3300005834 Bacteria 950
387 Ga0068851_10314097 3300005834 Bacteria 904
388 Ga0068870_10002856 3300005840 Bacteria 7267
389 Ga0068870_10003154 3300005840 Bacteria 6952
390 Ga0068870_10035701 3300005840 Bacteria 2553
391 Ga0068870_10131576 3300005840 Bacteria 1454
392 Ga0068870_10286882 3300005840 Bacteria 1034
393 Ga0068870_10344224 3300005840 Bacteria 955
394 Ga0068863_100001503 3300005841 Bacteria 23075
395 Ga0068863_100011131 3300005841 Bacteria 8721
396 Ga0068863_100015998 3300005841 Bacteria 7195
397 Ga0068863_100056874 3300005841 Bacteria 3703
398 Ga0068863_100153862 3300005841 Unclassified 2201
399 Ga0068863_100177915 3300005841 Bacteria 2042
400 Ga0068863_100387532 3300005841 Unclassified 1365
401 Ga0068863_100441844 3300005841 Unclassified 1276
402 Ga0068863_100527213 3300005841 Unclassified 1165
403 Ga0068863_100650183 3300005841 Unclassified 1046
404 Ga0068863_101401956 3300005841 Bacteria 706
405 Ga0068858_100000083 3300005842 Bacteria 98991
406 Ga0068858_100043979 3300005842 Bacteria 4140
407 Ga0068858_100075033 3300005842 Bacteria 3141
408 Ga0068858_100206090 3300005842 Bacteria 1860
409 Ga0068858_100329655 3300005842 Bacteria 1460
410 Ga0068858_100867059 3300005842 Bacteria 882
411 Ga0068860_100000394 3300005843 Bacteria 57127
412 Ga0068860_100000443 3300005843 Bacteria 52294
413 Ga0068860_100001434 3300005843 Bacteria 25816
414 Ga0068860_100004753 3300005843 Bacteria 13841
415 Ga0068860_100004980 3300005843 Bacteria 13539
416 Ga0068860_100007835 3300005843 Bacteria 10661
417 Ga0068860_100054045 3300005843 Bacteria 3817
418 Ga0068860_100199964 3300005843 Bacteria 1936
419 Ga0068860_100209375 3300005843 Bacteria 1891
420 Ga0068860_100361252 3300005843 Unclassified 1431
421 Ga0068860_100364842 3300005843 Bacteria 1423
422 Ga0068860_100402830 3300005843 Bacteria 1354
423 Ga0068860_100594475 3300005843 Bacteria 1111
424 Ga0068860_100723326 3300005843 Bacteria 1006
425 Ga0068860_100881070 3300005843 Bacteria 911
426 Ga0068862_100033339 3300005844 Bacteria 4352
427 Ga0068862_100040968 3300005844 Bacteria 3939
428 Ga0068862_100203214 3300005844 Bacteria 1787
429 Ga0068862_100412336 3300005844 Unclassified 1266
430 Ga0068862_100534851 3300005844 Bacteria 1117
431 Ga0068862_100694697 3300005844 Unclassified 985
432 Ga0081540_1007841 3300005983 Bacteria 7550
433 Ga0081539_10000382 3300005985 Bacteria 96235
434 Ga0070717_10703744 3300006028 Bacteria 918
435 Ga0075368_10285906 3300006042 Bacteria 709
436 Ga0070715_10008603 3300006163 Bacteria 3563
437 Ga0075362_10155472 3300006177 Bacteria 1099
438 Ga0075366_10005278 3300006195 Bacteria 7001
439 Ga0075366_10015186 3300006195 Bacteria 4410
440 Ga0075366_10038420 3300006195 Bacteria 2827
441 Ga0075366_10061076 3300006195 Bacteria 2239
442 Ga0075366_10110717 3300006195 Bacteria 1651
443 Ga0097621_100000359 3300006237 Bacteria 31567
444 Ga0097621_100001013 3300006237 Bacteria 19778
445 Ga0097621_100003388 3300006237 Bacteria 10974
446 Ga0097621_100003645 3300006237 Bacteria 10641
447 Ga0097621_100006956 3300006237 Bacteria 8054
448 Ga0097621_100008617 3300006237 Bacteria 7355
449 Ga0097621_100229366 3300006237 Unclassified 1621
450 Ga0097621_100239939 3300006237 Bacteria 1584
451 Ga0097621_100279711 3300006237 Unclassified 1469
452 Ga0097621_100307806 3300006237 Unclassified 1401
453 Ga0068871_100000201 3300006358 Bacteria 41079
454 Ga0068871_100001198 3300006358 Bacteria 17312
455 Ga0068871_100007075 3300006358 Bacteria 7998
456 Ga0068871_100014661 3300006358 Bacteria 5848
457 Ga0068871_100056438 3300006358 Bacteria 3192
458 Ga0068871_100070253 3300006358 Bacteria 2878
459 Ga0068871_100178144 3300006358 Bacteria 1826
460 Ga0068871_100180548 3300006358 Bacteria 1813
461 Ga0068871_100224985 3300006358 Bacteria 1627
462 Ga0068871_100359583 3300006358 Bacteria 1289
463 Ga0068871_100524094 3300006358 Unclassified 1070
464 Ga0068871_100580459 3300006358 Bacteria 1018
465 Ga0068871_100754737 3300006358 Bacteria 894
466 Ga0075428_100007814 3300006844 Bacteria 11855
467 Ga0075430_100000960 3300006846 Bacteria 22735
468 Ga0075430_100049369 3300006846 Unclassified 3552
469 Ga0075430_100510741 3300006846 Bacteria 992
470 Ga0075431_100015973 3300006847 Bacteria 7617
471 Ga0075431_100041784 3300006847 Bacteria 4729
472 Ga0075431_100042520 3300006847 Unclassified 4687
473 Ga0075429_100011087 3300006880 Bacteria 7802
474 Ga0075429_100017423 3300006880 Bacteria 6212
475 Ga0075429_100264597 3300006880 Bacteria 1506
476 Ga0068865_100006660 3300006881 Bacteria 7068
477 Ga0068865_100021658 3300006881 Bacteria 4183
478 Ga0068865_100036806 3300006881 Bacteria 3302
479 Ga0068865_100249088 3300006881 Bacteria 1401
480 Ga0068865_100288219 3300006881 Bacteria 1309
481 Ga0068865_100322226 3300006881 Bacteria 1244
482 Ga0068865_100442626 3300006881 Bacteria 1073
483 Ga0068865_101057382 3300006881 Bacteria 713
484 Ga0097620_100000025 3300006931 Bacteria 191679
485 Ga0097620_100005715 3300006931 Bacteria 12653
486 Ga0097620_100007026 3300006931 Bacteria 11428
487 Ga0097620_100024672 3300006931 Bacteria 6034
488 Ga0097620_100044169 3300006931 Bacteria 4478
489 Ga0097620_100055225 3300006931 Bacteria 3996
490 Ga0097620_100068386 3300006931 Bacteria 3586
491 Ga0097620_100069008 3300006931 Bacteria 3569
492 Ga0097620_100105577 3300006931 Bacteria 2876
493 Ga0097620_100226519 3300006931 Bacteria 1957
494 Ga0097620_100287544 3300006931 Bacteria 1737
495 Ga0097620_100414453 3300006931 Bacteria 1443
496 Ga0097620_100592209 3300006931 Bacteria 1202
497 Ga0097620_100992380 3300006931 Bacteria 922
498 Ga0097620_101307807 3300006931 Bacteria 799
499 Ga0097620_102093675 3300006931 Bacteria 625
500 Ga0105251_10123147 3300009011 Bacteria 1177
501 Ga0105240_10005867 3300009093 Bacteria 18198
502 Ga0105240_10006669 3300009093 Bacteria 16930
503 Ga0105240_10013970 3300009093 Bacteria 10992
504 Ga0105240_10016100 3300009093 Bacteria 10132
505 Ga0105240_10017244 3300009093 Bacteria 9740
506 Ga0105240_10024771 3300009093 Bacteria 7902
507 Ga0105240_10098645 3300009093 Bacteria 3557
508 Ga0105240_10117202 3300009093 Bacteria 3211
509 Ga0105240_10184742 3300009093 Unclassified 2457
510 Ga0105240_10279744 3300009093 Bacteria 1917
511 Ga0105240_11681180 3300009093 Bacteria 663
512 Ga0111539_10013348 3300009094 Bacteria 10265
513 Ga0111539_10193808 3300009094 Bacteria 2370
514 Ga0111539_10204149 3300009094 Bacteria 2304
515 Ga0111539_10572031 3300009094 Bacteria 1316
516 Ga0111539_10792345 3300009094 Unclassified 1103
517 Ga0105245_10053019 3300009098 Bacteria 3640
518 Ga0105247_10004482 3300009101 Bacteria 8906
519 Ga0105247_10007771 3300009101 Bacteria 6562
520 Ga0105247_10065965 3300009101 Bacteria 2253
521 Ga0105247_10105064 3300009101 Bacteria 1810
522 Ga0105247_10166741 3300009101 Unclassified 1462
523 Ga0114129_10005551 3300009147 Bacteria 17840
524 Ga0105241_10000460 3300009174 Bacteria 30681
525 Ga0105241_10000583 3300009174 Bacteria 27510
526 Ga0105241_10007773 3300009174 Bacteria 7885
527 Ga0105241_10060867 3300009174 Bacteria 2906
528 Ga0105241_10104753 3300009174 Bacteria 2254
529 Ga0105241_10400392 3300009174 Bacteria 1204
530 Ga0105241_10442505 3300009174 Bacteria 1148
531 Ga0105241_10955286 3300009174 Unclassified 799
532 Ga0105242_10014258 3300009176 Bacteria 6156
533 Ga0105242_10049986 3300009176 Bacteria 3403
534 Ga0105242_10071856 3300009176 Bacteria 2873
535 Ga0105242_10154113 3300009176 Bacteria 2006
536 Ga0105242_10221047 3300009176 Bacteria 1693
537 Ga0105242_10225776 3300009176 Unclassified 1676
538 Ga0105242_10633786 3300009176 Bacteria 1037
539 Ga0105242_11321006 3300009176 Bacteria 746
540 Ga0105248_10026738 3300009177 Bacteria 6417
541 Ga0105248_10056348 3300009177 Bacteria 4410
542 Ga0105248_10245972 3300009177 Bacteria 2013
543 Ga0105248_11196648 3300009177 Bacteria 859
544 Ga0105237_10000191 3300009545 Bacteria 87065
545 Ga0105237_10002013 3300009545 Bacteria 25878
546 Ga0105237_10002339 3300009545 Bacteria 23551
547 Ga0105237_10003181 3300009545 Bacteria 19693
548 Ga0105237_10009688 3300009545 Bacteria 10307
549 Ga0105237_10010072 3300009545 Bacteria 10083
550 Ga0105237_10020602 3300009545 Bacteria 6795
551 Ga0105237_10044567 3300009545 Bacteria 4467
552 Ga0105237_10423974 3300009545 Bacteria 1336
553 Ga0105237_11514974 3300009545 Unclassified 677
554 Ga0105238_10000488 3300009551 Bacteria 41712
555 Ga0105238_10134331 3300009551 Bacteria 2452
556 Ga0105238_10328568 3300009551 Bacteria 1516
557 Ga0105249_10001096 3300009553 Bacteria 24070
558 Ga0105249_10003251 3300009553 Bacteria 14076
559 Ga0105249_10004354 3300009553 Bacteria 12246
560 Ga0105249_10007340 3300009553 Bacteria 9611
561 Ga0105249_10008333 3300009553 Bacteria 9026
562 Ga0105249_10008489 3300009553 Bacteria 8951
563 Ga0105249_10013225 3300009553 Bacteria 7283
564 Ga0105249_10021033 3300009553 Bacteria 5840
565 Ga0105249_10087661 3300009553 Bacteria 2905
566 Ga0105249_10164802 3300009553 Bacteria 2145
567 Ga0105249_10394897 3300009553 Bacteria 1412
568 Ga0105249_10642552 3300009553 Bacteria 1118
569 Ga0105249_10730028 3300009553 Bacteria 1052
570 Ga0105249_11144550 3300009553 Bacteria 849
571 Ga0105249_11231787 3300009553 Bacteria 819
572 Ga0105239_10001833 3300010375 Bacteria 27816
573 Ga0105239_10003738 3300010375 Bacteria 18534
574 Ga0105239_10009153 3300010375 Bacteria 11202
575 Ga0105239_10013146 3300010375 Bacteria 9199
576 Ga0105239_10015008 3300010375 Bacteria 8588
577 Ga0105239_10019015 3300010375 Bacteria 7591
578 Ga0105239_10032094 3300010375 Bacteria 5771
579 Ga0105239_10112269 3300010375 Bacteria 3022
580 Ga0105239_10157371 3300010375 Bacteria 2538
581 Ga0105239_10198268 3300010375 Bacteria 2249
582 Ga0105246_10006859 3300011119 Bacteria 6966
583 Ga0105246_10017282 3300011119 Bacteria 4581
584 Ga0105246_10157402 3300011119 Bacteria 1727
585 Ga0105246_10323729 3300011119 Bacteria 1254
586 Ga0105246_10349734 3300011119 Unclassified 1211
587 Ga0157324_1010930 3300012506 Bacteria 777
588 Ga0157373_10002220 3300013100 Bacteria 14694
589 Ga0157373_10006783 3300013100 Bacteria 8529
590 Ga0157373_10010511 3300013100 Bacteria 6810
591 Ga0157373_10022014 3300013100 Bacteria 4625
592 Ga0157373_10034411 3300013100 Bacteria 3639
593 Ga0157373_10042364 3300013100 Bacteria 3254
594 Ga0157373_10053913 3300013100 Bacteria 2858
595 Ga0157371_10001718 3300013102 Bacteria 22261
596 Ga0157371_10001864 3300013102 Bacteria 21109
597 Ga0157371_10006147 3300013102 Bacteria 9969
598 Ga0157371_10007563 3300013102 Bacteria 8772
599 Ga0157371_10008606 3300013102 Bacteria 8105
600 Ga0157371_10008653 3300013102 Bacteria 8087
601 Ga0157371_10030654 3300013102 Bacteria 3878
602 Ga0157371_10038406 3300013102 Bacteria 3426
603 Ga0157371_10060321 3300013102 Unclassified 2690
604 Ga0157371_10103590 3300013102 Unclassified 2019
605 Ga0157371_10125041 3300013102 Bacteria 1829
606 Ga0157371_10277432 3300013102 Unclassified 1210
607 Ga0157371_10374637 3300013102 Bacteria 1039
608 Ga0157371_10433626 3300013102 Unclassified 965
609 Ga0157371_10439405 3300013102 Bacteria 958
610 Ga0157370_10002931 3300013104 Bacteria 20307
611 Ga0157370_10003909 3300013104 Bacteria 17358
612 Ga0157370_10013148 3300013104 Bacteria 8538
613 Ga0157370_10032563 3300013104 Bacteria 5090
614 Ga0157370_10054974 3300013104 Unclassified 3794
615 Ga0157370_10090737 3300013104 Bacteria 2869
616 Ga0157370_10221773 3300013104 Bacteria 1751
617 Ga0157370_10238099 3300013104 Unclassified 1684
618 Ga0157370_10241058 3300013104 Bacteria 1673
619 Ga0157370_10309030 3300013104 Bacteria 1459
620 Ga0157370_10350574 3300013104 Bacteria 1360
621 Ga0157370_10416136 3300013104 Bacteria 1237
622 Ga0157370_10783391 3300013104 Unclassified 868
623 Ga0157369_10008510 3300013105 Bacteria 11765
624 Ga0157369_10010331 3300013105 Bacteria 10646
625 Ga0157369_10025886 3300013105 Bacteria 6509
626 Ga0157369_10117768 3300013105 Bacteria 2820
627 Ga0157374_10000011 3300013296 Bacteria 466749
628 Ga0157374_10000074 3300013296 Bacteria 99947
629 Ga0157374_10004005 3300013296 Bacteria 12384
630 Ga0157374_10007442 3300013296 Bacteria 9340
631 Ga0157374_10024269 3300013296 Bacteria 5434
632 Ga0157374_10025127 3300013296 Bacteria 5344
633 Ga0157374_10046292 3300013296 Bacteria 4028
634 Ga0157374_10057395 3300013296 Bacteria 3636
635 Ga0157374_10099880 3300013296 Unclassified 2781
636 Ga0157374_10185774 3300013296 Unclassified 2032
637 Ga0157374_10345802 3300013296 Bacteria 1477
638 Ga0157374_10351128 3300013296 Bacteria 1465
639 Ga0157374_10440365 3300013296 Bacteria 1303
640 Ga0157374_10702641 3300013296 Bacteria 1024
641 Ga0157374_10968374 3300013296 Bacteria 870
642 Ga0157378_10001083 3300013297 Bacteria 24880
643 Ga0157378_10004008 3300013297 Bacteria 13014
644 Ga0157378_10005125 3300013297 Bacteria 11504
645 Ga0157378_10006722 3300013297 Bacteria 10047
646 Ga0157378_10010333 3300013297 Bacteria 8149
647 Ga0157378_10020956 3300013297 Bacteria 5751
648 Ga0157378_10023648 3300013297 Bacteria 5405
649 Ga0157378_10085900 3300013297 Bacteria 2851
650 Ga0157378_10091795 3300013297 Bacteria 2762
651 Ga0157378_10130990 3300013297 Bacteria 2321
652 Ga0157378_10196530 3300013297 Bacteria 1905
653 Ga0157378_10217693 3300013297 Bacteria 1814
654 Ga0157378_10228607 3300013297 Unclassified 1772
655 Ga0157378_10332084 3300013297 Bacteria 1480
656 Ga0157378_10778175 3300013297 Bacteria 981
657 Ga0157378_11046476 3300013297 Unclassified 852
658 Ga0157378_11413204 3300013297 Bacteria 739
659 Ga0163162_10000029 3300013306 Bacteria 168510
660 Ga0163162_10000424 3300013306 Bacteria 38989
661 Ga0163162_10001000 3300013306 Bacteria 26251
662 Ga0163162_10001299 3300013306 Bacteria 23358
663 Ga0163162_10002193 3300013306 Bacteria 18320
664 Ga0163162_10003040 3300013306 Bacteria 16029
665 Ga0163162_10003535 3300013306 Bacteria 14954
666 Ga0163162_10003577 3300013306 Bacteria 14863
667 Ga0163162_10040893 3300013306 Bacteria 4637
668 Ga0163162_10074959 3300013306 Bacteria 3443
669 Ga0163162_10122892 3300013306 Unclassified 2701
670 Ga0163162_10220830 3300013306 Bacteria 2025
671 Ga0163162_10280938 3300013306 Unclassified 1797
672 Ga0163162_10372522 3300013306 Bacteria 1561
673 Ga0163162_10487776 3300013306 Bacteria 1363
674 Ga0163162_10516136 3300013306 Bacteria 1325
675 Ga0163162_10948021 3300013306 Unclassified 972
676 Ga0163162_11097598 3300013306 Bacteria 901
677 Ga0163162_11670075 3300013306 Bacteria 727
678 Ga0157372_10001323 3300013307 Bacteria 26827
679 Ga0157372_10001983 3300013307 Bacteria 22252
680 Ga0157372_10015169 3300013307 Bacteria 8247
681 Ga0157372_10018824 3300013307 Bacteria 7430
682 Ga0157372_10030649 3300013307 Bacteria 5885
683 Ga0157372_10046594 3300013307 Bacteria 4813
684 Ga0157372_10049345 3300013307 Bacteria 4680
685 Ga0157372_10087823 3300013307 Unclassified 3529
686 Ga0157372_10129708 3300013307 Bacteria 2900
687 Ga0157372_10156054 3300013307 Bacteria 2636
688 Ga0157372_10156639 3300013307 Bacteria 2631
689 Ga0157372_10167750 3300013307 Bacteria 2539
690 Ga0157372_10226634 3300013307 Bacteria 2167
691 Ga0157372_10277600 3300013307 Bacteria 1948
692 Ga0157372_10443735 3300013307 Bacteria 1512
693 Ga0157372_10533912 3300013307 Bacteria 1367
694 Ga0157372_10672589 3300013307 Bacteria 1205
695 Ga0157372_10711596 3300013307 Bacteria 1168
696 Ga0157372_11147648 3300013307 Bacteria 898
697 Ga0157372_11287743 3300013307 Bacteria 844
698 Ga0157375_10000042 3300013308 Bacteria 160008
699 Ga0157375_10003311 3300013308 Bacteria 13954
700 Ga0157375_10011768 3300013308 Bacteria 7737
701 Ga0157375_10026087 3300013308 Bacteria 5440
702 Ga0157375_10031855 3300013308 Bacteria 4994
703 Ga0157375_10032063 3300013308 Bacteria 4979
704 Ga0157375_10074180 3300013308 Unclassified 3423
705 Ga0157375_10098473 3300013308 Unclassified 3001
706 Ga0157375_10163880 3300013308 Bacteria 2367
707 Ga0157375_10369855 3300013308 Unclassified 1600
708 Ga0157375_10388193 3300013308 Bacteria 1563
709 Ga0157375_10606648 3300013308 Bacteria 1253
710 Ga0157375_10727691 3300013308 Unclassified 1145
711 Ga0157375_10835060 3300013308 Bacteria 1068
712 Ga0157375_11002301 3300013308 Bacteria 975
713 Ga0157375_11494807 3300013308 Bacteria 797
714 Ga0157375_11621536 3300013308 Bacteria 765
715 Ga0157375_12193536 3300013308 Bacteria 658
716 Ga0163163_10000076 3300014325 Bacteria 108784
717 Ga0163163_10000202 3300014325 Bacteria 61701
718 Ga0163163_10041585 3300014325 Bacteria 4495
719 Ga0163163_10094560 3300014325 Bacteria 3007
720 Ga0163163_10122102 3300014325 Bacteria 2639
721 Ga0163163_10132178 3300014325 Bacteria 2536
722 Ga0163163_10194923 3300014325 Bacteria 2074
723 Ga0163163_10211587 3300014325 Bacteria 1988
724 Ga0163163_10468721 3300014325 Unclassified 1320
725 Ga0163163_10993056 3300014325 Bacteria 903
726 Ga0163163_11074243 3300014325 Bacteria 868
727 Ga0163163_11101444 3300014325 Unclassified 857
728 Ga0163163_11142596 3300014325 Unclassified 842
729 Ga0163163_11768844 3300014325 Unclassified 678
730 Ga0157380_10001511 3300014326 Bacteria 15260
731 Ga0157380_10019688 3300014326 Bacteria 5033
732 Ga0157380_10058768 3300014326 Bacteria 3066
733 Ga0157380_10120247 3300014326 Bacteria 2224
734 Ga0157380_10534274 3300014326 Bacteria 1147
735 Ga0157380_11276268 3300014326 Bacteria 781
736 Ga0157380_11914773 3300014326 Unclassified 654
737 Ga0182008_10229332 3300014497 Bacteria 952
738 Ga0157377_10000678 3300014745 Bacteria 14088
739 Ga0157377_10010998 3300014745 Bacteria 4500
740 Ga0157377_10057007 3300014745 Bacteria 2220
741 Ga0157377_10234134 3300014745 Bacteria 1182
742 Ga0157377_10774175 3300014745 Bacteria 705
743 Ga0157379_10000016 3300014968 Bacteria 103230
744 Ga0157379_10058453 3300014968 Bacteria 3448
745 Ga0157379_10061393 3300014968 Unclassified 3361
746 Ga0157379_10095163 3300014968 Bacteria 2672
747 Ga0157379_10116345 3300014968 Unclassified 2404
748 Ga0157379_10225863 3300014968 Unclassified 1697
749 Ga0157379_10231500 3300014968 Unclassified 1675
750 Ga0157379_10235598 3300014968 Bacteria 1660
751 Ga0157379_10291825 3300014968 Bacteria 1485
752 Ga0157376_10000067 3300014969 Bacteria 83894
753 Ga0157376_10000842 3300014969 Bacteria 20112
754 Ga0157376_10001885 3300014969 Bacteria 13999
755 Ga0157376_10004408 3300014969 Bacteria 9798
756 Ga0157376_10038461 3300014969 Bacteria 3893
757 Ga0157376_10050196 3300014969 Bacteria 3460
758 Ga0157376_10061479 3300014969 Bacteria 3157
759 Ga0157376_10072036 3300014969 Bacteria 2938
760 Ga0157376_10257732 3300014969 Bacteria 1632
761 Ga0157376_10289725 3300014969 Bacteria 1545
762 Ga0157376_10311207 3300014969 Unclassified 1494
763 Ga0157376_10435270 3300014969 Bacteria 1276
764 Ga0157376_10477087 3300014969 Bacteria 1222
765 Ga0157376_10537356 3300014969 Unclassified 1155
766 Ga0157376_11486976 3300014969 Bacteria 710
767 Ga0163161_10005108 3300017792 Bacteria 9133
768 Ga0163161_10009090 3300017792 Bacteria 6873
769 Ga0163161_10067198 3300017792 Bacteria 2618
770 Ga0163161_10175276 3300017792 Unclassified 1641
771 Ga0163161_10279971 3300017792 Bacteria 1308
772 Ga0163161_10295801 3300017792 Bacteria 1274
773 Ga0197907_10540640 3300020069 Bacteria 988
774 Ga0206356_10223461 3300020070 Bacteria 1909
775 Ga0206352_11102928 3300020078 Unclassified 1112
776 Ga0206353_10650099 3300020082 Bacteria 1442
777 Ga0213876_10003359 3300021384 Bacteria 9162
778 Ga0213876_10252200 3300021384 Bacteria 938
779 Ga0209646_1000428 3300025246 Bacteria 23332
780 Ga0207666_1031875 3300025271 Bacteria 809
781 Ga0207426_1000230 3300025302 Bacteria 128357
782 Ga0207697_10047026 3300025315 Bacteria 1778
783 Ga0207697_10114310 3300025315 Bacteria 1157
784 Ga0207697_10129237 3300025315 Unclassified 1091
785 Ga0207697_10178137 3300025315 Bacteria 931
786 Ga0207656_10052404 3300025321 Bacteria 1767
787 Ga0207656_10117772 3300025321 Unclassified 1234
788 Ga0207656_10184059 3300025321 Bacteria 1004
789 Ga0207682_10005622 3300025893 Bacteria 5097
790 Ga0207682_10008288 3300025893 Bacteria 4116
791 Ga0207682_10079399 3300025893 Unclassified 1403
792 Ga0207682_10128897 3300025893 Bacteria 1128
793 Ga0207642_10016736 3300025899 Bacteria 2771
794 Ga0207642_10135370 3300025899 Bacteria 1292
795 Ga0207642_10196643 3300025899 Bacteria 1111
796 Ga0207642_10442008 3300025899 Bacteria 786
797 Ga0207710_10005590 3300025900 Bacteria 5409
798 Ga0207710_10009215 3300025900 Bacteria 4152
799 Ga0207688_10002147 3300025901 Bacteria 10604
800 Ga0207688_10302526 3300025901 Bacteria 978
801 Ga0207688_10309247 3300025901 Bacteria 967
802 Ga0207680_10000180 3300025903 Bacteria 30911
803 Ga0207680_10001414 3300025903 Bacteria 11364
804 Ga0207680_10007029 3300025903 Bacteria 5467
805 Ga0207680_10029849 3300025903 Bacteria 3068
806 Ga0207680_10090961 3300025903 Bacteria 1941
807 Ga0207680_10160351 3300025903 Unclassified 1507
808 Ga0207680_10826100 3300025903 Bacteria 664
809 Ga0207647_10000096 3300025904 Bacteria 67468
810 Ga0207647_10013169 3300025904 Bacteria 5745
811 Ga0207647_10031011 3300025904 Bacteria 3445
812 Ga0207647_10074097 3300025904 Bacteria 2051
813 Ga0207647_10090039 3300025904 Unclassified 1831
814 Ga0207647_10329313 3300025904 Bacteria 866
815 Ga0207685_10068044 3300025905 Bacteria 1434
816 Ga0207685_10104160 3300025905 Bacteria 1218
817 Ga0207645_10000326 3300025907 Bacteria 39738
818 Ga0207645_10002072 3300025907 Bacteria 16048
819 Ga0207645_10021126 3300025907 Bacteria 4249
820 Ga0207645_10023895 3300025907 Bacteria 3967
821 Ga0207645_10024269 3300025907 Bacteria 3933
822 Ga0207645_10058499 3300025907 Bacteria 2461
823 Ga0207645_10073710 3300025907 Bacteria 2185
824 Ga0207645_10150341 3300025907 Bacteria 1520
825 Ga0207643_10004929 3300025908 Bacteria 7140
826 Ga0207643_10014031 3300025908 Bacteria 4348
827 Ga0207643_10064949 3300025908 Bacteria 2090
828 Ga0207643_10099267 3300025908 Bacteria 1706
829 Ga0207643_10125503 3300025908 Bacteria 1523
830 Ga0207705_10011138 3300025909 Bacteria 6519
831 Ga0207705_10016501 3300025909 Bacteria 5292
832 Ga0207705_10067764 3300025909 Bacteria 2583
833 Ga0207705_10114588 3300025909 Bacteria 1994
834 Ga0207705_10329377 3300025909 Bacteria 1174
835 Ga0207654_10112936 3300025911 Unclassified 1693
836 Ga0207654_10115371 3300025911 Bacteria 1678
837 Ga0207654_10122746 3300025911 Unclassified 1634
838 Ga0207654_10325850 3300025911 Bacteria 1051
839 Ga0207707_10034952 3300025912 Bacteria 4396
840 Ga0207707_10068701 3300025912 Bacteria 3088
841 Ga0207707_10122944 3300025912 Unclassified 2269
842 Ga0207707_10367474 3300025912 Bacteria 1238
843 Ga0207695_10000212 3300025913 Bacteria 156450
844 Ga0207695_10000351 3300025913 Bacteria 105891
845 Ga0207695_10001387 3300025913 Bacteria 40927
846 Ga0207695_10002698 3300025913 Bacteria 25889
847 Ga0207695_10014473 3300025913 Bacteria 9339
848 Ga0207695_10038130 3300025913 Bacteria 5178
849 Ga0207695_10062333 3300025913 Bacteria 3850
850 Ga0207695_10167338 3300025913 Bacteria 2126
851 Ga0207695_10184809 3300025913 Bacteria 2004
852 Ga0207671_10001741 3300025914 Bacteria 24461
853 Ga0207671_10007829 3300025914 Bacteria 9188
854 Ga0207671_10034593 3300025914 Bacteria 3753
855 Ga0207671_10053598 3300025914 Bacteria 2989
856 Ga0207671_10139180 3300025914 Bacteria 1869
857 Ga0207660_10033378 3300025917 Bacteria 3560
858 Ga0207660_10079738 3300025917 Bacteria 2402
859 Ga0207660_10271908 3300025917 Unclassified 1343
860 Ga0207660_10700834 3300025917 Bacteria 826
861 Ga0207662_10047084 3300025918 Bacteria 2553
862 Ga0207657_10006242 3300025919 Bacteria 12389
863 Ga0207657_10010679 3300025919 Bacteria 9145
864 Ga0207657_10016134 3300025919 Bacteria 7212
865 Ga0207657_10066421 3300025919 Bacteria 3070
866 Ga0207657_10071703 3300025919 Bacteria 2933
867 Ga0207657_10113770 3300025919 Bacteria 2232
868 Ga0207657_10313596 3300025919 Bacteria 1241
869 Ga0207657_10366092 3300025919 Bacteria 1136
870 Ga0207657_10397769 3300025919 Bacteria 1084
871 Ga0207649_10000517 3300025920 Bacteria 27099
872 Ga0207649_10004820 3300025920 Bacteria 7296
873 Ga0207649_10013530 3300025920 Bacteria 4555
874 Ga0207649_10032417 3300025920 Bacteria 3115
875 Ga0207649_10582597 3300025920 Bacteria 859
876 Ga0207652_10000160 3300025921 Bacteria 72867
877 Ga0207652_10000203 3300025921 Bacteria 62871
878 Ga0207652_10020989 3300025921 Bacteria 5387
879 Ga0207652_10034535 3300025921 Bacteria 4262
880 Ga0207652_10215366 3300025921 Unclassified 1730
881 Ga0207681_10141535 3300025923 Bacteria 1792
882 Ga0207681_10150477 3300025923 Bacteria 1743
883 Ga0207681_10229236 3300025923 Unclassified 1441
884 Ga0207681_10346617 3300025923 Bacteria 1188
885 Ga0207681_10405152 3300025923 Bacteria 1102
886 Ga0207681_10410026 3300025923 Bacteria 1096
887 Ga0207681_10426336 3300025923 Bacteria 1075
888 Ga0207694_10002191 3300025924 Bacteria 16050
889 Ga0207694_10119520 3300025924 Bacteria 2103
890 Ga0207694_10338757 3300025924 Bacteria 1243
891 Ga0207694_10454869 3300025924 Bacteria 1069
892 Ga0207650_10015592 3300025925 Bacteria 5296
893 Ga0207650_10031051 3300025925 Bacteria 3855
894 Ga0207650_10048549 3300025925 Unclassified 3131
895 Ga0207650_10075035 3300025925 Bacteria 2551
896 Ga0207650_10090022 3300025925 Unclassified 2343
897 Ga0207650_10107004 3300025925 Bacteria 2160
898 Ga0207650_10121462 3300025925 Bacteria 2034
899 Ga0207650_10131573 3300025925 Bacteria 1958
900 Ga0207650_10205114 3300025925 Unclassified 1581
901 Ga0207650_10843593 3300025925 Bacteria 777
902 Ga0207650_10857202 3300025925 Unclassified 771
903 Ga0207650_10929430 3300025925 Bacteria 739
904 Ga0207659_10020147 3300025926 Bacteria 4403
905 Ga0207659_10062942 3300025926 Bacteria 2680
906 Ga0207659_10124775 3300025926 Bacteria 1978
907 Ga0207659_10228003 3300025926 Bacteria 1501
908 Ga0207659_10233304 3300025926 Bacteria 1485
909 Ga0207659_10251571 3300025926 Bacteria 1434
910 Ga0207659_10447794 3300025926 Bacteria 1087
911 Ga0207687_10385532 3300025927 Bacteria 1149
912 Ga0207687_10419601 3300025927 Bacteria 1104
913 Ga0207700_10416370 3300025928 Bacteria 1180
914 Ga0207664_10780504 3300025929 Bacteria 859
915 Ga0207644_10005204 3300025931 Bacteria 8496
916 Ga0207644_10010988 3300025931 Bacteria 5979
917 Ga0207644_10029092 3300025931 Bacteria 3830
918 Ga0207644_10102421 3300025931 Bacteria 2153
919 Ga0207644_10110251 3300025931 Bacteria 2080
920 Ga0207644_10179728 3300025931 Unclassified 1657
921 Ga0207644_10221966 3300025931 Bacteria 1498
922 Ga0207644_10367779 3300025931 Bacteria 1171
923 Ga0207644_10514872 3300025931 Unclassified 988
924 Ga0207644_10631743 3300025931 Bacteria 890
925 Ga0207644_10800197 3300025931 Bacteria 788
926 Ga0207644_10821900 3300025931 Bacteria 777
927 Ga0207644_11010300 3300025931 Unclassified 698
928 Ga0207690_10003750 3300025932 Bacteria 9010
929 Ga0207690_10033836 3300025932 Bacteria 3289
930 Ga0207690_10073558 3300025932 Bacteria 2364
931 Ga0207690_10125399 3300025932 Bacteria 1871
932 Ga0207690_10132078 3300025932 Bacteria 1829
933 Ga0207690_10234008 3300025932 Bacteria 1412
934 Ga0207690_10241948 3300025932 Bacteria 1390
935 Ga0207706_10000750 3300025933 Bacteria 33787
936 Ga0207706_10016387 3300025933 Bacteria 6692
937 Ga0207706_10020556 3300025933 Bacteria 5933
938 Ga0207706_10023049 3300025933 Bacteria 5592
939 Ga0207706_10042762 3300025933 Bacteria 4015
940 Ga0207706_10102958 3300025933 Bacteria 2512
941 Ga0207706_10107261 3300025933 Unclassified 2458
942 Ga0207706_10280866 3300025933 Bacteria 1452
943 Ga0207706_10438003 3300025933 Bacteria 1131
944 Ga0207706_10656086 3300025933 Bacteria 898
945 Ga0207706_11127979 3300025933 Unclassified 654
946 Ga0207686_10001189 3300025934 Bacteria 15075
947 Ga0207686_10217714 3300025934 Unclassified 1377
948 Ga0207686_10531715 3300025934 Bacteria 917
949 Ga0207686_10633730 3300025934 Unclassified 844
950 Ga0207670_10019099 3300025936 Bacteria 4179
951 Ga0207670_10025493 3300025936 Bacteria 3712
952 Ga0207670_10125996 3300025936 Unclassified 1869
953 Ga0207669_10085197 3300025937 Unclassified 2039
954 Ga0207669_10085320 3300025937 Bacteria 2038
955 Ga0207669_10121985 3300025937 Bacteria 1772
956 Ga0207669_10159144 3300025937 Bacteria 1593
957 Ga0207669_10785710 3300025937 Unclassified 788
958 Ga0207704_10003568 3300025938 Bacteria 7068
959 Ga0207704_10062813 3300025938 Unclassified 2311
960 Ga0207704_10100454 3300025938 Unclassified 1927
961 Ga0207704_10220807 3300025938 Unclassified 1402
962 Ga0207704_10254372 3300025938 Bacteria 1321
963 Ga0207704_10846069 3300025938 Bacteria 766
964 Ga0207665_10446152 3300025939 Unclassified 992
965 Ga0207665_10821887 3300025939 Unclassified 735
966 Ga0207691_10000004 3300025940 Bacteria 168729
967 Ga0207691_10008770 3300025940 Bacteria 9702
968 Ga0207691_10012199 3300025940 Bacteria 8236
969 Ga0207691_10092285 3300025940 Bacteria 2711
970 Ga0207691_10119935 3300025940 Bacteria 2332
971 Ga0207691_10123516 3300025940 Bacteria 2291
972 Ga0207691_10147643 3300025940 Bacteria 2069
973 Ga0207691_10166281 3300025940 Bacteria 1933
974 Ga0207691_10577767 3300025940 Unclassified 952
975 Ga0207691_10628784 3300025940 Bacteria 908
976 Ga0207711_10195825 3300025941 Bacteria 1843
977 Ga0207711_10631223 3300025941 Bacteria 999
978 Ga0207689_10000208 3300025942 Bacteria 51706
979 Ga0207689_10001060 3300025942 Bacteria 26468
980 Ga0207689_10009934 3300025942 Bacteria 8207
981 Ga0207689_10028144 3300025942 Bacteria 4700
982 Ga0207689_10037110 3300025942 Bacteria 4044
983 Ga0207689_10037202 3300025942 Bacteria 4038
984 Ga0207689_10037929 3300025942 Bacteria 3994
985 Ga0207689_10105863 3300025942 Bacteria 2311
986 Ga0207689_10271717 3300025942 Unclassified 1403
987 Ga0207689_10321630 3300025942 Unclassified 1284
988 Ga0207689_10368211 3300025942 Bacteria 1195
989 Ga0207689_10373769 3300025942 Bacteria 1186
990 Ga0207689_10423549 3300025942 Bacteria 1111
991 Ga0207661_10004064 3300025944 Bacteria 10221
992 Ga0207661_10005152 3300025944 Bacteria 9184
993 Ga0207661_10009530 3300025944 Bacteria 6971
994 Ga0207661_10012348 3300025944 Bacteria 6206
995 Ga0207661_10014985 3300025944 Bacteria 5692
996 Ga0207661_10083693 3300025944 Bacteria 2641
997 Ga0207661_10106492 3300025944 Unclassified 2364
998 Ga0207661_10199373 3300025944 Bacteria 1759
999 Ga0207661_10213934 3300025944 Bacteria 1700
1000 Ga0207661_10443084 3300025944 Unclassified 1182
1001 Ga0207661_10847963 3300025944 Bacteria 841
1002 Ga0207679_10000091 3300025945 Bacteria 78725
1003 Ga0207679_10088357 3300025945 Unclassified 2389
1004 Ga0207679_10143727 3300025945 Bacteria 1932
1005 Ga0207679_10145500 3300025945 Bacteria 1921
1006 Ga0207679_10154060 3300025945 Bacteria 1874
1007 Ga0207667_10000180 3300025949 Bacteria 92094
1008 Ga0207667_10007224 3300025949 Bacteria 13403
1009 Ga0207667_10019132 3300025949 Bacteria 7657
1010 Ga0207667_10023030 3300025949 Bacteria 6865
1011 Ga0207667_10058402 3300025949 Bacteria 4046
1012 Ga0207667_10067451 3300025949 Bacteria 3727
1013 Ga0207667_10399654 3300025949 Unclassified 1399
1014 Ga0207667_10415679 3300025949 Unclassified 1369
1015 Ga0207651_10000302 3300025960 Bacteria 21253
1016 Ga0207651_10021739 3300025960 Bacteria 3907
1017 Ga0207651_10027471 3300025960 Bacteria 3574
1018 Ga0207651_10029400 3300025960 Bacteria 3481
1019 Ga0207651_10031956 3300025960 Bacteria 3373
1020 Ga0207651_10047578 3300025960 Bacteria 2893
1021 Ga0207651_10086102 3300025960 Bacteria 2282
1022 Ga0207651_10124527 3300025960 Bacteria 1961
1023 Ga0207651_10127397 3300025960 Bacteria 1942
1024 Ga0207651_10453495 3300025960 Bacteria 1101
1025 Ga0207651_10585860 3300025960 Archaea 973
1026 Ga0207651_10733788 3300025960 Bacteria 872
1027 Ga0207712_10001457 3300025961 Bacteria 16141
1028 Ga0207712_10003310 3300025961 Bacteria 10213
1029 Ga0207712_10003706 3300025961 Bacteria 9642
1030 Ga0207712_10005164 3300025961 Bacteria 8260
1031 Ga0207712_10013201 3300025961 Bacteria 5294
1032 Ga0207712_10037790 3300025961 Bacteria 3296
1033 Ga0207712_10047684 3300025961 Bacteria 2976
1034 Ga0207712_10062027 3300025961 Unclassified 2656
1035 Ga0207712_10076224 3300025961 Bacteria 2427
1036 Ga0207712_10196951 3300025961 Bacteria 1594
1037 Ga0207712_10226407 3300025961 Bacteria 1498
1038 Ga0207712_10927891 3300025961 Unclassified 770
1039 Ga0207712_11057476 3300025961 Bacteria 721
1040 Ga0207668_10000570 3300025972 Bacteria 23150
1041 Ga0207668_10047293 3300025972 Bacteria 2945
1042 Ga0207668_10049242 3300025972 Bacteria 2895
1043 Ga0207668_10054499 3300025972 Bacteria 2776
1044 Ga0207668_10077133 3300025972 Bacteria 2401
1045 Ga0207668_10183382 3300025972 Bacteria 1653
1046 Ga0207668_10287486 3300025972 Bacteria 1351
1047 Ga0207668_10359318 3300025972 Bacteria 1220
1048 Ga0207640_10019688 3300025981 Bacteria 3992
1049 Ga0207640_10023926 3300025981 Bacteria 3678
1050 Ga0207640_10037553 3300025981 Bacteria 3048
1051 Ga0207640_10041598 3300025981 Bacteria 2924
1052 Ga0207640_10133836 3300025981 Bacteria 1796
1053 Ga0207640_10452346 3300025981 Bacteria 1059
1054 Ga0207640_10979069 3300025981 Unclassified 743
1055 Ga0207658_10000059 3300025986 Bacteria 121530
1056 Ga0207658_10030114 3300025986 Bacteria 3840
1057 Ga0207658_10043150 3300025986 Bacteria 3277
1058 Ga0207658_10051498 3300025986 Unclassified 3035
1059 Ga0207658_10119616 3300025986 Bacteria 2097
1060 Ga0207658_10125874 3300025986 Bacteria 2051
1061 Ga0207658_10206271 3300025986 Bacteria 1644
1062 Ga0207658_10237458 3300025986 Bacteria 1542
1063 Ga0207677_10000288 3300026023 Bacteria 37751
1064 Ga0207677_10031308 3300026023 Bacteria 3407
1065 Ga0207677_10039243 3300026023 Bacteria 3112
1066 Ga0207677_10039603 3300026023 Bacteria 3101
1067 Ga0207677_10089938 3300026023 Bacteria 2230
1068 Ga0207677_10145146 3300026023 Bacteria 1823
1069 Ga0207677_10260411 3300026023 Bacteria 1413
1070 Ga0207677_10294770 3300026023 Unclassified 1338
1071 Ga0207677_10454609 3300026023 Bacteria 1098
1072 Ga0207677_10705594 3300026023 Unclassified 896
1073 Ga0207677_11089309 3300026023 Bacteria 728
1074 Ga0207703_10002835 3300026035 Bacteria 14789
1075 Ga0207703_10043008 3300026035 Bacteria 3624
1076 Ga0207703_10075085 3300026035 Bacteria 2800
1077 Ga0207703_10161076 3300026035 Bacteria 1965
1078 Ga0207703_10181071 3300026035 Unclassified 1860
1079 Ga0207703_10241295 3300026035 Bacteria 1625
1080 Ga0207703_10462785 3300026035 Bacteria 1186
1081 Ga0207703_10789711 3300026035 Bacteria 906
1082 Ga0207639_10001397 3300026041 Bacteria 16299
1083 Ga0207639_10003957 3300026041 Bacteria 9997
1084 Ga0207639_10008375 3300026041 Bacteria 7088
1085 Ga0207639_10044905 3300026041 Bacteria 3325
1086 Ga0207639_10104998 3300026041 Bacteria 2291
1087 Ga0207639_10235394 3300026041 Bacteria 1590
1088 Ga0207639_10283216 3300026041 Bacteria 1458
1089 Ga0207639_10334759 3300026041 Unclassified 1348
1090 Ga0207639_10336797 3300026041 Unclassified 1344
1091 Ga0207639_10392718 3300026041 Unclassified 1248
1092 Ga0207639_10461414 3300026041 Bacteria 1155
1093 Ga0207678_10025516 3300026067 Bacteria 5159
1094 Ga0207678_10194329 3300026067 Unclassified 1734
1095 Ga0207678_10450997 3300026067 Unclassified 1118
1096 Ga0207678_10743373 3300026067 Unclassified 865
1097 Ga0207708_10095331 3300026075 Bacteria 2298
1098 Ga0207708_10280527 3300026075 Bacteria 1350
1099 Ga0207702_10007625 3300026078 Bacteria 9210
1100 Ga0207702_10069228 3300026078 Bacteria 3033
1101 Ga0207702_10159464 3300026078 Bacteria 2059
1102 Ga0207641_10000132 3300026088 Bacteria 109247
1103 Ga0207641_10002402 3300026088 Bacteria 17295
1104 Ga0207641_10002685 3300026088 Bacteria 16230
1105 Ga0207641_10009890 3300026088 Bacteria 7853
1106 Ga0207641_10038936 3300026088 Bacteria 3975
1107 Ga0207641_10189474 3300026088 Bacteria 1889
1108 Ga0207641_10912886 3300026088 Bacteria 872
1109 Ga0207648_10001340 3300026089 Bacteria 27318
1110 Ga0207648_10002340 3300026089 Bacteria 20450
1111 Ga0207648_10017639 3300026089 Bacteria 6484
1112 Ga0207648_10021653 3300026089 Bacteria 5775
1113 Ga0207648_10032519 3300026089 Bacteria 4605
1114 Ga0207648_10047813 3300026089 Bacteria 3748
1115 Ga0207648_10063699 3300026089 Bacteria 3213
1116 Ga0207648_10096399 3300026089 Bacteria 2588
1117 Ga0207648_10101968 3300026089 Bacteria 2515
1118 Ga0207648_10137067 3300026089 Bacteria 2156
1119 Ga0207648_10148351 3300026089 Bacteria 2069
1120 Ga0207648_10167591 3300026089 Bacteria 1941
1121 Ga0207648_10181507 3300026089 Unclassified 1863
1122 Ga0207648_10291878 3300026089 Bacteria 1460
1123 Ga0207648_10325433 3300026089 Bacteria 1382
1124 Ga0207648_10374179 3300026089 Bacteria 1287
1125 Ga0207648_10450049 3300026089 Bacteria 1172
1126 Ga0207648_10512712 3300026089 Bacteria 1098
1127 Ga0207648_10636568 3300026089 Bacteria 985
1128 Ga0207648_10654388 3300026089 Bacteria 971
1129 Ga0207648_10793730 3300026089 Unclassified 881
1130 Ga0207676_10011568 3300026095 Bacteria 6311
1131 Ga0207676_10012403 3300026095 Bacteria 6106
1132 Ga0207676_10016753 3300026095 Bacteria 5305
1133 Ga0207676_10026923 3300026095 Bacteria 4277
1134 Ga0207676_10077302 3300026095 Bacteria 2692
1135 Ga0207676_10173598 3300026095 Bacteria 1880
1136 Ga0207676_10230216 3300026095 Bacteria 1656
1137 Ga0207676_10476812 3300026095 Bacteria 1181
1138 Ga0207676_10727523 3300026095 Bacteria 963
1139 Ga0207676_11127160 3300026095 Bacteria 776
1140 Ga0207674_10006694 3300026116 Bacteria 13532
1141 Ga0207674_10006896 3300026116 Bacteria 13314
1142 Ga0207674_10023357 3300026116 Bacteria 6626
1143 Ga0207674_10052795 3300026116 Bacteria 4145
1144 Ga0207674_10053953 3300026116 Bacteria 4094
1145 Ga0207674_10054039 3300026116 Bacteria 4091
1146 Ga0207674_10057709 3300026116 Unclassified 3935
1147 Ga0207674_10067997 3300026116 Bacteria 3586
1148 Ga0207674_10093966 3300026116 Bacteria 2986
1149 Ga0207674_10127622 3300026116 Bacteria 2508
1150 Ga0207674_10274640 3300026116 Bacteria 1633
1151 Ga0207675_100000085 3300026118 Bacteria 73716
1152 Ga0207675_100016346 3300026118 Bacteria 6927
1153 Ga0207675_100035584 3300026118 Bacteria 4645
1154 Ga0207675_100088384 3300026118 Bacteria 2910
1155 Ga0207675_100174211 3300026118 Bacteria 2058
1156 Ga0207675_100352493 3300026118 Bacteria 1442
1157 Ga0207675_100377379 3300026118 Bacteria 1394
1158 Ga0207675_100383432 3300026118 Bacteria 1383
1159 Ga0207675_100409154 3300026118 Unclassified 1338
1160 Ga0207675_100435228 3300026118 Unclassified 1297
1161 Ga0207675_100524824 3300026118 Bacteria 1181
1162 Ga0207675_100609104 3300026118 Unclassified 1096
1163 Ga0207683_10005340 3300026121 Bacteria 11024
1164 Ga0207683_10016473 3300026121 Bacteria 6291
1165 Ga0207683_10041323 3300026121 Bacteria 4026
1166 Ga0207683_10091804 3300026121 Bacteria 2705
1167 Ga0207683_10279253 3300026121 Unclassified 1526
1168 Ga0207683_10324796 3300026121 Bacteria 1410
1169 Ga0207683_10339332 3300026121 Bacteria 1378
1170 Ga0207683_10441386 3300026121 Unclassified 1199
1171 Ga0207683_10495244 3300026121 Bacteria 1128
1172 Ga0207683_10617006 3300026121 Unclassified 1004
1173 Ga0207698_10000340 3300026142 Bacteria 27673
1174 Ga0207698_10011519 3300026142 Bacteria 5738
1175 Ga0207698_10029547 3300026142 Bacteria 3928
1176 Ga0207698_10035407 3300026142 Bacteria 3652
1177 Ga0207698_10238513 3300026142 Bacteria 1655
1178 Ga0207698_10333680 3300026142 Bacteria 1425
1179 Ga0207698_10372677 3300026142 Bacteria 1356
1180 Ga0207698_10449356 3300026142 Bacteria 1244
1181 Ga0207698_10569123 3300026142 Bacteria 1113
1182 Ga0207698_10683766 3300026142 Bacteria 1019
1183 Ga0207698_10800923 3300026142 Unclassified 944
1184 Ga0207698_11257536 3300026142 Bacteria 755
1185 Ga0209969_1015996 3300027360 Bacteria 1098
1186 Ga0209995_1002115 3300027471 Bacteria 3120
1187 Ga0209995_1042542 3300027471 Bacteria 768
1188 Ga0209968_1026917 3300027526 Bacteria 951
1189 Ga0209974_10011818 3300027876 Bacteria 2927
1190 Ga0209974_10117311 3300027876 Bacteria 941
1191 Ga0209974_10131091 3300027876 Unclassified 894
1192 Ga0207428_10194312 3300027907 Bacteria 1529
1193 Ga0207428_10250191 3300027907 Bacteria 1322
1194 Ga0268266_10000068 3300028379 Bacteria 241100
1195 Ga0268266_10005417 3300028379 Bacteria 11903
1196 Ga0268266_10050525 3300028379 Bacteria 3568
1197 Ga0268266_10144908 3300028379 Unclassified 2134
1198 Ga0268266_10213214 3300028379 Unclassified 1772
1199 Ga0268266_10891988 3300028379 Bacteria 860
1200 Ga0268265_10038653 3300028380 Bacteria 3511
1201 Ga0268265_10190141 3300028380 Unclassified 1772
1202 Ga0268265_10316702 3300028380 Unclassified 1411
1203 Ga0268265_10535943 3300028380 Bacteria 1109
1204 Ga0268264_10000559 3300028381 Bacteria 45910
1205 Ga0268264_10002198 3300028381 Bacteria 17332
1206 Ga0268264_10004188 3300028381 Bacteria 12320
1207 Ga0268264_10028330 3300028381 Bacteria 4581
1208 Ga0268264_10060420 3300028381 Unclassified 3176
1209 Ga0268264_10061200 3300028381 Bacteria 3158
1210 Ga0268264_10062135 3300028381 Bacteria 3135
1211 Ga0268264_10180253 3300028381 Bacteria 1918
1212 Ga0268264_10287183 3300028381 Bacteria 1543
1213 Ga0268264_10575443 3300028381 Bacteria 1107
1214 Ga0307517_10000501 3300028786 Bacteria 67241
1215 Ga0307515_10000001 3300028794 Bacteria 4259510
1216 Ga0307515_10000437 3300028794 Bacteria 100047
1217 Ga0265324_10025756 3300029957 Bacteria 2084
1218 Ga0307511_10002747 3300030521 Bacteria 18300
1219 Ga0316177_1202552 3300030731 Unclassified 1171
1220 Ga0265767_103702 3300030836 Bacteria 871
1221 Ga0265327_10000059 3300031251 Bacteria 236935
1222 Ga0265327_10185022 3300031251 Bacteria 951
1223 Ga0307513_10053858 3300031456 Bacteria 4320
1224 Ga0307509_10046582 3300031507 Bacteria 4668
1225 Ga0307408_100762134 3300031548 Bacteria 875
1226 Ga0307516_10001546 3300031730 Bacteria 31635
1227 Ga0307413_10599266 3300031824 Bacteria 901
1228 Ga0307410_10243132 3300031852 Unclassified 1396
1229 Ga0307406_10648888 3300031901 Bacteria 876
1230 Ga0307409_101334628 3300031995 Bacteria 743
1231 Ga0307414_10168798 3300032004 Bacteria 1747
1232 Ga0307414_10187048 3300032004 Bacteria 1672
1233 Ga0307414_10578930 3300032004 Unclassified 1004
1234 Ga0307414_10736435 3300032004 Bacteria 895
1235 Ga0307414_10921577 3300032004 Bacteria 802
1236 Ga0307415_100405167 3300032126 Bacteria 1166
1237 Ga0307415_100414546 3300032126 Bacteria 1154
1238 Ga0307510_10001895 3300033180 Bacteria 23475
1239 Ga0373960_0040689 3300035121 Bacteria 1343
1240 Ga0373955_0016181 3300035172 Bacteria 3667
1241 Ga0373924_0098964 3300035410 Unclassified 1253
1242 Ga0373935_0287424 3300035692 Bacteria 1159
1243 Ga0373935_0553513 3300035692 Bacteria 839
1244 Ga0373933_0011503 3300035724 Bacteria 4882
1245 Ga0373937_0028695 3300036401 Bacteria 5036
1246 Ga0373937_0245697 3300036401 Unclassified 1687
1247 Ga0373937_1280170 3300036401 Unclassified 681
1248 Ga0265778_002398 3300036457 Bacteria 1805
1249 Ga0395899_0001724 3300037312 Bacteria 18183
1250 Ga0395899_0011321 3300037312 Bacteria 6832
1251 Ga0395899_0064523 3300037312 Bacteria 2692
1252 Ga0395900_0002996 3300037418 Bacteria 18376
1253 Ga0395900_0010177 3300037418 Bacteria 9620
1254 Ga0395900_0013929 3300037418 Bacteria 8206
1255 Ga0395900_0079413 3300037418 Bacteria 3371
1256 Ga0395900_0088855 3300037418 Bacteria 3176
1257 Ga0395900_0104794 3300037418 Bacteria 2905
1258 Ga0395900_0174959 3300037418 Bacteria 2183
1259 Ga0395900_0193331 3300037418 Bacteria 2063
1260 Ga0395900_0252058 3300037418 Unclassified 1766
1261 Ga0395900_0795956 3300037418 Bacteria 873
1262 Ga0395900_0967666 3300037418 Bacteria 772
1263 Ga0395898_0000738 3300037466 Bacteria 57155
1264 Ga0395898_0024451 3300037466 Bacteria 6093
1265 Ga0395898_0239270 3300037466 Bacteria 1731
1266 Ga0395898_0988702 3300037466 Bacteria 777
1267 Ga0395905_0077764 3300037471 Bacteria 3109
1268 Ga0395905_0086937 3300037471 Bacteria 2931
1269 Ga0395901_0001002 3300038443 Bacteria 30541
1270 Ga0395901_0011343 3300038443 Bacteria 9030
1271 Ga0395901_0189765 3300038443 Bacteria 2155
1272 Ga0395901_0963273 3300038443 Bacteria 831
1273 Ga0395901_1108215 3300038443 Bacteria 762
1274 Ga0436365_0637816 3300039437 Bacteria 1166
1275 Ga0436365_0695509 3300039437 Bacteria 9211
1276 Ga0436365_1500359 3300039437 Bacteria 7335
1277 Ga0436365_1764755 3300039437 Bacteria 858
1278 Ga0436365_1811077 3300039437 Unclassified 819
1279 Ga0436363_0986890 3300039450 Bacteria 875
1280 Ga0436363_1310381 3300039450 Bacteria 1219
1281 Ga0439436_0000892 3300041404 Bacteria 8160
1282 Ga0439439_0105642 3300041406 Bacteria 777
1283 Ga0439453_0003875 3300041408 Unclassified 2188
1284 Ga0439461_0005814 3300041410 Unclassified 2123
1285 Ga0439465_0113123 3300041413 Unclassified 946
1286 Ga0451792_03301 3300041445 Bacteria 632
1287 Ga0451793_0024139 3300041452 Unclassified 697
1288 Ga0451802_1945429 3300041460 Bacteria 807
1289 Ga0451804_0553358 3300041463 Bacteria 1059
1290 Ga0451807_1598288 3300041486 Bacteria 1138
1291 Ga0451837_1580665 3300041494 Bacteria 1132
1292 Ga0451841_1153364 3300041498 Bacteria 920
1293 Ga0451843_0874254 3300041509 Bacteria 795
1294 Ga0451853_2288231 3300041512 Bacteria 799
1295 Ga0439431_0028317 3300041997 Bacteria 1380
1296 Ga0439431_0105498 3300041997 Bacteria 777
1297 Ga0439433_0061867 3300041999 Bacteria 893
1298 Ga0439441_034466 3300042001 Bacteria 994
1299 Ga0439443_030538 3300042003 Unclassified 887
1300 Ga0439449_0018302 3300042007 Bacteria 2629
1301 Ga0439449_0187696 3300042007 Bacteria 773
1302 Ga0439454_010502 3300042011 Bacteria 1221
1303 Ga0439457_000874 3300042014 Bacteria 9102
1304 Ga0439457_033165 3300042014 Bacteria 1146
1305 Ga0439462_0005921 3300042015 Bacteria 3026
1306 Ga0450923_001203 3300042125 Unclassified 3327
1307 Ga0450897_005671 3300042128 Unclassified 1091
1308 Ga0450894_003253 3300042131 Unclassified 2132
1309 Ga0450896_026535 3300042133 Bacteria 864
1310 Ga0450898_013879 3300042134 Bacteria 1348
1311 Ga0450899_004880 3300042135 Unclassified 1437
1312 Ga0439446_0021394 3300042156 Bacteria 1828
1313 Ga0439446_0063321 3300042156 Unclassified 1121
1314 Ga0439446_0072433 3300042156 Bacteria 1056
1315 Ga0439458_0027618 3300042157 Bacteria 1340
1316 Ga0439434_0005581 3300042435 Bacteria 3676
1317 Ga0439435_0047167 3300042436 Bacteria 1223
1318 Ga0439435_0105003 3300042436 Unclassified 872
1319 Ga0451577_0195614 3300042876 Bacteria 1825
1320 Ga0451577_0399127 3300042876 Bacteria 1248
1321 Ga0466969_0004965 3300044656 Bacteria 7083
1322 Ga0466972_0000026 3300044658 Bacteria 184739
1323 Ga0466972_0000365 3300044658 Bacteria 24444
1324 Ga0466972_0015799 3300044658 Bacteria 3774
1325 Ga0453683_0068536 3300044673 Bacteria 2218
1326 Ga0453683_0201612 3300044673 Bacteria 1263
1327 Ga0466965_0083432 3300044683 Bacteria 1618
1328 Ga0466966_0000038 3300044684 Bacteria 97255
1329 Ga0466964_0255636 3300044706 Unclassified 866
1330 Ga0453684_0024262 3300044712 Bacteria 8874
1331 Ga0453684_0092126 3300044712 Bacteria 3738
1332 Ga0453684_0093030 3300044712 Bacteria 3714
1333 Ga0453684_0458040 3300044712 Bacteria 1419
1334 Ga0453684_0500667 3300044712 Bacteria 1345
1335 Ga0466971_0254890 3300044719 Bacteria 836
1336 Ga0466970_0000091 3300044765 Bacteria 38259
1337 Ga0466970_0036872 3300044765 Bacteria 2591
1338 Ga0466957_0000329 3300044842 Bacteria 23093
1339 Ga0466957_0002553 3300044842 Bacteria 9798
1340 Ga0466960_0097432 3300044901 Bacteria 1509
1341 Ga0466960_0140487 3300044901 Bacteria 1282
1342 Ga0466959_0000289 3300045049 Bacteria 30468
1343 Ga0466959_0056854 3300045049 Unclassified 2854
1344 Ga0451576_0737654 3300045051 Bacteria 1035
1345 Ga0466967_0475632 3300045976 Unclassified 1223
1346 Ga0495629_0160073 3300046459 Bacteria 1564
1347 Ga0495638_0030399 3300046460 Bacteria 3478
1348 Ga0495638_0057933 3300046460 Bacteria 2402
1349 Ga0495653_0351859 3300046463 Bacteria 947
1350 Ga0495653_0355172 3300046463 Bacteria 942
1351 Ga0495650_0040895 3300046471 Bacteria 1986
1352 Ga0495580_0051318 3300046472 Bacteria 2916
1353 Ga0495582_0035634 3300046473 Bacteria 2737
1354 Ga0495639_0041808 3300046475 Bacteria 2066
1355 Ga0495594_0177485 3300046499 Bacteria 1212
1356 Ga0495594_0353330 3300046499 Bacteria 837
1357 Ga0495606_0042507 3300046507 Unclassified 3038
1358 Ga0495608_0165987 3300046511 Bacteria 1402
1359 Ga0495628_0066563 3300046516 Bacteria 2816
1360 Ga0495630_0014167 3300046517 Bacteria 5804
1361 Ga0495632_0141945 3300046519 Bacteria 1114
1362 Ga0495643_0007703 3300046522 Bacteria 6901
1363 Ga0495648_0004618 3300046524 Bacteria 11716
1364 Ga0495648_0236387 3300046524 Bacteria 891
1365 Ga0495652_0310913 3300046529 Bacteria 1142
1366 Ga0495587_0161482 3300046536 Bacteria 1275
1367 Ga0495587_0192947 3300046536 Unclassified 1153
1368 Ga0495598_0048028 3300046537 Bacteria 1275
1369 Ga0495621_0163719 3300046539 Unclassified 881
1370 Ga0495645_0159430 3300046543 Unclassified 1561
1371 Ga0495622_0284599 3300046557 Bacteria 722
1372 Ga0495633_0139253 3300046558 Bacteria 1122
1373 Ga0495633_0201459 3300046558 Bacteria 914
1374 Ga0495668_0000106 3300046616 Bacteria 133476
1375 Ga0495668_0004320 3300046616 Bacteria 10158
1376 Ga0495611_0000280 3300046648 Bacteria 34841
1377 Ga0495625_0525782 3300046660 Bacteria 720
1378 Ga0495635_0057667 3300046663 Bacteria 2672
1379 Ga0495635_0673985 3300046663 Unclassified 672
1380 Ga0495588_0234565 3300046674 Bacteria 968
1381 Ga0495657_0423884 3300046675 Unclassified 781
1382 Ga0495599_0167119 3300046678 Bacteria 1358
1383 Ga0495623_0092470 3300046679 Bacteria 1854
1384 Ga0495646_0229971 3300046680 Bacteria 1000
1385 Ga0495658_0053174 3300046683 Bacteria 2299
1386 Ga0495613_0155760 3300046689 Unclassified 1628
1387 Ga0495613_0223458 3300046689 Bacteria 1321
1388 Ga0495670_0306587 3300046691 Unclassified 851
1389 Ga0495649_0208519 3300046694 Bacteria 1013
1390 Ga0495604_0122686 3300047317 Bacteria 1879
1391 Ga0495604_0259213 3300047317 Bacteria 1182
1392 Ga0495674_0617899 3300047319 Bacteria 857
1393 Ga0495672_0013590 3300047320 Bacteria 5610
1394 Ga0495672_0017207 3300047320 Bacteria 4840
1395 Ga0495672_0017258 3300047320 Bacteria 4832
1396 Ga0495676_0250416 3300047321 Bacteria 1209
1397 Ga0495687_000058 3300047443 Bacteria 185830
1398 Ga0495684_0051941 3300047471 Bacteria 3128
1399 Ga0495686_0000005 3300047472 Bacteria 827143
1400 Ga0496104_0219336 3300048907 Unclassified 1814
1401 Ga0496104_0493433 3300048907 Unclassified 1136
1402 Ga0496104_0515565 3300048907 Unclassified 1107
1403 Ga0496105_0101590 3300048908 Bacteria 2375
1404 Ga0496105_0327536 3300048908 Bacteria 1227
1405 Ga0496105_0497625 3300048908 Unclassified 957
1406 Ga0496106_0198575 3300048909 Bacteria 1596
1407 Ga0496106_0258644 3300048909 Bacteria 1393
1408 Ga0496109_0068145 3300048912 Unclassified 3262
1409 Ga0496109_0387865 3300048912 Bacteria 1320
1410 Ga0496110_0128391 3300048913 Unclassified 2288
1411 Ga0496110_0322478 3300048913 Bacteria 1407
1412 Ga0496111_0220021 3300048914 Bacteria 1411
1413 Ga0496112_0521446 3300048915 Bacteria 1123
1414 Ga0496114_0417155 3300048917 Bacteria 1189
1415 Ga0496115_0792252 3300048918 Bacteria 738
1416 Ga0501297_011970 3300049520 Bacteria 1003
1417 Ga0501298_023999 3300049521 Bacteria 1159
1418 Ga0501300_005665 3300049523 Bacteria 1840
1419 Ga0501315_051339 3300049531 Bacteria 648
1420 Ga0501031_0010199 3300049568 Bacteria 6119
1421 Ga0501031_0435858 3300049568 Unclassified 847
1422 Ga0501032_0005001 3300049569 Bacteria 9914
1423 Ga0501032_0012070 3300049569 Bacteria 6186
1424 Ga0501032_0035851 3300049569 Bacteria 3389
1425 Ga0501033_0039371 3300049570 Bacteria 3531
1426 Ga0501033_0247549 3300049570 Unclassified 1264
1427 Ga0501033_0531243 3300049570 Bacteria 812
1428 Ga0501034_0000002 3300049571 Bacteria 565510
1429 Ga0501034_0005058 3300049571 Bacteria 14487
1430 Ga0501034_0012357 3300049571 Bacteria 8821
1431 Ga0501034_0025430 3300049571 Bacteria 6027
1432 Ga0501034_0044290 3300049571 Bacteria 4501
1433 Ga0501034_0100600 3300049571 Bacteria 2885
1434 Ga0501036_0004608 3300049572 Bacteria 11136
1435 Ga0501036_0010166 3300049572 Bacteria 7755
1436 Ga0501036_0036429 3300049572 Bacteria 4164
1437 Ga0501036_0521371 3300049572 Bacteria 988
1438 Ga0501037_0015291 3300049573 Bacteria 5646
1439 Ga0501037_0021115 3300049573 Bacteria 4810
1440 Ga0501037_0030076 3300049573 Bacteria 4013
1441 Ga0501037_0148427 3300049573 Bacteria 1677
1442 Ga0501037_0235448 3300049573 Bacteria 1285
1443 Ga0501038_0004730 3300049574 Bacteria 12664
1444 Ga0501038_0014791 3300049574 Bacteria 7107
1445 Ga0501038_0062052 3300049574 Bacteria 3195
1446 Ga0501038_0447772 3300049574 Bacteria 993
1447 Ga0501039_0018535 3300049575 Bacteria 5343
1448 Ga0501039_1082445 3300049575 Unclassified 622
1449 Ga0501043_0003152 3300049579 Bacteria 13648
1450 Ga0501043_0003493 3300049579 Bacteria 12916
1451 Ga0501043_0013836 3300049579 Bacteria 6315
1452 Ga0501043_0036027 3300049579 Bacteria 3892
1453 Ga0501043_0112220 3300049579 Bacteria 2140
1454 Ga0501043_0221979 3300049579 Bacteria 1462
1455 Ga0501046_0019891 3300049580 Bacteria 5560
1456 Ga0501046_0177888 3300049580 Bacteria 1592
1457 Ga0501046_0601062 3300049580 Bacteria 781
1458 Ga0501047_0004866 3300049581 Bacteria 12612
1459 Ga0501047_0011501 3300049581 Bacteria 8378
1460 Ga0501047_0014221 3300049581 Bacteria 7564
1461 Ga0501047_0076507 3300049581 Bacteria 3221
1462 Ga0501047_0590593 3300049581 Bacteria 933
1463 Ga0501070_0005871 3300049586 Bacteria 10467
1464 Ga0501070_0035915 3300049586 Bacteria 4139
1465 Ga0501070_0100433 3300049586 Bacteria 2394
1466 Ga0501070_0490951 3300049586 Unclassified 987
1467 Ga0501073_0013047 3300049589 Bacteria 6060
1468 Ga0501073_0185311 3300049589 Unclassified 1441
1469 Ga0501073_0332847 3300049589 Bacteria 1048
1470 Ga0501074_0004850 3300049590 Bacteria 9645
1471 Ga0501198_005559 3300049649 Bacteria 1778
1472 Ga0501198_010814 3300049649 Bacteria 1354
1473 Ga0501198_016201 3300049649 Bacteria 1151
1474 Ga0501202_002956 3300049652 Bacteria 2887
1475 Ga0501202_027736 3300049652 Bacteria 1165
1476 Ga0501202_055079 3300049652 Unclassified 888
1477 Ga0501207_009038 3300049654 Bacteria 1449
1478 Ga0501207_020556 3300049654 Bacteria 1055
1479 Ga0501207_045094 3300049654 Bacteria 775
1480 Ga0501209_037534 3300049656 Bacteria 1265
1481 Ga0501216_005462 3300049660 Bacteria 1919
1482 Ga0501216_016698 3300049660 Bacteria 1248
1483 Ga0501216_018823 3300049660 Bacteria 1192
1484 Ga0501217_027040 3300049661 Bacteria 1389
1485 Ga0501217_035343 3300049661 Bacteria 1249
1486 Ga0501222_027248 3300049662 Bacteria 777
1487 Ga0501223_007304 3300049663 Bacteria 2264
1488 Ga0501228_008552 3300049666 Bacteria 982
1489 Ga0501228_011139 3300049666 Bacteria 906
1490 Ga0501230_053803 3300049667 Bacteria 804
1491 Ga0501233_015711 3300049668 Bacteria 1562
1492 Ga0501233_114911 3300049668 Unclassified 723
1493 Ga0501235_015160 3300049669 Bacteria 1700
1494 Ga0501235_020699 3300049669 Bacteria 1461
1495 Ga0501239_006215 3300049672 Bacteria 1223
1496 Ga0501240_004913 3300049673 Bacteria 1575
1497 Ga0501242_000503 3300049674 Bacteria 3453
1498 Ga0501243_017373 3300049675 Bacteria 1167
1499 Ga0501247_004012 3300049677 Bacteria 1597
1500 Ga0501248_000767 3300049678 Bacteria 1850
1501 Ga0501249_059805 3300049679 Bacteria 882
1502 Ga0501252_004982 3300049682 Bacteria 1431
1503 Ga0501257_010101 3300049686 Bacteria 2137
1504 Ga0501257_011700 3300049686 Bacteria 2005
1505 Ga0501257_017886 3300049686 Bacteria 1650
1506 Ga0501257_070940 3300049686 Bacteria 890
1507 Ga0501259_000582 3300049688 Bacteria 5847
1508 Ga0501259_026903 3300049688 Bacteria 1062
1509 Ga0501259_048317 3300049688 Bacteria 857
1510 Ga0501221_029325 3300049704 Bacteria 1138
1511 Ga0501225_0001455 3300049705 Bacteria 7411
1512 Ga0501225_0008434 3300049705 Bacteria 2958
1513 Ga0501225_0144531 3300049705 Unclassified 721
1514 Ga0501234_012927 3300049707 Bacteria 1310
1515 Ga0501245_029800 3300049708 Bacteria 897
1516 Ga0501080_0055040 3300049742 Bacteria 3705
1517 Ga0501080_0106708 3300049742 Bacteria 2595
1518 Ga0501083_0007173 3300049744 Bacteria 7913
1519 Ga0501266_000390 3300049763 Bacteria 5860
1520 Ga0501266_005049 3300049763 Bacteria 1643
1521 Ga0501268_040269 3300049765 Bacteria 877
1522 Ga0501273_005325 3300049770 Bacteria 1450
1523 Ga0501274_022864 3300049771 Bacteria 661
1524 Ga0501274_024049 3300049771 Bacteria 651
1525 Ga0501279_001908 3300049775 Bacteria 2746
1526 Ga0501279_012112 3300049775 Bacteria 1172
1527 Ga0501280_023762 3300049776 Bacteria 927
1528 Ga0501283_034196 3300049779 Bacteria 862
1529 Ga0501035_0010218 3300049822 Bacteria 8711
1530 Ga0501035_0012287 3300049822 Bacteria 7915
1531 Ga0501035_0036730 3300049822 Bacteria 4439
1532 Ga0501035_0039073 3300049822 Bacteria 4296
1533 Ga0501035_0142983 3300049822 Bacteria 2079
1534 Ga0501035_0462837 3300049822 Bacteria 1048
1535 Ga0501035_0602823 3300049822 Bacteria 895
1536 Ga0501044_0001926 3300049823 Bacteria 24024
1537 Ga0501044_0007781 3300049823 Bacteria 11781
1538 Ga0501044_0012837 3300049823 Bacteria 9070
1539 Ga0501044_0014761 3300049823 Bacteria 8421
1540 Ga0501044_0036953 3300049823 Bacteria 5106
1541 Ga0501044_0064958 3300049823 Unclassified 3723
1542 Ga0501044_0083210 3300049823 Bacteria 3237
1543 Ga0501044_0092179 3300049823 Bacteria 3056
1544 Ga0501044_0166040 3300049823 Bacteria 2182
1545 Ga0501212_011499 3300049851 Bacteria 1276
1546 Ga0501212_040242 3300049851 Bacteria 771
1547 Ga0501284_00030 3300050005 Bacteria 71858
1548 nmdc:mga03683_128083_c1 3300050489 Bacteria 1134
1549 nmdc:mga0k408_103984_c1 3300050493 Bacteria 1676
1550 nmdc:mga0k408_30751_c1 3300050493 Bacteria 3063
1551 nmdc:mga0k408_32463_c1 3300050493 Bacteria 2983
1552 nmdc:mga04h51_250845_c1 3300050495 Bacteria 709
1553 nmdc:mga07m45_327051_c1 3300050496 Bacteria 891
1554 nmdc:mga05p37_26606_c1 3300050507 Bacteria 7035
1555 nmdc:mga05p37_506593_c1 3300050507 Unclassified 1384
1556 nmdc:mga09592_44276_c1 3300050508 Bacteria 3746
1557 nmdc:mga09592_551676_c1 3300050508 Bacteria 990
1558 nmdc:mga09592_73063_c1 3300050508 Unclassified 2914
1559 nmdc:mga09592_998_c1 3300050508 Bacteria 22420
1560 nmdc:mga0qj67_15168_c1 3300050509 Bacteria 5831
1561 nmdc:mga0qj67_811678_c1 3300050509 Bacteria 740
1562 nmdc:mga0qj67_83675_c1 3300050509 Unclassified 2558
1563 nmdc:mga06r32_237412_c1 3300050510 Unclassified 1811
1564 nmdc:mga06r32_7056_c1 3300050510 Bacteria 10105
1565 nmdc:mga08y16_1010584_c1 3300050511 Bacteria 811
1566 nmdc:mga08y16_165575_c1 3300050511 Bacteria 2297
1567 nmdc:mga08y16_21376_c1 3300050511 Bacteria 6834
1568 nmdc:mga08y16_671903_c1 3300050511 Bacteria 1038
1569 Ga0500635_0143978 3300053080 Bacteria 906
1570 Ga0495619_0066698 3300053085 Bacteria 2402
1571 Ga0495619_0102830 3300053085 Bacteria 1946
1572 Ga0500578_0001471 3300053086 Bacteria 23470
1573 Ga0500646_0011076 3300053090 Bacteria 2316
1574 Ga0500646_0022380 3300053090 Bacteria 1690
1575 Ga0500646_0056428 3300053090 Unclassified 1145
1576 Ga0500583_0000111 3300053092 Bacteria 40256
1577 Ga0500583_0003656 3300053092 Bacteria 4886
1578 Ga0500583_0031771 3300053092 Bacteria 2324
1579 Ga0500583_0179605 3300053092 Bacteria 1054
1580 Ga0500583_0206068 3300053092 Bacteria 977
1581 Ga0500651_0225189 3300053093 Bacteria 1098
1582 Ga0500566_0187964 3300053094 Bacteria 1054
1583 Ga0500641_0006434 3300053096 Bacteria 4171
1584 Ga0500555_025878 3300053103 Bacteria 1678
1585 Ga0500594_0083141 3300053118 Bacteria 961
1586 Ga0500628_011183 3300053129 Bacteria 1625
1587 Ga0500642_0001723 3300053130 Bacteria 6309
1588 Ga0500642_0217251 3300053130 Bacteria 886
1589 Ga0500652_022859 3300053131 Bacteria 2371
1590 Ga0500655_013077 3300053133 Unclassified 1513
1591 Ga0500568_0001592 3300053139 Bacteria 14355
1592 Ga0500588_0003858 3300053146 Bacteria 3204
1593 Ga0500588_0006116 3300053146 Bacteria 2708
1594 Ga0500588_0186736 3300053146 Bacteria 764
1595 Ga0500589_046782 3300053147 Bacteria 2014
1596 Ga0500603_039444 3300053150 Bacteria 1254
1597 Ga0500604_0009264 3300053151 Bacteria 2623
1598 Ga0500616_0003551 3300053153 Bacteria 11819
1599 Ga0500622_0007310 3300053156 Bacteria 6289
1600 Ga0500636_0010388 3300053177 Bacteria 5432
1601 Ga0500637_0051659 3300053178 Bacteria 2343
1602 Ga0500637_0221686 3300053178 Bacteria 1069
1603 Ga0500611_000039 3300053727 Bacteria 68825
1604 Ga0500645_032453 3300053730 Bacteria 1566
1605 Ga0500587_006027 3300053739 Bacteria 1620
1606 Ga0501084_0481208 3300054114 Unclassified 1049
1607 Ga0587130_003217 3300059631 Bacteria 1366
1608 Ga0466962_0036487 3300061719 Bacteria 2353
1609 Ga0466962_0179018 3300061719 Bacteria 1034

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025933 Ga0207706_10656086 Ga0207706_106560862 188
2 3300025960 Ga0207651_10453495 Ga0207651_104534951 188
3 3300005364 Ga0070673_100934709 Ga0070673_1009347091 189
4 3300013102 Ga0157371_10125041 Ga0157371_101250412 189
5 3300013307 Ga0157372_10156639 Ga0157372_101566392 189
6 3300025931 Ga0207644_11010300 Ga0207644_110103001 189
7 3300032126 Ga0307415_100405167 Ga0307415_1004051672 189
8 3300004800 Ga0058861_10057842 Ga0058861_100578421 190
9 3300005290 Ga0065712_10112883 Ga0065712_101128832 190
10 3300005327 Ga0070658_10021161 Ga0070658_100211612 190
11 3300005327 Ga0070658_10116595 Ga0070658_101165952 190
12 3300005327 Ga0070658_10487656 Ga0070658_104876561 190
13 3300005327 Ga0070658_10526686 Ga0070658_105266862 190
14 3300005329 Ga0070683_100004078 Ga0070683_1000040782 190
15 3300005329 Ga0070683_100300823 Ga0070683_1003008232 190
16 3300005331 Ga0070670_100020307 Ga0070670_1000203071 190
17 3300005336 Ga0070680_100033585 Ga0070680_1000335852 190
18 3300005338 Ga0068868_100102720 Ga0068868_1001027202 190
19 3300005339 Ga0070660_100005843 Ga0070660_1000058436 190
20 3300005344 Ga0070661_100027276 Ga0070661_1000272762 190
21 3300005345 Ga0070692_10358561 Ga0070692_103585611 190
22 3300005354 Ga0070675_100576184 Ga0070675_1005761842 190
23 3300005355 Ga0070671_100036282 Ga0070671_1000362822 190
24 3300005355 Ga0070671_100103149 Ga0070671_1001031492 190
25 3300005364 Ga0070673_100420652 Ga0070673_1004206522 190
26 3300005366 Ga0070659_100008941 Ga0070659_1000089414 190
27 3300005458 Ga0070681_10041664 Ga0070681_100416643 190
28 3300005530 Ga0070679_100027505 Ga0070679_1000275054 190
29 3300005530 Ga0070679_100587234 Ga0070679_1005872341 190
30 3300005535 Ga0070684_100009974 Ga0070684_1000099741 190
31 3300005539 Ga0068853_100189312 Ga0068853_1001893122 190
32 3300005547 Ga0070693_100345161 Ga0070693_1003451612 190
33 3300005563 Ga0068855_100064439 Ga0068855_1000644392 190
34 3300005563 Ga0068855_100889888 Ga0068855_1008898881 190
35 3300005577 Ga0068857_100093247 Ga0068857_1000932472 190
36 3300005616 Ga0068852_100045468 Ga0068852_1000454683 190
37 3300005618 Ga0068864_100495963 Ga0068864_1004959631 190
38 3300005834 Ga0068851_10036230 Ga0068851_100362303 190
39 3300005834 Ga0068851_10314097 Ga0068851_103140971 190
40 3300009545 Ga0105237_10044567 Ga0105237_100445672 190
41 3300013100 Ga0157373_10010511 Ga0157373_100105114 190
42 3300013102 Ga0157371_10001718 Ga0157371_1000171814 190
43 3300013102 Ga0157371_10007563 Ga0157371_100075634 190
44 3300013102 Ga0157371_10103590 Ga0157371_101035902 190
45 3300013102 Ga0157371_10277432 Ga0157371_102774322 190
46 3300013102 Ga0157371_10433626 Ga0157371_104336261 190
47 3300013104 Ga0157370_10054974 Ga0157370_100549742 190
48 3300013104 Ga0157370_10238099 Ga0157370_102380992 190
49 3300013104 Ga0157370_10350574 Ga0157370_103505742 190
50 3300013104 Ga0157370_10416136 Ga0157370_104161361 190
51 3300013105 Ga0157369_10008510 Ga0157369_100085106 190
52 3300013296 Ga0157374_10025127 Ga0157374_100251272 190
53 3300013307 Ga0157372_10018824 Ga0157372_100188246 190
54 3300013307 Ga0157372_10049345 Ga0157372_100493454 190
55 3300013307 Ga0157372_10226634 Ga0157372_102266342 190
56 3300013307 Ga0157372_10711596 Ga0157372_107115961 190
57 3300013307 Ga0157372_11287743 Ga0157372_112877431 190
58 3300014325 Ga0163163_10041585 Ga0163163_100415854 190
59 3300014325 Ga0163163_11101444 Ga0163163_111014441 190
60 3300014745 Ga0157377_10057007 Ga0157377_100570072 190
61 3300025321 Ga0207656_10052404 Ga0207656_100524042 190
62 3300025904 Ga0207647_10000096 Ga0207647_1000009620 190
63 3300025909 Ga0207705_10329377 Ga0207705_103293771 190
64 3300025914 Ga0207671_10034593 Ga0207671_100345933 190
65 3300025917 Ga0207660_10079738 Ga0207660_100797382 190
66 3300025919 Ga0207657_10006242 Ga0207657_1000624210 190
67 3300025919 Ga0207657_10016134 Ga0207657_100161344 190
68 3300025920 Ga0207649_10013530 Ga0207649_100135304 190
69 3300025920 Ga0207649_10582597 Ga0207649_105825972 190
70 3300025921 Ga0207652_10020989 Ga0207652_100209894 190
71 3300025921 Ga0207652_10034535 Ga0207652_100345353 190
72 3300025925 Ga0207650_10031051 Ga0207650_100310513 190
73 3300025926 Ga0207659_10228003 Ga0207659_102280032 190
74 3300025931 Ga0207644_10029092 Ga0207644_100290922 190
75 3300025931 Ga0207644_10110251 Ga0207644_101102511 190
76 3300025932 Ga0207690_10003750 Ga0207690_100037509 190
77 3300025940 Ga0207691_10147643 Ga0207691_101476432 190
78 3300025944 Ga0207661_10009530 Ga0207661_100095304 190
79 3300025944 Ga0207661_10083693 Ga0207661_100836932 190
80 3300025944 Ga0207661_10106492 Ga0207661_101064922 190
81 3300025949 Ga0207667_10058402 Ga0207667_100584024 190
82 3300025949 Ga0207667_10415679 Ga0207667_104156791 190
83 3300025960 Ga0207651_10585860 Ga0207651_105858602 190
84 3300025960 Ga0207651_10733788 Ga0207651_107337882 190
85 3300026023 Ga0207677_10260411 Ga0207677_102604112 190
86 3300026041 Ga0207639_10283216 Ga0207639_102832162 190
87 3300026095 Ga0207676_10476812 Ga0207676_104768121 190
88 3300026116 Ga0207674_10052795 Ga0207674_100527954 190
89 3300026116 Ga0207674_10054039 Ga0207674_100540394 190
90 3300026142 Ga0207698_10238513 Ga0207698_102385132 190
91 3300031824 Ga0307413_10599266 Ga0307413_105992661 190
92 3300031852 Ga0307410_10243132 Ga0307410_102431322 190
93 3300037418 Ga0395900_0967666 Ga0395900_0967666_92_664 190
94 3300037471 Ga0395905_0086937 Ga0395905_0086937_1127_1699 190
95 3300039450 Ga0436363_0986890 Ga0436363_0986890_244_816 190
96 3300049570 Ga0501033_0039371 Ga0501033_0039371_1019_1591 190
97 3300049571 Ga0501034_0012357 Ga0501034_0012357_7838_8410 190
98 3300049571 Ga0501034_0100600 Ga0501034_0100600_408_980 190
99 3300049573 Ga0501037_0235448 Ga0501037_0235448_393_965 190
100 3300049575 Ga0501039_1082445 Ga0501039_1082445_25_597 190
101 3300049586 Ga0501070_0035915 Ga0501070_0035915_519_1091 190
102 3300049649 Ga0501198_005559 Ga0501198_005559_1107_1679 190
103 3300049649 Ga0501198_010814 Ga0501198_010814_315_890 190
104 3300049652 Ga0501202_002956 Ga0501202_002956_512_1087 190
105 3300049654 Ga0501207_045094 Ga0501207_045094_115_690 190
106 3300049660 Ga0501216_018823 Ga0501216_018823_446_1021 190
107 3300049661 Ga0501217_035343 Ga0501217_035343_159_734 190
108 3300049662 Ga0501222_027248 Ga0501222_027248_129_704 190
109 3300049663 Ga0501223_007304 Ga0501223_007304_891_1466 190
110 3300049666 Ga0501228_008552 Ga0501228_008552_187_762 190
111 3300049668 Ga0501233_015711 Ga0501233_015711_528_1103 190
112 3300049669 Ga0501235_020699 Ga0501235_020699_489_1061 190
113 3300049672 Ga0501239_006215 Ga0501239_006215_124_699 190
114 3300049673 Ga0501240_004913 Ga0501240_004913_30_602 190
115 3300049674 Ga0501242_000503 Ga0501242_000503_1736_2308 190
116 3300049678 Ga0501248_000767 Ga0501248_000767_1149_1724 190
117 3300049679 Ga0501249_059805 Ga0501249_059805_97_672 190
118 3300049686 Ga0501257_070940 Ga0501257_070940_284_859 190
119 3300049688 Ga0501259_000582 Ga0501259_000582_2851_3423 190
120 3300049704 Ga0501221_029325 Ga0501221_029325_436_1011 190
121 3300049705 Ga0501225_0008434 Ga0501225_0008434_2019_2594 190
122 3300049707 Ga0501234_012927 Ga0501234_012927_632_1207 190
123 3300049763 Ga0501266_000390 Ga0501266_000390_1412_1984 190
124 3300049763 Ga0501266_005049 Ga0501266_005049_912_1487 190
125 3300049770 Ga0501273_005325 Ga0501273_005325_515_1090 190
126 3300049771 Ga0501274_022864 Ga0501274_022864_76_651 190
127 3300049771 Ga0501274_024049 Ga0501274_024049_16_588 190
128 3300049775 Ga0501279_012112 Ga0501279_012112_79_654 190
129 3300049776 Ga0501280_023762 Ga0501280_023762_224_799 190
130 3300049822 Ga0501035_0036730 Ga0501035_0036730_778_1350 190
131 3300049822 Ga0501035_0142983 Ga0501035_0142983_183_755 190
132 3300049823 Ga0501044_0083210 Ga0501044_0083210_155_727 190
133 3300049851 Ga0501212_011499 Ga0501212_011499_578_1153 190
134 3300053153 Ga0500616_0003551 Ga0500616_0003551_10770_11345 190
135 3300003320 rootH2_10287056 rootH2_102870562 191
136 3300005290 Ga0065712_10239023 Ga0065712_102390231 191
137 3300005290 Ga0065712_10287644 Ga0065712_102876441 191
138 3300005328 Ga0070676_10000006 Ga0070676_1000000653 191
139 3300005329 Ga0070683_100005753 Ga0070683_1000057538 191
140 3300005331 Ga0070670_100118408 Ga0070670_1001184082 191
141 3300005333 Ga0070677_10066630 Ga0070677_100666301 191
142 3300005333 Ga0070677_10109314 Ga0070677_101093142 191
143 3300005334 Ga0068869_100013324 Ga0068869_1000133242 191
144 3300005334 Ga0068869_100087394 Ga0068869_1000873942 191
145 3300005335 Ga0070666_10000694 Ga0070666_1000069417 191
146 3300005336 Ga0070680_100006185 Ga0070680_1000061852 191
147 3300005337 Ga0070682_100139417 Ga0070682_1001394172 191
148 3300005337 Ga0070682_100851817 Ga0070682_1008518171 191
149 3300005338 Ga0068868_100000022 Ga0068868_10000002218 191
150 3300005338 Ga0068868_101413474 Ga0068868_1014134741 191
151 3300005339 Ga0070660_100159810 Ga0070660_1001598102 191
152 3300005339 Ga0070660_100464586 Ga0070660_1004645861 191
153 3300005340 Ga0070689_100224528 Ga0070689_1002245282 191
154 3300005341 Ga0070691_10017424 Ga0070691_100174242 191
155 3300005343 Ga0070687_100037360 Ga0070687_1000373602 191
156 3300005343 Ga0070687_100277285 Ga0070687_1002772851 191
157 3300005345 Ga0070692_10247256 Ga0070692_102472561 191
158 3300005347 Ga0070668_100000016 Ga0070668_10000001666 191
159 3300005353 Ga0070669_100791426 Ga0070669_1007914261 191
160 3300005354 Ga0070675_100304730 Ga0070675_1003047301 191
161 3300005354 Ga0070675_100353317 Ga0070675_1003533172 191
162 3300005354 Ga0070675_100354799 Ga0070675_1003547992 191
163 3300005355 Ga0070671_100007792 Ga0070671_1000077926 191
164 3300005356 Ga0070674_100014627 Ga0070674_1000146276 191
165 3300005364 Ga0070673_100000647 Ga0070673_1000006475 191
166 3300005364 Ga0070673_100030971 Ga0070673_1000309714 191
167 3300005365 Ga0070688_100073712 Ga0070688_1000737123 191
168 3300005366 Ga0070659_100064852 Ga0070659_1000648523 191
169 3300005366 Ga0070659_100375152 Ga0070659_1003751522 191
170 3300005367 Ga0070667_100000031 Ga0070667_100000031139 191
171 3300005367 Ga0070667_100154354 Ga0070667_1001543543 191
172 3300005436 Ga0070713_101161547 Ga0070713_1011615471 191
173 3300005455 Ga0070663_100089289 Ga0070663_1000892892 191
174 3300005455 Ga0070663_100219145 Ga0070663_1002191452 191
175 3300005455 Ga0070663_100758318 Ga0070663_1007583182 191
176 3300005456 Ga0070678_100152473 Ga0070678_1001524732 191
177 3300005456 Ga0070678_100418199 Ga0070678_1004181991 191
178 3300005457 Ga0070662_100034754 Ga0070662_1000347543 191
179 3300005458 Ga0070681_10017596 Ga0070681_100175962 191
180 3300005458 Ga0070681_11053957 Ga0070681_110539571 191
181 3300005459 Ga0068867_100000137 Ga0068867_10000013741 191
182 3300005459 Ga0068867_100081643 Ga0068867_1000816432 191
183 3300005459 Ga0068867_100152234 Ga0068867_1001522342 191
184 3300005459 Ga0068867_100260796 Ga0068867_1002607961 191
185 3300005459 Ga0068867_100514620 Ga0068867_1005146202 191
186 3300005459 Ga0068867_100635729 Ga0068867_1006357291 191
187 3300005466 Ga0070685_10038748 Ga0070685_100387482 191
188 3300005466 Ga0070685_10327043 Ga0070685_103270432 191
189 3300005466 Ga0070685_10434375 Ga0070685_104343752 191
190 3300005530 Ga0070679_100004034 Ga0070679_10000403411 191
191 3300005530 Ga0070679_100309604 Ga0070679_1003096041 191
192 3300005535 Ga0070684_100770060 Ga0070684_1007700601 191
193 3300005539 Ga0068853_100005499 Ga0068853_1000054993 191
194 3300005539 Ga0068853_100018696 Ga0068853_1000186962 191
195 3300005539 Ga0068853_100231400 Ga0068853_1002314002 191
196 3300005543 Ga0070672_100000002 Ga0070672_100000002121 191
197 3300005543 Ga0070672_100039646 Ga0070672_1000396462 191
198 3300005543 Ga0070672_100057200 Ga0070672_1000572003 191
199 3300005543 Ga0070672_100319399 Ga0070672_1003193992 191
200 3300005543 Ga0070672_100372661 Ga0070672_1003726612 191
201 3300005544 Ga0070686_100065135 Ga0070686_1000651352 191
202 3300005544 Ga0070686_100083477 Ga0070686_1000834772 191
203 3300005546 Ga0070696_100565385 Ga0070696_1005653851 191
204 3300005548 Ga0070665_100002563 Ga0070665_10000256311 191
205 3300005563 Ga0068855_100000304 Ga0068855_1000003044 191
206 3300005563 Ga0068855_100004731 Ga0068855_1000047315 191
207 3300005563 Ga0068855_100033881 Ga0068855_1000338814 191
208 3300005563 Ga0068855_100123688 Ga0068855_1001236882 191
209 3300005563 Ga0068855_100641134 Ga0068855_1006411342 191
210 3300005564 Ga0070664_100117527 Ga0070664_1001175272 191
211 3300005564 Ga0070664_100415447 Ga0070664_1004154472 191
212 3300005578 Ga0068854_100031961 Ga0068854_1000319612 191
213 3300005578 Ga0068854_101049677 Ga0068854_1010496771 191
214 3300005578 Ga0068854_101116163 Ga0068854_1011161631 191
215 3300005614 Ga0068856_100019904 Ga0068856_1000199044 191
216 3300005614 Ga0068856_100075018 Ga0068856_1000750183 191
217 3300005616 Ga0068852_100159471 Ga0068852_1001594712 191
218 3300005616 Ga0068852_100237214 Ga0068852_1002372142 191
219 3300005616 Ga0068852_100285235 Ga0068852_1002852351 191
220 3300005616 Ga0068852_100665291 Ga0068852_1006652912 191
221 3300005617 Ga0068859_100414430 Ga0068859_1004144302 191
222 3300005617 Ga0068859_100592271 Ga0068859_1005922712 191
223 3300005617 Ga0068859_100992526 Ga0068859_1009925261 191
224 3300005618 Ga0068864_100002821 Ga0068864_1000028215 191
225 3300005618 Ga0068864_100084704 Ga0068864_1000847043 191
226 3300005618 Ga0068864_101182318 Ga0068864_1011823181 191
227 3300005718 Ga0068866_10087830 Ga0068866_100878302 191
228 3300005719 Ga0068861_100045634 Ga0068861_1000456342 191
229 3300005719 Ga0068861_100127034 Ga0068861_1001270342 191
230 3300005719 Ga0068861_100143592 Ga0068861_1001435922 191
231 3300005719 Ga0068861_100319525 Ga0068861_1003195252 191
232 3300005834 Ga0068851_10000480 Ga0068851_100004806 191
233 3300005834 Ga0068851_10219080 Ga0068851_102190802 191
234 3300005840 Ga0068870_10131576 Ga0068870_101315761 191
235 3300005840 Ga0068870_10286882 Ga0068870_102868821 191
236 3300005841 Ga0068863_100011131 Ga0068863_1000111316 191
237 3300005841 Ga0068863_100650183 Ga0068863_1006501832 191
238 3300005842 Ga0068858_100000083 Ga0068858_10000008362 191
239 3300005842 Ga0068858_100329655 Ga0068858_1003296551 191
240 3300005843 Ga0068860_100000394 Ga0068860_10000039445 191
241 3300005843 Ga0068860_100004753 Ga0068860_1000047534 191
242 3300005843 Ga0068860_100004980 Ga0068860_1000049804 191
243 3300005843 Ga0068860_100007835 Ga0068860_1000078358 191
244 3300005843 Ga0068860_100209375 Ga0068860_1002093752 191
245 3300005844 Ga0068862_100534851 Ga0068862_1005348512 191
246 3300005983 Ga0081540_1007841 Ga0081540_10078419 191
247 3300006028 Ga0070717_10703744 Ga0070717_107037442 191
248 3300006237 Ga0097621_100003645 Ga0097621_1000036453 191
249 3300006237 Ga0097621_100239939 Ga0097621_1002399392 191
250 3300006358 Ga0068871_100000201 Ga0068871_1000002019 191
251 3300006358 Ga0068871_100070253 Ga0068871_1000702532 191
252 3300006358 Ga0068871_100359583 Ga0068871_1003595832 191
253 3300006358 Ga0068871_100580459 Ga0068871_1005804592 191
254 3300006880 Ga0075429_100264597 Ga0075429_1002645972 191
255 3300006881 Ga0068865_100006660 Ga0068865_1000066602 191
256 3300006881 Ga0068865_101057382 Ga0068865_1010573821 191
257 3300006931 Ga0097620_100414453 Ga0097620_1004144532 191
258 3300006931 Ga0097620_100592209 Ga0097620_1005922092 191
259 3300006931 Ga0097620_100992380 Ga0097620_1009923801 191
260 3300009093 Ga0105240_10005867 Ga0105240_1000586716 191
261 3300009093 Ga0105240_10006669 Ga0105240_1000666915 191
262 3300009093 Ga0105240_10013970 Ga0105240_1001397011 191
263 3300009093 Ga0105240_10016100 Ga0105240_100161003 191
264 3300009093 Ga0105240_10017244 Ga0105240_100172446 191
265 3300009093 Ga0105240_10098645 Ga0105240_100986452 191
266 3300009093 Ga0105240_10117202 Ga0105240_101172022 191
267 3300009093 Ga0105240_10184742 Ga0105240_101847422 191
268 3300009093 Ga0105240_10279744 Ga0105240_102797442 191
269 3300009093 Ga0105240_11681180 Ga0105240_116811801 191
270 3300009094 Ga0111539_10204149 Ga0111539_102041492 191
271 3300009094 Ga0111539_10572031 Ga0111539_105720312 191
272 3300009098 Ga0105245_10053019 Ga0105245_100530192 191
273 3300009101 Ga0105247_10065965 Ga0105247_100659652 191
274 3300009174 Ga0105241_10000460 Ga0105241_100004602 191
275 3300009174 Ga0105241_10955286 Ga0105241_109552862 191
276 3300009176 Ga0105242_10154113 Ga0105242_101541132 191
277 3300009177 Ga0105248_10026738 Ga0105248_100267384 191
278 3300009177 Ga0105248_11196648 Ga0105248_111966481 191
279 3300009545 Ga0105237_10000191 Ga0105237_1000019131 191
280 3300009545 Ga0105237_10002339 Ga0105237_100023398 191
281 3300009545 Ga0105237_10009688 Ga0105237_100096884 191
282 3300009545 Ga0105237_10010072 Ga0105237_100100722 191
283 3300009545 Ga0105237_10423974 Ga0105237_104239742 191
284 3300009551 Ga0105238_10000488 Ga0105238_1000048810 191
285 3300009551 Ga0105238_10134331 Ga0105238_101343312 191
286 3300009551 Ga0105238_10328568 Ga0105238_103285682 191
287 3300009553 Ga0105249_10004354 Ga0105249_100043542 191
288 3300009553 Ga0105249_10642552 Ga0105249_106425522 191
289 3300009553 Ga0105249_10730028 Ga0105249_107300281 191
290 3300010375 Ga0105239_10001833 Ga0105239_1000183318 191
291 3300010375 Ga0105239_10013146 Ga0105239_100131462 191
292 3300010375 Ga0105239_10015008 Ga0105239_100150081 191
293 3300010375 Ga0105239_10032094 Ga0105239_100320947 191
294 3300010375 Ga0105239_10112269 Ga0105239_101122691 191
295 3300013100 Ga0157373_10006783 Ga0157373_100067835 191
296 3300013100 Ga0157373_10022014 Ga0157373_100220142 191
297 3300013100 Ga0157373_10042364 Ga0157373_100423643 191
298 3300013100 Ga0157373_10053913 Ga0157373_100539132 191
299 3300013102 Ga0157371_10001864 Ga0157371_1000186415 191
300 3300013102 Ga0157371_10006147 Ga0157371_100061476 191
301 3300013102 Ga0157371_10008653 Ga0157371_100086536 191
302 3300013102 Ga0157371_10030654 Ga0157371_100306542 191
303 3300013104 Ga0157370_10002931 Ga0157370_100029316 191
304 3300013104 Ga0157370_10003909 Ga0157370_1000390910 191
305 3300013104 Ga0157370_10090737 Ga0157370_100907372 191
306 3300013104 Ga0157370_10221773 Ga0157370_102217732 191
307 3300013104 Ga0157370_10241058 Ga0157370_102410582 191
308 3300013104 Ga0157370_10309030 Ga0157370_103090302 191
309 3300013104 Ga0157370_10783391 Ga0157370_107833912 191
310 3300013105 Ga0157369_10025886 Ga0157369_100258867 191
311 3300013105 Ga0157369_10117768 Ga0157369_101177682 191
312 3300013296 Ga0157374_10000011 Ga0157374_10000011106 191
313 3300013296 Ga0157374_10000074 Ga0157374_1000007412 191
314 3300013296 Ga0157374_10057395 Ga0157374_100573952 191
315 3300013296 Ga0157374_10099880 Ga0157374_100998802 191
316 3300013296 Ga0157374_10440365 Ga0157374_104403652 191
317 3300013296 Ga0157374_10702641 Ga0157374_107026411 191
318 3300013296 Ga0157374_10968374 Ga0157374_109683742 191
319 3300013297 Ga0157378_10001083 Ga0157378_100010836 191
320 3300013297 Ga0157378_10005125 Ga0157378_100051256 191
321 3300013297 Ga0157378_10217693 Ga0157378_102176932 191
322 3300013297 Ga0157378_10332084 Ga0157378_103320842 191
323 3300013297 Ga0157378_10778175 Ga0157378_107781752 191
324 3300013306 Ga0163162_10000029 Ga0163162_10000029131 191
325 3300013306 Ga0163162_10003040 Ga0163162_100030406 191
326 3300013306 Ga0163162_10003535 Ga0163162_100035357 191
327 3300013306 Ga0163162_10003577 Ga0163162_1000357710 191
328 3300013306 Ga0163162_10516136 Ga0163162_105161361 191
329 3300013307 Ga0157372_10001323 Ga0157372_100013239 191
330 3300013307 Ga0157372_10001983 Ga0157372_1000198312 191
331 3300013307 Ga0157372_10046594 Ga0157372_100465944 191
332 3300013307 Ga0157372_10087823 Ga0157372_100878234 191
333 3300013307 Ga0157372_10129708 Ga0157372_101297082 191
334 3300013307 Ga0157372_10277600 Ga0157372_102776002 191
335 3300013307 Ga0157372_10443735 Ga0157372_104437352 191
336 3300013307 Ga0157372_10533912 Ga0157372_105339121 191
337 3300013307 Ga0157372_11147648 Ga0157372_111476482 191
338 3300013308 Ga0157375_10000042 Ga0157375_1000004230 191
339 3300013308 Ga0157375_10163880 Ga0157375_101638801 191
340 3300013308 Ga0157375_10388193 Ga0157375_103881932 191
341 3300013308 Ga0157375_10606648 Ga0157375_106066481 191
342 3300013308 Ga0157375_10835060 Ga0157375_108350602 191
343 3300013308 Ga0157375_11002301 Ga0157375_110023012 191
344 3300013308 Ga0157375_12193536 Ga0157375_121935361 191
345 3300014325 Ga0163163_10000076 Ga0163163_1000007671 191
346 3300014325 Ga0163163_10122102 Ga0163163_101221022 191
347 3300014325 Ga0163163_10194923 Ga0163163_101949232 191
348 3300014325 Ga0163163_10468721 Ga0163163_104687212 191
349 3300014325 Ga0163163_10993056 Ga0163163_109930562 191
350 3300014325 Ga0163163_11074243 Ga0163163_110742431 191
351 3300014325 Ga0163163_11768844 Ga0163163_117688441 191
352 3300014326 Ga0157380_10001511 Ga0157380_100015117 191
353 3300014326 Ga0157380_10534274 Ga0157380_105342742 191
354 3300014745 Ga0157377_10234134 Ga0157377_102341341 191
355 3300014968 Ga0157379_10000016 Ga0157379_1000001666 191
356 3300014968 Ga0157379_10095163 Ga0157379_100951633 191
357 3300014968 Ga0157379_10235598 Ga0157379_102355982 191
358 3300014969 Ga0157376_10000067 Ga0157376_1000006770 191
359 3300014969 Ga0157376_10004408 Ga0157376_1000440810 191
360 3300014969 Ga0157376_10061479 Ga0157376_100614793 191
361 3300014969 Ga0157376_10537356 Ga0157376_105373562 191
362 3300017792 Ga0163161_10005108 Ga0163161_100051084 191
363 3300017792 Ga0163161_10279971 Ga0163161_102799712 191
364 3300020070 Ga0206356_10223461 Ga0206356_102234612 191
365 3300020078 Ga0206352_11102928 Ga0206352_111029282 191
366 3300020082 Ga0206353_10650099 Ga0206353_106500992 191
367 3300025315 Ga0207697_10114310 Ga0207697_101143102 191
368 3300025315 Ga0207697_10178137 Ga0207697_101781372 191
369 3300025893 Ga0207682_10005622 Ga0207682_100056225 191
370 3300025899 Ga0207642_10196643 Ga0207642_101966431 191
371 3300025901 Ga0207688_10002147 Ga0207688_100021476 191
372 3300025903 Ga0207680_10001414 Ga0207680_100014142 191
373 3300025903 Ga0207680_10007029 Ga0207680_100070294 191
374 3300025904 Ga0207647_10031011 Ga0207647_100310113 191
375 3300025904 Ga0207647_10329313 Ga0207647_103293132 191
376 3300025907 Ga0207645_10002072 Ga0207645_100020722 191
377 3300025907 Ga0207645_10021126 Ga0207645_100211262 191
378 3300025908 Ga0207643_10099267 Ga0207643_100992671 191
379 3300025909 Ga0207705_10011138 Ga0207705_100111382 191
380 3300025909 Ga0207705_10016501 Ga0207705_100165011 191
381 3300025909 Ga0207705_10067764 Ga0207705_100677642 191
382 3300025909 Ga0207705_10114588 Ga0207705_101145882 191
383 3300025911 Ga0207654_10112936 Ga0207654_101129361 191
384 3300025911 Ga0207654_10122746 Ga0207654_101227462 191
385 3300025912 Ga0207707_10034952 Ga0207707_100349524 191
386 3300025912 Ga0207707_10068701 Ga0207707_100687012 191
387 3300025913 Ga0207695_10000212 Ga0207695_10000212133 191
388 3300025913 Ga0207695_10000351 Ga0207695_1000035187 191
389 3300025913 Ga0207695_10001387 Ga0207695_1000138721 191
390 3300025913 Ga0207695_10002698 Ga0207695_100026986 191
391 3300025913 Ga0207695_10014473 Ga0207695_100144734 191
392 3300025913 Ga0207695_10038130 Ga0207695_100381302 191
393 3300025913 Ga0207695_10167338 Ga0207695_101673382 191
394 3300025913 Ga0207695_10184809 Ga0207695_101848092 191
395 3300025914 Ga0207671_10001741 Ga0207671_1000174121 191
396 3300025914 Ga0207671_10007829 Ga0207671_100078297 191
397 3300025914 Ga0207671_10053598 Ga0207671_100535982 191
398 3300025917 Ga0207660_10033378 Ga0207660_100333782 191
399 3300025917 Ga0207660_10700834 Ga0207660_107008341 191
400 3300025918 Ga0207662_10047084 Ga0207662_100470842 191
401 3300025919 Ga0207657_10066421 Ga0207657_100664211 191
402 3300025919 Ga0207657_10071703 Ga0207657_100717032 191
403 3300025919 Ga0207657_10313596 Ga0207657_103135961 191
404 3300025919 Ga0207657_10366092 Ga0207657_103660922 191
405 3300025919 Ga0207657_10397769 Ga0207657_103977691 191
406 3300025921 Ga0207652_10000160 Ga0207652_1000016037 191
407 3300025921 Ga0207652_10000203 Ga0207652_1000020325 191
408 3300025923 Ga0207681_10346617 Ga0207681_103466171 191
409 3300025924 Ga0207694_10002191 Ga0207694_100021912 191
410 3300025924 Ga0207694_10119520 Ga0207694_101195202 191
411 3300025924 Ga0207694_10338757 Ga0207694_103387572 191
412 3300025924 Ga0207694_10454869 Ga0207694_104548691 191
413 3300025925 Ga0207650_10107004 Ga0207650_101070042 191
414 3300025925 Ga0207650_10857202 Ga0207650_108572021 191
415 3300025926 Ga0207659_10020147 Ga0207659_100201476 191
416 3300025926 Ga0207659_10251571 Ga0207659_102515711 191
417 3300025926 Ga0207659_10447794 Ga0207659_104477941 191
418 3300025927 Ga0207687_10419601 Ga0207687_104196012 191
419 3300025928 Ga0207700_10416370 Ga0207700_104163702 191
420 3300025929 Ga0207664_10780504 Ga0207664_107805041 191
421 3300025931 Ga0207644_10005204 Ga0207644_100052046 191
422 3300025932 Ga0207690_10033836 Ga0207690_100338363 191
423 3300025932 Ga0207690_10234008 Ga0207690_102340082 191
424 3300025932 Ga0207690_10241948 Ga0207690_102419482 191
425 3300025933 Ga0207706_10023049 Ga0207706_100230494 191
426 3300025933 Ga0207706_10102958 Ga0207706_101029582 191
427 3300025937 Ga0207669_10085197 Ga0207669_100851972 191
428 3300025938 Ga0207704_10003568 Ga0207704_100035686 191
429 3300025939 Ga0207665_10446152 Ga0207665_104461522 191
430 3300025939 Ga0207665_10821887 Ga0207665_108218871 191
431 3300025940 Ga0207691_10000004 Ga0207691_10000004131 191
432 3300025940 Ga0207691_10012199 Ga0207691_100121998 191
433 3300025941 Ga0207711_10195825 Ga0207711_101958252 191
434 3300025942 Ga0207689_10028144 Ga0207689_100281442 191
435 3300025942 Ga0207689_10037202 Ga0207689_100372024 191
436 3300025944 Ga0207661_10004064 Ga0207661_100040642 191
437 3300025944 Ga0207661_10443084 Ga0207661_104430842 191
438 3300025945 Ga0207679_10145500 Ga0207679_101455002 191
439 3300025949 Ga0207667_10000180 Ga0207667_100001807 191
440 3300025949 Ga0207667_10007224 Ga0207667_100072244 191
441 3300025949 Ga0207667_10023030 Ga0207667_100230302 191
442 3300025949 Ga0207667_10399654 Ga0207667_103996542 191
443 3300025960 Ga0207651_10000302 Ga0207651_1000030217 191
444 3300025960 Ga0207651_10127397 Ga0207651_101273972 191
445 3300025961 Ga0207712_10003310 Ga0207712_100033102 191
446 3300025961 Ga0207712_10226407 Ga0207712_102264072 191
447 3300025972 Ga0207668_10000570 Ga0207668_1000057013 191
448 3300025972 Ga0207668_10054499 Ga0207668_100544993 191
449 3300025981 Ga0207640_10979069 Ga0207640_109790691 191
450 3300025986 Ga0207658_10000059 Ga0207658_1000005910 191
451 3300025986 Ga0207658_10125874 Ga0207658_101258742 191
452 3300026023 Ga0207677_10000288 Ga0207677_1000028831 191
453 3300026023 Ga0207677_10294770 Ga0207677_102947702 191
454 3300026035 Ga0207703_10002835 Ga0207703_100028358 191
455 3300026035 Ga0207703_10241295 Ga0207703_102412952 191
456 3300026041 Ga0207639_10001397 Ga0207639_100013972 191
457 3300026041 Ga0207639_10044905 Ga0207639_100449052 191
458 3300026041 Ga0207639_10336797 Ga0207639_103367972 191
459 3300026041 Ga0207639_10461414 Ga0207639_104614142 191
460 3300026067 Ga0207678_10450997 Ga0207678_104509972 191
461 3300026078 Ga0207702_10159464 Ga0207702_101594642 191
462 3300026088 Ga0207641_10002402 Ga0207641_1000240213 191
463 3300026089 Ga0207648_10002340 Ga0207648_1000234014 191
464 3300026089 Ga0207648_10021653 Ga0207648_100216533 191
465 3300026089 Ga0207648_10148351 Ga0207648_101483512 191
466 3300026089 Ga0207648_10167591 Ga0207648_101675912 191
467 3300026089 Ga0207648_10291878 Ga0207648_102918781 191
468 3300026089 Ga0207648_10450049 Ga0207648_104500492 191
469 3300026089 Ga0207648_10654388 Ga0207648_106543882 191
470 3300026089 Ga0207648_10793730 Ga0207648_107937301 191
471 3300026095 Ga0207676_10016753 Ga0207676_100167532 191
472 3300026116 Ga0207674_10093966 Ga0207674_100939663 191
473 3300026116 Ga0207674_10274640 Ga0207674_102746401 191
474 3300026118 Ga0207675_100174211 Ga0207675_1001742111 191
475 3300026118 Ga0207675_100352493 Ga0207675_1003524932 191
476 3300026118 Ga0207675_100383432 Ga0207675_1003834321 191
477 3300026118 Ga0207675_100609104 Ga0207675_1006091042 191
478 3300026121 Ga0207683_10041323 Ga0207683_100413234 191
479 3300026121 Ga0207683_10091804 Ga0207683_100918042 191
480 3300026121 Ga0207683_10339332 Ga0207683_103393322 191
481 3300026142 Ga0207698_10333680 Ga0207698_103336802 191
482 3300026142 Ga0207698_10372677 Ga0207698_103726772 191
483 3300026142 Ga0207698_10449356 Ga0207698_104493562 191
484 3300027471 Ga0209995_1042542 Ga0209995_10425421 191
485 3300027907 Ga0207428_10250191 Ga0207428_102501912 191
486 3300028379 Ga0268266_10000068 Ga0268266_100000683 191
487 3300028379 Ga0268266_10005417 Ga0268266_1000541710 191
488 3300028381 Ga0268264_10000559 Ga0268264_1000055912 191
489 3300028381 Ga0268264_10004188 Ga0268264_100041888 191
490 3300028381 Ga0268264_10028330 Ga0268264_100283302 191
491 3300028381 Ga0268264_10180253 Ga0268264_101802532 191
492 3300028786 Ga0307517_10000501 Ga0307517_1000050141 191
493 3300030521 Ga0307511_10002747 Ga0307511_100027474 191
494 3300030836 Ga0265767_103702 Ga0265767_1037021 191
495 3300031251 Ga0265327_10000059 Ga0265327_10000059144 191
496 3300031548 Ga0307408_100762134 Ga0307408_1007621342 191
497 3300031730 Ga0307516_10001546 Ga0307516_1000154617 191
498 3300031995 Ga0307409_101334628 Ga0307409_1013346281 191
499 3300032004 Ga0307414_10168798 Ga0307414_101687982 191
500 3300032004 Ga0307414_10187048 Ga0307414_101870481 191
501 3300032004 Ga0307414_10736435 Ga0307414_107364352 191
502 3300032126 Ga0307415_100414546 Ga0307415_1004145462 191
503 3300033180 Ga0307510_10001895 Ga0307510_1000189510 191
504 3300035121 Ga0373960_0040689 Ga0373960_0040689_561_1139 191
505 3300035410 Ga0373924_0098964 Ga0373924_0098964_347_922 191
506 3300035692 Ga0373935_0553513 Ga0373935_0553513_176_751 191
507 3300036401 Ga0373937_1280170 Ga0373937_1280170_38_613 191
508 3300036457 Ga0265778_002398 Ga0265778_002398_13_588 191
509 3300037312 Ga0395899_0001724 Ga0395899_0001724_10736_11311 191
510 3300037312 Ga0395899_0011321 Ga0395899_0011321_5354_5929 191
511 3300037312 Ga0395899_0064523 Ga0395899_0064523_1330_1905 191
512 3300037418 Ga0395900_0002996 Ga0395900_0002996_16521_17096 191
513 3300037418 Ga0395900_0010177 Ga0395900_0010177_7769_8344 191
514 3300037418 Ga0395900_0013929 Ga0395900_0013929_6502_7077 191
515 3300037418 Ga0395900_0079413 Ga0395900_0079413_2084_2659 191
516 3300037418 Ga0395900_0088855 Ga0395900_0088855_1557_2132 191
517 3300037418 Ga0395900_0104794 Ga0395900_0104794_775_1350 191
518 3300037418 Ga0395900_0174959 Ga0395900_0174959_1393_1968 191
519 3300037418 Ga0395900_0193331 Ga0395900_0193331_12_587 191
520 3300037418 Ga0395900_0252058 Ga0395900_0252058_274_849 191
521 3300037418 Ga0395900_0795956 Ga0395900_0795956_283_858 191
522 3300037466 Ga0395898_0000738 Ga0395898_0000738_14271_14846 191
523 3300037466 Ga0395898_0024451 Ga0395898_0024451_3181_3756 191
524 3300037466 Ga0395898_0239270 Ga0395898_0239270_103_678 191
525 3300037466 Ga0395898_0988702 Ga0395898_0988702_134_709 191
526 3300037471 Ga0395905_0077764 Ga0395905_0077764_2263_2838 191
527 3300038443 Ga0395901_0001002 Ga0395901_0001002_29459_30034 191
528 3300038443 Ga0395901_0011343 Ga0395901_0011343_1453_2028 191
529 3300038443 Ga0395901_0189765 Ga0395901_0189765_972_1547 191
530 3300038443 Ga0395901_0963273 Ga0395901_0963273_118_693 191
531 3300038443 Ga0395901_1108215 Ga0395901_1108215_46_621 191
532 3300039437 Ga0436365_1500359 Ga0436365_1500359_4786_5361 191
533 3300039437 Ga0436365_1764755 Ga0436365_1764755_74_649 191
534 3300039437 Ga0436365_1811077 Ga0436365_1811077_94_669 191
535 3300042007 Ga0439449_0187696 Ga0439449_0187696_98_676 191
536 3300042156 Ga0439446_0072433 Ga0439446_0072433_287_862 191
537 3300042876 Ga0451577_0195614 Ga0451577_0195614_260_835 191
538 3300044658 Ga0466972_0015799 Ga0466972_0015799_2199_2774 191
539 3300044706 Ga0466964_0255636 Ga0466964_0255636_186_761 191
540 3300044712 Ga0453684_0024262 Ga0453684_0024262_1655_2230 191
541 3300044712 Ga0453684_0092126 Ga0453684_0092126_2715_3293 191
542 3300044712 Ga0453684_0458040 Ga0453684_0458040_516_1091 191
543 3300044719 Ga0466971_0254890 Ga0466971_0254890_92_667 191
544 3300044765 Ga0466970_0036872 Ga0466970_0036872_1402_1977 191
545 3300045049 Ga0466959_0056854 Ga0466959_0056854_201_776 191
546 3300045051 Ga0451576_0737654 Ga0451576_0737654_407_982 191
547 3300046459 Ga0495629_0160073 Ga0495629_0160073_530_1105 191
548 3300046460 Ga0495638_0057933 Ga0495638_0057933_1378_1953 191
549 3300046463 Ga0495653_0355172 Ga0495653_0355172_193_768 191
550 3300046472 Ga0495580_0051318 Ga0495580_0051318_591_1166 191
551 3300046473 Ga0495582_0035634 Ga0495582_0035634_436_1011 191
552 3300046475 Ga0495639_0041808 Ga0495639_0041808_490_1065 191
553 3300046507 Ga0495606_0042507 Ga0495606_0042507_1874_2449 191
554 3300046524 Ga0495648_0004618 Ga0495648_0004618_2394_2969 191
555 3300046524 Ga0495648_0236387 Ga0495648_0236387_59_634 191
556 3300046536 Ga0495587_0192947 Ga0495587_0192947_309_884 191
557 3300046537 Ga0495598_0048028 Ga0495598_0048028_504_1082 191
558 3300046539 Ga0495621_0163719 Ga0495621_0163719_132_710 191
559 3300046543 Ga0495645_0159430 Ga0495645_0159430_198_773 191
560 3300046558 Ga0495633_0139253 Ga0495633_0139253_137_712 191
561 3300046648 Ga0495611_0000280 Ga0495611_0000280_4466_5041 191
562 3300046660 Ga0495625_0525782 Ga0495625_0525782_130_705 191
563 3300046663 Ga0495635_0673985 Ga0495635_0673985_25_600 191
564 3300046675 Ga0495657_0423884 Ga0495657_0423884_30_605 191
565 3300046679 Ga0495623_0092470 Ga0495623_0092470_953_1528 191
566 3300046683 Ga0495658_0053174 Ga0495658_0053174_222_797 191
567 3300046689 Ga0495613_0155760 Ga0495613_0155760_396_971 191
568 3300046691 Ga0495670_0306587 Ga0495670_0306587_171_746 191
569 3300046694 Ga0495649_0208519 Ga0495649_0208519_407_982 191
570 3300047317 Ga0495604_0122686 Ga0495604_0122686_798_1373 191
571 3300047319 Ga0495674_0617899 Ga0495674_0617899_213_788 191
572 3300047320 Ga0495672_0013590 Ga0495672_0013590_2829_3404 191
573 3300047443 Ga0495687_000058 Ga0495687_000058_81310_81885 191
574 3300047472 Ga0495686_0000005 Ga0495686_0000005_307948_308523 191
575 3300048907 Ga0496104_0515565 Ga0496104_0515565_422_997 191
576 3300048908 Ga0496105_0101590 Ga0496105_0101590_1055_1630 191
577 3300048909 Ga0496106_0198575 Ga0496106_0198575_14_589 191
578 3300048912 Ga0496109_0068145 Ga0496109_0068145_2485_3060 191
579 3300048918 Ga0496115_0792252 Ga0496115_0792252_53_628 191
580 3300049520 Ga0501297_011970 Ga0501297_011970_26_601 191
581 3300049521 Ga0501298_023999 Ga0501298_023999_190_765 191
582 3300049570 Ga0501033_0531243 Ga0501033_0531243_29_604 191
583 3300049572 Ga0501036_0521371 Ga0501036_0521371_68_643 191
584 3300049573 Ga0501037_0148427 Ga0501037_0148427_303_878 191
585 3300049579 Ga0501043_0221979 Ga0501043_0221979_685_1260 191
586 3300049586 Ga0501070_0490951 Ga0501070_0490951_196_771 191
587 3300049589 Ga0501073_0332847 Ga0501073_0332847_394_969 191
588 3300049649 Ga0501198_016201 Ga0501198_016201_562_1137 191
589 3300049652 Ga0501202_027736 Ga0501202_027736_439_1014 191
590 3300049654 Ga0501207_009038 Ga0501207_009038_277_852 191
591 3300049660 Ga0501216_005462 Ga0501216_005462_1316_1891 191
592 3300049661 Ga0501217_027040 Ga0501217_027040_442_1017 191
593 3300049666 Ga0501228_011139 Ga0501228_011139_215_790 191
594 3300049669 Ga0501235_015160 Ga0501235_015160_994_1569 191
595 3300049675 Ga0501243_017373 Ga0501243_017373_244_819 191
596 3300049677 Ga0501247_004012 Ga0501247_004012_861_1436 191
597 3300049682 Ga0501252_004982 Ga0501252_004982_538_1113 191
598 3300049686 Ga0501257_010101 Ga0501257_010101_1250_1828 191
599 3300049686 Ga0501257_017886 Ga0501257_017886_489_1064 191
600 3300049688 Ga0501259_048317 Ga0501259_048317_254_829 191
601 3300049708 Ga0501245_029800 Ga0501245_029800_190_765 191
602 3300049765 Ga0501268_040269 Ga0501268_040269_185_760 191
603 3300049775 Ga0501279_001908 Ga0501279_001908_1737_2312 191
604 3300049779 Ga0501283_034196 Ga0501283_034196_86_661 191
605 3300049822 Ga0501035_0602823 Ga0501035_0602823_54_629 191
606 3300049823 Ga0501044_0064958 Ga0501044_0064958_2481_3056 191
607 3300049823 Ga0501044_0092179 Ga0501044_0092179_2038_2613 191
608 3300049851 Ga0501212_040242 Ga0501212_040242_104_679 191
609 3300050508 nmdc:mga09592_551676_c1 nmdc:mga09592_551676_c1_290_868 191
610 3300050511 nmdc:mga08y16_1010584_c1 nmdc:mga08y16_1010584_c1_149_730 191
611 3300050511 nmdc:mga08y16_165575_c1 nmdc:mga08y16_165575_c1_1012_1590 191
612 3300050511 nmdc:mga08y16_671903_c1 nmdc:mga08y16_671903_c1_101_682 191
613 3300053080 Ga0500635_0143978 Ga0500635_0143978_124_699 191
614 3300053085 Ga0495619_0102830 Ga0495619_0102830_1307_1882 191
615 3300053090 Ga0500646_0056428 Ga0500646_0056428_251_826 191
616 3300053092 Ga0500583_0031771 Ga0500583_0031771_1135_1710 191
617 3300053092 Ga0500583_0179605 Ga0500583_0179605_424_999 191
618 3300053130 Ga0500642_0001723 Ga0500642_0001723_496_1071 191
619 3300053146 Ga0500588_0186736 Ga0500588_0186736_29_604 191
620 3300053156 Ga0500622_0007310 Ga0500622_0007310_5267_5842 191
621 3300061719 Ga0466962_0179018 Ga0466962_0179018_262_837 191
622 3300002738 JGI25154J39366_1005894 JGI25154J39366_10058942 192
623 3300003320 rootH2_10105229 rootH2_101052292 192
624 3300003322 rootL2_10039832 rootL2_100398325 192
625 3300003322 rootL2_10232916 rootL2_102329162 192
626 3300003322 rootL2_10282654 rootL2_102826542 192
627 3300003323 rootH1_10246374 rootH1_102463742 192
628 3300005290 Ga0065712_10022179 Ga0065712_100221792 192
629 3300005290 Ga0065712_10072726 Ga0065712_100727266 192
630 3300005293 Ga0065715_10098512 Ga0065715_100985124 192
631 3300005295 Ga0065707_10128168 Ga0065707_101281683 192
632 3300005295 Ga0065707_10287444 Ga0065707_102874442 192
633 3300005295 Ga0065707_10378629 Ga0065707_103786291 192
634 3300005327 Ga0070658_10778950 Ga0070658_107789502 192
635 3300005328 Ga0070676_10032766 Ga0070676_100327663 192
636 3300005328 Ga0070676_10099297 Ga0070676_100992971 192
637 3300005328 Ga0070676_10111389 Ga0070676_101113892 192
638 3300005329 Ga0070683_100019023 Ga0070683_1000190234 192
639 3300005329 Ga0070683_101318974 Ga0070683_1013189741 192
640 3300005330 Ga0070690_100002608 Ga0070690_1000026084 192
641 3300005331 Ga0070670_100015474 Ga0070670_1000154742 192
642 3300005331 Ga0070670_100076196 Ga0070670_1000761962 192
643 3300005331 Ga0070670_100240628 Ga0070670_1002406281 192
644 3300005331 Ga0070670_100275846 Ga0070670_1002758462 192
645 3300005331 Ga0070670_100296213 Ga0070670_1002962131 192
646 3300005331 Ga0070670_100425203 Ga0070670_1004252032 192
647 3300005331 Ga0070670_100554154 Ga0070670_1005541542 192
648 3300005331 Ga0070670_100631972 Ga0070670_1006319722 192
649 3300005333 Ga0070677_10008592 Ga0070677_100085922 192
650 3300005333 Ga0070677_10054548 Ga0070677_100545482 192
651 3300005334 Ga0068869_100003895 Ga0068869_1000038953 192
652 3300005334 Ga0068869_100057499 Ga0068869_1000574993 192
653 3300005334 Ga0068869_100067378 Ga0068869_1000673782 192
654 3300005334 Ga0068869_100125885 Ga0068869_1001258853 192
655 3300005334 Ga0068869_100196101 Ga0068869_1001961012 192
656 3300005334 Ga0068869_100373521 Ga0068869_1003735211 192
657 3300005334 Ga0068869_100406638 Ga0068869_1004066382 192
658 3300005334 Ga0068869_100560047 Ga0068869_1005600472 192
659 3300005334 Ga0068869_100907884 Ga0068869_1009078841 192
660 3300005335 Ga0070666_10000086 Ga0070666_1000008653 192
661 3300005335 Ga0070666_10130417 Ga0070666_101304173 192
662 3300005335 Ga0070666_10134316 Ga0070666_101343162 192
663 3300005335 Ga0070666_10221107 Ga0070666_102211072 192
664 3300005335 Ga0070666_10283600 Ga0070666_102836002 192
665 3300005335 Ga0070666_10786143 Ga0070666_107861431 192
666 3300005335 Ga0070666_10918320 Ga0070666_109183201 192
667 3300005337 Ga0070682_100350391 Ga0070682_1003503912 192
668 3300005338 Ga0068868_100004473 Ga0068868_1000044733 192
669 3300005338 Ga0068868_100004930 Ga0068868_10000493010 192
670 3300005338 Ga0068868_100091163 Ga0068868_1000911633 192
671 3300005338 Ga0068868_100097183 Ga0068868_1000971832 192
672 3300005338 Ga0068868_100239278 Ga0068868_1002392783 192
673 3300005338 Ga0068868_100288029 Ga0068868_1002880292 192
674 3300005338 Ga0068868_100368446 Ga0068868_1003684462 192
675 3300005339 Ga0070660_100535177 Ga0070660_1005351771 192
676 3300005340 Ga0070689_100005812 Ga0070689_1000058122 192
677 3300005340 Ga0070689_100022565 Ga0070689_1000225653 192
678 3300005340 Ga0070689_100054044 Ga0070689_1000540442 192
679 3300005340 Ga0070689_100158140 Ga0070689_1001581402 192
680 3300005340 Ga0070689_100222254 Ga0070689_1002222542 192
681 3300005340 Ga0070689_100696795 Ga0070689_1006967952 192
682 3300005343 Ga0070687_100371970 Ga0070687_1003719701 192
683 3300005344 Ga0070661_100000111 Ga0070661_10000011135 192
684 3300005344 Ga0070661_100040704 Ga0070661_1000407044 192
685 3300005344 Ga0070661_101084664 Ga0070661_1010846641 192
686 3300005347 Ga0070668_100009821 Ga0070668_1000098214 192
687 3300005347 Ga0070668_100020610 Ga0070668_1000206103 192
688 3300005347 Ga0070668_100180324 Ga0070668_1001803242 192
689 3300005347 Ga0070668_100632878 Ga0070668_1006328781 192
690 3300005347 Ga0070668_100797619 Ga0070668_1007976191 192
691 3300005353 Ga0070669_100002767 Ga0070669_1000027679 192
692 3300005353 Ga0070669_100091070 Ga0070669_1000910703 192
693 3300005353 Ga0070669_100210170 Ga0070669_1002101702 192
694 3300005353 Ga0070669_100329579 Ga0070669_1003295793 192
695 3300005353 Ga0070669_100566155 Ga0070669_1005661552 192
696 3300005354 Ga0070675_100030791 Ga0070675_1000307913 192
697 3300005354 Ga0070675_100059730 Ga0070675_1000597302 192
698 3300005354 Ga0070675_100123800 Ga0070675_1001238001 192
699 3300005354 Ga0070675_100209628 Ga0070675_1002096282 192
700 3300005354 Ga0070675_100286254 Ga0070675_1002862542 192
701 3300005354 Ga0070675_100391897 Ga0070675_1003918971 192
702 3300005355 Ga0070671_100031479 Ga0070671_1000314791 192
703 3300005355 Ga0070671_100079696 Ga0070671_1000796962 192
704 3300005355 Ga0070671_100107867 Ga0070671_1001078672 192
705 3300005355 Ga0070671_100213291 Ga0070671_1002132913 192
706 3300005355 Ga0070671_100316696 Ga0070671_1003166962 192
707 3300005355 Ga0070671_100433442 Ga0070671_1004334422 192
708 3300005355 Ga0070671_100639546 Ga0070671_1006395462 192
709 3300005356 Ga0070674_100354222 Ga0070674_1003542222 192
710 3300005364 Ga0070673_100007801 Ga0070673_1000078012 192
711 3300005364 Ga0070673_100024176 Ga0070673_1000241764 192
712 3300005364 Ga0070673_100166640 Ga0070673_1001666402 192
713 3300005364 Ga0070673_100288537 Ga0070673_1002885371 192
714 3300005364 Ga0070673_100292798 Ga0070673_1002927982 192
715 3300005364 Ga0070673_100801347 Ga0070673_1008013471 192
716 3300005365 Ga0070688_100004492 Ga0070688_1000044924 192
717 3300005365 Ga0070688_100221521 Ga0070688_1002215212 192
718 3300005365 Ga0070688_101046969 Ga0070688_1010469691 192
719 3300005366 Ga0070659_100441635 Ga0070659_1004416352 192
720 3300005367 Ga0070667_100009085 Ga0070667_1000090855 192
721 3300005367 Ga0070667_100012532 Ga0070667_1000125322 192
722 3300005367 Ga0070667_100078833 Ga0070667_1000788333 192
723 3300005367 Ga0070667_100118725 Ga0070667_1001187251 192
724 3300005367 Ga0070667_100234362 Ga0070667_1002343622 192
725 3300005367 Ga0070667_100897805 Ga0070667_1008978051 192
726 3300005367 Ga0070667_101235548 Ga0070667_1012355481 192
727 3300005367 Ga0070667_101418353 Ga0070667_1014183531 192
728 3300005438 Ga0070701_10254354 Ga0070701_102543542 192
729 3300005441 Ga0070700_100066476 Ga0070700_1000664763 192
730 3300005441 Ga0070700_100309939 Ga0070700_1003099391 192
731 3300005444 Ga0070694_100498655 Ga0070694_1004986551 192
732 3300005455 Ga0070663_100187111 Ga0070663_1001871111 192
733 3300005456 Ga0070678_100028680 Ga0070678_1000286804 192
734 3300005456 Ga0070678_100052167 Ga0070678_1000521672 192
735 3300005456 Ga0070678_100132433 Ga0070678_1001324332 192
736 3300005456 Ga0070678_101306168 Ga0070678_1013061681 192
737 3300005457 Ga0070662_100006327 Ga0070662_1000063274 192
738 3300005457 Ga0070662_100042448 Ga0070662_1000424482 192
739 3300005457 Ga0070662_100197952 Ga0070662_1001979522 192
740 3300005457 Ga0070662_100277439 Ga0070662_1002774392 192
741 3300005459 Ga0068867_100007969 Ga0068867_1000079692 192
742 3300005459 Ga0068867_100011614 Ga0068867_1000116141 192
743 3300005459 Ga0068867_100011772 Ga0068867_1000117723 192
744 3300005459 Ga0068867_100027792 Ga0068867_1000277924 192
745 3300005459 Ga0068867_100056690 Ga0068867_1000566902 192
746 3300005459 Ga0068867_100073064 Ga0068867_1000730644 192
747 3300005459 Ga0068867_100095264 Ga0068867_1000952642 192
748 3300005459 Ga0068867_100272438 Ga0068867_1002724382 192
749 3300005459 Ga0068867_100317110 Ga0068867_1003171102 192
750 3300005459 Ga0068867_101320011 Ga0068867_1013200111 192
751 3300005466 Ga0070685_10161513 Ga0070685_101615131 192
752 3300005466 Ga0070685_10250184 Ga0070685_102501842 192
753 3300005471 Ga0070698_100009628 Ga0070698_1000096284 192
754 3300005471 Ga0070698_100015207 Ga0070698_1000152071 192
755 3300005471 Ga0070698_100059728 Ga0070698_1000597281 192
756 3300005518 Ga0070699_101261036 Ga0070699_1012610361 192
757 3300005535 Ga0070684_100000105 Ga0070684_1000001051 192
758 3300005535 Ga0070684_100008247 Ga0070684_1000082474 192
759 3300005539 Ga0068853_100037373 Ga0068853_1000373732 192
760 3300005539 Ga0068853_100072711 Ga0068853_1000727112 192
761 3300005539 Ga0068853_100098211 Ga0068853_1000982113 192
762 3300005539 Ga0068853_100240366 Ga0068853_1002403662 192
763 3300005539 Ga0068853_101460312 Ga0068853_1014603121 192
764 3300005543 Ga0070672_100026695 Ga0070672_1000266952 192
765 3300005543 Ga0070672_100037943 Ga0070672_1000379432 192
766 3300005543 Ga0070672_100157293 Ga0070672_1001572932 192
767 3300005543 Ga0070672_100214404 Ga0070672_1002144042 192
768 3300005543 Ga0070672_100261509 Ga0070672_1002615092 192
769 3300005544 Ga0070686_100015194 Ga0070686_1000151944 192
770 3300005544 Ga0070686_100184024 Ga0070686_1001840242 192
771 3300005544 Ga0070686_100572591 Ga0070686_1005725911 192
772 3300005547 Ga0070693_100323873 Ga0070693_1003238731 192
773 3300005548 Ga0070665_100007232 Ga0070665_1000072329 192
774 3300005548 Ga0070665_100135266 Ga0070665_1001352663 192
775 3300005548 Ga0070665_101496358 Ga0070665_1014963581 192
776 3300005548 Ga0070665_101728941 Ga0070665_1017289411 192
777 3300005549 Ga0070704_100480440 Ga0070704_1004804401 192
778 3300005563 Ga0068855_100041782 Ga0068855_1000417822 192
779 3300005563 Ga0068855_100652165 Ga0068855_1006521652 192
780 3300005563 Ga0068855_101424401 Ga0068855_1014244011 192
781 3300005564 Ga0070664_100000243 Ga0070664_10000024331 192
782 3300005564 Ga0070664_100049708 Ga0070664_1000497084 192
783 3300005564 Ga0070664_100052212 Ga0070664_1000522123 192
784 3300005564 Ga0070664_100311546 Ga0070664_1003115462 192
785 3300005564 Ga0070664_101023893 Ga0070664_1010238932 192
786 3300005577 Ga0068857_100017217 Ga0068857_1000172179 192
787 3300005577 Ga0068857_100036180 Ga0068857_1000361802 192
788 3300005577 Ga0068857_100067733 Ga0068857_1000677333 192
789 3300005577 Ga0068857_100128245 Ga0068857_1001282452 192
790 3300005577 Ga0068857_101114107 Ga0068857_1011141072 192
791 3300005577 Ga0068857_101461922 Ga0068857_1014619221 192
792 3300005578 Ga0068854_100120998 Ga0068854_1001209982 192
793 3300005578 Ga0068854_100152605 Ga0068854_1001526052 192
794 3300005614 Ga0068856_100010109 Ga0068856_1000101094 192
795 3300005614 Ga0068856_101427193 Ga0068856_1014271931 192
796 3300005615 Ga0070702_100109243 Ga0070702_1001092433 192
797 3300005615 Ga0070702_100304833 Ga0070702_1003048332 192
798 3300005616 Ga0068852_100006022 Ga0068852_1000060227 192
799 3300005616 Ga0068852_100605398 Ga0068852_1006053982 192
800 3300005616 Ga0068852_100912456 Ga0068852_1009124562 192
801 3300005617 Ga0068859_100000025 Ga0068859_10000002526 192
802 3300005617 Ga0068859_100005715 Ga0068859_10000571510 192
803 3300005617 Ga0068859_100007026 Ga0068859_1000070266 192
804 3300005617 Ga0068859_100024673 Ga0068859_1000246737 192
805 3300005617 Ga0068859_100044169 Ga0068859_1000441692 192
806 3300005617 Ga0068859_100055221 Ga0068859_1000552214 192
807 3300005617 Ga0068859_100069009 Ga0068859_1000690092 192
808 3300005617 Ga0068859_100105576 Ga0068859_1001055762 192
809 3300005617 Ga0068859_100226519 Ga0068859_1002265192 192
810 3300005617 Ga0068859_100287546 Ga0068859_1002875462 192
811 3300005617 Ga0068859_101307987 Ga0068859_1013079872 192
812 3300005617 Ga0068859_102093677 Ga0068859_1020936771 192
813 3300005618 Ga0068864_100006400 Ga0068864_1000064002 192
814 3300005618 Ga0068864_100016974 Ga0068864_1000169745 192
815 3300005618 Ga0068864_100019781 Ga0068864_1000197813 192
816 3300005618 Ga0068864_100031973 Ga0068864_1000319732 192
817 3300005618 Ga0068864_100051432 Ga0068864_1000514323 192
818 3300005618 Ga0068864_100096445 Ga0068864_1000964453 192
819 3300005618 Ga0068864_100960327 Ga0068864_1009603271 192
820 3300005718 Ga0068866_10025452 Ga0068866_100254522 192
821 3300005718 Ga0068866_10036264 Ga0068866_100362642 192
822 3300005718 Ga0068866_10080813 Ga0068866_100808132 192
823 3300005718 Ga0068866_10588888 Ga0068866_105888881 192
824 3300005719 Ga0068861_100004483 Ga0068861_1000044836 192
825 3300005719 Ga0068861_100233595 Ga0068861_1002335952 192
826 3300005719 Ga0068861_100237197 Ga0068861_1002371972 192
827 3300005719 Ga0068861_100768189 Ga0068861_1007681892 192
828 3300005719 Ga0068861_101263180 Ga0068861_1012631801 192
829 3300005834 Ga0068851_10057111 Ga0068851_100571112 192
830 3300005834 Ga0068851_10264846 Ga0068851_102648461 192
831 3300005840 Ga0068870_10002856 Ga0068870_100028566 192
832 3300005840 Ga0068870_10003154 Ga0068870_100031542 192
833 3300005840 Ga0068870_10035701 Ga0068870_100357012 192
834 3300005840 Ga0068870_10344224 Ga0068870_103442241 192
835 3300005841 Ga0068863_100001503 Ga0068863_1000015032 192
836 3300005841 Ga0068863_100015998 Ga0068863_1000159984 192
837 3300005841 Ga0068863_100056874 Ga0068863_1000568744 192
838 3300005841 Ga0068863_100153862 Ga0068863_1001538622 192
839 3300005841 Ga0068863_100177915 Ga0068863_1001779153 192
840 3300005841 Ga0068863_100441844 Ga0068863_1004418442 192
841 3300005841 Ga0068863_101401956 Ga0068863_1014019561 192
842 3300005842 Ga0068858_100043979 Ga0068858_1000439794 192
843 3300005842 Ga0068858_100075033 Ga0068858_1000750333 192
844 3300005842 Ga0068858_100206090 Ga0068858_1002060902 192
845 3300005842 Ga0068858_100867059 Ga0068858_1008670591 192
846 3300005843 Ga0068860_100000443 Ga0068860_1000004432 192
847 3300005843 Ga0068860_100001434 Ga0068860_10000143413 192
848 3300005843 Ga0068860_100054045 Ga0068860_1000540453 192
849 3300005843 Ga0068860_100199964 Ga0068860_1001999642 192
850 3300005843 Ga0068860_100361252 Ga0068860_1003612521 192
851 3300005843 Ga0068860_100364842 Ga0068860_1003648422 192
852 3300005843 Ga0068860_100402830 Ga0068860_1004028302 192
853 3300005843 Ga0068860_100594475 Ga0068860_1005944752 192
854 3300005843 Ga0068860_100723326 Ga0068860_1007233261 192
855 3300005843 Ga0068860_100881070 Ga0068860_1008810701 192
856 3300005844 Ga0068862_100033339 Ga0068862_1000333392 192
857 3300005844 Ga0068862_100040968 Ga0068862_1000409684 192
858 3300005844 Ga0068862_100203214 Ga0068862_1002032142 192
859 3300005844 Ga0068862_100412336 Ga0068862_1004123362 192
860 3300005844 Ga0068862_100694697 Ga0068862_1006946972 192
861 3300006042 Ga0075368_10285906 Ga0075368_102859061 192
862 3300006163 Ga0070715_10008603 Ga0070715_100086034 192
863 3300006177 Ga0075362_10155472 Ga0075362_101554721 192
864 3300006195 Ga0075366_10005278 Ga0075366_100052784 192
865 3300006195 Ga0075366_10015186 Ga0075366_100151866 192
866 3300006195 Ga0075366_10110717 Ga0075366_101107172 192
867 3300006237 Ga0097621_100000359 Ga0097621_1000003597 192
868 3300006237 Ga0097621_100001013 Ga0097621_1000010136 192
869 3300006237 Ga0097621_100006956 Ga0097621_1000069562 192
870 3300006237 Ga0097621_100008617 Ga0097621_1000086173 192
871 3300006237 Ga0097621_100229366 Ga0097621_1002293663 192
872 3300006237 Ga0097621_100279711 Ga0097621_1002797112 192
873 3300006237 Ga0097621_100307806 Ga0097621_1003078062 192
874 3300006358 Ga0068871_100001198 Ga0068871_10000119810 192
875 3300006358 Ga0068871_100007075 Ga0068871_1000070755 192
876 3300006358 Ga0068871_100056438 Ga0068871_1000564382 192
877 3300006358 Ga0068871_100178144 Ga0068871_1001781442 192
878 3300006358 Ga0068871_100180548 Ga0068871_1001805482 192
879 3300006358 Ga0068871_100224985 Ga0068871_1002249852 192
880 3300006358 Ga0068871_100524094 Ga0068871_1005240942 192
881 3300006358 Ga0068871_100754737 Ga0068871_1007547372 192
882 3300006844 Ga0075428_100007814 Ga0075428_1000078149 192
883 3300006846 Ga0075430_100000960 Ga0075430_10000096017 192
884 3300006846 Ga0075430_100049369 Ga0075430_1000493692 192
885 3300006846 Ga0075430_100510741 Ga0075430_1005107412 192
886 3300006847 Ga0075431_100015973 Ga0075431_1000159738 192
887 3300006847 Ga0075431_100041784 Ga0075431_1000417842 192
888 3300006847 Ga0075431_100042520 Ga0075431_1000425202 192
889 3300006880 Ga0075429_100011087 Ga0075429_1000110875 192
890 3300006880 Ga0075429_100017423 Ga0075429_1000174234 192
891 3300006881 Ga0068865_100021658 Ga0068865_1000216582 192
892 3300006881 Ga0068865_100036806 Ga0068865_1000368062 192
893 3300006881 Ga0068865_100249088 Ga0068865_1002490881 192
894 3300006881 Ga0068865_100288219 Ga0068865_1002882193 192
895 3300006881 Ga0068865_100322226 Ga0068865_1003222261 192
896 3300006881 Ga0068865_100442626 Ga0068865_1004426262 192
897 3300006931 Ga0097620_100000025 Ga0097620_10000002526 192
898 3300006931 Ga0097620_100005715 Ga0097620_10000571510 192
899 3300006931 Ga0097620_100007026 Ga0097620_1000070266 192
900 3300006931 Ga0097620_100024672 Ga0097620_1000246727 192
901 3300006931 Ga0097620_100044169 Ga0097620_1000441692 192
902 3300006931 Ga0097620_100055225 Ga0097620_1000552254 192
903 3300006931 Ga0097620_100068386 Ga0097620_1000683862 192
904 3300006931 Ga0097620_100069008 Ga0097620_1000690082 192
905 3300006931 Ga0097620_100105577 Ga0097620_1001055772 192
906 3300006931 Ga0097620_100226519 Ga0097620_1002265192 192
907 3300006931 Ga0097620_100287544 Ga0097620_1002875442 192
908 3300006931 Ga0097620_101307807 Ga0097620_1013078072 192
909 3300006931 Ga0097620_102093675 Ga0097620_1020936751 192
910 3300009011 Ga0105251_10123147 Ga0105251_101231472 192
911 3300009093 Ga0105240_10024771 Ga0105240_100247713 192
912 3300009094 Ga0111539_10013348 Ga0111539_100133486 192
913 3300009094 Ga0111539_10193808 Ga0111539_101938082 192
914 3300009094 Ga0111539_10792345 Ga0111539_107923452 192
915 3300009101 Ga0105247_10004482 Ga0105247_1000448210 192
916 3300009101 Ga0105247_10007771 Ga0105247_100077712 192
917 3300009101 Ga0105247_10105064 Ga0105247_101050642 192
918 3300009101 Ga0105247_10166741 Ga0105247_101667412 192
919 3300009147 Ga0114129_10005551 Ga0114129_100055513 192
920 3300009174 Ga0105241_10000583 Ga0105241_100005835 192
921 3300009174 Ga0105241_10007773 Ga0105241_100077732 192
922 3300009174 Ga0105241_10060867 Ga0105241_100608674 192
923 3300009174 Ga0105241_10104753 Ga0105241_101047532 192
924 3300009174 Ga0105241_10400392 Ga0105241_104003922 192
925 3300009174 Ga0105241_10442505 Ga0105241_104425052 192
926 3300009176 Ga0105242_10014258 Ga0105242_100142583 192
927 3300009176 Ga0105242_10049986 Ga0105242_100499862 192
928 3300009176 Ga0105242_10071856 Ga0105242_100718563 192
929 3300009176 Ga0105242_10633786 Ga0105242_106337862 192
930 3300009176 Ga0105242_11321006 Ga0105242_113210061 192
931 3300009177 Ga0105248_10245972 Ga0105248_102459722 192
932 3300009545 Ga0105237_10002013 Ga0105237_100020131 192
933 3300009545 Ga0105237_10020602 Ga0105237_100206025 192
934 3300009545 Ga0105237_11514974 Ga0105237_115149741 192
935 3300009553 Ga0105249_10001096 Ga0105249_1000109618 192
936 3300009553 Ga0105249_10003251 Ga0105249_100032513 192
937 3300009553 Ga0105249_10008489 Ga0105249_100084894 192
938 3300009553 Ga0105249_10013225 Ga0105249_100132254 192
939 3300009553 Ga0105249_10021033 Ga0105249_100210331 192
940 3300009553 Ga0105249_10164802 Ga0105249_101648022 192
941 3300009553 Ga0105249_10394897 Ga0105249_103948972 192
942 3300009553 Ga0105249_11144550 Ga0105249_111445501 192
943 3300009553 Ga0105249_11231787 Ga0105249_112317872 192
944 3300010375 Ga0105239_10003738 Ga0105239_1000373814 192
945 3300010375 Ga0105239_10009153 Ga0105239_100091537 192
946 3300010375 Ga0105239_10157371 Ga0105239_101573713 192
947 3300010375 Ga0105239_10198268 Ga0105239_101982682 192
948 3300011119 Ga0105246_10006859 Ga0105246_100068592 192
949 3300011119 Ga0105246_10017282 Ga0105246_100172826 192
950 3300011119 Ga0105246_10157402 Ga0105246_101574022 192
951 3300011119 Ga0105246_10323729 Ga0105246_103237291 192
952 3300011119 Ga0105246_10349734 Ga0105246_103497342 192
953 3300012506 Ga0157324_1010930 Ga0157324_10109302 192
954 3300013100 Ga0157373_10034411 Ga0157373_100344112 192
955 3300013102 Ga0157371_10439405 Ga0157371_104394052 192
956 3300013104 Ga0157370_10013148 Ga0157370_100131482 192
957 3300013296 Ga0157374_10007442 Ga0157374_100074424 192
958 3300013296 Ga0157374_10024269 Ga0157374_100242694 192
959 3300013296 Ga0157374_10046292 Ga0157374_100462923 192
960 3300013296 Ga0157374_10185774 Ga0157374_101857743 192
961 3300013296 Ga0157374_10345802 Ga0157374_103458022 192
962 3300013296 Ga0157374_10351128 Ga0157374_103511282 192
963 3300013297 Ga0157378_10010333 Ga0157378_100103335 192
964 3300013297 Ga0157378_10020956 Ga0157378_100209562 192
965 3300013297 Ga0157378_10023648 Ga0157378_100236486 192
966 3300013297 Ga0157378_10085900 Ga0157378_100859004 192
967 3300013297 Ga0157378_10091795 Ga0157378_100917951 192
968 3300013297 Ga0157378_10130990 Ga0157378_101309903 192
969 3300013297 Ga0157378_10196530 Ga0157378_101965302 192
970 3300013297 Ga0157378_10228607 Ga0157378_102286072 192
971 3300013297 Ga0157378_11046476 Ga0157378_110464762 192
972 3300013297 Ga0157378_11413204 Ga0157378_114132041 192
973 3300013306 Ga0163162_10000424 Ga0163162_1000042414 192
974 3300013306 Ga0163162_10002193 Ga0163162_1000219321 192
975 3300013306 Ga0163162_10040893 Ga0163162_100408934 192
976 3300013306 Ga0163162_10074959 Ga0163162_100749592 192
977 3300013306 Ga0163162_10122892 Ga0163162_101228923 192
978 3300013306 Ga0163162_10220830 Ga0163162_102208301 192
979 3300013306 Ga0163162_10372522 Ga0163162_103725222 192
980 3300013306 Ga0163162_10487776 Ga0163162_104877761 192
981 3300013306 Ga0163162_10948021 Ga0163162_109480212 192
982 3300013306 Ga0163162_11097598 Ga0163162_110975982 192
983 3300013306 Ga0163162_11670075 Ga0163162_116700751 192
984 3300013307 Ga0157372_10030649 Ga0157372_100306494 192
985 3300013307 Ga0157372_10156054 Ga0157372_101560543 192
986 3300013308 Ga0157375_10011768 Ga0157375_100117689 192
987 3300013308 Ga0157375_10026087 Ga0157375_100260874 192
988 3300013308 Ga0157375_10031855 Ga0157375_100318553 192
989 3300013308 Ga0157375_10032063 Ga0157375_100320632 192
990 3300013308 Ga0157375_10074180 Ga0157375_100741803 192
991 3300013308 Ga0157375_10098473 Ga0157375_100984732 192
992 3300013308 Ga0157375_10369855 Ga0157375_103698552 192
993 3300013308 Ga0157375_10727691 Ga0157375_107276911 192
994 3300013308 Ga0157375_11494807 Ga0157375_114948071 192
995 3300013308 Ga0157375_11621536 Ga0157375_116215361 192
996 3300014325 Ga0163163_10094560 Ga0163163_100945603 192
997 3300014325 Ga0163163_10132178 Ga0163163_101321783 192
998 3300014325 Ga0163163_10211587 Ga0163163_102115872 192
999 3300014325 Ga0163163_11142596 Ga0163163_111425962 192
1000 3300014326 Ga0157380_10019688 Ga0157380_100196884 192
1001 3300014326 Ga0157380_10058768 Ga0157380_100587682 192
1002 3300014326 Ga0157380_11276268 Ga0157380_112762681 192
1003 3300014326 Ga0157380_11914773 Ga0157380_119147731 192
1004 3300014745 Ga0157377_10000678 Ga0157377_100006784 192
1005 3300014745 Ga0157377_10010998 Ga0157377_100109985 192
1006 3300014745 Ga0157377_10774175 Ga0157377_107741751 192
1007 3300014968 Ga0157379_10058453 Ga0157379_100584534 192
1008 3300014968 Ga0157379_10061393 Ga0157379_100613932 192
1009 3300014968 Ga0157379_10116345 Ga0157379_101163452 192
1010 3300014968 Ga0157379_10225863 Ga0157379_102258633 192
1011 3300014968 Ga0157379_10231500 Ga0157379_102315002 192
1012 3300014968 Ga0157379_10291825 Ga0157379_102918251 192
1013 3300014969 Ga0157376_10001885 Ga0157376_100018855 192
1014 3300014969 Ga0157376_10038461 Ga0157376_100384613 192
1015 3300014969 Ga0157376_10050196 Ga0157376_100501961 192
1016 3300014969 Ga0157376_10072036 Ga0157376_100720363 192
1017 3300014969 Ga0157376_10257732 Ga0157376_102577322 192
1018 3300014969 Ga0157376_10289725 Ga0157376_102897252 192
1019 3300014969 Ga0157376_10311207 Ga0157376_103112071 192
1020 3300014969 Ga0157376_10435270 Ga0157376_104352702 192
1021 3300014969 Ga0157376_11486976 Ga0157376_114869761 192
1022 3300017792 Ga0163161_10009090 Ga0163161_100090907 192
1023 3300017792 Ga0163161_10067198 Ga0163161_100671983 192
1024 3300017792 Ga0163161_10175276 Ga0163161_101752762 192
1025 3300017792 Ga0163161_10295801 Ga0163161_102958012 192
1026 3300020069 Ga0197907_10540640 Ga0197907_105406402 192
1027 3300021384 Ga0213876_10003359 Ga0213876_100033598 192
1028 3300021384 Ga0213876_10252200 Ga0213876_102522001 192
1029 3300025246 Ga0209646_1000428 Ga0209646_10004289 192
1030 3300025271 Ga0207666_1031875 Ga0207666_10318751 192
1031 3300025302 Ga0207426_1000230 Ga0207426_100023080 192
1032 3300025315 Ga0207697_10047026 Ga0207697_100470262 192
1033 3300025315 Ga0207697_10129237 Ga0207697_101292372 192
1034 3300025321 Ga0207656_10117772 Ga0207656_101177722 192
1035 3300025321 Ga0207656_10184059 Ga0207656_101840591 192
1036 3300025893 Ga0207682_10008288 Ga0207682_100082884 192
1037 3300025893 Ga0207682_10079399 Ga0207682_100793991 192
1038 3300025893 Ga0207682_10128897 Ga0207682_101288972 192
1039 3300025899 Ga0207642_10016736 Ga0207642_100167362 192
1040 3300025899 Ga0207642_10135370 Ga0207642_101353701 192
1041 3300025899 Ga0207642_10442008 Ga0207642_104420081 192
1042 3300025900 Ga0207710_10005590 Ga0207710_100055906 192
1043 3300025900 Ga0207710_10009215 Ga0207710_100092152 192
1044 3300025901 Ga0207688_10302526 Ga0207688_103025262 192
1045 3300025901 Ga0207688_10309247 Ga0207688_103092472 192
1046 3300025903 Ga0207680_10000180 Ga0207680_1000018012 192
1047 3300025903 Ga0207680_10029849 Ga0207680_100298494 192
1048 3300025903 Ga0207680_10090961 Ga0207680_100909611 192
1049 3300025903 Ga0207680_10160351 Ga0207680_101603512 192
1050 3300025903 Ga0207680_10826100 Ga0207680_108261001 192
1051 3300025904 Ga0207647_10074097 Ga0207647_100740972 192
1052 3300025905 Ga0207685_10068044 Ga0207685_100680442 192
1053 3300025905 Ga0207685_10104160 Ga0207685_101041602 192
1054 3300025907 Ga0207645_10000326 Ga0207645_1000032637 192
1055 3300025907 Ga0207645_10024269 Ga0207645_100242693 192
1056 3300025907 Ga0207645_10058499 Ga0207645_100584992 192
1057 3300025907 Ga0207645_10073710 Ga0207645_100737102 192
1058 3300025907 Ga0207645_10150341 Ga0207645_101503412 192
1059 3300025908 Ga0207643_10004929 Ga0207643_100049294 192
1060 3300025908 Ga0207643_10014031 Ga0207643_100140312 192
1061 3300025908 Ga0207643_10064949 Ga0207643_100649492 192
1062 3300025908 Ga0207643_10125503 Ga0207643_101255032 192
1063 3300025911 Ga0207654_10115371 Ga0207654_101153712 192
1064 3300025911 Ga0207654_10325850 Ga0207654_103258502 192
1065 3300025913 Ga0207695_10062333 Ga0207695_100623332 192
1066 3300025914 Ga0207671_10139180 Ga0207671_101391802 192
1067 3300025919 Ga0207657_10113770 Ga0207657_101137701 192
1068 3300025920 Ga0207649_10000517 Ga0207649_1000051720 192
1069 3300025920 Ga0207649_10032417 Ga0207649_100324171 192
1070 3300025923 Ga0207681_10141535 Ga0207681_101415353 192
1071 3300025923 Ga0207681_10150477 Ga0207681_101504772 192
1072 3300025923 Ga0207681_10229236 Ga0207681_102292363 192
1073 3300025923 Ga0207681_10405152 Ga0207681_104051521 192
1074 3300025923 Ga0207681_10410026 Ga0207681_104100261 192
1075 3300025923 Ga0207681_10426336 Ga0207681_104263361 192
1076 3300025925 Ga0207650_10048549 Ga0207650_100485491 192
1077 3300025925 Ga0207650_10075035 Ga0207650_100750352 192
1078 3300025925 Ga0207650_10090022 Ga0207650_100900223 192
1079 3300025925 Ga0207650_10121462 Ga0207650_101214623 192
1080 3300025925 Ga0207650_10131573 Ga0207650_101315732 192
1081 3300025925 Ga0207650_10843593 Ga0207650_108435931 192
1082 3300025925 Ga0207650_10929430 Ga0207650_109294302 192
1083 3300025926 Ga0207659_10062942 Ga0207659_100629424 192
1084 3300025926 Ga0207659_10124775 Ga0207659_101247753 192
1085 3300025926 Ga0207659_10233304 Ga0207659_102333042 192
1086 3300025927 Ga0207687_10385532 Ga0207687_103855321 192
1087 3300025931 Ga0207644_10010988 Ga0207644_100109885 192
1088 3300025931 Ga0207644_10102421 Ga0207644_101024211 192
1089 3300025931 Ga0207644_10179728 Ga0207644_101797281 192
1090 3300025931 Ga0207644_10221966 Ga0207644_102219662 192
1091 3300025931 Ga0207644_10367779 Ga0207644_103677791 192
1092 3300025931 Ga0207644_10514872 Ga0207644_105148721 192
1093 3300025931 Ga0207644_10631743 Ga0207644_106317431 192
1094 3300025931 Ga0207644_10800197 Ga0207644_108001971 192
1095 3300025931 Ga0207644_10821900 Ga0207644_108219001 192
1096 3300025932 Ga0207690_10073558 Ga0207690_100735582 192
1097 3300025932 Ga0207690_10125399 Ga0207690_101253992 192
1098 3300025933 Ga0207706_10016387 Ga0207706_100163875 192
1099 3300025933 Ga0207706_10020556 Ga0207706_100205568 192
1100 3300025933 Ga0207706_10042762 Ga0207706_100427623 192
1101 3300025933 Ga0207706_10107261 Ga0207706_101072613 192
1102 3300025933 Ga0207706_10280866 Ga0207706_102808661 192
1103 3300025933 Ga0207706_10438003 Ga0207706_104380032 192
1104 3300025933 Ga0207706_11127979 Ga0207706_111279791 192
1105 3300025934 Ga0207686_10001189 Ga0207686_100011894 192
1106 3300025934 Ga0207686_10217714 Ga0207686_102177142 192
1107 3300025934 Ga0207686_10531715 Ga0207686_105317152 192
1108 3300025936 Ga0207670_10019099 Ga0207670_100190992 192
1109 3300025936 Ga0207670_10025493 Ga0207670_100254933 192
1110 3300025936 Ga0207670_10125996 Ga0207670_101259962 192
1111 3300025937 Ga0207669_10121985 Ga0207669_101219851 192
1112 3300025937 Ga0207669_10159144 Ga0207669_101591442 192
1113 3300025937 Ga0207669_10785710 Ga0207669_107857101 192
1114 3300025938 Ga0207704_10100454 Ga0207704_101004542 192
1115 3300025938 Ga0207704_10220807 Ga0207704_102208072 192
1116 3300025938 Ga0207704_10254372 Ga0207704_102543721 192
1117 3300025938 Ga0207704_10846069 Ga0207704_108460692 192
1118 3300025940 Ga0207691_10008770 Ga0207691_100087707 192
1119 3300025940 Ga0207691_10092285 Ga0207691_100922852 192
1120 3300025940 Ga0207691_10123516 Ga0207691_101235162 192
1121 3300025940 Ga0207691_10166281 Ga0207691_101662812 192
1122 3300025940 Ga0207691_10577767 Ga0207691_105777672 192
1123 3300025941 Ga0207711_10631223 Ga0207711_106312232 192
1124 3300025942 Ga0207689_10000208 Ga0207689_1000020817 192
1125 3300025942 Ga0207689_10001060 Ga0207689_1000106025 192
1126 3300025942 Ga0207689_10009934 Ga0207689_100099344 192
1127 3300025942 Ga0207689_10037110 Ga0207689_100371103 192
1128 3300025942 Ga0207689_10037929 Ga0207689_100379292 192
1129 3300025942 Ga0207689_10105863 Ga0207689_101058631 192
1130 3300025942 Ga0207689_10271717 Ga0207689_102717172 192
1131 3300025942 Ga0207689_10373769 Ga0207689_103737691 192
1132 3300025942 Ga0207689_10423549 Ga0207689_104235491 192
1133 3300025944 Ga0207661_10005152 Ga0207661_100051528 192
1134 3300025944 Ga0207661_10014985 Ga0207661_100149854 192
1135 3300025944 Ga0207661_10199373 Ga0207661_101993731 192
1136 3300025944 Ga0207661_10847963 Ga0207661_108479632 192
1137 3300025945 Ga0207679_10000091 Ga0207679_1000009149 192
1138 3300025945 Ga0207679_10143727 Ga0207679_101437273 192
1139 3300025945 Ga0207679_10154060 Ga0207679_101540602 192
1140 3300025949 Ga0207667_10019132 Ga0207667_100191322 192
1141 3300025960 Ga0207651_10021739 Ga0207651_100217393 192
1142 3300025960 Ga0207651_10027471 Ga0207651_100274712 192
1143 3300025960 Ga0207651_10031956 Ga0207651_100319562 192
1144 3300025960 Ga0207651_10047578 Ga0207651_100475782 192
1145 3300025960 Ga0207651_10086102 Ga0207651_100861022 192
1146 3300025960 Ga0207651_10124527 Ga0207651_101245272 192
1147 3300025961 Ga0207712_10001457 Ga0207712_1000145717 192
1148 3300025961 Ga0207712_10003706 Ga0207712_100037065 192
1149 3300025961 Ga0207712_10005164 Ga0207712_100051648 192
1150 3300025961 Ga0207712_10013201 Ga0207712_100132015 192
1151 3300025961 Ga0207712_10037790 Ga0207712_100377902 192
1152 3300025961 Ga0207712_10047684 Ga0207712_100476841 192
1153 3300025961 Ga0207712_10062027 Ga0207712_100620272 192
1154 3300025961 Ga0207712_10076224 Ga0207712_100762243 192
1155 3300025961 Ga0207712_10196951 Ga0207712_101969512 192
1156 3300025961 Ga0207712_10927891 Ga0207712_109278911 192
1157 3300025961 Ga0207712_11057476 Ga0207712_110574761 192
1158 3300025972 Ga0207668_10047293 Ga0207668_100472933 192
1159 3300025972 Ga0207668_10049242 Ga0207668_100492422 192
1160 3300025972 Ga0207668_10077133 Ga0207668_100771333 192
1161 3300025972 Ga0207668_10183382 Ga0207668_101833821 192
1162 3300025972 Ga0207668_10287486 Ga0207668_102874862 192
1163 3300025972 Ga0207668_10359318 Ga0207668_103593182 192
1164 3300025981 Ga0207640_10037553 Ga0207640_100375532 192
1165 3300025981 Ga0207640_10041598 Ga0207640_100415984 192
1166 3300025981 Ga0207640_10133836 Ga0207640_101338362 192
1167 3300025981 Ga0207640_10452346 Ga0207640_104523462 192
1168 3300025986 Ga0207658_10030114 Ga0207658_100301144 192
1169 3300025986 Ga0207658_10043150 Ga0207658_100431502 192
1170 3300025986 Ga0207658_10051498 Ga0207658_100514983 192
1171 3300025986 Ga0207658_10119616 Ga0207658_101196162 192
1172 3300025986 Ga0207658_10206271 Ga0207658_102062713 192
1173 3300025986 Ga0207658_10237458 Ga0207658_102374581 192
1174 3300026023 Ga0207677_10031308 Ga0207677_100313083 192
1175 3300026023 Ga0207677_10039603 Ga0207677_100396032 192
1176 3300026023 Ga0207677_10089938 Ga0207677_100899381 192
1177 3300026023 Ga0207677_10145146 Ga0207677_101451463 192
1178 3300026023 Ga0207677_10454609 Ga0207677_104546091 192
1179 3300026023 Ga0207677_10705594 Ga0207677_107055941 192
1180 3300026023 Ga0207677_11089309 Ga0207677_110893091 192
1181 3300026035 Ga0207703_10043008 Ga0207703_100430083 192
1182 3300026035 Ga0207703_10075085 Ga0207703_100750853 192
1183 3300026035 Ga0207703_10161076 Ga0207703_101610762 192
1184 3300026035 Ga0207703_10181071 Ga0207703_101810712 192
1185 3300026035 Ga0207703_10462785 Ga0207703_104627852 192
1186 3300026035 Ga0207703_10789711 Ga0207703_107897111 192
1187 3300026041 Ga0207639_10003957 Ga0207639_100039572 192
1188 3300026041 Ga0207639_10104998 Ga0207639_101049982 192
1189 3300026041 Ga0207639_10235394 Ga0207639_102353942 192
1190 3300026041 Ga0207639_10334759 Ga0207639_103347592 192
1191 3300026041 Ga0207639_10392718 Ga0207639_103927182 192
1192 3300026067 Ga0207678_10025516 Ga0207678_100255167 192
1193 3300026067 Ga0207678_10194329 Ga0207678_101943292 192
1194 3300026067 Ga0207678_10743373 Ga0207678_107433732 192
1195 3300026075 Ga0207708_10095331 Ga0207708_100953313 192
1196 3300026075 Ga0207708_10280527 Ga0207708_102805272 192
1197 3300026078 Ga0207702_10007625 Ga0207702_100076256 192
1198 3300026088 Ga0207641_10000132 Ga0207641_1000013257 192
1199 3300026088 Ga0207641_10009890 Ga0207641_100098905 192
1200 3300026088 Ga0207641_10038936 Ga0207641_100389365 192
1201 3300026088 Ga0207641_10189474 Ga0207641_101894742 192
1202 3300026089 Ga0207648_10001340 Ga0207648_1000134019 192
1203 3300026089 Ga0207648_10032519 Ga0207648_100325193 192
1204 3300026089 Ga0207648_10047813 Ga0207648_100478132 192
1205 3300026089 Ga0207648_10063699 Ga0207648_100636992 192
1206 3300026089 Ga0207648_10096399 Ga0207648_100963993 192
1207 3300026089 Ga0207648_10137067 Ga0207648_101370672 192
1208 3300026089 Ga0207648_10181507 Ga0207648_101815073 192
1209 3300026089 Ga0207648_10325433 Ga0207648_103254332 192
1210 3300026089 Ga0207648_10374179 Ga0207648_103741792 192
1211 3300026089 Ga0207648_10512712 Ga0207648_105127121 192
1212 3300026095 Ga0207676_10012403 Ga0207676_100124034 192
1213 3300026095 Ga0207676_10026923 Ga0207676_100269233 192
1214 3300026095 Ga0207676_10077302 Ga0207676_100773023 192
1215 3300026095 Ga0207676_10173598 Ga0207676_101735981 192
1216 3300026095 Ga0207676_10230216 Ga0207676_102302162 192
1217 3300026095 Ga0207676_10727523 Ga0207676_107275231 192
1218 3300026095 Ga0207676_11127160 Ga0207676_111271601 192
1219 3300026116 Ga0207674_10006896 Ga0207674_1000689611 192
1220 3300026116 Ga0207674_10023357 Ga0207674_100233579 192
1221 3300026116 Ga0207674_10057709 Ga0207674_100577092 192
1222 3300026116 Ga0207674_10067997 Ga0207674_100679972 192
1223 3300026116 Ga0207674_10127622 Ga0207674_101276222 192
1224 3300026118 Ga0207675_100000085 Ga0207675_10000008560 192
1225 3300026118 Ga0207675_100016346 Ga0207675_1000163466 192
1226 3300026118 Ga0207675_100035584 Ga0207675_1000355844 192
1227 3300026118 Ga0207675_100088384 Ga0207675_1000883842 192
1228 3300026118 Ga0207675_100377379 Ga0207675_1003773792 192
1229 3300026118 Ga0207675_100435228 Ga0207675_1004352282 192
1230 3300026118 Ga0207675_100524824 Ga0207675_1005248242 192
1231 3300026121 Ga0207683_10005340 Ga0207683_100053409 192
1232 3300026121 Ga0207683_10016473 Ga0207683_100164732 192
1233 3300026121 Ga0207683_10279253 Ga0207683_102792532 192
1234 3300026121 Ga0207683_10324796 Ga0207683_103247962 192
1235 3300026121 Ga0207683_10617006 Ga0207683_106170061 192
1236 3300026142 Ga0207698_10011519 Ga0207698_100115192 192
1237 3300026142 Ga0207698_10035407 Ga0207698_100354074 192
1238 3300026142 Ga0207698_10569123 Ga0207698_105691232 192
1239 3300026142 Ga0207698_10683766 Ga0207698_106837662 192
1240 3300026142 Ga0207698_10800923 Ga0207698_108009232 192
1241 3300026142 Ga0207698_11257536 Ga0207698_112575362 192
1242 3300027876 Ga0209974_10117311 Ga0209974_101173112 192
1243 3300027876 Ga0209974_10131091 Ga0209974_101310911 192
1244 3300027907 Ga0207428_10194312 Ga0207428_101943122 192
1245 3300028379 Ga0268266_10050525 Ga0268266_100505254 192
1246 3300028379 Ga0268266_10144908 Ga0268266_101449082 192
1247 3300028379 Ga0268266_10213214 Ga0268266_102132142 192
1248 3300028379 Ga0268266_10891988 Ga0268266_108919881 192
1249 3300028380 Ga0268265_10038653 Ga0268265_100386532 192
1250 3300028380 Ga0268265_10190141 Ga0268265_101901412 192
1251 3300028381 Ga0268264_10002198 Ga0268264_100021984 192
1252 3300028381 Ga0268264_10060420 Ga0268264_100604203 192
1253 3300028381 Ga0268264_10061200 Ga0268264_100612002 192
1254 3300028381 Ga0268264_10062135 Ga0268264_100621352 192
1255 3300028381 Ga0268264_10287183 Ga0268264_102871832 192
1256 3300028381 Ga0268264_10575443 Ga0268264_105754432 192
1257 3300028794 Ga0307515_10000001 Ga0307515_100000012018 192
1258 3300028794 Ga0307515_10000437 Ga0307515_1000043721 192
1259 3300029957 Ga0265324_10025756 Ga0265324_100257562 192
1260 3300030731 Ga0316177_1202552 Ga0316177_12025522 192
1261 3300031251 Ga0265327_10185022 Ga0265327_101850222 192
1262 3300031456 Ga0307513_10053858 Ga0307513_100538582 192
1263 3300031507 Ga0307509_10046582 Ga0307509_100465824 192
1264 3300031901 Ga0307406_10648888 Ga0307406_106488881 192
1265 3300032004 Ga0307414_10578930 Ga0307414_105789302 192
1266 3300032004 Ga0307414_10921577 Ga0307414_109215772 192
1267 3300035172 Ga0373955_0016181 Ga0373955_0016181_703_1281 192
1268 3300035692 Ga0373935_0287424 Ga0373935_0287424_491_1072 192
1269 3300035724 Ga0373933_0011503 Ga0373933_0011503_3949_4527 192
1270 3300036401 Ga0373937_0028695 Ga0373937_0028695_59_637 192
1271 3300036401 Ga0373937_0245697 Ga0373937_0245697_647_1228 192
1272 3300039437 Ga0436365_0695509 Ga0436365_0695509_7442_8023 192
1273 3300039450 Ga0436363_1310381 Ga0436363_1310381_338_919 192
1274 3300041404 Ga0439436_0000892 Ga0439436_0000892_5174_5755 192
1275 3300041406 Ga0439439_0105642 Ga0439439_0105642_110_691 192
1276 3300041408 Ga0439453_0003875 Ga0439453_0003875_1013_1591 192
1277 3300041410 Ga0439461_0005814 Ga0439461_0005814_1383_1964 192
1278 3300041413 Ga0439465_0113123 Ga0439465_0113123_272_853 192
1279 3300041445 Ga0451792_03301 Ga0451792_03301_13_594 192
1280 3300041452 Ga0451793_0024139 Ga0451793_0024139_67_645 192
1281 3300041460 Ga0451802_1945429 Ga0451802_1945429_117_701 192
1282 3300041463 Ga0451804_0553358 Ga0451804_0553358_177_758 192
1283 3300041486 Ga0451807_1598288 Ga0451807_1598288_126_707 192
1284 3300041494 Ga0451837_1580665 Ga0451837_1580665_473_1054 192
1285 3300041498 Ga0451841_1153364 Ga0451841_1153364_291_872 192
1286 3300041509 Ga0451843_0874254 Ga0451843_0874254_169_750 192
1287 3300041997 Ga0439431_0028317 Ga0439431_0028317_512_1093 192
1288 3300041997 Ga0439431_0105498 Ga0439431_0105498_57_638 192
1289 3300041999 Ga0439433_0061867 Ga0439433_0061867_168_749 192
1290 3300042001 Ga0439441_034466 Ga0439441_034466_405_983 192
1291 3300042003 Ga0439443_030538 Ga0439443_030538_71_652 192
1292 3300042007 Ga0439449_0018302 Ga0439449_0018302_651_1232 192
1293 3300042011 Ga0439454_010502 Ga0439454_010502_505_1086 192
1294 3300042014 Ga0439457_000874 Ga0439457_000874_1607_2188 192
1295 3300042014 Ga0439457_033165 Ga0439457_033165_277_858 192
1296 3300042015 Ga0439462_0005921 Ga0439462_0005921_1725_2306 192
1297 3300042125 Ga0450923_001203 Ga0450923_001203_434_1015 192
1298 3300042128 Ga0450897_005671 Ga0450897_005671_353_934 192
1299 3300042131 Ga0450894_003253 Ga0450894_003253_1117_1698 192
1300 3300042133 Ga0450896_026535 Ga0450896_026535_270_851 192
1301 3300042134 Ga0450898_013879 Ga0450898_013879_349_930 192
1302 3300042135 Ga0450899_004880 Ga0450899_004880_278_859 192
1303 3300042156 Ga0439446_0021394 Ga0439446_0021394_665_1243 192
1304 3300042156 Ga0439446_0063321 Ga0439446_0063321_285_866 192
1305 3300042157 Ga0439458_0027618 Ga0439458_0027618_579_1157 192
1306 3300042435 Ga0439434_0005581 Ga0439434_0005581_2109_2690 192
1307 3300042436 Ga0439435_0047167 Ga0439435_0047167_337_918 192
1308 3300042436 Ga0439435_0105003 Ga0439435_0105003_93_674 192
1309 3300042876 Ga0451577_0399127 Ga0451577_0399127_236_814 192
1310 3300044656 Ga0466969_0004965 Ga0466969_0004965_4541_5122 192
1311 3300044658 Ga0466972_0000026 Ga0466972_0000026_36846_37430 192
1312 3300044658 Ga0466972_0000365 Ga0466972_0000365_15838_16419 192
1313 3300044673 Ga0453683_0201612 Ga0453683_0201612_96_677 192
1314 3300044683 Ga0466965_0083432 Ga0466965_0083432_120_701 192
1315 3300044684 Ga0466966_0000038 Ga0466966_0000038_46929_47510 192
1316 3300044712 Ga0453684_0500667 Ga0453684_0500667_595_1179 192
1317 3300044765 Ga0466970_0000091 Ga0466970_0000091_18573_19157 192
1318 3300044842 Ga0466957_0000329 Ga0466957_0000329_2455_3036 192
1319 3300044842 Ga0466957_0002553 Ga0466957_0002553_708_1295 192
1320 3300044901 Ga0466960_0097432 Ga0466960_0097432_574_1155 192
1321 3300044901 Ga0466960_0140487 Ga0466960_0140487_549_1133 192
1322 3300045049 Ga0466959_0000289 Ga0466959_0000289_4720_5301 192
1323 3300046460 Ga0495638_0030399 Ga0495638_0030399_2331_2912 192
1324 3300046463 Ga0495653_0351859 Ga0495653_0351859_26_604 192
1325 3300046471 Ga0495650_0040895 Ga0495650_0040895_81_662 192
1326 3300046499 Ga0495594_0177485 Ga0495594_0177485_253_834 192
1327 3300046511 Ga0495608_0165987 Ga0495608_0165987_196_774 192
1328 3300046516 Ga0495628_0066563 Ga0495628_0066563_746_1324 192
1329 3300046517 Ga0495630_0014167 Ga0495630_0014167_4285_4863 192
1330 3300046522 Ga0495643_0007703 Ga0495643_0007703_2234_2815 192
1331 3300046529 Ga0495652_0310913 Ga0495652_0310913_288_866 192
1332 3300046536 Ga0495587_0161482 Ga0495587_0161482_214_792 192
1333 3300046557 Ga0495622_0284599 Ga0495622_0284599_103_681 192
1334 3300046558 Ga0495633_0201459 Ga0495633_0201459_151_732 192
1335 3300046616 Ga0495668_0000106 Ga0495668_0000106_23608_24189 192
1336 3300046616 Ga0495668_0004320 Ga0495668_0004320_3789_4370 192
1337 3300046663 Ga0495635_0057667 Ga0495635_0057667_1555_2133 192
1338 3300046674 Ga0495588_0234565 Ga0495588_0234565_256_837 192
1339 3300046678 Ga0495599_0167119 Ga0495599_0167119_695_1273 192
1340 3300046680 Ga0495646_0229971 Ga0495646_0229971_34_612 192
1341 3300046689 Ga0495613_0223458 Ga0495613_0223458_227_805 192
1342 3300047317 Ga0495604_0259213 Ga0495604_0259213_538_1116 192
1343 3300047320 Ga0495672_0017258 Ga0495672_0017258_1737_2318 192
1344 3300047321 Ga0495676_0250416 Ga0495676_0250416_420_998 192
1345 3300047471 Ga0495684_0051941 Ga0495684_0051941_2085_2663 192
1346 3300048907 Ga0496104_0219336 Ga0496104_0219336_1095_1673 192
1347 3300048907 Ga0496104_0493433 Ga0496104_0493433_101_682 192
1348 3300048908 Ga0496105_0327536 Ga0496105_0327536_362_940 192
1349 3300048908 Ga0496105_0497625 Ga0496105_0497625_359_937 192
1350 3300048909 Ga0496106_0258644 Ga0496106_0258644_591_1169 192
1351 3300048912 Ga0496109_0387865 Ga0496109_0387865_649_1227 192
1352 3300048913 Ga0496110_0128391 Ga0496110_0128391_583_1161 192
1353 3300048913 Ga0496110_0322478 Ga0496110_0322478_772_1350 192
1354 3300048914 Ga0496111_0220021 Ga0496111_0220021_114_692 192
1355 3300048915 Ga0496112_0521446 Ga0496112_0521446_411_989 192
1356 3300048917 Ga0496114_0417155 Ga0496114_0417155_357_935 192
1357 3300049523 Ga0501300_005665 Ga0501300_005665_1049_1630 192
1358 3300049531 Ga0501315_051339 Ga0501315_051339_55_636 192
1359 3300049568 Ga0501031_0010199 Ga0501031_0010199_678_1259 192
1360 3300049568 Ga0501031_0435858 Ga0501031_0435858_150_734 192
1361 3300049569 Ga0501032_0005001 Ga0501032_0005001_6026_6607 192
1362 3300049569 Ga0501032_0012070 Ga0501032_0012070_94_678 192
1363 3300049569 Ga0501032_0035851 Ga0501032_0035851_1382_1963 192
1364 3300049570 Ga0501033_0247549 Ga0501033_0247549_38_619 192
1365 3300049571 Ga0501034_0000002 Ga0501034_0000002_98822_99406 192
1366 3300049571 Ga0501034_0005058 Ga0501034_0005058_12122_12706 192
1367 3300049571 Ga0501034_0025430 Ga0501034_0025430_3472_4053 192
1368 3300049571 Ga0501034_0044290 Ga0501034_0044290_1828_2409 192
1369 3300049572 Ga0501036_0004608 Ga0501036_0004608_252_833 192
1370 3300049572 Ga0501036_0010166 Ga0501036_0010166_3293_3874 192
1371 3300049572 Ga0501036_0036429 Ga0501036_0036429_2487_3071 192
1372 3300049573 Ga0501037_0015291 Ga0501037_0015291_1971_2552 192
1373 3300049573 Ga0501037_0021115 Ga0501037_0021115_2393_2977 192
1374 3300049573 Ga0501037_0030076 Ga0501037_0030076_265_846 192
1375 3300049574 Ga0501038_0004730 Ga0501038_0004730_7051_7632 192
1376 3300049574 Ga0501038_0014791 Ga0501038_0014791_6369_6953 192
1377 3300049574 Ga0501038_0062052 Ga0501038_0062052_1445_2026 192
1378 3300049574 Ga0501038_0447772 Ga0501038_0447772_176_757 192
1379 3300049575 Ga0501039_0018535 Ga0501039_0018535_3615_4196 192
1380 3300049579 Ga0501043_0003152 Ga0501043_0003152_5428_6009 192
1381 3300049579 Ga0501043_0003493 Ga0501043_0003493_6899_7480 192
1382 3300049579 Ga0501043_0013836 Ga0501043_0013836_4983_5567 192
1383 3300049579 Ga0501043_0112220 Ga0501043_0112220_612_1193 192
1384 3300049580 Ga0501046_0019891 Ga0501046_0019891_3393_3974 192
1385 3300049580 Ga0501046_0177888 Ga0501046_0177888_250_831 192
1386 3300049580 Ga0501046_0601062 Ga0501046_0601062_70_651 192
1387 3300049581 Ga0501047_0004866 Ga0501047_0004866_7087_7668 192
1388 3300049581 Ga0501047_0011501 Ga0501047_0011501_1892_2473 192
1389 3300049581 Ga0501047_0014221 Ga0501047_0014221_1440_2024 192
1390 3300049581 Ga0501047_0076507 Ga0501047_0076507_124_708 192
1391 3300049581 Ga0501047_0590593 Ga0501047_0590593_169_750 192
1392 3300049586 Ga0501070_0005871 Ga0501070_0005871_9385_9966 192
1393 3300049586 Ga0501070_0100433 Ga0501070_0100433_622_1203 192
1394 3300049589 Ga0501073_0013047 Ga0501073_0013047_1459_2040 192
1395 3300049589 Ga0501073_0185311 Ga0501073_0185311_774_1355 192
1396 3300049590 Ga0501074_0004850 Ga0501074_0004850_4545_5126 192
1397 3300049652 Ga0501202_055079 Ga0501202_055079_141_725 192
1398 3300049654 Ga0501207_020556 Ga0501207_020556_53_637 192
1399 3300049656 Ga0501209_037534 Ga0501209_037534_137_721 192
1400 3300049660 Ga0501216_016698 Ga0501216_016698_257_841 192
1401 3300049667 Ga0501230_053803 Ga0501230_053803_198_779 192
1402 3300049668 Ga0501233_114911 Ga0501233_114911_85_669 192
1403 3300049686 Ga0501257_011700 Ga0501257_011700_1154_1735 192
1404 3300049688 Ga0501259_026903 Ga0501259_026903_263_844 192
1405 3300049705 Ga0501225_0001455 Ga0501225_0001455_3253_3834 192
1406 3300049705 Ga0501225_0144531 Ga0501225_0144531_98_682 192
1407 3300049742 Ga0501080_0055040 Ga0501080_0055040_234_815 192
1408 3300049742 Ga0501080_0106708 Ga0501080_0106708_1377_1958 192
1409 3300049744 Ga0501083_0007173 Ga0501083_0007173_3427_4008 192
1410 3300049822 Ga0501035_0010218 Ga0501035_0010218_3578_4159 192
1411 3300049822 Ga0501035_0012287 Ga0501035_0012287_3708_4289 192
1412 3300049822 Ga0501035_0039073 Ga0501035_0039073_118_702 192
1413 3300049822 Ga0501035_0462837 Ga0501035_0462837_391_972 192
1414 3300049823 Ga0501044_0001926 Ga0501044_0001926_13965_14549 192
1415 3300049823 Ga0501044_0007781 Ga0501044_0007781_4781_5362 192
1416 3300049823 Ga0501044_0012837 Ga0501044_0012837_4123_4704 192
1417 3300049823 Ga0501044_0014761 Ga0501044_0014761_3578_4159 192
1418 3300049823 Ga0501044_0036953 Ga0501044_0036953_2012_2593 192
1419 3300049823 Ga0501044_0166040 Ga0501044_0166040_1349_1930 192
1420 3300050005 Ga0501284_00030 Ga0501284_00030_5659_6240 192
1421 3300050489 nmdc:mga03683_128083_c1 nmdc:mga03683_128083_c1_379_960 192
1422 3300050493 nmdc:mga0k408_103984_c1 nmdc:mga0k408_103984_c1_30_611 192
1423 3300050493 nmdc:mga0k408_30751_c1 nmdc:mga0k408_30751_c1_552_1133 192
1424 3300050495 nmdc:mga04h51_250845_c1 nmdc:mga04h51_250845_c1_61_642 192
1425 3300050496 nmdc:mga07m45_327051_c1 nmdc:mga07m45_327051_c1_157_738 192
1426 3300050507 nmdc:mga05p37_26606_c1 nmdc:mga05p37_26606_c1_3673_4254 192
1427 3300050507 nmdc:mga05p37_506593_c1 nmdc:mga05p37_506593_c1_235_816 192
1428 3300050508 nmdc:mga09592_44276_c1 nmdc:mga09592_44276_c1_1287_1871 192
1429 3300050508 nmdc:mga09592_73063_c1 nmdc:mga09592_73063_c1_1773_2351 192
1430 3300050508 nmdc:mga09592_998_c1 nmdc:mga09592_998_c1_1202_1780 192
1431 3300050509 nmdc:mga0qj67_15168_c1 nmdc:mga0qj67_15168_c1_4331_4909 192
1432 3300050509 nmdc:mga0qj67_811678_c1 nmdc:mga0qj67_811678_c1_112_693 192
1433 3300050509 nmdc:mga0qj67_83675_c1 nmdc:mga0qj67_83675_c1_405_983 192
1434 3300050510 nmdc:mga06r32_237412_c1 nmdc:mga06r32_237412_c1_904_1482 192
1435 3300050510 nmdc:mga06r32_7056_c1 nmdc:mga06r32_7056_c1_6615_7199 192
1436 3300050511 nmdc:mga08y16_21376_c1 nmdc:mga08y16_21376_c1_737_1318 192
1437 3300053085 Ga0495619_0066698 Ga0495619_0066698_1223_1801 192
1438 3300053086 Ga0500578_0001471 Ga0500578_0001471_13482_14063 192
1439 3300053090 Ga0500646_0011076 Ga0500646_0011076_1000_1581 192
1440 3300053090 Ga0500646_0022380 Ga0500646_0022380_458_1036 192
1441 3300053092 Ga0500583_0003656 Ga0500583_0003656_2575_3156 192
1442 3300053092 Ga0500583_0206068 Ga0500583_0206068_199_780 192
1443 3300053094 Ga0500566_0187964 Ga0500566_0187964_302_886 192
1444 3300053096 Ga0500641_0006434 Ga0500641_0006434_3027_3608 192
1445 3300053103 Ga0500555_025878 Ga0500555_025878_738_1319 192
1446 3300053118 Ga0500594_0083141 Ga0500594_0083141_192_773 192
1447 3300053129 Ga0500628_011183 Ga0500628_011183_751_1332 192
1448 3300053130 Ga0500642_0217251 Ga0500642_0217251_219_800 192
1449 3300053133 Ga0500655_013077 Ga0500655_013077_417_995 192
1450 3300053139 Ga0500568_0001592 Ga0500568_0001592_5567_6148 192
1451 3300053146 Ga0500588_0003858 Ga0500588_0003858_2398_2976 192
1452 3300053146 Ga0500588_0006116 Ga0500588_0006116_706_1287 192
1453 3300053147 Ga0500589_046782 Ga0500589_046782_578_1159 192
1454 3300053150 Ga0500603_039444 Ga0500603_039444_279_863 192
1455 3300053151 Ga0500604_0009264 Ga0500604_0009264_1665_2246 192
1456 3300053177 Ga0500636_0010388 Ga0500636_0010388_2571_3155 192
1457 3300053178 Ga0500637_0051659 Ga0500637_0051659_1702_2280 192
1458 3300053178 Ga0500637_0221686 Ga0500637_0221686_130_708 192
1459 3300053727 Ga0500611_000039 Ga0500611_000039_33839_34420 192
1460 3300053730 Ga0500645_032453 Ga0500645_032453_458_1039 192
1461 3300053739 Ga0500587_006027 Ga0500587_006027_905_1486 192
1462 3300054114 Ga0501084_0481208 Ga0501084_0481208_155_736 192
1463 3300059631 Ga0587130_003217 Ga0587130_003217_150_734 192
1464 3300061719 Ga0466962_0036487 Ga0466962_0036487_353_934 192
1465 3300005328 Ga0070676_10064134 Ga0070676_100641342 195
1466 3300005334 Ga0068869_100358868 Ga0068869_1003588682 195
1467 3300005343 Ga0070687_100159497 Ga0070687_1001594971 195
1468 3300005347 Ga0070668_100085581 Ga0070668_1000855811 195
1469 3300005356 Ga0070674_100060673 Ga0070674_1000606731 195
1470 3300005578 Ga0068854_100439686 Ga0068854_1004396861 195
1471 3300005718 Ga0068866_10156950 Ga0068866_101569502 195
1472 3300006195 Ga0075366_10061076 Ga0075366_100610763 195
1473 3300009176 Ga0105242_10221047 Ga0105242_102210473 195
1474 3300014969 Ga0157376_10477087 Ga0157376_104770871 195
1475 3300025907 Ga0207645_10023895 Ga0207645_100238956 195
1476 3300025938 Ga0207704_10062813 Ga0207704_100628132 195
1477 3300025940 Ga0207691_10628784 Ga0207691_106287841 195
1478 3300025942 Ga0207689_10321630 Ga0207689_103216302 195
1479 3300026089 Ga0207648_10017639 Ga0207648_100176392 195
1480 3300026118 Ga0207675_100409154 Ga0207675_1004091542 195
1481 3300028380 Ga0268265_10316702 Ga0268265_103167022 195
1482 3300047320 Ga0495672_0017207 Ga0495672_0017207_1729_2319 195
1483 3300050493 nmdc:mga0k408_32463_c1 nmdc:mga0k408_32463_c1_439_1029 195
1484 3300039437 Ga0436365_0637816 Ga0436365_0637816_29_649 196
1485 3300009176 Ga0105242_10225776 Ga0105242_102257761 197
1486 3300009553 Ga0105249_10087661 Ga0105249_100876613 197
1487 3300014326 Ga0157380_10120247 Ga0157380_101202472 197
1488 3300026088 Ga0207641_10002685 Ga0207641_100026855 197
1489 3300005535 Ga0070684_100044558 Ga0070684_1000445582 198
1490 3300005577 Ga0068857_100001483 Ga0068857_10000148313 198
1491 3300005616 Ga0068852_100002957 Ga0068852_1000029572 198
1492 3300025904 Ga0207647_10013169 Ga0207647_100131696 198
1493 3300025981 Ga0207640_10023926 Ga0207640_100239262 198
1494 3300026116 Ga0207674_10006694 Ga0207674_100066944 198
1495 3300026142 Ga0207698_10000340 Ga0207698_100003402 198
1496 3300003323 rootH1_10095093 rootH1_100950933 199
1497 3300005330 Ga0070690_100347092 Ga0070690_1003470922 199
1498 3300025934 Ga0207686_10633730 Ga0207686_106337301 199
1499 3300025944 Ga0207661_10213934 Ga0207661_102139342 199
1500 3300046519 Ga0495632_0141945 Ga0495632_0141945_266_868 199
1501 3300053092 Ga0500583_0000111 Ga0500583_0000111_7409_8011 199
1502 3300053093 Ga0500651_0225189 Ga0500651_0225189_340_942 199
1503 3300053131 Ga0500652_022859 Ga0500652_022859_296_898 199
1504 3300003203 JGI25406J46586_10000609 JGI25406J46586_1000060914 200
1505 3300005327 Ga0070658_10110174 Ga0070658_101101742 200
1506 3300005329 Ga0070683_100015684 Ga0070683_1000156844 200
1507 3300005330 Ga0070690_100057770 Ga0070690_1000577703 200
1508 3300005336 Ga0070680_100090131 Ga0070680_1000901312 200
1509 3300005337 Ga0070682_100002732 Ga0070682_1000027322 200
1510 3300005338 Ga0068868_100523329 Ga0068868_1005233291 200
1511 3300005339 Ga0070660_100028097 Ga0070660_1000280972 200
1512 3300005344 Ga0070661_100003323 Ga0070661_1000033239 200
1513 3300005354 Ga0070675_100008236 Ga0070675_1000082365 200
1514 3300005364 Ga0070673_100006643 Ga0070673_1000066432 200
1515 3300005366 Ga0070659_100003580 Ga0070659_1000035804 200
1516 3300005456 Ga0070678_100458804 Ga0070678_1004588042 200
1517 3300005457 Ga0070662_100008324 Ga0070662_1000083244 200
1518 3300005458 Ga0070681_10017351 Ga0070681_100173512 200
1519 3300005530 Ga0070679_100042810 Ga0070679_1000428106 200
1520 3300005535 Ga0070684_100009084 Ga0070684_1000090842 200
1521 3300005539 Ga0068853_100006051 Ga0068853_1000060516 200
1522 3300005547 Ga0070693_100141007 Ga0070693_1001410071 200
1523 3300005563 Ga0068855_100018632 Ga0068855_1000186323 200
1524 3300005564 Ga0070664_100002674 Ga0070664_10000267410 200
1525 3300005577 Ga0068857_100103396 Ga0068857_1001033962 200
1526 3300005578 Ga0068854_100006676 Ga0068854_1000066768 200
1527 3300005618 Ga0068864_100287882 Ga0068864_1002878822 200
1528 3300005841 Ga0068863_100527213 Ga0068863_1005272132 200
1529 3300005985 Ga0081539_10000382 Ga0081539_1000038255 200
1530 3300006237 Ga0097621_100003388 Ga0097621_1000033885 200
1531 3300006358 Ga0068871_100014661 Ga0068871_1000146613 200
1532 3300013100 Ga0157373_10002220 Ga0157373_100022205 200
1533 3300013102 Ga0157371_10008606 Ga0157371_100086068 200
1534 3300013102 Ga0157371_10060321 Ga0157371_100603212 200
1535 3300013104 Ga0157370_10032563 Ga0157370_100325633 200
1536 3300013105 Ga0157369_10010331 Ga0157369_1001033110 200
1537 3300013296 Ga0157374_10004005 Ga0157374_100040057 200
1538 3300013297 Ga0157378_10006722 Ga0157378_100067222 200
1539 3300013307 Ga0157372_10015169 Ga0157372_100151696 200
1540 3300025904 Ga0207647_10090039 Ga0207647_100900392 200
1541 3300025912 Ga0207707_10122944 Ga0207707_101229442 200
1542 3300025912 Ga0207707_10367474 Ga0207707_103674741 200
1543 3300025917 Ga0207660_10271908 Ga0207660_102719082 200
1544 3300025919 Ga0207657_10010679 Ga0207657_100106794 200
1545 3300025920 Ga0207649_10004820 Ga0207649_100048203 200
1546 3300025921 Ga0207652_10215366 Ga0207652_102153662 200
1547 3300025925 Ga0207650_10205114 Ga0207650_102051141 200
1548 3300025933 Ga0207706_10000750 Ga0207706_1000075030 200
1549 3300025944 Ga0207661_10012348 Ga0207661_100123482 200
1550 3300025945 Ga0207679_10088357 Ga0207679_100883571 200
1551 3300025949 Ga0207667_10067451 Ga0207667_100674512 200
1552 3300025960 Ga0207651_10029400 Ga0207651_100294002 200
1553 3300025981 Ga0207640_10019688 Ga0207640_100196881 200
1554 3300026023 Ga0207677_10039243 Ga0207677_100392433 200
1555 3300026041 Ga0207639_10008375 Ga0207639_100083757 200
1556 3300026078 Ga0207702_10069228 Ga0207702_100692282 200
1557 3300026089 Ga0207648_10101968 Ga0207648_101019683 200
1558 3300026116 Ga0207674_10053953 Ga0207674_100539532 200
1559 3300026121 Ga0207683_10495244 Ga0207683_104952442 200
1560 3300026142 Ga0207698_10029547 Ga0207698_100295472 200
1561 3300045976 Ga0466967_0475632 Ga0466967_0475632_23_625 200
1562 3300005344 Ga0070661_100009578 Ga0070661_1000095785 201
1563 3300005366 Ga0070659_100007898 Ga0070659_1000078986 201
1564 3300005616 Ga0068852_100448115 Ga0068852_1004481152 201
1565 3300013102 Ga0157371_10038406 Ga0157371_100384061 201
1566 3300013102 Ga0157371_10374637 Ga0157371_103746371 201
1567 3300013307 Ga0157372_10167750 Ga0157372_101677502 201
1568 3300013307 Ga0157372_10672589 Ga0157372_106725891 201
1569 3300014497 Ga0182008_10229332 Ga0182008_102293321 201
1570 3300025932 Ga0207690_10132078 Ga0207690_101320782 201
1571 3300027471 Ga0209995_1002115 Ga0209995_10021153 201
1572 3300027526 Ga0209968_1026917 Ga0209968_10269172 201
1573 3300027876 Ga0209974_10011818 Ga0209974_100118183 201
1574 3300044673 Ga0453683_0068536 Ga0453683_0068536_160_786 201
1575 3300044712 Ga0453684_0093030 Ga0453684_0093030_3039_3665 201
1576 3300049579 Ga0501043_0036027 Ga0501043_0036027_2266_2892 201
1577 3300005718 Ga0068866_10312454 Ga0068866_103124541 202
1578 3300025937 Ga0207669_10085320 Ga0207669_100853202 202
1579 3300027360 Ga0209969_1015996 Ga0209969_10159962 202
1580 3300002459 JGI24751J29686_10000360 JGI24751J29686_100003606 203
1581 3300005331 Ga0070670_100005255 Ga0070670_1000052554 203
1582 3300005331 Ga0070670_100198778 Ga0070670_1001987782 203
1583 3300005456 Ga0070678_100303827 Ga0070678_1003038272 203
1584 3300005618 Ga0068864_100012870 Ga0068864_1000128705 203
1585 3300005834 Ga0068851_10281951 Ga0068851_102819511 203
1586 3300005841 Ga0068863_100387532 Ga0068863_1003875322 203
1587 3300006195 Ga0075366_10038420 Ga0075366_100384202 203
1588 3300009177 Ga0105248_10056348 Ga0105248_100563484 203
1589 3300009545 Ga0105237_10003181 Ga0105237_1000318112 203
1590 3300009553 Ga0105249_10007340 Ga0105249_100073405 203
1591 3300009553 Ga0105249_10008333 Ga0105249_100083336 203
1592 3300010375 Ga0105239_10019015 Ga0105239_100190155 203
1593 3300013297 Ga0157378_10004008 Ga0157378_1000400810 203
1594 3300013306 Ga0163162_10001000 Ga0163162_100010009 203
1595 3300013306 Ga0163162_10001299 Ga0163162_100012998 203
1596 3300013306 Ga0163162_10280938 Ga0163162_102809382 203
1597 3300013308 Ga0157375_10003311 Ga0157375_1000331112 203
1598 3300014325 Ga0163163_10000202 Ga0163163_100002028 203
1599 3300014969 Ga0157376_10000842 Ga0157376_1000084221 203
1600 3300025925 Ga0207650_10015592 Ga0207650_100155922 203
1601 3300025940 Ga0207691_10119935 Ga0207691_101199352 203
1602 3300025942 Ga0207689_10368211 Ga0207689_103682112 203
1603 3300026088 Ga0207641_10912886 Ga0207641_109128861 203
1604 3300026089 Ga0207648_10636568 Ga0207648_106365681 203
1605 3300026095 Ga0207676_10011568 Ga0207676_100115683 203
1606 3300026121 Ga0207683_10441386 Ga0207683_104413862 203
1607 3300028380 Ga0268265_10535943 Ga0268265_105359431 203
1608 3300041512 Ga0451853_2288231 Ga0451853_2288231_110_751 203
1609 3300046499 Ga0495594_0353330 Ga0495594_0353330_66_677 203

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04542

Sigma70_r2

Sigma-70 region 2

64

132

0.98

PF08281

Sigma70_r4_2

Sigma-70, region 4

157

210

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lup-assembly2.cif.gz_C crystal structure of the complex formed by region of e. coli sigmae bound to its -10 element non template strand 0.5481 13 94
2mao-assembly1.cif.gz_A nmr structure of region 2 of e. coli sigmae 0.4953 11 104
4lup-assembly2.cif.gz_C crystal structure of the complex formed by region of e. coli sigmae bound to its -10 element non template strand 0.4791 13 94
2mao-assembly1.cif.gz_A nmr structure of region 2 of e. coli sigmae 0.4408 11 104
8e0m-assembly4.cif.gz_L homotrimeric variant of tctrp9, bgl15 0.36 29 186
ID Description Score Start End Superfamily
4lupC00 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.5481 13 94 1.10.1740.10
2maoA00 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.4953 11 104 1.10.1740.10
4lupC00 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.4791 13 94 1.10.1740.10
2mapA00 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.4761 1 104 1.10.1740.10
2mapA00 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.4719 1 104 1.10.1740.10
ID Description Score Start End GO Terms
AF-A0A7C4HYC5-F1-model_v4 RNA polymerase sigma factor 70 region 4 type 2 domain-containing protein 0.4954 83 195
AF-A0A1Q7V0A9-F1-model_v4 RNA polymerase sigma factor 70 region 4 type 2 domain-containing protein 0.4865 87 196
AF-A0A2V9YVS3-F1-model_v4 RNA polymerase sigma factor 70 region 4 type 2 domain-containing protein 0.461 86 193
AF-A0A2N9N0G3-F1-model_v4 RNA polymerase sigma factor 70 region 4 type 2 domain-containing protein 0.429 87 198
AF-A0A2V9YAW7-F1-model_v4 RNA polymerase sigma factor 70 region 4 type 2 domain-containing protein 0.4184 79 203 GO:0003677
GO:0006352
GO:0016987

Feature Viewer

pLDDT pTM Quality
66.91 0.5 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map