F495012

General Info

Members Datasets Scaffolds Average Seq Length
1604 646 1497 213

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10042032|Ga0265338_100420323
Length 225
Sequence MAWNRDQMAARAARELRDGFYVNLGIGIPTLVANFIPDGMEVTLQSENGMLGMGPFPFAGDEDPDLINAGKQTITQLPKTSYFSSADSFAMIRGGHIDLSILGAMQVSATGDLANWMVPGKMVKGMGGAMDLVAGVKKVVVVMEHTNKDGEHKIRDWCSLPLTGVGVVDMIITDLAVFTVDKHAGGLTLIELAPGVELAEIGDKTGAPFDVKLADGVRGSFAPAM

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
3 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
4 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
5 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
6 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
7 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
8 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
9 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
10 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
11 2643221556 Massilia sp. Root1485 Isolate Unclassified
12 2643221569 Achromobacter sp. Root565 Isolate Unclassified
13 2643221570 Acidovorax sp. Root568 Isolate Unclassified
14 2643221594 Achromobacter sp. Root170 Isolate Unclassified
15 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
16 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
17 2643221621 Achromobacter sp. Root83 Isolate Unclassified
18 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
19 2643221640 Caulobacter sp. Root342 Isolate Unclassified
20 2643221642 Caulobacter sp. Root343 Isolate Unclassified
21 2643221645 Massilia sp. Root351 Isolate Unclassified
22 2643221652 Acidovorax sp. Root402 Isolate Unclassified
23 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
24 2643221664 Massilia sp. Root418 Isolate Unclassified
25 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
26 2643221684 Massilia sp. Root133 Isolate Unclassified
27 2643221718 Rhizobium sp. Root268 Isolate Unclassified
28 2643221723 Ensifer sp. Root278 Isolate Unclassified
29 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
30 2738541280 Massilia sp. GV090 Isolate Unclassified
31 2738541297 Duganella sp. GV083 Isolate Unclassified
32 2738541300 Massilia sp. GV016 Isolate Unclassified
33 2738541357 Duganella sp. GV053 Isolate Unclassified
34 2738543003 Duganella sp. GV066 Isolate Unclassified
35 2738543018 Massilia sp. GV045 Isolate Unclassified
36 2738543026 Duganella sp. GV089 Isolate Unclassified
37 2738543029 Duganella sp. GV039 Isolate Unclassified
38 2738543030 Massilia sp. GV097 Isolate Unclassified
39 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
40 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
41 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
42 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
43 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
44 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
45 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
46 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
47 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
48 2818991435 Caulobacter henricii 536 Isolate Unclassified
49 2818991436 Collimonas arenae 515 Isolate Unclassified
50 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
51 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
52 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
53 2821131069 Duganella sp. 1224 Isolate Unclassified
54 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
55 2842711865 Duganella sp. R-73148 Isolate Unclassified
56 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
57 2855730933 Achromobacter sp. HZ28 Isolate Nodule
58 2855767633 Achromobacter sp. HZ34 Isolate Nodule
59 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
60 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
61 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
62 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
63 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
64 2857553236 Duganella sp. R-74557 Isolate Unclassified
65 2857558681 Duganella sp. R-74565 Isolate Unclassified
66 2857564685 Duganella sp. R-74599 Isolate Unclassified
67 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
68 2858950400 Achromobacter sp. K91 Isolate Unclassified
69 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
70 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
71 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
72 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
73 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
74 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
75 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
76 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
77 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
78 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
79 2902330777 Methylobacterium sp. 2A Isolate Unclassified
80 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
81 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
82 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
83 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
84 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
85 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
86 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
87 2916699645 Acinetobacter ursingii M3 Isolate Unclassified
88 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
89 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
90 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
91 2919476304 Duganella sp. 3397 Isolate Unclassified
92 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
93 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
94 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
95 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
96 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
97 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
98 2941479691
99 2952252522 Salinicola sp. DM10 Isolate Unclassified
100 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
101 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
102 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
103 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
104 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
105 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
106 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
107 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
108 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
109 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
110 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
111 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
112 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
113 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
114 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
115 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
116 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
117 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
118 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
119 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
120 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
121 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
122 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
123 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
124 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
125 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
126 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
127 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
128 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
129 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
131 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
132 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
133 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
134 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
135 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
136 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
137 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
138 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
139 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
140 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
141 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
142 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
143 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
144 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
145 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
146 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
147 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
148 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
149 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
150 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
151 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
152 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
153 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
154 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
155 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
156 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
157 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
158 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
159 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
160 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
161 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
162 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
163 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
164 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
165 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
166 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
167 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
168 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
169 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
170 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
171 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
172 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
173 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
174 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
175 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
176 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
177 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
178 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
179 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
180 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
181 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
182 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
183 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
184 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
185 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
186 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
187 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
188 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
189 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
190 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
191 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
192 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
193 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
194 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
195 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
196 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
197 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
198 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
199 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
200 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
201 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
202 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
203 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
204 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
205 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
206 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
207 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
208 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
209 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
210 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
211 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
212 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
213 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
214 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
215 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
216 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
217 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
218 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
219 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
220 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
221 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
222 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
223 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
224 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
225 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
226 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
227 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
228 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
229 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
230 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
231 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
232 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
233 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
234 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
235 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
236 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
237 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
238 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
239 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
240 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
241 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
242 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
243 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
244 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
245 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
246 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
247 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
248 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
249 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
250 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
251 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
252 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
253 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
254 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
255 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
256 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
257 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
258 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
259 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
260 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
261 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
262 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
263 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
264 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
265 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
267 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
268 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
269 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
270 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
271 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
272 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
273 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
274 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
275 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
276 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
277 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
278 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
279 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
280 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
281 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
282 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
283 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
284 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
285 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
286 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
287 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
288 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
289 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
290 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
291 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
292 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
293 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
294 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
295 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
296 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
297 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
342 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
347 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
348 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
349 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
350 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
351 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
353 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
354 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
355 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
356 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
357 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
358 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
359 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
360 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
361 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
362 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
363 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
364 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
366 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
367 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
368 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
369 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
370 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
371 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
372 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
373 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
374 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
375 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
376 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
377 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
378 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
380 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
381 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
382 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
383 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
384 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
385 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
386 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
387 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
388 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
389 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
390 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
391 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
392 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
393 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
394 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
395 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
396 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
397 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
398 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
399 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
400 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
401 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
402 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
403 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
404 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
405 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
406 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
407 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
408 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
409 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
410 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
411 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
412 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
413 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
414 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
415 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
416 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
417 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
418 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
419 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
420 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
421 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
422 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
423 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
424 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
425 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
426 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
427 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
428 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
429 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
430 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
431 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
432 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
433 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
434 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
435 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
436 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
437 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
438 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
439 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
440 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
441 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
442 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
443 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
444 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
445 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
446 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
447 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
448 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
449 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
450 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
451 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
452 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
453 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
454 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
455 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
456 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
457 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
458 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
459 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
460 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
461 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
462 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
463 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
464 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
465 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
466 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
467 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
468 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
469 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
470 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
471 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
472 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
473 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
474 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
475 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
476 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
477 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
478 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
479 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
480 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
481 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
482 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
483 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
484 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
485 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
486 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
487 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
488 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
489 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
490 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
491 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
492 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
493 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
494 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
495 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
496 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
497 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
498 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
499 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
500 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
501 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
502 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
503 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
504 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
505 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
506 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
507 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
508 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
509 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
510 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
511 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
512 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
513 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
514 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
515 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
516 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
517 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
518 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
519 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
520 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
521 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
522 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
523 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
524 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
525 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
526 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
527 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
528 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
529 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
530 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
531 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
532 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
533 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
534 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
535 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
536 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
537 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
538 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
539 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
540 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
541 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
542 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
543 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
544 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
545 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
546 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
547 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
548 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
549 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
550 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
551 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
552 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
553 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
554 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
555 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
556 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
557 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
558 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
559 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
560 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
561 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
562 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
563 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
564 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
565 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
566 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
567 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
568 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
569 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
570 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
571 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
572 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
573 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
574 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
575 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
576 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
577 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
578 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
579 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
580 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
581 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
582 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
583 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
584 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
585 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
586 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
587 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
588 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
589 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
590 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
591 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
592 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
593 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
594 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
595 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
596 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
597 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
598 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
599 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
600 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
601 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
602 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
603 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
604 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
605 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
606 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
607 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
608 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
609 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
610 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
611 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
612 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
613 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
614 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
615 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
616 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
617 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
618 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
619 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
620 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
621 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
622 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
623 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
624 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
625 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
626 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
627 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
628 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
629 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
630 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
631 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
632 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
633 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
634 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
635 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
636 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
637 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
638 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
639 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
640 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
641 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
642 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
643 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
644 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
645 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
646 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.46
Metatranscriptomes 0.87
Isolates 6.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.57
Nodule 0.81
Rhizoplane 2.18
Rhizosphere 65.84
Stem 0
Stem Tuber 0
Unclassified 10.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1000255 3300001976 Bacteria 7368
2 JGI24740J21852_10003031 3300001979 Bacteria 7435
3 JGI24739J22299_10038407 3300001989 Bacteria 1609
4 JGI24743J22301_10001118 3300001991 Bacteria 3593
5 JGI24735J21928_10018757 3300002067 Bacteria 2131
6 JGI24735J21928_10052533 3300002067 Bacteria 1175
7 JGI24748J21848_1000053 3300002074 Bacteria 50665
8 JGI24749J21850_1001230 3300002076 Bacteria 3642
9 JGI24034J26672_10000036 3300002239 Bacteria 84333
10 JGI24742J22300_10002780 3300002244 Bacteria 2822
11 JGI25155J39150_1000073 3300002704 Bacteria 62972
12 JGI25156J39149_1000609 3300002705 Bacteria 19855
13 JGI25156J39149_1004731 3300002705 Bacteria 4079
14 JGI25162J39368_1000001 3300002737 Bacteria 740113
15 JGI25162J39368_1006819 3300002737 Bacteria 1886
16 JGI25154J39366_1000118 3300002738 Bacteria 64203
17 JGI25154J39366_1000258 3300002738 Bacteria 33918
18 JGI25154J39366_1000270 3300002738 Bacteria 32293
19 JGI25157J39369_1000001 3300002741 Bacteria 363277
20 JGI25164J39214_1001808 3300002772 Bacteria 4125
21 JGI25152J39213_1001584 3300002773 Bacteria 9542
22 JGI25152J39213_1015800 3300002773 Bacteria 1478
23 JGI25150J39212_1000428 3300002774 Bacteria 19227
24 JGI25150J39212_1001402 3300002774 Bacteria 6805
25 JGI25150J39212_1010535 3300002774 Bacteria 1713
26 JGI25159J45721_1000675 3300002987 Bacteria 15067
27 JGI25159J45721_1001076 3300002987 Bacteria 11675
28 JGI25159J45721_1001508 3300002987 Bacteria 9542
29 JGI25159J45721_1001707 3300002987 Bacteria 8878
30 JGI25159J45721_1007198 3300002987 Bacteria 3219
31 JGI25151J46595_10003026 3300003187 Bacteria 9542
32 JGI25151J46595_10010417 3300003187 Bacteria 4324
33 JGI25151J46595_10023110 3300003187 Bacteria 2568
34 JGI25151J46595_10036981 3300003187 Bacteria 1835
35 JGI25165J46597_1000001 3300003214 Bacteria 1111887
36 JGI25153J46596_10000395 3300003215 Bacteria 29365
37 JGI25153J46596_10021825 3300003215 Bacteria 2378
38 JGI25160J50197_1000259 3300003354 Bacteria 39883
39 JGI25160J50197_1000962 3300003354 Bacteria 15067
40 JGI25160J50197_1002071 3300003354 Bacteria 9542
41 JGI25160J50197_1003470 3300003354 Bacteria 7046
42 JGI25161J50226_1000092 3300003374 Bacteria 72932
43 JGI25161J50226_1002450 3300003374 Bacteria 4751
44 JGI25161J50226_1003326 3300003374 Bacteria 3724
45 Ga0007417J51691_1023165 3300003544 Bacteria 2041
46 Ga0007410J51695_1034713 3300003574 Bacteria 1937
47 Ga0007409J51694_1016496 3300003575 Bacteria 2565
48 Ga0007416J51690_1013575 3300003577 Bacteria 2318
49 Ga0007416J51690_1033019 3300003577 Bacteria 1140
50 Ga0006562J51391_1148455 3300003578 Bacteria 1322
51 Ga0007411J51799_112918 3300003611 Bacteria 981
52 Ga0032354_1022659 3300003693 Bacteria 3337
53 Ga0055538_1000001 3300003751 Bacteria 1111887
54 Ga0055539_1000001 3300003752 Bacteria 1111887
55 Ga0055533_1000003 3300003756 Bacteria 1111887
56 Ga0055525_1000001 3300003759 Bacteria 1016948
57 Ga0055525_1000003 3300003759 Bacteria 962094
58 Ga0055525_1000046 3300003759 Bacteria 261587
59 Ga0055535_1000215 3300003761 Bacteria 61211
60 Ga0055535_1001710 3300003761 Bacteria 9959
61 Ga0055535_1003636 3300003761 Bacteria 4215
62 Ga0055542_1000004 3300003762 Bacteria 553532
63 Ga0055542_1000412 3300003762 Bacteria 41756
64 Ga0055529_1000032 3300003763 Bacteria 255895
65 Ga0055529_1000306 3300003763 Bacteria 56382
66 Ga0055526_1000951 3300003771 Bacteria 21419
67 Ga0055526_1001576 3300003771 Bacteria 16041
68 Ga0055526_1002557 3300003771 Bacteria 12209
69 Ga0055526_1003709 3300003771 Bacteria 9542
70 Ga0055526_1004461 3300003771 Bacteria 8396
71 Ga0055526_1004811 3300003771 Bacteria 7981
72 Ga0055526_1006869 3300003771 Bacteria 6066
73 Ga0055526_1008931 3300003771 Bacteria 4912
74 Ga0055537_1000030 3300003773 Bacteria 100491
75 Ga0055537_1000086 3300003773 Bacteria 67416
76 Ga0055537_1000587 3300003773 Bacteria 20267
77 Ga0055537_1001401 3300003773 Bacteria 9542
78 Ga0055524_1000093 3300003775 Bacteria 111953
79 Ga0055524_1000194 3300003775 Bacteria 66522
80 Ga0055524_1002243 3300003775 Bacteria 10121
81 Ga0055524_1002452 3300003775 Bacteria 9542
82 Ga0055524_1002681 3300003775 Bacteria 9017
83 Ga0055536_1000715 3300003781 Bacteria 22226
84 Ga0055536_1003152 3300003781 Bacteria 8948
85 Ga0055536_1014255 3300003781 Bacteria 2806
86 Ga0055534_1000024 3300003784 Bacteria 131674
87 Ga0055534_1000447 3300003784 Bacteria 24217
88 Ga0055534_1000820 3300003784 Bacteria 14368
89 Ga0055534_1001417 3300003784 Bacteria 9542
90 Ga0055534_1001838 3300003784 Bacteria 7925
91 Ga0055534_1021827 3300003784 Bacteria 1066
92 Ga0055528_1000439 3300003790 Bacteria 33348
93 Ga0055528_1000961 3300003790 Bacteria 19107
94 Ga0055528_1002611 3300003790 Bacteria 9542
95 Ga0055528_1014420 3300003790 Bacteria 2924
96 Ga0055530_10000541 3300003791 Bacteria 32834
97 Ga0055530_10057965 3300003791 Bacteria 873
98 Ga0055540_1000089 3300003792 Bacteria 100214
99 Ga0055540_1004954 3300003792 Bacteria 5802
100 Ga0055540_1006243 3300003792 Bacteria 4778
101 Ga0055540_1013378 3300003792 Bacteria 2509
102 Ga0055531_10000269 3300003794 Bacteria 53905
103 Ga0055531_10002978 3300003794 Bacteria 11006
104 Ga0055531_10005739 3300003794 Bacteria 7190
105 Ga0055531_10009722 3300003794 Bacteria 4882
106 Ga0055531_10042077 3300003794 Bacteria 1312
107 Ga0055541_1000001 3300003841 Bacteria 1111887
108 Ga0055541_1001138 3300003841 Bacteria 5964
109 Ga0055543_1001474 3300004625 Bacteria 9297
110 Ga0055543_1003203 3300004625 Bacteria 4977
111 Ga0055543_1004025 3300004625 Bacteria 4123
112 Ga0055543_1005432 3300004625 Bacteria 3256
113 Ga0055543_1009685 3300004625 Bacteria 2056
114 Ga0065165_1000353 3300005262 Bacteria 75343
115 Ga0065165_1000600 3300005262 Bacteria 52753
116 Ga0065165_1001802 3300005262 Bacteria 21054
117 Ga0065165_1002550 3300005262 Bacteria 15105
118 Ga0065165_1005751 3300005262 Bacteria 6806
119 Ga0065165_1014470 3300005262 Bacteria 3060
120 Ga0065165_1036832 3300005262 Bacteria 1488
121 Ga0065165_1038483 3300005262 Bacteria 1441
122 Ga0065714_10014905 3300005288 Bacteria 2916
123 Ga0065714_10151557 3300005288 Bacteria 1103
124 Ga0065704_10180239 3300005289 Bacteria 1241
125 Ga0065704_10198711 3300005289 Bacteria 1156
126 Ga0065704_10215718 3300005289 Bacteria 1092
127 Ga0065704_10457162 3300005289 Bacteria 700
128 Ga0065712_10250585 3300005290 Bacteria 957
129 Ga0065707_10085375 3300005295 Bacteria 6202
130 Ga0070658_10009563 3300005327 Bacteria 7783
131 Ga0070658_10028610 3300005327 Bacteria 4475
132 Ga0070658_10080132 3300005327 Bacteria 2682
133 Ga0070658_10327550 3300005327 Bacteria 1308
134 Ga0070658_10452422 3300005327 Bacteria 1106
135 Ga0070676_10124788 3300005328 Bacteria 1620
136 Ga0070676_10138541 3300005328 Bacteria 1546
137 Ga0070683_100001966 3300005329 Bacteria 16104
138 Ga0070683_100036898 3300005329 Bacteria 4472
139 Ga0070683_100421886 3300005329 Bacteria 1273
140 Ga0070670_100002397 3300005331 Bacteria 15444
141 Ga0070670_100049854 3300005331 Bacteria 3599
142 Ga0070670_100074892 3300005331 Bacteria 2908
143 Ga0070670_100299937 3300005331 Bacteria 1405
144 Ga0070670_100555591 3300005331 Bacteria 1024
145 Ga0070677_10000523 3300005333 Bacteria 13180
146 Ga0070677_10032192 3300005333 Bacteria 2009
147 Ga0068869_100008423 3300005334 Bacteria 6649
148 Ga0068869_100010764 3300005334 Bacteria 5975
149 Ga0068869_100249632 3300005334 Bacteria 1417
150 Ga0070666_10084706 3300005335 Bacteria 2170
151 Ga0070680_100006104 3300005336 Bacteria 9131
152 Ga0068868_100000004 3300005338 Bacteria 150718
153 Ga0068868_100001107 3300005338 Bacteria 18443
154 Ga0070660_100176833 3300005339 Bacteria 1726
155 Ga0070660_100259759 3300005339 Bacteria 1418
156 Ga0070660_100406251 3300005339 Bacteria 1126
157 Ga0070689_100318277 3300005340 Bacteria 1298
158 Ga0070661_100000006 3300005344 Bacteria 216544
159 Ga0070661_100000994 3300005344 Bacteria 20120
160 Ga0070661_100006933 3300005344 Bacteria 7821
161 Ga0070668_100008742 3300005347 Bacteria 7522
162 Ga0070668_100129046 3300005347 Bacteria 2028
163 Ga0070668_100239734 3300005347 Bacteria 1502
164 Ga0070668_100576965 3300005347 Bacteria 981
165 Ga0070669_100012993 3300005353 Bacteria 5912
166 Ga0070669_100040177 3300005353 Bacteria 3400
167 Ga0070669_100049127 3300005353 Bacteria 3080
168 Ga0070669_100201034 3300005353 Bacteria 1568
169 Ga0070669_100265299 3300005353 Bacteria 1371
170 Ga0070669_100267171 3300005353 Bacteria 1367
171 Ga0070675_100002143 3300005354 Bacteria 14606
172 Ga0070675_100002327 3300005354 Bacteria 14133
173 Ga0070675_100091547 3300005354 Bacteria 2548
174 Ga0070675_100133314 3300005354 Bacteria 2119
175 Ga0070671_100003169 3300005355 Bacteria 12826
176 Ga0070671_100009039 3300005355 Bacteria 7995
177 Ga0070671_100011946 3300005355 Bacteria 6986
178 Ga0070671_100022247 3300005355 Bacteria 5179
179 Ga0070671_100125957 3300005355 Bacteria 2156
180 Ga0070671_100224309 3300005355 Bacteria 1594
181 Ga0070671_100250235 3300005355 Bacteria 1505
182 Ga0070671_100342328 3300005355 Bacteria 1276
183 Ga0070674_100034507 3300005356 Bacteria 3380
184 Ga0070674_100044141 3300005356 Bacteria 3037
185 Ga0070674_100182252 3300005356 Bacteria 1609
186 Ga0070674_100348366 3300005356 Bacteria 1195
187 Ga0070674_100406579 3300005356 Bacteria 1114
188 Ga0070674_100452768 3300005356 Bacteria 1060
189 Ga0070673_100007098 3300005364 Bacteria 7356
190 Ga0070673_100021209 3300005364 Bacteria 4703
191 Ga0070673_100043576 3300005364 Bacteria 3469
192 Ga0070673_100174672 3300005364 Bacteria 1835
193 Ga0070673_100182855 3300005364 Bacteria 1795
194 Ga0070673_100186388 3300005364 Bacteria 1779
195 Ga0070673_100767541 3300005364 Bacteria 889
196 Ga0070688_100473180 3300005365 Bacteria 941
197 Ga0070659_100000929 3300005366 Bacteria 21500
198 Ga0070659_100006995 3300005366 Bacteria 8167
199 Ga0070659_100259547 3300005366 Bacteria 1441
200 Ga0070659_100324528 3300005366 Bacteria 1287
201 Ga0070667_100001557 3300005367 Bacteria 20558
202 Ga0070667_100016942 3300005367 Bacteria 6030
203 Ga0070667_100480287 3300005367 Bacteria 1138
204 Ga0070667_100732944 3300005367 Bacteria 916
205 Ga0070667_100865492 3300005367 Bacteria 840
206 Ga0070714_100089631 3300005435 Bacteria 2693
207 Ga0070713_100089448 3300005436 Bacteria 2645
208 Ga0070713_100501445 3300005436 Bacteria 1145
209 Ga0070713_100858097 3300005436 Bacteria 872
210 Ga0070710_10202944 3300005437 Bacteria 1253
211 Ga0070711_100071388 3300005439 Bacteria 2447
212 Ga0070711_100747873 3300005439 Bacteria 826
213 Ga0070700_100170991 3300005441 Bacteria 1505
214 Ga0070700_100315320 3300005441 Bacteria 1147
215 Ga0070663_100012236 3300005455 Bacteria 5418
216 Ga0070663_100024503 3300005455 Bacteria 4063
217 Ga0070663_100451472 3300005455 Bacteria 1059
218 Ga0070678_100004119 3300005456 Bacteria 8191
219 Ga0070678_100359840 3300005456 Bacteria 1253
220 Ga0070681_10011352 3300005458 Bacteria 8812
221 Ga0070681_10269042 3300005458 Bacteria 1616
222 Ga0068867_100000048 3300005459 Bacteria 73813
223 Ga0068867_100004827 3300005459 Bacteria 9491
224 Ga0068867_100025498 3300005459 Bacteria 4242
225 Ga0068867_100090559 3300005459 Bacteria 2321
226 Ga0068867_100134811 3300005459 Bacteria 1923
227 Ga0068867_100290668 3300005459 Bacteria 1344
228 Ga0070685_10191940 3300005466 Bacteria 1322
229 Ga0070707_100181678 3300005468 Bacteria 2051
230 Ga0070698_100095994 3300005471 Bacteria 2941
231 Ga0070679_100000001 3300005530 Bacteria 764811
232 Ga0070679_100058491 3300005530 Bacteria 3841
233 Ga0070679_100380720 3300005530 Bacteria 1358
234 Ga0070684_100004982 3300005535 Bacteria 10141
235 Ga0068853_100268022 3300005539 Bacteria 1572
236 Ga0068853_100385407 3300005539 Bacteria 1309
237 Ga0070672_100023179 3300005543 Bacteria 4572
238 Ga0070672_100049884 3300005543 Bacteria 3258
239 Ga0070672_100089641 3300005543 Bacteria 2478
240 Ga0070672_100360506 3300005543 Bacteria 1241
241 Ga0070672_100487623 3300005543 Bacteria 1065
242 Ga0070693_100232520 3300005547 Bacteria 1213
243 Ga0070665_100033278 3300005548 Bacteria 5187
244 Ga0070665_100280727 3300005548 Bacteria 1667
245 Ga0070665_100498020 3300005548 Bacteria 1229
246 Ga0068855_100004740 3300005563 Bacteria 16602
247 Ga0068855_100004765 3300005563 Bacteria 16563
248 Ga0068855_100011354 3300005563 Bacteria 10754
249 Ga0068855_100080833 3300005563 Bacteria 3769
250 Ga0068855_100109993 3300005563 Bacteria 3164
251 Ga0068855_100191596 3300005563 Bacteria 2306
252 Ga0068855_100278184 3300005563 Bacteria 1859
253 Ga0068855_100950038 3300005563 Bacteria 905
254 Ga0070664_100000282 3300005564 Bacteria 36692
255 Ga0070664_100019344 3300005564 Bacteria 5603
256 Ga0070664_100038293 3300005564 Bacteria 4036
257 Ga0070664_100061503 3300005564 Bacteria 3200
258 Ga0068857_100016086 3300005577 Bacteria 6554
259 Ga0068857_100114219 3300005577 Bacteria 2428
260 Ga0068857_100292839 3300005577 Bacteria 1499
261 Ga0068857_100405795 3300005577 Bacteria 1268
262 Ga0068854_100064887 3300005578 Bacteria 2654
263 Ga0068854_100186459 3300005578 Bacteria 1623
264 Ga0068856_100034658 3300005614 Bacteria 4944
265 Ga0068856_100128445 3300005614 Bacteria 2538
266 Ga0068856_100646647 3300005614 Bacteria 1078
267 Ga0068856_100728763 3300005614 Bacteria 1012
268 Ga0068852_100000048 3300005616 Bacteria 87297
269 Ga0068852_100004013 3300005616 Bacteria 10352
270 Ga0068852_100018978 3300005616 Bacteria 5431
271 Ga0068852_100109695 3300005616 Bacteria 2506
272 Ga0068852_100127977 3300005616 Bacteria 2335
273 Ga0068852_100155854 3300005616 Bacteria 2128
274 Ga0068852_100314395 3300005616 Bacteria 1519
275 Ga0068852_100443706 3300005616 Bacteria 1283
276 Ga0068852_100574432 3300005616 Bacteria 1130
277 Ga0068852_100945954 3300005616 Bacteria 879
278 Ga0068859_100013690 3300005617 Bacteria 8132
279 Ga0068859_100036992 3300005617 Bacteria 4900
280 Ga0068859_100097644 3300005617 Bacteria 2991
281 Ga0068864_100002769 3300005618 Bacteria 14470
282 Ga0068864_100011909 3300005618 Bacteria 7183
283 Ga0068864_100063454 3300005618 Bacteria 3201
284 Ga0068864_100325041 3300005618 Bacteria 1445
285 Ga0068861_100010229 3300005719 Bacteria 6512
286 Ga0068861_100694602 3300005719 Bacteria 945
287 Ga0068851_10007313 3300005834 Bacteria 5064
288 Ga0068851_10028110 3300005834 Bacteria 2776
289 Ga0068851_10126671 3300005834 Bacteria 1377
290 Ga0068851_10190658 3300005834 Bacteria 1139
291 Ga0068863_100000323 3300005841 Bacteria 48685
292 Ga0068863_100001631 3300005841 Bacteria 22176
293 Ga0068863_100014569 3300005841 Bacteria 7569
294 Ga0068863_100198971 3300005841 Bacteria 1927
295 Ga0068863_100358823 3300005841 Bacteria 1420
296 Ga0068858_100002617 3300005842 Bacteria 18131
297 Ga0068858_100002948 3300005842 Bacteria 17114
298 Ga0068860_100000069 3300005843 Bacteria 179064
299 Ga0068860_100000524 3300005843 Bacteria 46839
300 Ga0068860_100011518 3300005843 Bacteria 8717
301 Ga0068860_100509105 3300005843 Bacteria 1203
302 Ga0068862_100009227 3300005844 Bacteria 8170
303 Ga0068862_100082302 3300005844 Bacteria 2793
304 Ga0070717_10575880 3300006028 Bacteria 1020
305 Ga0075365_10005295 3300006038 Bacteria 6943
306 Ga0075365_10009750 3300006038 Bacteria 5547
307 Ga0075365_10027139 3300006038 Bacteria 3640
308 Ga0075363_100002405 3300006048 Bacteria 7638
309 Ga0075363_100014482 3300006048 Bacteria 3856
310 Ga0075363_100125351 3300006048 Bacteria 1437
311 Ga0075364_10001014 3300006051 Bacteria 14889
312 Ga0075364_10014348 3300006051 Bacteria 4895
313 Ga0075364_10037369 3300006051 Bacteria 3143
314 Ga0075364_10055355 3300006051 Bacteria 2595
315 Ga0075364_10175136 3300006051 Bacteria 1451
316 Ga0075364_10644528 3300006051 Bacteria 723
317 Ga0075432_10021123 3300006058 Bacteria 2226
318 Ga0070712_100003162 3300006175 Bacteria 10145
319 Ga0070712_100063584 3300006175 Bacteria 2614
320 Ga0075362_10003092 3300006177 Bacteria 5737
321 Ga0075362_10045866 3300006177 Bacteria 1942
322 Ga0075367_10018656 3300006178 Bacteria 3832
323 Ga0075367_10044803 3300006178 Bacteria 2594
324 Ga0075369_10019058 3300006186 Bacteria 2798
325 Ga0075369_10219067 3300006186 Bacteria 881
326 Ga0075366_10023990 3300006195 Bacteria 3556
327 Ga0075366_10085752 3300006195 Bacteria 1884
328 Ga0075366_10134051 3300006195 Bacteria 1495
329 Ga0075366_10136681 3300006195 Bacteria 1480
330 Ga0075366_10174826 3300006195 Bacteria 1303
331 Ga0075366_10194514 3300006195 Bacteria 1233
332 Ga0075366_10492522 3300006195 Bacteria 758
333 Ga0097621_100026937 3300006237 Bacteria 4516
334 Ga0097621_100030071 3300006237 Bacteria 4296
335 Ga0097621_100065452 3300006237 Bacteria 2991
336 Ga0075370_10001129 3300006353 Bacteria 11193
337 Ga0075370_10006235 3300006353 Bacteria 5982
338 Ga0075370_10006846 3300006353 Bacteria 5765
339 Ga0075370_10008342 3300006353 Bacteria 5327
340 Ga0075370_10050137 3300006353 Bacteria 2368
341 Ga0068871_100002247 3300006358 Bacteria 13129
342 Ga0068871_100077837 3300006358 Bacteria 2741
343 Ga0068871_100147195 3300006358 Bacteria 2006
344 Ga0068871_100246610 3300006358 Bacteria 1554
345 Ga0068871_100406335 3300006358 Bacteria 1213
346 Ga0075429_100478892 3300006880 Bacteria 1091
347 Ga0075429_100880813 3300006880 Bacteria 784
348 Ga0068865_100076478 3300006881 Bacteria 2390
349 Ga0068865_100145391 3300006881 Bacteria 1793
350 Ga0068865_100153063 3300006881 Bacteria 1751
351 Ga0075436_100554577 3300006914 Bacteria 844
352 Ga0097620_100013690 3300006931 Bacteria 8132
353 Ga0097620_100036992 3300006931 Bacteria 4900
354 Ga0097620_100097647 3300006931 Bacteria 2991
355 Ga0079104_1000007 3300006946 Bacteria 390531
356 Ga0079104_1005881 3300006946 Bacteria 4778
357 Ga0099826_10000132 3300006948 Bacteria 31946
358 Ga0105251_10166054 3300009011 Bacteria 995
359 Ga0105244_10121953 3300009036 Bacteria 1262
360 Ga0105250_10056123 3300009092 Bacteria 1581
361 Ga0105250_10103416 3300009092 Bacteria 1163
362 Ga0105240_10000084 3300009093 Bacteria 192787
363 Ga0105240_10004442 3300009093 Bacteria 21388
364 Ga0105240_10008224 3300009093 Bacteria 14951
365 Ga0105240_10106546 3300009093 Bacteria 3399
366 Ga0105240_10153246 3300009093 Bacteria 2743
367 Ga0105240_10211667 3300009093 Bacteria 2265
368 Ga0105240_10385039 3300009093 Bacteria 1583
369 Ga0105240_11019860 3300009093 Bacteria 884
370 Ga0105240_11265032 3300009093 Bacteria 779
371 Ga0105245_10001510 3300009098 Bacteria 21074
372 Ga0105245_10731934 3300009098 Bacteria 1024
373 Ga0105247_10001822 3300009101 Bacteria 14946
374 Ga0105243_10000005 3300009148 Bacteria 576265
375 Ga0105241_10174653 3300009174 Bacteria 1777
376 Ga0105242_10236947 3300009176 Bacteria 1638
377 Ga0105248_10001008 3300009177 Bacteria 31117
378 Ga0105248_10006497 3300009177 Bacteria 12823
379 Ga0105248_10028876 3300009177 Bacteria 6183
380 Ga0105248_10180654 3300009177 Bacteria 2378
381 Ga0105237_10010106 3300009545 Bacteria 10062
382 Ga0105237_10048803 3300009545 Bacteria 4255
383 Ga0105237_10130578 3300009545 Bacteria 2506
384 Ga0105237_10158718 3300009545 Bacteria 2259
385 Ga0105238_10000113 3300009551 Bacteria 89675
386 Ga0105238_10000160 3300009551 Bacteria 73564
387 Ga0105238_10017512 3300009551 Bacteria 7285
388 Ga0105238_10177187 3300009551 Bacteria 2109
389 Ga0105238_10194328 3300009551 Bacteria 2005
390 Ga0105238_10450889 3300009551 Bacteria 1283
391 Ga0105238_10455046 3300009551 Bacteria 1277
392 Ga0105238_10556574 3300009551 Bacteria 1152
393 Ga0105238_10977881 3300009551 Bacteria 867
394 Ga0105249_10132588 3300009553 Bacteria 2380
395 Ga0105249_11837142 3300009553 Bacteria 679
396 Ga0105239_10000289 3300010375 Bacteria 74109
397 Ga0105239_10003397 3300010375 Bacteria 19526
398 Ga0105246_10000618 3300011119 Bacteria 19835
399 Ga0157373_10147263 3300013100 Bacteria 1656
400 Ga0157371_10548477 3300013102 Bacteria 857
401 Ga0157370_10002535 3300013104 Bacteria 21958
402 Ga0157369_10000334 3300013105 Bacteria 62941
403 Ga0157369_10003357 3300013105 Bacteria 19001
404 Ga0157369_10232759 3300013105 Bacteria 1926
405 Ga0157369_10303725 3300013105 Bacteria 1660
406 Ga0171462_1031 3300013250 Bacteria 104981
407 Ga0157374_10020568 3300013296 Bacteria 5858
408 Ga0157374_10139935 3300013296 Bacteria 2349
409 Ga0157378_10020749 3300013297 Bacteria 5778
410 Ga0157378_10127308 3300013297 Bacteria 2354
411 Ga0163162_10003717 3300013306 Bacteria 14623
412 Ga0163162_10020731 3300013306 Bacteria 6461
413 Ga0163162_10046081 3300013306 Bacteria 4370
414 Ga0163162_10070533 3300013306 Bacteria 3546
415 Ga0163162_10084914 3300013306 Bacteria 3242
416 Ga0163162_10318325 3300013306 Bacteria 1688
417 Ga0157372_10000092 3300013307 Bacteria 93247
418 Ga0157372_10034949 3300013307 Bacteria 5531
419 Ga0157372_10081286 3300013307 Bacteria 3668
420 Ga0157372_10594982 3300013307 Bacteria 1289
421 Ga0157375_10002806 3300013308 Bacteria 15079
422 Ga0157375_10198861 3300013308 Bacteria 2160
423 Ga0157375_10491870 3300013308 Bacteria 1391
424 Ga0157375_10516563 3300013308 Bacteria 1358
425 Ga0163163_10001715 3300014325 Bacteria 18487
426 Ga0163163_10008501 3300014325 Bacteria 9123
427 Ga0163163_10335608 3300014325 Bacteria 1567
428 Ga0182008_10009226 3300014497 Bacteria 5333
429 Ga0182008_10059354 3300014497 Bacteria 1887
430 Ga0182008_10071746 3300014497 Bacteria 1704
431 Ga0182008_10106183 3300014497 Bacteria 1390
432 Ga0157377_10236796 3300014745 Bacteria 1176
433 Ga0157379_10002856 3300014968 Bacteria 14562
434 Ga0157379_10025217 3300014968 Bacteria 5279
435 Ga0157379_10029132 3300014968 Bacteria 4911
436 Ga0157379_10082697 3300014968 Bacteria 2877
437 Ga0157376_10278536 3300014969 Bacteria 1574
438 Ga0157376_10295651 3300014969 Bacteria 1531
439 Ga0182006_1031937 3300015261 Bacteria 2119
440 Ga0182007_10000921 3300015262 Bacteria 16266
441 Ga0182007_10005649 3300015262 Bacteria 5459
442 Ga0182007_10013824 3300015262 Bacteria 3064
443 Ga0182005_1000534 3300015265 Bacteria 19265
444 Ga0183362_10001 3300015683 Bacteria 2046624
445 Ga0163161_10019141 3300017792 Bacteria 4800
446 Ga0163161_10021781 3300017792 Bacteria 4507
447 Ga0163161_10071729 3300017792 Bacteria 2535
448 Ga0163161_10503648 3300017792 Bacteria 986
449 Ga0213872_10000001 3300021361 Bacteria 662532
450 Ga0213872_10000051 3300021361 Bacteria 107261
451 Ga0213872_10000060 3300021361 Bacteria 100249
452 Ga0213872_10000632 3300021361 Bacteria 26629
453 Ga0213872_10002848 3300021361 Bacteria 9879
454 Ga0213872_10008989 3300021361 Bacteria 4804
455 Ga0213872_10018060 3300021361 Bacteria 3254
456 Ga0213876_10005332 3300021384 Bacteria 7074
457 Ga0213875_10059590 3300021388 Bacteria 1787
458 Ga0209435_100001 3300025206 Bacteria 1424171
459 Ga0209436_100633 3300025208 Bacteria 15033
460 Ga0209436_103318 3300025208 Bacteria 4334
461 Ga0207672_1000282 3300025223 Bacteria 6890
462 Ga0209784_100004 3300025224 Bacteria 1378156
463 Ga0209784_100638 3300025224 Bacteria 10668
464 Ga0209566_100004 3300025225 Bacteria 1531866
465 Ga0209566_100651 3300025225 Bacteria 20982
466 Ga0209674_100006 3300025226 Bacteria 1531866
467 Ga0209674_100160 3300025226 Bacteria 88210
468 Ga0209672_101339 3300025228 Bacteria 9292
469 Ga0209147_100004 3300025229 Bacteria 1371850
470 Ga0209147_100097 3300025229 Bacteria 164034
471 Ga0209147_103938 3300025229 Bacteria 2647
472 Ga0209563_100005 3300025230 Bacteria 1774893
473 Ga0209563_100007 3300025230 Bacteria 1579402
474 Ga0209563_100009 3300025230 Bacteria 1378156
475 Ga0207427_100310 3300025231 Bacteria 33900
476 Ga0207427_112082 3300025231 Bacteria 868
477 Ga0209437_100004 3300025233 Bacteria 1378156
478 Ga0209437_100053 3300025233 Bacteria 375580
479 Ga0209437_100234 3300025233 Bacteria 92856
480 Ga0209437_103429 3300025233 Bacteria 2875
481 Ga0209258_100022 3300025242 Bacteria 553584
482 Ga0209258_100504 3300025242 Bacteria 38241
483 Ga0209258_100720 3300025242 Bacteria 22119
484 Ga0209258_100960 3300025242 Bacteria 13681
485 Ga0207425_1000041 3300025245 Bacteria 210441
486 Ga0207425_1000262 3300025245 Bacteria 38967
487 Ga0207425_1001031 3300025245 Bacteria 12991
488 Ga0207425_1002773 3300025245 Bacteria 5951
489 Ga0207425_1004638 3300025245 Bacteria 4071
490 Ga0207425_1010697 3300025245 Bacteria 2221
491 Ga0209646_1000001 3300025246 Bacteria 3092932
492 Ga0209646_1000019 3300025246 Bacteria 475248
493 Ga0209646_1000103 3300025246 Bacteria 164034
494 Ga0209646_1000109 3300025246 Bacteria 158348
495 Ga0209026_1000001 3300025250 Bacteria 1228671
496 Ga0209026_1000467 3300025250 Bacteria 31163
497 Ga0209026_1005641 3300025250 Bacteria 3302
498 Ga0209677_100005 3300025253 Bacteria 1378156
499 Ga0209677_101739 3300025253 Bacteria 9066
500 Ga0209677_105152 3300025253 Bacteria 3503
501 Ga0209677_109555 3300025253 Bacteria 1723
502 Ga0209148_1000034 3300025254 Bacteria 553584
503 Ga0209148_1000118 3300025254 Bacteria 188330
504 Ga0209148_1002934 3300025254 Bacteria 5173
505 Ga0209148_1006589 3300025254 Bacteria 2502
506 Ga0209148_1016130 3300025254 Bacteria 1291
507 Ga0209759_1000001 3300025256 Bacteria 2799452
508 Ga0209759_1000064 3300025256 Bacteria 193120
509 Ga0209759_1000091 3300025256 Bacteria 164034
510 Ga0209759_1001021 3300025256 Bacteria 18791
511 Ga0209759_1001647 3300025256 Bacteria 11774
512 Ga0209759_1004695 3300025256 Bacteria 5005
513 Ga0209759_1022906 3300025256 Bacteria 1387
514 Ga0209759_1029416 3300025256 Bacteria 1100
515 Ga0209129_1000111 3300025258 Bacteria 148853
516 Ga0209129_1000667 3300025258 Bacteria 22744
517 Ga0209129_1004143 3300025258 Bacteria 5862
518 Ga0209129_1005500 3300025258 Bacteria 4454
519 Ga0209233_1000005 3300025261 Bacteria 1531866
520 Ga0209233_1016765 3300025261 Bacteria 2011
521 Ga0209565_1000017 3300025263 Bacteria 462438
522 Ga0209565_1000028 3300025263 Bacteria 348536
523 Ga0209565_1000040 3300025263 Bacteria 266543
524 Ga0209565_1000110 3300025263 Bacteria 119879
525 Ga0209565_1000673 3300025263 Bacteria 21605
526 Ga0209565_1021834 3300025263 Bacteria 1332
527 Ga0209455_1000043 3300025272 Bacteria 413928
528 Ga0209455_1000128 3300025272 Bacteria 162413
529 Ga0209455_1001018 3300025272 Bacteria 14039
530 Ga0209455_1005410 3300025272 Bacteria 3950
531 Ga0209673_1000007 3300025273 Bacteria 634477
532 Ga0209673_1000035 3300025273 Bacteria 328411
533 Ga0209673_1000109 3300025273 Bacteria 183000
534 Ga0209673_1000175 3300025273 Bacteria 131239
535 Ga0209673_1000664 3300025273 Bacteria 49941
536 Ga0209673_1000944 3300025273 Bacteria 36333
537 Ga0209673_1008587 3300025273 Bacteria 4533
538 Ga0209673_1046346 3300025273 Bacteria 1187
539 Ga0209130_1000118 3300025284 Bacteria 129005
540 Ga0209130_1000156 3300025284 Bacteria 101929
541 Ga0209130_1000205 3300025284 Bacteria 79260
542 Ga0209130_1000231 3300025284 Bacteria 73279
543 Ga0209130_1000332 3300025284 Bacteria 54263
544 Ga0209130_1001496 3300025284 Bacteria 15119
545 Ga0209130_1005762 3300025284 Bacteria 4196
546 Ga0209130_1027397 3300025284 Bacteria 1211
547 Ga0209675_1000009 3300025291 Bacteria 562872
548 Ga0209675_1000024 3300025291 Bacteria 312615
549 Ga0209675_1000111 3300025291 Bacteria 114805
550 Ga0209675_1000677 3300025291 Bacteria 23818
551 Ga0209675_1001309 3300025291 Bacteria 14763
552 Ga0209675_1002194 3300025291 Bacteria 10241
553 Ga0209675_1004947 3300025291 Bacteria 5748
554 Ga0209675_1005028 3300025291 Bacteria 5666
555 Ga0209676_1000005 3300025292 Bacteria 1076001
556 Ga0209676_1000054 3300025292 Bacteria 365890
557 Ga0209676_1000182 3300025292 Bacteria 146373
558 Ga0209676_1000478 3300025292 Bacteria 65984
559 Ga0209676_1001275 3300025292 Bacteria 26098
560 Ga0209676_1001975 3300025292 Bacteria 16337
561 Ga0209676_1003684 3300025292 Bacteria 9169
562 Ga0209676_1030840 3300025292 Bacteria 1633
563 Ga0209676_1040847 3300025292 Bacteria 1302
564 Ga0209025_1000068 3300025294 Bacteria 294129
565 Ga0209025_1000096 3300025294 Bacteria 239153
566 Ga0209025_1000116 3300025294 Bacteria 218293
567 Ga0209025_1000301 3300025294 Bacteria 110450
568 Ga0209025_1000493 3300025294 Bacteria 75884
569 Ga0209025_1002157 3300025294 Bacteria 21934
570 Ga0209025_1009771 3300025294 Bacteria 6621
571 Ga0209025_1010236 3300025294 Bacteria 6384
572 Ga0209025_1027558 3300025294 Bacteria 2814
573 Ga0209025_1039236 3300025294 Bacteria 2069
574 Ga0209025_1089606 3300025294 Bacteria 1010
575 Ga0209564_1000005 3300025295 Bacteria 1147192
576 Ga0209564_1000055 3300025295 Bacteria 343782
577 Ga0209564_1000089 3300025295 Bacteria 249694
578 Ga0209564_1000155 3300025295 Bacteria 165859
579 Ga0209564_1000298 3300025295 Bacteria 99805
580 Ga0209564_1001181 3300025295 Bacteria 30229
581 Ga0209564_1001242 3300025295 Bacteria 28585
582 Ga0209564_1002177 3300025295 Bacteria 16470
583 Ga0209564_1045708 3300025295 Bacteria 1123
584 Ga0209758_1000004 3300025297 Bacteria 1375322
585 Ga0209758_1000107 3300025297 Bacteria 218293
586 Ga0209758_1000625 3300025297 Bacteria 54181
587 Ga0209758_1011921 3300025297 Bacteria 4949
588 Ga0209758_1012663 3300025297 Bacteria 4692
589 Ga0209050_1000001 3300025298 Bacteria 3563507
590 Ga0209050_1000007 3300025298 Bacteria 1187891
591 Ga0209050_1000066 3300025298 Bacteria 305458
592 Ga0209050_1001192 3300025298 Bacteria 30549
593 Ga0209050_1002423 3300025298 Bacteria 16073
594 Ga0209050_1004030 3300025298 Bacteria 10326
595 Ga0209050_1004615 3300025298 Bacteria 9201
596 Ga0209050_1006167 3300025298 Bacteria 7210
597 Ga0209050_1046647 3300025298 Bacteria 1136
598 Ga0209256_1000003 3300025299 Bacteria 1661127
599 Ga0209256_1000038 3300025299 Bacteria 375225
600 Ga0209256_1000078 3300025299 Bacteria 225992
601 Ga0209256_1000087 3300025299 Bacteria 218290
602 Ga0209256_1000559 3300025299 Bacteria 53325
603 Ga0209256_1001512 3300025299 Bacteria 23519
604 Ga0209256_1002806 3300025299 Bacteria 13344
605 Ga0207426_1000090 3300025302 Bacteria 280662
606 Ga0207426_1000123 3300025302 Bacteria 218290
607 Ga0207426_1000197 3300025302 Bacteria 146366
608 Ga0207426_1001904 3300025302 Bacteria 15119
609 Ga0209051_1000009 3300025303 Bacteria 706778
610 Ga0209051_1000044 3300025303 Bacteria 305458
611 Ga0209051_1000092 3300025303 Bacteria 170056
612 Ga0209051_1000115 3300025303 Bacteria 152010
613 Ga0209051_1000191 3300025303 Bacteria 108763
614 Ga0209051_1000598 3300025303 Bacteria 42554
615 Ga0209051_1001071 3300025303 Bacteria 25392
616 Ga0209051_1010665 3300025303 Bacteria 4610
617 Ga0209051_1022825 3300025303 Bacteria 2622
618 Ga0209051_1023358 3300025303 Bacteria 2574
619 Ga0209257_1000011 3300025304 Bacteria 1112630
620 Ga0209257_1000055 3300025304 Bacteria 415534
621 Ga0209257_1000082 3300025304 Bacteria 305458
622 Ga0209257_1000234 3300025304 Bacteria 129712
623 Ga0209257_1000576 3300025304 Bacteria 61751
624 Ga0209257_1000978 3300025304 Bacteria 38851
625 Ga0209257_1001479 3300025304 Bacteria 27607
626 Ga0209257_1004829 3300025304 Bacteria 9989
627 Ga0209257_1005159 3300025304 Bacteria 9427
628 Ga0209257_1005496 3300025304 Bacteria 8855
629 Ga0207697_10016149 3300025315 Bacteria 3079
630 Ga0207656_10006575 3300025321 Bacteria 4189
631 Ga0207656_10070612 3300025321 Bacteria 1551
632 Ga0207656_10084810 3300025321 Bacteria 1429
633 Ga0207696_1010086 3300025711 Bacteria 3484
634 Ga0207696_1060660 3300025711 Bacteria 1064
635 Ga0207655_1000490 3300025728 Bacteria 50941
636 Ga0207655_1001848 3300025728 Bacteria 18290
637 Ga0207655_1032591 3300025728 Bacteria 2378
638 Ga0207713_1023413 3300025735 Bacteria 2907
639 Ga0207713_1043269 3300025735 Bacteria 1862
640 Ga0207710_10000839 3300025900 Bacteria 16567
641 Ga0207710_10138408 3300025900 Bacteria 1174
642 Ga0207680_10011979 3300025903 Bacteria 4404
643 Ga0207699_10282769 3300025906 Bacteria 1153
644 Ga0207645_10004606 3300025907 Bacteria 10162
645 Ga0207645_10074675 3300025907 Bacteria 2170
646 Ga0207645_10085170 3300025907 Bacteria 2029
647 Ga0207705_10000022 3300025909 Bacteria 302232
648 Ga0207705_10011480 3300025909 Bacteria 6407
649 Ga0207705_10054399 3300025909 Bacteria 2885
650 Ga0207705_10058677 3300025909 Bacteria 2776
651 Ga0207705_10225361 3300025909 Bacteria 1425
652 Ga0207705_10232500 3300025909 Bacteria 1403
653 Ga0207654_10000122 3300025911 Bacteria 50286
654 Ga0207654_10072187 3300025911 Bacteria 2054
655 Ga0207654_10111551 3300025911 Bacteria 1703
656 Ga0207707_10020223 3300025912 Bacteria 5812
657 Ga0207707_10768950 3300025912 Bacteria 804
658 Ga0207695_10000115 3300025913 Bacteria 240394
659 Ga0207695_10002097 3300025913 Bacteria 30292
660 Ga0207695_10002265 3300025913 Bacteria 28809
661 Ga0207695_10009870 3300025913 Bacteria 11730
662 Ga0207695_10075283 3300025913 Bacteria 3435
663 Ga0207695_10075549 3300025913 Bacteria 3428
664 Ga0207695_10662262 3300025913 Bacteria 925
665 Ga0207671_10000032 3300025914 Bacteria 245878
666 Ga0207671_10003511 3300025914 Bacteria 15567
667 Ga0207671_10030516 3300025914 Bacteria 4020
668 Ga0207671_10148734 3300025914 Bacteria 1808
669 Ga0207671_10187463 3300025914 Bacteria 1612
670 Ga0207671_10306396 3300025914 Bacteria 1255
671 Ga0207693_10001513 3300025915 Bacteria 20519
672 Ga0207693_10052921 3300025915 Bacteria 3185
673 Ga0207693_10164553 3300025915 Bacteria 1746
674 Ga0207663_10026185 3300025916 Bacteria 3382
675 Ga0207657_10009497 3300025919 Bacteria 9770
676 Ga0207657_10027318 3300025919 Bacteria 5228
677 Ga0207657_10031155 3300025919 Bacteria 4834
678 Ga0207657_10074311 3300025919 Bacteria 2871
679 Ga0207657_10090441 3300025919 Bacteria 2554
680 Ga0207657_10337918 3300025919 Bacteria 1189
681 Ga0207649_10000043 3300025920 Bacteria 115777
682 Ga0207649_10001607 3300025920 Bacteria 13119
683 Ga0207649_10011954 3300025920 Bacteria 4802
684 Ga0207649_10014094 3300025920 Bacteria 4473
685 Ga0207649_10084561 3300025920 Bacteria 2063
686 Ga0207649_10545329 3300025920 Bacteria 887
687 Ga0207652_10000001 3300025921 Bacteria 1006643
688 Ga0207652_10000002 3300025921 Bacteria 878035
689 Ga0207652_10010127 3300025921 Bacteria 7595
690 Ga0207652_10351826 3300025921 Bacteria 1330
691 Ga0207652_10730030 3300025921 Bacteria 883
692 Ga0207694_10000029 3300025924 Bacteria 239107
693 Ga0207694_10000075 3300025924 Bacteria 114693
694 Ga0207694_10044937 3300025924 Bacteria 3411
695 Ga0207694_10223310 3300025924 Bacteria 1537
696 Ga0207694_10355031 3300025924 Bacteria 1214
697 Ga0207694_10801042 3300025924 Bacteria 796
698 Ga0207650_10001122 3300025925 Bacteria 19719
699 Ga0207650_10001617 3300025925 Bacteria 16075
700 Ga0207650_10031834 3300025925 Bacteria 3812
701 Ga0207650_10408127 3300025925 Bacteria 1125
702 Ga0207650_10410813 3300025925 Bacteria 1122
703 Ga0207650_10568842 3300025925 Bacteria 951
704 Ga0207650_10599609 3300025925 Bacteria 926
705 Ga0207650_10958335 3300025925 Bacteria 727
706 Ga0207650_11044370 3300025925 Bacteria 695
707 Ga0207659_10000333 3300025926 Bacteria 28322
708 Ga0207659_10000725 3300025926 Bacteria 19531
709 Ga0207659_10022085 3300025926 Bacteria 4234
710 Ga0207659_10144382 3300025926 Bacteria 1851
711 Ga0207659_10167568 3300025926 Bacteria 1730
712 Ga0207659_10204591 3300025926 Bacteria 1579
713 Ga0207687_10001035 3300025927 Bacteria 18903
714 Ga0207687_10030036 3300025927 Bacteria 3661
715 Ga0207700_10051821 3300025928 Bacteria 3065
716 Ga0207700_10070877 3300025928 Bacteria 2681
717 Ga0207700_10089054 3300025928 Bacteria 2432
718 Ga0207700_10372829 3300025928 Bacteria 1246
719 Ga0207664_10021867 3300025929 Bacteria 4766
720 Ga0207644_10000004 3300025931 Bacteria 566613
721 Ga0207644_10002789 3300025931 Bacteria 11256
722 Ga0207644_10003511 3300025931 Bacteria 10148
723 Ga0207644_10037827 3300025931 Bacteria 3397
724 Ga0207644_10047328 3300025931 Bacteria 3068
725 Ga0207644_10072487 3300025931 Bacteria 2522
726 Ga0207644_10074243 3300025931 Bacteria 2495
727 Ga0207644_10106918 3300025931 Bacteria 2110
728 Ga0207644_10240434 3300025931 Bacteria 1441
729 Ga0207644_10510565 3300025931 Bacteria 992
730 Ga0207690_10001881 3300025932 Bacteria 12883
731 Ga0207690_10004240 3300025932 Bacteria 8469
732 Ga0207690_10017400 3300025932 Bacteria 4387
733 Ga0207690_10068256 3300025932 Bacteria 2442
734 Ga0207690_10076710 3300025932 Bacteria 2321
735 Ga0207690_10283359 3300025932 Bacteria 1291
736 Ga0207706_10003714 3300025933 Bacteria 14563
737 Ga0207706_10388187 3300025933 Bacteria 1211
738 Ga0207686_10001449 3300025934 Bacteria 13451
739 Ga0207686_10039242 3300025934 Bacteria 2873
740 Ga0207686_10169483 3300025934 Bacteria 1538
741 Ga0207686_10275904 3300025934 Bacteria 1239
742 Ga0207686_10328274 3300025934 Bacteria 1145
743 Ga0207709_10000001 3300025935 Bacteria 2228154
744 Ga0207709_10000112 3300025935 Bacteria 127357
745 Ga0207709_10001810 3300025935 Bacteria 14277
746 Ga0207709_10108818 3300025935 Bacteria 1849
747 Ga0207709_10239070 3300025935 Bacteria 1320
748 Ga0207670_10228915 3300025936 Bacteria 1427
749 Ga0207669_10103836 3300025937 Bacteria 1886
750 Ga0207669_10174610 3300025937 Bacteria 1533
751 Ga0207669_10301771 3300025937 Bacteria 1217
752 Ga0207691_10002459 3300025940 Bacteria 18118
753 Ga0207691_10005340 3300025940 Bacteria 12402
754 Ga0207691_10102062 3300025940 Bacteria 2559
755 Ga0207691_10221545 3300025940 Bacteria 1640
756 Ga0207691_10270086 3300025940 Bacteria 1464
757 Ga0207711_10008206 3300025941 Bacteria 8740
758 Ga0207711_10011843 3300025941 Bacteria 7247
759 Ga0207711_10030939 3300025941 Bacteria 4515
760 Ga0207711_10873743 3300025941 Bacteria 836
761 Ga0207689_10002718 3300025942 Bacteria 16358
762 Ga0207689_10023944 3300025942 Bacteria 5122
763 Ga0207689_10031365 3300025942 Bacteria 4425
764 Ga0207689_10079531 3300025942 Bacteria 2694
765 Ga0207689_10197185 3300025942 Bacteria 1662
766 Ga0207689_10563622 3300025942 Bacteria 957
767 Ga0207661_10001150 3300025944 Bacteria 17677
768 Ga0207661_10112065 3300025944 Bacteria 2309
769 Ga0207679_10000225 3300025945 Bacteria 44668
770 Ga0207679_10018810 3300025945 Bacteria 4634
771 Ga0207679_10077585 3300025945 Bacteria 2528
772 Ga0207679_11066314 3300025945 Bacteria 741
773 Ga0207667_10000110 3300025949 Bacteria 131872
774 Ga0207667_10003481 3300025949 Bacteria 19435
775 Ga0207667_10004567 3300025949 Bacteria 16975
776 Ga0207667_10005512 3300025949 Bacteria 15434
777 Ga0207667_10009897 3300025949 Bacteria 11183
778 Ga0207667_10090353 3300025949 Bacteria 3165
779 Ga0207667_10350994 3300025949 Bacteria 1504
780 Ga0207651_10027621 3300025960 Bacteria 3567
781 Ga0207651_10067104 3300025960 Bacteria 2523
782 Ga0207651_10076827 3300025960 Bacteria 2388
783 Ga0207651_10178377 3300025960 Bacteria 1682
784 Ga0207712_10009979 3300025961 Bacteria 6018
785 Ga0207712_10174343 3300025961 Bacteria 1684
786 Ga0207712_10304926 3300025961 Bacteria 1308
787 Ga0207668_10162136 3300025972 Bacteria 1743
788 Ga0207640_10002493 3300025981 Bacteria 9864
789 Ga0207640_10008128 3300025981 Bacteria 5809
790 Ga0207640_10319771 3300025981 Bacteria 1235
791 Ga0207640_10328359 3300025981 Bacteria 1221
792 Ga0207658_10001341 3300025986 Bacteria 19263
793 Ga0207658_10010270 3300025986 Bacteria 6361
794 Ga0207658_10053260 3300025986 Bacteria 2989
795 Ga0207658_10353477 3300025986 Bacteria 1280
796 Ga0207658_10422575 3300025986 Bacteria 1175
797 Ga0207677_10000023 3300026023 Bacteria 128514
798 Ga0207677_10003064 3300026023 Bacteria 8834
799 Ga0207677_10012494 3300026023 Bacteria 4885
800 Ga0207677_10041078 3300026023 Bacteria 3055
801 Ga0207677_10087194 3300026023 Bacteria 2259
802 Ga0207703_10002320 3300026035 Bacteria 16616
803 Ga0207703_10071820 3300026035 Bacteria 2859
804 Ga0207703_10212890 3300026035 Bacteria 1724
805 Ga0207639_10024872 3300026041 Bacteria 4338
806 Ga0207639_10089385 3300026041 Bacteria 2461
807 Ga0207678_10001628 3300026067 Bacteria 20589
808 Ga0207708_10107984 3300026075 Bacteria 2158
809 Ga0207708_10226676 3300026075 Bacteria 1499
810 Ga0207708_10236071 3300026075 Bacteria 1469
811 Ga0207702_10001243 3300026078 Bacteria 25735
812 Ga0207702_10189621 3300026078 Bacteria 1899
813 Ga0207702_10221863 3300026078 Bacteria 1762
814 Ga0207702_10620691 3300026078 Bacteria 1062
815 Ga0207641_10000216 3300026088 Bacteria 74765
816 Ga0207641_10000283 3300026088 Bacteria 63661
817 Ga0207641_10056121 3300026088 Bacteria 3346
818 Ga0207641_10125187 3300026088 Bacteria 2300
819 Ga0207641_10477984 3300026088 Bacteria 1207
820 Ga0207648_10000319 3300026089 Bacteria 52621
821 Ga0207648_10000492 3300026089 Bacteria 44104
822 Ga0207648_10029637 3300026089 Bacteria 4853
823 Ga0207648_10035867 3300026089 Bacteria 4370
824 Ga0207648_10152670 3300026089 Bacteria 2038
825 Ga0207676_10001271 3300026095 Bacteria 18758
826 Ga0207674_10022394 3300026116 Bacteria 6786
827 Ga0207674_10184816 3300026116 Bacteria 2035
828 Ga0207674_10362669 3300026116 Bacteria 1401
829 Ga0207674_11079463 3300026116 Bacteria 772
830 Ga0207675_100007230 3300026118 Bacteria 10492
831 Ga0207675_100712457 3300026118 Bacteria 1013
832 Ga0207683_10005156 3300026121 Bacteria 11217
833 Ga0207683_10006290 3300026121 Bacteria 10176
834 Ga0207683_10036312 3300026121 Bacteria 4290
835 Ga0207683_10099365 3300026121 Bacteria 2597
836 Ga0207683_10121982 3300026121 Bacteria 2341
837 Ga0207683_10407401 3300026121 Bacteria 1251
838 Ga0207683_10984286 3300026121 Bacteria 783
839 Ga0207683_11314589 3300026121 Bacteria 669
840 Ga0207698_10000011 3300026142 Bacteria 260352
841 Ga0207698_10002619 3300026142 Bacteria 10698
842 Ga0207698_10003576 3300026142 Bacteria 9380
843 Ga0207698_10063424 3300026142 Bacteria 2892
844 Ga0207698_10127545 3300026142 Bacteria 2167
845 Ga0207698_10152899 3300026142 Bacteria 2006
846 Ga0207698_10169428 3300026142 Bacteria 1921
847 Ga0207698_10174145 3300026142 Bacteria 1898
848 Ga0207698_10225014 3300026142 Bacteria 1699
849 Ga0207698_10522221 3300026142 Bacteria 1159
850 Ga0209281_1000020 3300027111 Bacteria 575972
851 Ga0209281_1009167 3300027111 Bacteria 2340
852 Ga0209389_1007187 3300027296 Bacteria 9782
853 Ga0209371_1000006 3300027312 Bacteria 1055642
854 Ga0209371_1018881 3300027312 Bacteria 1738
855 Ga0209371_1023446 3300027312 Bacteria 1453
856 Ga0209996_1000765 3300027395 Bacteria 3822
857 Ga0209984_1014278 3300027424 Bacteria 1047
858 Ga0209968_1000652 3300027526 Bacteria 5356
859 Ga0209970_1000415 3300027614 Bacteria 7224
860 Ga0209282_1000127 3300027666 Bacteria 48767
861 Ga0209282_1123307 3300027666 Bacteria 1292
862 Ga0209966_1000005 3300027695 Bacteria 103734
863 Ga0209813_10002725 3300027866 Bacteria 4070
864 Ga0209974_10029328 3300027876 Bacteria 1822
865 Ga0209974_10053136 3300027876 Bacteria 1364
866 Ga0268266_10538720 3300028379 Bacteria 1117
867 Ga0268266_11042751 3300028379 Bacteria 791
868 Ga0268265_10003864 3300028380 Bacteria 10577
869 Ga0268265_10084197 3300028380 Bacteria 2520
870 Ga0268264_10000086 3300028381 Bacteria 239021
871 Ga0268264_10001666 3300028381 Bacteria 20465
872 Ga0268264_10233019 3300028381 Bacteria 1701
873 Ga0268264_10977864 3300028381 Bacteria 852
874 Ga0268264_11198878 3300028381 Bacteria 769
875 Ga0265334_10026852 3300028573 Bacteria 2322
876 Ga0307517_10097661 3300028786 Bacteria 2343
877 Ga0307515_10000459 3300028794 Bacteria 97482
878 Ga0307515_10001963 3300028794 Bacteria 45524
879 Ga0307515_10014710 3300028794 Bacteria 14482
880 Ga0307515_10026050 3300028794 Bacteria 10085
881 Ga0307515_10033350 3300028794 Bacteria 8483
882 Ga0307515_10123381 3300028794 Bacteria 2914
883 Ga0307515_10238926 3300028794 Bacteria 1592
884 Ga0265338_10042032 3300028800 Bacteria 4265
885 Ga0265338_10290040 3300028800 Bacteria 1193
886 Ga0265324_10018140 3300029957 Bacteria 2552
887 Ga0268256_1000007 3300030500 Bacteria 1055326
888 Ga0268256_1025697 3300030500 Bacteria 1492
889 Ga0268256_1026567 3300030500 Bacteria 1453
890 Ga0307512_10113847 3300030522 Bacteria 1768
891 Ga0307512_10310328 3300030522 Bacteria 726
892 Ga0316176_1081397 3300030732 Bacteria 863
893 Ga0314311_1026854 3300030733 Bacteria 1868
894 Ga0316183_1152609 3300030742 Bacteria 1364
895 Ga0316181_1185892 3300030744 Bacteria 676
896 Ga0265760_10021726 3300031090 Bacteria 1858
897 Ga0265330_10000032 3300031235 Bacteria 130592
898 Ga0265332_10000001 3300031238 Bacteria 863783
899 Ga0265332_10000014 3300031238 Bacteria 249035
900 Ga0265332_10008632 3300031238 Bacteria 4573
901 Ga0265320_10006647 3300031240 Bacteria 7266
902 Ga0265320_10025753 3300031240 Bacteria 3088
903 Ga0265325_10017822 3300031241 Bacteria 3945
904 Ga0265340_10071377 3300031247 Bacteria 1646
905 Ga0265340_10072242 3300031247 Bacteria 1634
906 Ga0265339_10229013 3300031249 Bacteria 906
907 Ga0265331_10013807 3300031250 Bacteria 4330
908 Ga0265327_10000028 3300031251 Bacteria 361066
909 Ga0265327_10000842 3300031251 Bacteria 45767
910 Ga0265327_10009661 3300031251 Bacteria 6919
911 Ga0265327_10011906 3300031251 Bacteria 5935
912 Ga0265327_10025911 3300031251 Bacteria 3408
913 Ga0265327_10153951 3300031251 Bacteria 1066
914 Ga0265316_10004128 3300031344 Bacteria 14537
915 Ga0307513_10000006 3300031456 Bacteria 470848
916 Ga0307513_10000011 3300031456 Bacteria 354929
917 Ga0307513_10000433 3300031456 Bacteria 60335
918 Ga0307513_10008993 3300031456 Bacteria 12672
919 Ga0307513_10141275 3300031456 Bacteria 2334
920 Ga0307513_10177890 3300031456 Bacteria 1995
921 Ga0307513_10221498 3300031456 Bacteria 1713
922 Ga0307513_10354415 3300031456 Bacteria 1214
923 Ga0307509_10000120 3300031507 Bacteria 114238
924 Ga0307509_10060404 3300031507 Bacteria 4007
925 Ga0307509_10100657 3300031507 Bacteria 2927
926 Ga0307408_100000046 3300031548 Bacteria 167686
927 Ga0307408_100000048 3300031548 Bacteria 165579
928 Ga0307408_100005071 3300031548 Bacteria 8838
929 Ga0307408_100005727 3300031548 Bacteria 8282
930 Ga0307408_100012484 3300031548 Bacteria 5630
931 Ga0307408_100027533 3300031548 Bacteria 3918
932 Ga0307408_100049122 3300031548 Bacteria 3029
933 Ga0307408_100154703 3300031548 Bacteria 1814
934 Ga0307408_100241318 3300031548 Bacteria 1485
935 Ga0307408_100281943 3300031548 Bacteria 1384
936 Ga0307408_100374721 3300031548 Bacteria 1215
937 Ga0307408_101257036 3300031548 Bacteria 692
938 Ga0307508_10000163 3300031616 Bacteria 80086
939 Ga0307508_10078880 3300031616 Bacteria 2873
940 Ga0307508_10120167 3300031616 Bacteria 2229
941 Ga0307514_10000225 3300031649 Bacteria 151002
942 Ga0307514_10024041 3300031649 Bacteria 4936
943 Ga0265314_10000022 3300031711 Bacteria 297299
944 Ga0265314_10014338 3300031711 Bacteria 6350
945 Ga0265314_10027819 3300031711 Bacteria 4226
946 Ga0265314_10187104 3300031711 Bacteria 1235
947 Ga0307516_10000446 3300031730 Bacteria 54416
948 Ga0307516_10003308 3300031730 Bacteria 20859
949 Ga0307516_10004343 3300031730 Bacteria 17529
950 Ga0307516_10005782 3300031730 Bacteria 14650
951 Ga0307516_10014293 3300031730 Bacteria 8405
952 Ga0307516_10076972 3300031730 Bacteria 3186
953 Ga0307516_10137321 3300031730 Bacteria 2218
954 Ga0307516_10210348 3300031730 Bacteria 1660
955 Ga0307516_10325589 3300031730 Bacteria 1207
956 Ga0307516_10579188 3300031730 Bacteria 776
957 Ga0307405_10042818 3300031731 Bacteria 2758
958 Ga0307405_10108573 3300031731 Bacteria 1875
959 Ga0307405_10749787 3300031731 Bacteria 813
960 Ga0307413_10001777 3300031824 Bacteria 8441
961 Ga0307413_10095542 3300031824 Bacteria 1949
962 Ga0307413_10337263 3300031824 Bacteria 1158
963 Ga0307410_10169218 3300031852 Bacteria 1645
964 Ga0307410_10280996 3300031852 Bacteria 1306
965 Ga0307410_10428096 3300031852 Bacteria 1075
966 Ga0307410_10490870 3300031852 Bacteria 1009
967 Ga0307406_10000575 3300031901 Bacteria 21150
968 Ga0307406_10003389 3300031901 Bacteria 8685
969 Ga0307412_10001140 3300031911 Bacteria 15222
970 Ga0307412_10003407 3300031911 Bacteria 8831
971 Ga0307412_10053482 3300031911 Bacteria 2676
972 Ga0307412_10113530 3300031911 Bacteria 1938
973 Ga0307412_10368830 3300031911 Bacteria 1158
974 Ga0307412_10487675 3300031911 Bacteria 1023
975 Ga0307409_100309358 3300031995 Bacteria 1474
976 Ga0307409_100380848 3300031995 Bacteria 1341
977 Ga0307416_100010513 3300032002 Bacteria 6117
978 Ga0307416_100293906 3300032002 Bacteria 1610
979 Ga0307416_100481892 3300032002 Bacteria 1301
980 Ga0307416_100608617 3300032002 Bacteria 1173
981 Ga0307414_10022421 3300032004 Bacteria 3982
982 Ga0307414_10023710 3300032004 Bacteria 3897
983 Ga0307414_10030245 3300032004 Bacteria 3535
984 Ga0307414_10171863 3300032004 Bacteria 1733
985 Ga0307411_10033683 3300032005 Bacteria 3179
986 Ga0307411_10161100 3300032005 Bacteria 1680
987 Ga0307411_10167987 3300032005 Bacteria 1651
988 Ga0307411_10402030 3300032005 Bacteria 1132
989 Ga0307411_11259227 3300032005 Bacteria 672
990 Ga0307415_100005526 3300032126 Bacteria 6723
991 Ga0307415_100957934 3300032126 Bacteria 793
992 Ga0307507_10074397 3300033179 Bacteria 3046
993 Ga0307507_10293737 3300033179 Bacteria 1003
994 Ga0307510_10002394 3300033180 Bacteria 21269
995 Ga0307510_10052763 3300033180 Bacteria 4281
996 Ga0307510_10137639 3300033180 Bacteria 2095
997 Ga0373926_0002266 3300035083 Bacteria 6080
998 Ga0373936_0244956 3300035113 Bacteria 799
999 Ga0373939_0000004 3300035114 Bacteria 106519
1000 Ga0373939_0016008 3300035114 Bacteria 1971
1001 Ga0373939_0186460 3300035114 Bacteria 777
1002 Ga0373941_0094452 3300035115 Bacteria 1031
1003 Ga0373945_0042844 3300035116 Bacteria 1641
1004 Ga0373957_0077988 3300035120 Bacteria 1304
1005 Ga0373960_0001434 3300035121 Bacteria 5279
1006 Ga0373943_0000102 3300035170 Bacteria 31578
1007 Ga0373943_0027135 3300035170 Bacteria 2688
1008 Ga0373946_0000763 3300035171 Bacteria 10962
1009 Ga0373946_0024658 3300035171 Bacteria 2359
1010 Ga0373946_0028107 3300035171 Bacteria 2229
1011 Ga0373955_0010364 3300035172 Bacteria 4399
1012 Ga0373924_0239035 3300035410 Bacteria 803
1013 Ga0373931_0001005 3300035691 Bacteria 11928
1014 Ga0373935_0005950 3300035692 Bacteria 7236
1015 Ga0373935_0014152 3300035692 Bacteria 4816
1016 Ga0373927_0003194 3300035695 Bacteria 11808
1017 Ga0373927_0013278 3300035695 Bacteria 5475
1018 Ga0373927_0109177 3300035695 Bacteria 1802
1019 Ga0373933_0005427 3300035724 Bacteria 6939
1020 Ga0373947_0002970 3300035725 Bacteria 10120
1021 Ga0373947_0008316 3300035725 Bacteria 5976
1022 Ga0373937_0027556 3300036401 Bacteria 5138
1023 Ga0373925_0001514 3300037068 Bacteria 19868
1024 Ga0373925_0018543 3300037068 Bacteria 5058
1025 Ga0373925_0033277 3300037068 Bacteria 3799
1026 Ga0395899_0001751 3300037312 Bacteria 18046
1027 Ga0395899_0003063 3300037312 Bacteria 13332
1028 Ga0395899_0011805 3300037312 Bacteria 6686
1029 Ga0395899_0032509 3300037312 Bacteria 3919
1030 Ga0395899_0033535 3300037312 Bacteria 3855
1031 Ga0395900_0008788 3300037418 Bacteria 10380
1032 Ga0395900_0009935 3300037418 Bacteria 9742
1033 Ga0395900_0012770 3300037418 Bacteria 8584
1034 Ga0395900_0029682 3300037418 Bacteria 5610
1035 Ga0395900_0079898 3300037418 Bacteria 3360
1036 Ga0395900_0086114 3300037418 Bacteria 3229
1037 Ga0395900_0120862 3300037418 Bacteria 2687
1038 Ga0395900_0130517 3300037418 Bacteria 2575
1039 Ga0395900_0268895 3300037418 Bacteria 1700
1040 Ga0395900_0437272 3300037418 Bacteria 1266
1041 Ga0395900_0449471 3300037418 Bacteria 1245
1042 Ga0395900_0474203 3300037418 Bacteria 1205
1043 Ga0395898_0000337 3300037466 Bacteria 106044
1044 Ga0395898_0014216 3300037466 Bacteria 8185
1045 Ga0395898_0184649 3300037466 Bacteria 1993
1046 Ga0395898_0390742 3300037466 Bacteria 1326
1047 Ga0395905_0000249 3300037471 Bacteria 80584
1048 Ga0395905_0000416 3300037471 Bacteria 59735
1049 Ga0395905_0000704 3300037471 Bacteria 44377
1050 Ga0395905_0003638 3300037471 Bacteria 16382
1051 Ga0395905_0012379 3300037471 Bacteria 8213
1052 Ga0395905_0018706 3300037471 Bacteria 6571
1053 Ga0395905_0024829 3300037471 Bacteria 5656
1054 Ga0395905_0052002 3300037471 Bacteria 3836
1055 Ga0395905_0074093 3300037471 Bacteria 3190
1056 Ga0395905_0087681 3300037471 Bacteria 2917
1057 Ga0395905_0090163 3300037471 Bacteria 2874
1058 Ga0395905_0185233 3300037471 Bacteria 1954
1059 Ga0395905_0261590 3300037471 Bacteria 1615
1060 Ga0395905_0336830 3300037471 Bacteria 1399
1061 Ga0436364_0543976 3300037853 Bacteria 1192
1062 Ga0436364_1388333 3300037853 Bacteria 18576
1063 Ga0395901_0003716 3300038443 Bacteria 15380
1064 Ga0395901_0037770 3300038443 Bacteria 4994
1065 Ga0395901_0044289 3300038443 Bacteria 4615
1066 Ga0395901_0077228 3300038443 Bacteria 3476
1067 Ga0395901_0157318 3300038443 Bacteria 2387
1068 Ga0395901_0311600 3300038443 Bacteria 1630
1069 Ga0395901_1125135 3300038443 Bacteria 754
1070 Ga0436365_0267961 3300039437 Bacteria 8545
1071 Ga0436365_0442834 3300039437 Bacteria 1389
1072 Ga0436365_1653741 3300039437 Bacteria 3486
1073 Ga0436361_0120947 3300039447 Bacteria 26467
1074 Ga0436361_0174260 3300039447 Bacteria 101834
1075 Ga0436361_0287651 3300039447 Bacteria 35780
1076 Ga0436361_0292057 3300039447 Bacteria 25019
1077 Ga0436361_0360722 3300039447 Bacteria 3555
1078 Ga0436361_0457180 3300039447 Bacteria 5473
1079 Ga0436361_0727856 3300039447 Bacteria 4487
1080 Ga0436361_0810743 3300039447 Bacteria 2785
1081 Ga0436361_0829339 3300039447 Bacteria 5899
1082 Ga0436361_0850691 3300039447 Bacteria 5463
1083 Ga0436361_0939166 3300039447 Bacteria 85026
1084 Ga0439436_0051941 3300041404 Bacteria 1157
1085 Ga0439438_042417 3300041405 Bacteria 1177
1086 Ga0439439_0041034 3300041406 Bacteria 1199
1087 Ga0439439_0068984 3300041406 Bacteria 945
1088 Ga0439447_051123 3300041407 Bacteria 987
1089 Ga0439465_0001001 3300041413 Bacteria 9009
1090 Ga0451793_0331504 3300041452 Bacteria 1356
1091 Ga0451802_0500530 3300041460 Bacteria 2018
1092 Ga0451837_0453168 3300041494 Bacteria 688
1093 Ga0439431_0000135 3300041997 Bacteria 13228
1094 Ga0439433_0005311 3300041999 Bacteria 2767
1095 Ga0439448_0134225 3300042005 Bacteria 854
1096 Ga0439432_099548 3300042006 Bacteria 870
1097 Ga0439449_0002755 3300042007 Bacteria 6839
1098 Ga0439449_0011957 3300042007 Bacteria 3262
1099 Ga0439451_000253 3300042009 Bacteria 10322
1100 Ga0439456_015159 3300042013 Bacteria 1609
1101 Ga0439462_0042294 3300042015 Bacteria 1217
1102 Ga0450911_000860 3300042115 Bacteria 8275
1103 Ga0450915_006225 3300042119 Bacteria 755
1104 Ga0450917_001159 3300042120 Bacteria 1921
1105 Ga0450888_000211 3300042126 Bacteria 5225
1106 Ga0450890_002103 3300042127 Bacteria 2792
1107 Ga0450890_002841 3300042127 Bacteria 2344
1108 Ga0450891_002311 3300042129 Bacteria 1929
1109 Ga0450892_000342 3300042130 Bacteria 5523
1110 Ga0450898_008464 3300042134 Bacteria 1624
1111 Ga0450889_000406 3300042144 Bacteria 4808
1112 Ga0439434_0030089 3300042435 Bacteria 1647
1113 Ga0439459_0000732 3300042438 Bacteria 4495
1114 Ga0439464_0009922 3300042439 Bacteria 2511
1115 Ga0450893_0003052 3300042532 Bacteria 2634
1116 Ga0450893_0027811 3300042532 Bacteria 998
1117 Ga0451577_0007579 3300042876 Bacteria 10645
1118 Ga0451577_0012178 3300042876 Bacteria 8086
1119 Ga0451577_0014424 3300042876 Bacteria 7368
1120 Ga0451577_0254152 3300042876 Bacteria 1591
1121 Ga0466969_0014612 3300044656 Bacteria 4127
1122 Ga0453683_0001511 3300044673 Bacteria 19858
1123 Ga0453683_0040629 3300044673 Bacteria 2920
1124 Ga0453683_0151115 3300044673 Bacteria 1467
1125 Ga0466965_0004319 3300044683 Bacteria 6313
1126 Ga0466966_0016505 3300044684 Bacteria 4876
1127 Ga0466966_0058836 3300044684 Bacteria 2428
1128 Ga0466966_0075667 3300044684 Bacteria 2103
1129 Ga0466966_0153289 3300044684 Bacteria 1404
1130 Ga0466961_0013324 3300044693 Bacteria 5263
1131 Ga0466961_0116803 3300044693 Bacteria 1676
1132 Ga0466961_0196671 3300044693 Bacteria 1248
1133 Ga0453684_0000126 3300044712 Bacteria 336395
1134 Ga0453684_0713817 3300044712 Bacteria 1088
1135 Ga0466957_0109818 3300044842 Bacteria 1748
1136 Ga0466960_0266513 3300044901 Bacteria 956
1137 Ga0466959_0065867 3300045049 Bacteria 2628
1138 Ga0466959_0097689 3300045049 Bacteria 2104
1139 Ga0451576_0009548 3300045051 Bacteria 11238
1140 Ga0451576_0030419 3300045051 Bacteria 5770
1141 Ga0451576_0065938 3300045051 Bacteria 3769
1142 Ga0466967_0066727 3300045976 Bacteria 3207
1143 Ga0495592_0005124 3300046454 Bacteria 9653
1144 Ga0495592_0033858 3300046454 Bacteria 3853
1145 Ga0495603_0012974 3300046455 Bacteria 5038
1146 Ga0495603_0030464 3300046455 Bacteria 3249
1147 Ga0495629_0001156 3300046459 Bacteria 20848
1148 Ga0495629_0052790 3300046459 Bacteria 2844
1149 Ga0495629_0080113 3300046459 Bacteria 2280
1150 Ga0495651_0000976 3300046462 Bacteria 22172
1151 Ga0495651_0014296 3300046462 Bacteria 6135
1152 Ga0495651_0056416 3300046462 Bacteria 3017
1153 Ga0495653_0002352 3300046463 Bacteria 15015
1154 Ga0495653_0007349 3300046463 Bacteria 9024
1155 Ga0495653_0036253 3300046463 Bacteria 3885
1156 Ga0495650_0000224 3300046471 Bacteria 118058
1157 Ga0495650_0047032 3300046471 Bacteria 1807
1158 Ga0495580_0095758 3300046472 Bacteria 2065
1159 Ga0495582_0158586 3300046473 Bacteria 1286
1160 Ga0495582_0400906 3300046473 Bacteria 791
1161 Ga0495639_0003038 3300046475 Bacteria 7306
1162 Ga0495639_0011256 3300046475 Bacteria 3854
1163 Ga0495662_0001205 3300046476 Bacteria 12769
1164 Ga0495664_0000600 3300046477 Bacteria 18276
1165 Ga0495664_0187161 3300046477 Bacteria 1255
1166 Ga0495584_0088564 3300046491 Bacteria 1560
1167 Ga0495585_0000102 3300046492 Bacteria 91414
1168 Ga0495585_0004598 3300046492 Bacteria 8919
1169 Ga0495585_0007926 3300046492 Bacteria 6458
1170 Ga0495594_0005917 3300046499 Bacteria 6285
1171 Ga0495594_0028138 3300046499 Bacteria 3031
1172 Ga0495594_0120239 3300046499 Bacteria 1484
1173 Ga0495607_0008021 3300046501 Bacteria 7251
1174 Ga0495607_0021370 3300046501 Bacteria 4073
1175 Ga0495583_0000127 3300046506 Bacteria 127780
1176 Ga0495606_0000001 3300046507 Bacteria 592123
1177 Ga0495606_0008822 3300046507 Bacteria 8647
1178 Ga0495608_0002654 3300046511 Bacteria 12846
1179 Ga0495608_0004989 3300046511 Bacteria 9503
1180 Ga0495608_0307865 3300046511 Bacteria 980
1181 Ga0495610_0004596 3300046512 Bacteria 10125
1182 Ga0495610_0011303 3300046512 Bacteria 5467
1183 Ga0495616_0000184 3300046513 Bacteria 52694
1184 Ga0495616_0005947 3300046513 Bacteria 7441
1185 Ga0495616_0094813 3300046513 Bacteria 1407
1186 Ga0495618_0005805 3300046514 Bacteria 7504
1187 Ga0495618_0029268 3300046514 Bacteria 3435
1188 Ga0495618_0131487 3300046514 Bacteria 1601
1189 Ga0495618_0284887 3300046514 Bacteria 1030
1190 Ga0495620_0048787 3300046515 Bacteria 1815
1191 Ga0495628_0008815 3300046516 Bacteria 8632
1192 Ga0495628_0013432 3300046516 Bacteria 6889
1193 Ga0495628_0125817 3300046516 Bacteria 1964
1194 Ga0495628_0483126 3300046516 Bacteria 896
1195 Ga0495630_0005764 3300046517 Bacteria 8754
1196 Ga0495630_0031440 3300046517 Bacteria 3953
1197 Ga0495630_0670853 3300046517 Bacteria 793
1198 Ga0495632_0000081 3300046519 Bacteria 99136
1199 Ga0495632_0030420 3300046519 Bacteria 2802
1200 Ga0495632_0030570 3300046519 Bacteria 2794
1201 Ga0495637_0023019 3300046520 Bacteria 2836
1202 Ga0495643_0000630 3300046522 Bacteria 41718
1203 Ga0495643_0001320 3300046522 Bacteria 23471
1204 Ga0495643_0056018 3300046522 Bacteria 2105
1205 Ga0495643_0126760 3300046522 Bacteria 1285
1206 Ga0495648_0061322 3300046524 Bacteria 2234
1207 Ga0495648_0085982 3300046524 Bacteria 1775
1208 Ga0495663_0033616 3300046525 Bacteria 1532
1209 Ga0495666_0030665 3300046526 Bacteria 2637
1210 Ga0495642_0002999 3300046528 Bacteria 6728
1211 Ga0495652_0004595 3300046529 Bacteria 13160
1212 Ga0495652_0019591 3300046529 Bacteria 6023
1213 Ga0495652_0023823 3300046529 Bacteria 5423
1214 Ga0495652_0027916 3300046529 Bacteria 4971
1215 Ga0495652_0092105 3300046529 Bacteria 2477
1216 Ga0495665_0016891 3300046531 Bacteria 3929
1217 Ga0495665_0136570 3300046531 Bacteria 1282
1218 Ga0495640_0002848 3300046533 Bacteria 13917
1219 Ga0495640_0003109 3300046533 Bacteria 13396
1220 Ga0495640_0093329 3300046533 Bacteria 1983
1221 Ga0495586_0036434 3300046535 Bacteria 2640
1222 Ga0495586_0307160 3300046535 Bacteria 909
1223 Ga0495587_0000911 3300046536 Bacteria 19535
1224 Ga0495587_0051847 3300046536 Bacteria 2423
1225 Ga0495609_0000039 3300046538 Bacteria 179384
1226 Ga0495621_0045216 3300046539 Bacteria 1559
1227 Ga0495621_0119144 3300046539 Bacteria 1019
1228 Ga0495597_0000251 3300046542 Bacteria 48899
1229 Ga0495597_0000514 3300046542 Bacteria 32036
1230 Ga0495597_0002116 3300046542 Bacteria 13162
1231 Ga0495645_0010920 3300046543 Bacteria 6381
1232 Ga0495645_0036308 3300046543 Bacteria 3592
1233 Ga0495645_0072307 3300046543 Bacteria 2485
1234 Ga0495645_0169277 3300046543 Bacteria 1504
1235 Ga0495645_0289206 3300046543 Bacteria 1075
1236 Ga0495622_0011733 3300046557 Bacteria 4051
1237 Ga0495633_0001747 3300046558 Bacteria 16154
1238 Ga0495633_0002178 3300046558 Bacteria 14050
1239 Ga0495633_0066789 3300046558 Bacteria 1679
1240 Ga0495667_0013049 3300046559 Bacteria 5627
1241 Ga0495656_0000072 3300046615 Bacteria 45119
1242 Ga0495668_0000285 3300046616 Bacteria 70023
1243 Ga0495668_0001521 3300046616 Bacteria 22039
1244 Ga0495634_0004529 3300046642 Bacteria 10883
1245 Ga0495634_0014172 3300046642 Bacteria 5752
1246 Ga0495634_0054769 3300046642 Bacteria 2668
1247 Ga0495611_0006200 3300046648 Bacteria 5101
1248 Ga0495611_0167124 3300046648 Bacteria 1028
1249 Ga0495625_0000877 3300046660 Bacteria 40871
1250 Ga0495625_0023894 3300046660 Bacteria 4661
1251 Ga0495625_0027726 3300046660 Bacteria 4256
1252 Ga0495625_0054015 3300046660 Bacteria 2870
1253 Ga0495625_0112635 3300046660 Bacteria 1858
1254 Ga0495635_0014561 3300046663 Bacteria 5501
1255 Ga0495635_0025468 3300046663 Bacteria 4121
1256 Ga0495635_0033601 3300046663 Bacteria 3558
1257 Ga0495635_0043108 3300046663 Bacteria 3114
1258 Ga0495635_0187482 3300046663 Bacteria 1405
1259 Ga0495635_0409522 3300046663 Bacteria 900
1260 Ga0495659_0011166 3300046664 Bacteria 2893
1261 Ga0495661_0000094 3300046665 Bacteria 109394
1262 Ga0495661_0021839 3300046665 Bacteria 4166
1263 Ga0495661_0035155 3300046665 Bacteria 3147
1264 Ga0495661_0049153 3300046665 Bacteria 2559
1265 Ga0495588_0054750 3300046674 Bacteria 2058
1266 Ga0495588_0095435 3300046674 Bacteria 1559
1267 Ga0495657_0139398 3300046675 Bacteria 1513
1268 Ga0495599_0021832 3300046678 Bacteria 3996
1269 Ga0495623_0003590 3300046679 Bacteria 10258
1270 Ga0495623_0015491 3300046679 Bacteria 4928
1271 Ga0495623_0047779 3300046679 Bacteria 2716
1272 Ga0495646_0001661 3300046680 Bacteria 13293
1273 Ga0495646_0002551 3300046680 Bacteria 11188
1274 Ga0495646_0066311 3300046680 Bacteria 2135
1275 Ga0495646_0279299 3300046680 Bacteria 888
1276 Ga0495658_0025453 3300046683 Bacteria 3163
1277 Ga0495658_0228703 3300046683 Bacteria 1166
1278 Ga0495669_0000164 3300046684 Bacteria 42542
1279 Ga0495613_0023024 3300046689 Bacteria 4642
1280 Ga0495613_0026725 3300046689 Bacteria 4299
1281 Ga0495624_0004448 3300046690 Bacteria 10256
1282 Ga0495624_0005580 3300046690 Bacteria 9047
1283 Ga0495670_0038087 3300046691 Bacteria 2397
1284 Ga0495649_0001564 3300046694 Bacteria 17171
1285 Ga0495649_0121797 3300046694 Bacteria 1379
1286 Ga0495589_0000019 3300046794 Bacteria 200814
1287 Ga0495589_0001712 3300046794 Bacteria 12483
1288 Ga0495589_0110138 3300046794 Bacteria 1329
1289 Ga0495600_0003478 3300046809 Bacteria 9261
1290 Ga0495600_0006775 3300046809 Bacteria 6987
1291 Ga0495660_0090374 3300046810 Bacteria 1592
1292 Ga0495581_0087492 3300047315 Bacteria 1806
1293 Ga0495581_0272960 3300047315 Bacteria 988
1294 Ga0495604_0001863 3300047317 Bacteria 17177
1295 Ga0495604_0013119 3300047317 Bacteria 6601
1296 Ga0495604_0030390 3300047317 Bacteria 4290
1297 Ga0495604_0255656 3300047317 Bacteria 1192
1298 Ga0495604_0344532 3300047317 Bacteria 991
1299 Ga0495636_0012076 3300047318 Bacteria 3423
1300 Ga0495674_0001578 3300047319 Bacteria 22344
1301 Ga0495674_0004086 3300047319 Bacteria 14114
1302 Ga0495674_0025320 3300047319 Bacteria 5441
1303 Ga0495672_0001684 3300047320 Bacteria 21407
1304 Ga0495672_0018332 3300047320 Bacteria 4651
1305 Ga0495672_0021435 3300047320 Bacteria 4215
1306 Ga0495676_0007228 3300047321 Bacteria 10184
1307 Ga0495676_0007289 3300047321 Bacteria 10143
1308 Ga0495676_0016920 3300047321 Bacteria 6456
1309 Ga0495676_0100509 3300047321 Bacteria 2141
1310 Ga0495676_0316428 3300047321 Bacteria 1049
1311 Ga0495680_0003432 3300047322 Bacteria 15646
1312 Ga0495680_0041286 3300047322 Bacteria 3670
1313 Ga0495683_0139536 3300047323 Bacteria 1137
1314 Ga0495687_000059 3300047443 Bacteria 179357
1315 Ga0495687_011487 3300047443 Bacteria 4755
1316 Ga0495675_0103322 3300047444 Bacteria 1782
1317 Ga0495675_0286106 3300047444 Bacteria 982
1318 Ga0495677_0000006 3300047445 Bacteria 199230
1319 Ga0495685_013611 3300047447 Bacteria 2761
1320 Ga0495681_0003047 3300047470 Bacteria 11774
1321 Ga0495681_0064113 3300047470 Bacteria 1684
1322 Ga0495684_0013069 3300047471 Bacteria 6408
1323 Ga0495684_0021915 3300047471 Bacteria 4919
1324 Ga0495686_0006497 3300047472 Bacteria 8936
1325 Ga0495686_0010836 3300047472 Bacteria 6461
1326 Ga0495686_0017129 3300047472 Bacteria 4891
1327 Ga0495593_0090265 3300047673 Bacteria 1578
1328 Ga0495602_0006678 3300048088 Bacteria 12091
1329 Ga0495602_0029352 3300048088 Bacteria 5239
1330 Ga0495614_0006650 3300048089 Bacteria 5177
1331 Ga0495626_0000494 3300048091 Bacteria 39727
1332 Ga0495626_0000821 3300048091 Bacteria 27909
1333 Ga0495626_0001165 3300048091 Bacteria 21902
1334 Ga0495626_0001278 3300048091 Bacteria 20542
1335 Ga0496101_0009683 3300048904 Bacteria 6341
1336 Ga0496102_0037805 3300048905 Bacteria 4355
1337 Ga0496102_0946470 3300048905 Bacteria 782
1338 Ga0496102_0997117 3300048905 Bacteria 758
1339 Ga0496103_0032658 3300048906 Bacteria 3177
1340 Ga0496103_0170893 3300048906 Bacteria 1396
1341 Ga0496104_0003204 3300048907 Bacteria 14068
1342 Ga0496104_0086164 3300048907 Bacteria 2999
1343 Ga0496104_0157257 3300048907 Bacteria 2181
1344 Ga0496104_0305695 3300048907 Bacteria 1503
1345 Ga0496105_0003462 3300048908 Bacteria 11674
1346 Ga0496105_0025378 3300048908 Bacteria 4825
1347 Ga0496105_0072207 3300048908 Bacteria 2852
1348 Ga0496105_0093421 3300048908 Bacteria 2484
1349 Ga0496107_0020407 3300048910 Bacteria 4680
1350 Ga0496107_0521993 3300048910 Bacteria 880
1351 Ga0496107_0728200 3300048910 Bacteria 729
1352 Ga0496108_0114489 3300048911 Bacteria 2309
1353 Ga0496108_0309879 3300048911 Bacteria 1375
1354 Ga0496109_0100430 3300048912 Bacteria 2684
1355 Ga0496109_0337033 3300048912 Bacteria 1424
1356 Ga0496110_0054927 3300048913 Bacteria 3503
1357 Ga0496110_0907212 3300048913 Bacteria 787
1358 Ga0496111_0030956 3300048914 Bacteria 3808
1359 Ga0496111_0044917 3300048914 Bacteria 3176
1360 Ga0496112_0150025 3300048915 Bacteria 2298
1361 Ga0496112_0213950 3300048915 Bacteria 1884
1362 Ga0496113_0012960 3300048916 Bacteria 5624
1363 Ga0496114_0686916 3300048917 Bacteria 898
1364 Ga0496115_0284153 3300048918 Bacteria 1358
1365 Ga0496116_0033181 3300048919 Bacteria 3666
1366 Ga0496116_0036895 3300048919 Bacteria 3415
1367 Ga0496116_0052530 3300048919 Bacteria 2699
1368 Ga0496117_0024823 3300048920 Bacteria 4727
1369 Ga0496118_0011398 3300048921 Bacteria 8681
1370 Ga0496119_0012065 3300048922 Bacteria 7062
1371 Ga0496119_0018999 3300048922 Bacteria 5086
1372 Ga0496121_0000567 3300048924 Bacteria 69706
1373 Ga0496121_0006746 3300048924 Bacteria 14087
1374 Ga0496121_0012939 3300048924 Bacteria 9020
1375 Ga0496121_0026546 3300048924 Bacteria 5452
1376 Ga0496121_0028452 3300048924 Bacteria 5201
1377 Ga0496121_0036698 3300048924 Bacteria 4364
1378 Ga0496121_0167049 3300048924 Bacteria 1602
1379 Ga0496122_0000644 3300048925 Bacteria 70937
1380 Ga0496122_0005337 3300048925 Bacteria 15366
1381 Ga0496122_0196473 3300048925 Bacteria 1184
1382 Ga0496123_0000057 3300048926 Bacteria 228608
1383 Ga0496123_0000203 3300048926 Bacteria 121361
1384 Ga0496123_0034513 3300048926 Bacteria 3622
1385 Ga0496124_0000024 3300048927 Bacteria 414291
1386 Ga0496124_0034858 3300048927 Bacteria 4409
1387 Ga0496124_0081990 3300048927 Bacteria 2649
1388 Ga0496124_0298057 3300048927 Bacteria 1166
1389 Ga0496125_0000011 3300048928 Bacteria 655895
1390 Ga0496125_0033728 3300048928 Bacteria 4524
1391 Ga0495678_001541 3300049459 Bacteria 17802
1392 Ga0501031_0004268 3300049568 Bacteria 9236
1393 Ga0501032_0001868 3300049569 Bacteria 16653
1394 Ga0501032_0271036 3300049569 Bacteria 1100
1395 Ga0501032_0409307 3300049569 Bacteria 871
1396 Ga0501033_0000491 3300049570 Bacteria 37247
1397 Ga0501033_0014446 3300049570 Bacteria 5996
1398 Ga0501034_0165962 3300049571 Bacteria 2176
1399 Ga0501034_0273556 3300049571 Bacteria 1629
1400 Ga0501034_0462341 3300049571 Bacteria 1185
1401 Ga0501036_0000389 3300049572 Bacteria 30927
1402 Ga0501036_0178885 3300049572 Bacteria 1786
1403 Ga0501037_0001552 3300049573 Bacteria 16758
1404 Ga0501037_0003775 3300049573 Bacteria 10987
1405 Ga0501037_0142292 3300049573 Bacteria 1716
1406 Ga0501038_0000414 3300049574 Bacteria 36995
1407 Ga0501038_0026046 3300049574 Bacteria 5209
1408 Ga0501038_0348534 3300049574 Bacteria 1154
1409 Ga0501043_0015683 3300049579 Bacteria 5939
1410 Ga0501043_0222465 3300049579 Bacteria 1460
1411 Ga0501046_0028661 3300049580 Bacteria 4533
1412 Ga0501047_0007765 3300049581 Bacteria 10101
1413 Ga0501047_0019806 3300049581 Bacteria 6457
1414 Ga0501076_0347967 3300049592 Bacteria 1217
1415 Ga0501198_000021 3300049649 Bacteria 70854
1416 Ga0501222_000018 3300049662 Bacteria 71805
1417 Ga0501257_003248 3300049686 Bacteria 3474
1418 Ga0501229_013039 3300049706 Bacteria 1065
1419 Ga0501080_0787502 3300049742 Bacteria 835
1420 Ga0501241_004893 3300049758 Bacteria 2500
1421 Ga0501035_0002711 3300049822 Bacteria 17218
1422 Ga0501035_0010322 3300049822 Bacteria 8665
1423 Ga0501035_0015605 3300049822 Bacteria 7010
1424 Ga0501035_0100847 3300049822 Bacteria 2534
1425 Ga0501044_0001056 3300049823 Bacteria 33138
1426 Ga0501044_0001117 3300049823 Bacteria 31880
1427 Ga0501044_0005223 3300049823 Bacteria 14450
1428 Ga0501044_0032525 3300049823 Bacteria 5483
1429 Ga0501044_0043140 3300049823 Bacteria 4687
1430 nmdc:mga03683_1332_c1 3300050489 Bacteria 7311
1431 nmdc:mga03683_81758_c1 3300050489 Bacteria 1396
1432 nmdc:mga03n38_8009_c1 3300050490 Bacteria 3770
1433 nmdc:mga00v17_114337_c1 3300050491 Bacteria 1714
1434 nmdc:mga00v17_7626_c1 3300050491 Bacteria 5786
1435 nmdc:mga0yw44_10267_c1 3300050492 Bacteria 4776
1436 nmdc:mga0k408_119132_c1 3300050493 Bacteria 1563
1437 nmdc:mga0k408_32769_c1 3300050493 Bacteria 2969
1438 nmdc:mga0k408_5324_c1 3300050493 Bacteria 6835
1439 nmdc:mga06z11_16406_c1 3300050494 Bacteria 3336
1440 nmdc:mga04h51_2254_c1 3300050495 Bacteria 4546
1441 nmdc:mga07m45_3456_c1 3300050496 Bacteria 7619
1442 nmdc:mga07m45_81165_c1 3300050496 Bacteria 1852
1443 Ga0495601_0001015 3300053077 Bacteria 15352
1444 Ga0495601_0062988 3300053077 Bacteria 2356
1445 Ga0495601_0164118 3300053077 Bacteria 1452
1446 Ga0495601_0277200 3300053077 Bacteria 1093
1447 Ga0495612_0000523 3300053078 Bacteria 15440
1448 Ga0495612_0142801 3300053078 Bacteria 1039
1449 Ga0495595_0000244 3300053084 Bacteria 21433
1450 Ga0495619_0001492 3300053085 Bacteria 15422
1451 Ga0495619_0007733 3300053085 Bacteria 6802
1452 Ga0495619_0216970 3300053085 Bacteria 1325
1453 Ga0495619_0416771 3300053085 Bacteria 927
1454 Ga0500643_002719 3300053087 Bacteria 8878
1455 Ga0500643_004495 3300053087 Bacteria 6283
1456 Ga0500644_0008465 3300053088 Bacteria 2717
1457 Ga0500644_0118860 3300053088 Bacteria 1027
1458 Ga0500583_0019278 3300053092 Bacteria 2793
1459 Ga0500651_0000052 3300053093 Bacteria 76301
1460 Ga0500566_0090743 3300053094 Bacteria 1689
1461 Ga0500566_0221184 3300053094 Bacteria 941
1462 Ga0500594_0028715 3300053118 Bacteria 1449
1463 Ga0500594_0094382 3300053118 Bacteria 912
1464 Ga0500607_000003 3300053121 Bacteria 149664
1465 Ga0500608_000074 3300053122 Bacteria 42636
1466 Ga0500608_135974 3300053122 Bacteria 1096
1467 Ga0500618_001117 3300053125 Bacteria 13113
1468 Ga0500626_073827 3300053128 Bacteria 1515
1469 Ga0500655_000281 3300053133 Bacteria 11746
1470 Ga0500658_0000033 3300053134 Bacteria 89738
1471 Ga0500658_0000040 3300053134 Bacteria 79293
1472 Ga0500559_0000011 3300053136 Bacteria 164751
1473 Ga0500559_0000400 3300053136 Bacteria 31323
1474 Ga0500559_0006122 3300053136 Bacteria 5446
1475 Ga0500568_0004186 3300053139 Bacteria 7782
1476 Ga0500568_0006369 3300053139 Bacteria 5930
1477 Ga0500573_0005745 3300053140 Bacteria 6656
1478 Ga0500574_000287 3300053141 Bacteria 6183
1479 Ga0500574_066915 3300053141 Bacteria 1049
1480 Ga0500590_001152 3300053148 Bacteria 10437
1481 Ga0500604_0000025 3300053151 Bacteria 68203
1482 Ga0500604_0007438 3300053151 Bacteria 2901
1483 Ga0500616_0000254 3300053153 Bacteria 82664
1484 Ga0500616_0219060 3300053153 Bacteria 831
1485 Ga0500619_000035 3300053154 Bacteria 41663
1486 Ga0500622_0013799 3300053156 Bacteria 4352
1487 Ga0500622_0017687 3300053156 Bacteria 3793
1488 Ga0500622_0018708 3300053156 Bacteria 3680
1489 Ga0500645_002612 3300053730 Bacteria 7896
1490 Ga0590075_036627 3300059424 Bacteria 1250
1491 Ga0590077_033052 3300059426 Bacteria 1134
1492 Ga0587084_048259 3300059477 Bacteria 746
1493 Ga0587088_008258 3300059508 Bacteria 1467
1494 Ga0587092_019830 3300059512 Bacteria 1029
1495 Ga0587098_014045 3300059604 Bacteria 939
1496 Ga0587072_003368 3300059643 Bacteria 2241
1497 Ga0466962_0009549 3300061719 Bacteria 4652

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050489 nmdc:mga03683_1332_c1 nmdc:mga03683_1332_c1_6247_6882 199
2 3300050490 nmdc:mga03n38_8009_c1 nmdc:mga03n38_8009_c1_1305_1940 199
3 3300050491 nmdc:mga00v17_7626_c1 nmdc:mga00v17_7626_c1_1305_1940 199
4 3300050492 nmdc:mga0yw44_10267_c1 nmdc:mga0yw44_10267_c1_3847_4482 199
5 3300050493 nmdc:mga0k408_32769_c1 nmdc:mga0k408_32769_c1_1588_2223 199
6 3300050494 nmdc:mga06z11_16406_c1 nmdc:mga06z11_16406_c1_537_1172 199
7 3300050495 nmdc:mga04h51_2254_c1 nmdc:mga04h51_2254_c1_1423_2058 199
8 3300050496 nmdc:mga07m45_81165_c1 nmdc:mga07m45_81165_c1_837_1472 199
9 3300053092 Ga0500583_0019278 Ga0500583_0019278_640_1275 199
10 3300053118 Ga0500594_0094382 Ga0500594_0094382_107_742 199
11 3300053151 Ga0500604_0007438 Ga0500604_0007438_1799_2434 199
12 3300033180 Ga0307510_10137639 Ga0307510_101376393 200
13 3300013102 Ga0157371_10548477 Ga0157371_105484771 201
14 3300048919 Ga0496116_0033181 Ga0496116_0033181_1648_2301 201
15 3300048922 Ga0496119_0012065 Ga0496119_0012065_1301_1954 201
16 3300048928 Ga0496125_0000011 Ga0496125_0000011_211429_212082 201
17 3300009551 Ga0105238_10194328 Ga0105238_101943282 202
18 3300013307 Ga0157372_10594982 Ga0157372_105949822 202
19 3300014497 Ga0182008_10071746 Ga0182008_100717462 202
20 3300015261 Ga0182006_1031937 Ga0182006_10319373 202
21 3300025298 Ga0209050_1002423 Ga0209050_10024233 202
22 3300025303 Ga0209051_1023358 Ga0209051_10233584 202
23 3300037312 Ga0395899_0003063 Ga0395899_0003063_12529_13158 202
24 3300037418 Ga0395900_0012770 Ga0395900_0012770_81_710 202
25 3300037418 Ga0395900_0029682 Ga0395900_0029682_4492_5121 202
26 3300037418 Ga0395900_0474203 Ga0395900_0474203_498_1130 202
27 3300039447 Ga0436361_0360722 Ga0436361_0360722_378_1007 202
28 3300042005 Ga0439448_0134225 Ga0439448_0134225_205_834 202
29 3300044684 Ga0466966_0058836 Ga0466966_0058836_354_986 202
30 3300044684 Ga0466966_0153289 Ga0466966_0153289_78_707 202
31 3300044693 Ga0466961_0013324 Ga0466961_0013324_2409_3041 202
32 3300044693 Ga0466961_0116803 Ga0466961_0116803_1031_1660 202
33 3300045049 Ga0466959_0065867 Ga0466959_0065867_808_1437 202
34 3300045049 Ga0466959_0097689 Ga0466959_0097689_1019_1651 202
35 3300045976 Ga0466967_0066727 Ga0466967_0066727_1713_2342 202
36 3300046455 Ga0495603_0012974 Ga0495603_0012974_2596_3225 202
37 3300046463 Ga0495653_0036253 Ga0495653_0036253_3162_3791 202
38 3300046471 Ga0495650_0000224 Ga0495650_0000224_107380_108009 202
39 3300046499 Ga0495594_0005917 Ga0495594_0005917_957_1586 202
40 3300046499 Ga0495594_0028138 Ga0495594_0028138_170_799 202
41 3300046499 Ga0495594_0120239 Ga0495594_0120239_609_1238 202
42 3300046501 Ga0495607_0008021 Ga0495607_0008021_6446_7075 202
43 3300046513 Ga0495616_0000184 Ga0495616_0000184_32822_33451 202
44 3300046513 Ga0495616_0005947 Ga0495616_0005947_1493_2122 202
45 3300046519 Ga0495632_0000081 Ga0495632_0000081_41121_41750 202
46 3300046520 Ga0495637_0023019 Ga0495637_0023019_532_1182 202
47 3300046531 Ga0495665_0016891 Ga0495665_0016891_90_719 202
48 3300046531 Ga0495665_0136570 Ga0495665_0136570_564_1193 202
49 3300046535 Ga0495586_0036434 Ga0495586_0036434_186_815 202
50 3300046536 Ga0495587_0051847 Ga0495587_0051847_766_1395 202
51 3300046538 Ga0495609_0000039 Ga0495609_0000039_105764_106393 202
52 3300046542 Ga0495597_0000514 Ga0495597_0000514_3038_3667 202
53 3300046543 Ga0495645_0036308 Ga0495645_0036308_870_1502 202
54 3300046660 Ga0495625_0000877 Ga0495625_0000877_7374_8003 202
55 3300046663 Ga0495635_0409522 Ga0495635_0409522_259_888 202
56 3300046664 Ga0495659_0011166 Ga0495659_0011166_2201_2830 202
57 3300046665 Ga0495661_0000094 Ga0495661_0000094_1176_1805 202
58 3300046665 Ga0495661_0035155 Ga0495661_0035155_998_1627 202
59 3300046679 Ga0495623_0047779 Ga0495623_0047779_639_1268 202
60 3300046680 Ga0495646_0001661 Ga0495646_0001661_10179_10811 202
61 3300046690 Ga0495624_0004448 Ga0495624_0004448_5583_6212 202
62 3300046794 Ga0495589_0000019 Ga0495589_0000019_107535_108164 202
63 3300046794 Ga0495589_0001712 Ga0495589_0001712_8566_9195 202
64 3300047315 Ga0495581_0272960 Ga0495581_0272960_90_719 202
65 3300047317 Ga0495604_0255656 Ga0495604_0255656_373_1002 202
66 3300047317 Ga0495604_0344532 Ga0495604_0344532_319_948 202
67 3300047318 Ga0495636_0012076 Ga0495636_0012076_849_1478 202
68 3300047321 Ga0495676_0100509 Ga0495676_0100509_1261_1890 202
69 3300047321 Ga0495676_0316428 Ga0495676_0316428_41_670 202
70 3300047443 Ga0495687_000059 Ga0495687_000059_105764_106393 202
71 3300047445 Ga0495677_0000006 Ga0495677_0000006_92838_93467 202
72 3300048091 Ga0495626_0000494 Ga0495626_0000494_17540_18169 202
73 3300048091 Ga0495626_0000821 Ga0495626_0000821_3191_3820 202
74 3300048091 Ga0495626_0001278 Ga0495626_0001278_14154_14783 202
75 3300048905 Ga0496102_0037805 Ga0496102_0037805_177_830 202
76 3300048905 Ga0496102_0997117 Ga0496102_0997117_22_675 202
77 3300048907 Ga0496104_0086164 Ga0496104_0086164_1474_2127 202
78 3300048908 Ga0496105_0093421 Ga0496105_0093421_1689_2342 202
79 3300048910 Ga0496107_0521993 Ga0496107_0521993_174_827 202
80 3300048911 Ga0496108_0309879 Ga0496108_0309879_29_682 202
81 3300048912 Ga0496109_0100430 Ga0496109_0100430_747_1400 202
82 3300048913 Ga0496110_0054927 Ga0496110_0054927_269_922 202
83 3300048914 Ga0496111_0030956 Ga0496111_0030956_2932_3585 202
84 3300048917 Ga0496114_0686916 Ga0496114_0686916_89_742 202
85 3300048924 Ga0496121_0012939 Ga0496121_0012939_1992_2630 202
86 3300049569 Ga0501032_0271036 Ga0501032_0271036_34_666 202
87 3300049571 Ga0501034_0165962 Ga0501034_0165962_1380_2012 202
88 3300049572 Ga0501036_0178885 Ga0501036_0178885_703_1335 202
89 3300049573 Ga0501037_0142292 Ga0501037_0142292_621_1253 202
90 3300049574 Ga0501038_0026046 Ga0501038_0026046_2451_3083 202
91 3300049579 Ga0501043_0222465 Ga0501043_0222465_750_1382 202
92 3300049581 Ga0501047_0019806 Ga0501047_0019806_2402_3034 202
93 3300049822 Ga0501035_0010322 Ga0501035_0010322_1397_2029 202
94 3300049822 Ga0501035_0015605 Ga0501035_0015605_4205_4837 202
95 3300049823 Ga0501044_0001056 Ga0501044_0001056_7988_8620 202
96 3300049823 Ga0501044_0005223 Ga0501044_0005223_2726_3358 202
97 3300050491 nmdc:mga00v17_114337_c1 nmdc:mga00v17_114337_c1_1036_1668 202
98 3300061719 Ga0466962_0009549 Ga0466962_0009549_710_1342 202
99 iso_pu_bacteria 2856287931 2856294109 202
100 iso_pu_bacteria 2857357740 2857366272 202
101 3300002987 JGI25159J45721_1001076 JGI25159J45721_10010767 203
102 3300003771 Ga0055526_1001576 Ga0055526_100157614 203
103 3300004625 Ga0055543_1005432 Ga0055543_10054324 203
104 3300005262 Ga0065165_1000353 Ga0065165_100035362 203
105 3300025284 Ga0209130_1000156 Ga0209130_100015686 203
106 3300025295 Ga0209564_1000089 Ga0209564_1000089122 203
107 3300025941 Ga0207711_10873743 Ga0207711_108737432 203
108 3300028800 Ga0265338_10290040 Ga0265338_102900402 203
109 3300031911 Ga0307412_10001140 Ga0307412_100011403 203
110 3300035171 Ga0373946_0028107 Ga0373946_0028107_1324_1953 203
111 3300036401 Ga0373937_0027556 Ga0373937_0027556_3814_4443 203
112 3300041405 Ga0439438_042417 Ga0439438_042417_462_1112 203
113 3300046459 Ga0495629_0001156 Ga0495629_0001156_7233_7862 203
114 3300046471 Ga0495650_0047032 Ga0495650_0047032_1101_1751 203
115 3300046473 Ga0495582_0158586 Ga0495582_0158586_93_722 203
116 3300046511 Ga0495608_0002654 Ga0495608_0002654_10631_11260 203
117 3300046517 Ga0495630_0670853 Ga0495630_0670853_134_763 203
118 3300046529 Ga0495652_0023823 Ga0495652_0023823_4346_4975 203
119 3300046536 Ga0495587_0000911 Ga0495587_0000911_7288_7917 203
120 3300046543 Ga0495645_0010920 Ga0495645_0010920_3653_4282 203
121 3300046559 Ga0495667_0013049 Ga0495667_0013049_4701_5330 203
122 3300046642 Ga0495634_0004529 Ga0495634_0004529_9235_9864 203
123 3300046689 Ga0495613_0026725 Ga0495613_0026725_3540_4169 203
124 3300046809 Ga0495600_0006775 Ga0495600_0006775_2166_2795 203
125 3300047317 Ga0495604_0001863 Ga0495604_0001863_6345_6974 203
126 3300047319 Ga0495674_0001578 Ga0495674_0001578_10639_11268 203
127 3300048913 Ga0496110_0907212 Ga0496110_0907212_63_716 203
128 3300048921 Ga0496118_0011398 Ga0496118_0011398_7122_7925 203
129 3300048925 Ga0496122_0000644 Ga0496122_0000644_54720_55373 203
130 3300048926 Ga0496123_0000203 Ga0496123_0000203_107349_108002 203
131 3300048927 Ga0496124_0034858 Ga0496124_0034858_1650_2303 203
132 3300053077 Ga0495601_0062988 Ga0495601_0062988_143_772 203
133 3300053077 Ga0495601_0277200 Ga0495601_0277200_166_795 203
134 3300053084 Ga0495595_0000244 Ga0495595_0000244_10653_11282 203
135 3300053085 Ga0495619_0007733 Ga0495619_0007733_3949_4578 203
136 iso_pu_bacteria 2818991435 2819539152 203
137 iso_pu_bacteria 2818991454 2819648334 203
138 iso_pu_bacteria 2904479285 2904481859 203
139 iso_pu_bacteria 2952252522 2952255615 203
140 3300006051 Ga0075364_10001014 Ga0075364_100010149 204
141 3300046491 Ga0495584_0088564 Ga0495584_0088564_812_1462 204
142 3300046492 Ga0495585_0000102 Ga0495585_0000102_36745_37395 204
143 3300046513 Ga0495616_0094813 Ga0495616_0094813_466_1116 204
144 3300046519 Ga0495632_0030420 Ga0495632_0030420_2139_2789 204
145 3300046522 Ga0495643_0056018 Ga0495643_0056018_228_878 204
146 3300046648 Ga0495611_0006200 Ga0495611_0006200_4032_4682 204
147 3300046660 Ga0495625_0023894 Ga0495625_0023894_2617_3267 204
148 3300046794 Ga0495589_0110138 Ga0495589_0110138_61_711 204
149 3300047447 Ga0495685_013611 Ga0495685_013611_1929_2579 204
150 3300049570 Ga0501033_0014446 Ga0501033_0014446_5137_5778 204
151 3300049574 Ga0501038_0348534 Ga0501038_0348534_194_835 204
152 3300049822 Ga0501035_0100847 Ga0501035_0100847_503_1144 204
153 3300049823 Ga0501044_0043140 Ga0501044_0043140_471_1112 204
154 iso_pu_bacteria 2643221570 2643866594 204
155 iso_pu_bacteria 2643221640 2644225910 204
156 iso_pu_bacteria 2643221642 2644235399 204
157 iso_pu_bacteria 2643221652 2644296352 204
158 iso_pu_bacteria 2881101125 2881104189 204
159 iso_pu_bacteria 2939631187 2939632171 204
160 3300042009 Ga0439451_000253 Ga0439451_000253_2277_2906 205
161 3300042013 Ga0439456_015159 Ga0439456_015159_41_670 205
162 iso_pu_bacteria 2511231003 2511248470 205
163 iso_pu_bacteria 2511231026 2511385044 205
164 iso_pu_bacteria 2521172590 2521560555 205
165 iso_pu_bacteria 2551306416 2553005660 205
166 iso_pu_bacteria 2599185292 2599903268 205
167 iso_pu_bacteria 2600255292 2601669708 205
168 iso_pu_bacteria 2639762793 2640734230 205
169 iso_pu_bacteria 2643221554 2643790602 205
170 iso_pu_bacteria 2643221556 2643799913 205
171 iso_pu_bacteria 2643221569 2643862236 205
172 iso_pu_bacteria 2643221594 2643980737 205
173 iso_pu_bacteria 2643221603 2644028954 205
174 iso_pu_bacteria 2643221621 2644122162 205
175 iso_pu_bacteria 2643221645 2644253376 205
176 iso_pu_bacteria 2643221664 2644355576 205
177 iso_pu_bacteria 2643221684 2644474914 205
178 iso_pu_bacteria 2675903507 2678231208 205
179 iso_pu_bacteria 2738541280 2738737303 205
180 iso_pu_bacteria 2738541297 2738830074 205
181 iso_pu_bacteria 2738541300 2738841524 205
182 iso_pu_bacteria 2738541357 2739153870 205
183 iso_pu_bacteria 2738543003 2739195790 205
184 iso_pu_bacteria 2738543018 2739272395 205
185 iso_pu_bacteria 2738543026 2739322266 205
186 iso_pu_bacteria 2738543029 2739340507 205
187 iso_pu_bacteria 2738543030 2739341439 205
188 iso_pu_bacteria 2739367655 2739612225 205
189 iso_pu_bacteria 2765235838 2765571806 205
190 iso_pu_bacteria 2773857761 2774388237 205
191 iso_pu_bacteria 2808606386 2808982188 205
192 iso_pu_bacteria 2808606395 2809031946 205
193 iso_pu_bacteria 2808606415 2809130012 205
194 iso_pu_bacteria 2808606418 2809146730 205
195 iso_pu_bacteria 2808606419 2809148933 205
196 iso_pu_bacteria 2818991436 2819540680 205
197 iso_pu_bacteria 2818991445 2819593496 205
198 iso_pu_bacteria 2818991449 2819617248 205
199 iso_pu_bacteria 2821131069 2821132013 205
200 iso_pu_bacteria 2839094727 2839098473 205
201 iso_pu_bacteria 2842711865 2842712744 205
202 iso_pu_bacteria 2852618963 2852619069 205
203 iso_pu_bacteria 2855730933 2855734543 205
204 iso_pu_bacteria 2855767633 2855770133 205
205 iso_pu_bacteria 2857537821 2857538428 205
206 iso_pu_bacteria 2857542790 2857545256 205
207 iso_pu_bacteria 2857547612 2857551225 205
208 iso_pu_bacteria 2857553236 2857557717 205
209 iso_pu_bacteria 2857558681 2857563989 205
210 iso_pu_bacteria 2857564685 2857568532 205
211 iso_pu_bacteria 2857576091 2857578636 205
212 iso_pu_bacteria 2858950400 2858955689 205
213 iso_pu_bacteria 2881412998 2881414347 205
214 iso_pu_bacteria 2881927736 2881930324 205
215 iso_pu_bacteria 2884811622 2884812569 205
216 iso_pu_bacteria 2884811622 2884816163 205
217 iso_pu_bacteria 2884836552 2884839394 205
218 iso_pu_bacteria 2884836552 2884840030 205
219 iso_pu_bacteria 2884852848 2884856796 205
220 iso_pu_bacteria 2884852848 2884857202 205
221 iso_pu_bacteria 2887375801 2887377920 205
222 iso_pu_bacteria 2896154374 2896157789 205
223 iso_pu_bacteria 2896154374 2896158142 205
224 iso_pu_bacteria 2904439833 2904442886 205
225 iso_pu_bacteria 2904530477 2904534918 205
226 iso_pu_bacteria 2904584206 2904588743 205
227 iso_pu_bacteria 2904589729 2904594183 205
228 iso_pu_bacteria 2904601388 2904604979 205
229 iso_pu_bacteria 2916699645 2916699728 205
230 iso_pu_bacteria 2919046199 2919048618 205
231 iso_pu_bacteria 2919079590 2919083212 205
232 iso_pu_bacteria 2919182534 2919184125 205
233 iso_pu_bacteria 2919476304 2919480296 205
234 iso_pu_bacteria 2923510766 2923514333 205
235 iso_pu_bacteria 2928130867 2928133069 205
236 iso_pu_bacteria 2932410948 2932413194 205
237 iso_pu_bacteria 2932416698 2932417255 205
238 iso_pu_bacteria 2941479691 2941481975 205
239 iso_pu_bacteria 8002392321 8002394976 205
240 iso_pu_bacteria 8047673197 8047673309 205
241 iso_pu_bacteria 8048746797 8048749800 205
242 iso_pu_bacteria 8055225921 8055227904 205
243 3300006048 Ga0075363_100002405 Ga0075363_1000024052 206
244 3300006051 Ga0075364_10644528 Ga0075364_106445281 206
245 3300006177 Ga0075362_10003092 Ga0075362_100030923 206
246 3300006178 Ga0075367_10018656 Ga0075367_100186562 206
247 3300006186 Ga0075369_10019058 Ga0075369_100190582 206
248 3300006195 Ga0075366_10136681 Ga0075366_101366811 206
249 3300027866 Ga0209813_10002725 Ga0209813_100027252 206
250 iso_pu_bacteria 2599185352 2600197984 206
251 3300001979 JGI24740J21852_10003031 JGI24740J21852_100030316 207
252 3300001989 JGI24739J22299_10038407 JGI24739J22299_100384072 207
253 3300002704 JGI25155J39150_1000073 JGI25155J39150_10000736 207
254 3300002705 JGI25156J39149_1000609 JGI25156J39149_10006096 207
255 3300002705 JGI25156J39149_1004731 JGI25156J39149_10047313 207
256 3300002738 JGI25154J39366_1000118 JGI25154J39366_100011856 207
257 3300002738 JGI25154J39366_1000258 JGI25154J39366_10002586 207
258 3300002738 JGI25154J39366_1000270 JGI25154J39366_100027016 207
259 3300002741 JGI25157J39369_1000001 JGI25157J39369_10000016 207
260 3300002773 JGI25152J39213_1001584 JGI25152J39213_10015844 207
261 3300002774 JGI25150J39212_1001402 JGI25150J39212_10014025 207
262 3300002774 JGI25150J39212_1010535 JGI25150J39212_10105353 207
263 3300002987 JGI25159J45721_1001508 JGI25159J45721_10015088 207
264 3300002987 JGI25159J45721_1001707 JGI25159J45721_100170710 207
265 3300002987 JGI25159J45721_1007198 JGI25159J45721_10071982 207
266 3300003187 JGI25151J46595_10003026 JGI25151J46595_100030268 207
267 3300003187 JGI25151J46595_10036981 JGI25151J46595_100369812 207
268 3300003354 JGI25160J50197_1000259 JGI25160J50197_100025910 207
269 3300003354 JGI25160J50197_1002071 JGI25160J50197_10020718 207
270 3300003354 JGI25160J50197_1003470 JGI25160J50197_100347010 207
271 3300003374 JGI25161J50226_1000092 JGI25161J50226_100009260 207
272 3300003374 JGI25161J50226_1002450 JGI25161J50226_10024504 207
273 3300003578 Ga0006562J51391_1148455 Ga0006562J51391_11484552 207
274 3300003761 Ga0055535_1000215 Ga0055535_10002157 207
275 3300003762 Ga0055542_1000004 Ga0055542_1000004419 207
276 3300003762 Ga0055542_1000412 Ga0055542_100041211 207
277 3300003771 Ga0055526_1003709 Ga0055526_10037098 207
278 3300003771 Ga0055526_1004811 Ga0055526_10048113 207
279 3300003771 Ga0055526_1006869 Ga0055526_10068694 207
280 3300003771 Ga0055526_1008931 Ga0055526_10089314 207
281 3300003773 Ga0055537_1000086 Ga0055537_100008619 207
282 3300003773 Ga0055537_1000587 Ga0055537_10005873 207
283 3300003773 Ga0055537_1001401 Ga0055537_10014014 207
284 3300003775 Ga0055524_1000093 Ga0055524_100009318 207
285 3300003775 Ga0055524_1000194 Ga0055524_100019439 207
286 3300003775 Ga0055524_1002243 Ga0055524_100224310 207
287 3300003775 Ga0055524_1002452 Ga0055524_10024524 207
288 3300003781 Ga0055536_1014255 Ga0055536_10142552 207
289 3300003784 Ga0055534_1000024 Ga0055534_100002495 207
290 3300003784 Ga0055534_1001417 Ga0055534_10014174 207
291 3300003784 Ga0055534_1001838 Ga0055534_10018386 207
292 3300003784 Ga0055534_1021827 Ga0055534_10218272 207
293 3300003790 Ga0055528_1000961 Ga0055528_10009614 207
294 3300003790 Ga0055528_1002611 Ga0055528_10026114 207
295 3300003790 Ga0055528_1014420 Ga0055528_10144203 207
296 3300003791 Ga0055530_10000541 Ga0055530_1000054120 207
297 3300003791 Ga0055530_10057965 Ga0055530_100579651 207
298 3300003792 Ga0055540_1000089 Ga0055540_100008943 207
299 3300003792 Ga0055540_1004954 Ga0055540_10049544 207
300 3300003792 Ga0055540_1006243 Ga0055540_10062432 207
301 3300003792 Ga0055540_1013378 Ga0055540_10133782 207
302 3300003794 Ga0055531_10000269 Ga0055531_1000026940 207
303 3300003794 Ga0055531_10005739 Ga0055531_100057394 207
304 3300003794 Ga0055531_10009722 Ga0055531_100097222 207
305 3300003841 Ga0055541_1001138 Ga0055541_10011382 207
306 3300004625 Ga0055543_1004025 Ga0055543_10040252 207
307 3300004625 Ga0055543_1009685 Ga0055543_10096852 207
308 3300005262 Ga0065165_1005751 Ga0065165_10057515 207
309 3300005262 Ga0065165_1014470 Ga0065165_10144702 207
310 3300005262 Ga0065165_1036832 Ga0065165_10368322 207
311 3300005262 Ga0065165_1038483 Ga0065165_10384832 207
312 3300005288 Ga0065714_10014905 Ga0065714_100149053 207
313 3300005289 Ga0065704_10180239 Ga0065704_101802392 207
314 3300005289 Ga0065704_10198711 Ga0065704_101987112 207
315 3300005289 Ga0065704_10215718 Ga0065704_102157181 207
316 3300005327 Ga0070658_10452422 Ga0070658_104524222 207
317 3300005347 Ga0070668_100239734 Ga0070668_1002397342 207
318 3300005367 Ga0070667_100016942 Ga0070667_1000169424 207
319 3300005435 Ga0070714_100089631 Ga0070714_1000896311 207
320 3300005530 Ga0070679_100058491 Ga0070679_1000584913 207
321 3300005539 Ga0068853_100268022 Ga0068853_1002680222 207
322 3300005543 Ga0070672_100360506 Ga0070672_1003605062 207
323 3300005563 Ga0068855_100004765 Ga0068855_1000047659 207
324 3300005563 Ga0068855_100080833 Ga0068855_1000808332 207
325 3300005563 Ga0068855_100278184 Ga0068855_1002781842 207
326 3300005614 Ga0068856_100728763 Ga0068856_1007287632 207
327 3300005834 Ga0068851_10007313 Ga0068851_100073132 207
328 3300005841 Ga0068863_100198971 Ga0068863_1001989712 207
329 3300006038 Ga0075365_10009750 Ga0075365_100097504 207
330 3300006038 Ga0075365_10027139 Ga0075365_100271392 207
331 3300006048 Ga0075363_100014482 Ga0075363_1000144822 207
332 3300006051 Ga0075364_10037369 Ga0075364_100373694 207
333 3300006058 Ga0075432_10021123 Ga0075432_100211232 207
334 3300006177 Ga0075362_10045866 Ga0075362_100458662 207
335 3300006178 Ga0075367_10044803 Ga0075367_100448033 207
336 3300006195 Ga0075366_10023990 Ga0075366_100239903 207
337 3300006195 Ga0075366_10174826 Ga0075366_101748262 207
338 3300006195 Ga0075366_10492522 Ga0075366_104925222 207
339 3300006353 Ga0075370_10001129 Ga0075370_100011293 207
340 3300006353 Ga0075370_10006846 Ga0075370_100068465 207
341 3300006880 Ga0075429_100880813 Ga0075429_1008808131 207
342 3300006946 Ga0079104_1000007 Ga0079104_1000007207 207
343 3300006948 Ga0099826_10000132 Ga0099826_1000013229 207
344 3300014497 Ga0182008_10009226 Ga0182008_100092262 207
345 3300014497 Ga0182008_10059354 Ga0182008_100593542 207
346 3300015262 Ga0182007_10000921 Ga0182007_100009216 207
347 3300015683 Ga0183362_10001 Ga0183362_100011801 207
348 3300017792 Ga0163161_10071729 Ga0163161_100717292 207
349 3300025206 Ga0209435_100001 Ga0209435_1000011307 207
350 3300025208 Ga0209436_103318 Ga0209436_1033184 207
351 3300025224 Ga0209784_100638 Ga0209784_1006384 207
352 3300025225 Ga0209566_100651 Ga0209566_10065120 207
353 3300025226 Ga0209674_100160 Ga0209674_10016085 207
354 3300025228 Ga0209672_101339 Ga0209672_1013397 207
355 3300025229 Ga0209147_103938 Ga0209147_1039381 207
356 3300025242 Ga0209258_100022 Ga0209258_100022419 207
357 3300025245 Ga0207425_1001031 Ga0207425_10010315 207
358 3300025245 Ga0207425_1002773 Ga0207425_10027732 207
359 3300025245 Ga0207425_1004638 Ga0207425_10046384 207
360 3300025246 Ga0209646_1000001 Ga0209646_10000011676 207
361 3300025246 Ga0209646_1000019 Ga0209646_1000019137 207
362 3300025250 Ga0209026_1000001 Ga0209026_1000001330 207
363 3300025250 Ga0209026_1005641 Ga0209026_10056414 207
364 3300025253 Ga0209677_109555 Ga0209677_1095552 207
365 3300025254 Ga0209148_1000034 Ga0209148_1000034419 207
366 3300025254 Ga0209148_1000118 Ga0209148_1000118180 207
367 3300025256 Ga0209759_1000001 Ga0209759_10000011307 207
368 3300025256 Ga0209759_1004695 Ga0209759_10046953 207
369 3300025258 Ga0209129_1000111 Ga0209129_100011199 207
370 3300025258 Ga0209129_1000667 Ga0209129_10006676 207
371 3300025258 Ga0209129_1005500 Ga0209129_10055006 207
372 3300025263 Ga0209565_1000028 Ga0209565_100002834 207
373 3300025263 Ga0209565_1000040 Ga0209565_100004045 207
374 3300025263 Ga0209565_1000110 Ga0209565_100011011 207
375 3300025263 Ga0209565_1000673 Ga0209565_100067324 207
376 3300025263 Ga0209565_1021834 Ga0209565_10218342 207
377 3300025273 Ga0209673_1000035 Ga0209673_1000035301 207
378 3300025273 Ga0209673_1000109 Ga0209673_1000109118 207
379 3300025273 Ga0209673_1000175 Ga0209673_100017544 207
380 3300025273 Ga0209673_1000664 Ga0209673_10006645 207
381 3300025273 Ga0209673_1000944 Ga0209673_10009441 207
382 3300025284 Ga0209130_1000118 Ga0209130_100011878 207
383 3300025284 Ga0209130_1000205 Ga0209130_100020511 207
384 3300025284 Ga0209130_1000231 Ga0209130_100023110 207
385 3300025284 Ga0209130_1000332 Ga0209130_100033246 207
386 3300025284 Ga0209130_1027397 Ga0209130_10273972 207
387 3300025291 Ga0209675_1000024 Ga0209675_1000024223 207
388 3300025291 Ga0209675_1000111 Ga0209675_100011158 207
389 3300025291 Ga0209675_1000677 Ga0209675_10006775 207
390 3300025291 Ga0209675_1002194 Ga0209675_100219412 207
391 3300025291 Ga0209675_1004947 Ga0209675_10049474 207
392 3300025291 Ga0209675_1005028 Ga0209675_10050284 207
393 3300025292 Ga0209676_1000005 Ga0209676_1000005284 207
394 3300025292 Ga0209676_1000054 Ga0209676_100005444 207
395 3300025292 Ga0209676_1000478 Ga0209676_10004785 207
396 3300025292 Ga0209676_1001275 Ga0209676_100127516 207
397 3300025292 Ga0209676_1030840 Ga0209676_10308401 207
398 3300025294 Ga0209025_1000096 Ga0209025_1000096136 207
399 3300025294 Ga0209025_1000116 Ga0209025_1000116107 207
400 3300025294 Ga0209025_1000493 Ga0209025_100049356 207
401 3300025294 Ga0209025_1002157 Ga0209025_100215730 207
402 3300025294 Ga0209025_1009771 Ga0209025_10097716 207
403 3300025294 Ga0209025_1010236 Ga0209025_10102364 207
404 3300025294 Ga0209025_1027558 Ga0209025_10275583 207
405 3300025294 Ga0209025_1089606 Ga0209025_10896062 207
406 3300025295 Ga0209564_1000155 Ga0209564_1000155107 207
407 3300025295 Ga0209564_1000298 Ga0209564_100029865 207
408 3300025295 Ga0209564_1001181 Ga0209564_100118116 207
409 3300025295 Ga0209564_1001242 Ga0209564_100124216 207
410 3300025297 Ga0209758_1000107 Ga0209758_1000107107 207
411 3300025297 Ga0209758_1011921 Ga0209758_10119214 207
412 3300025297 Ga0209758_1012663 Ga0209758_10126635 207
413 3300025298 Ga0209050_1000007 Ga0209050_1000007813 207
414 3300025298 Ga0209050_1000066 Ga0209050_100006644 207
415 3300025298 Ga0209050_1001192 Ga0209050_100119215 207
416 3300025298 Ga0209050_1004030 Ga0209050_10040302 207
417 3300025298 Ga0209050_1046647 Ga0209050_10466472 207
418 3300025299 Ga0209256_1000003 Ga0209256_10000031318 207
419 3300025299 Ga0209256_1000038 Ga0209256_1000038145 207
420 3300025299 Ga0209256_1000087 Ga0209256_1000087107 207
421 3300025302 Ga0207426_1000090 Ga0207426_100009096 207
422 3300025302 Ga0207426_1000123 Ga0207426_1000123107 207
423 3300025302 Ga0207426_1000197 Ga0207426_1000197119 207
424 3300025303 Ga0209051_1000009 Ga0209051_1000009284 207
425 3300025303 Ga0209051_1000044 Ga0209051_100004444 207
426 3300025303 Ga0209051_1000092 Ga0209051_100009230 207
427 3300025303 Ga0209051_1000115 Ga0209051_1000115138 207
428 3300025303 Ga0209051_1000598 Ga0209051_100059827 207
429 3300025303 Ga0209051_1022825 Ga0209051_10228253 207
430 3300025304 Ga0209257_1000011 Ga0209257_1000011258 207
431 3300025304 Ga0209257_1000055 Ga0209257_1000055173 207
432 3300025304 Ga0209257_1000082 Ga0209257_100008244 207
433 3300025304 Ga0209257_1000576 Ga0209257_100057652 207
434 3300025304 Ga0209257_1004829 Ga0209257_10048298 207
435 3300025304 Ga0209257_1005159 Ga0209257_10051598 207
436 3300025909 Ga0207705_10054399 Ga0207705_100543994 207
437 3300025909 Ga0207705_10232500 Ga0207705_102325002 207
438 3300025911 Ga0207654_10111551 Ga0207654_101115512 207
439 3300025913 Ga0207695_10075283 Ga0207695_100752832 207
440 3300025914 Ga0207671_10187463 Ga0207671_101874632 207
441 3300025924 Ga0207694_10044937 Ga0207694_100449375 207
442 3300025932 Ga0207690_10068256 Ga0207690_100682562 207
443 3300025934 Ga0207686_10001449 Ga0207686_100014496 207
444 3300025934 Ga0207686_10169483 Ga0207686_101694832 207
445 3300025934 Ga0207686_10328274 Ga0207686_103282741 207
446 3300025935 Ga0207709_10000112 Ga0207709_1000011255 207
447 3300025942 Ga0207689_10079531 Ga0207689_100795312 207
448 3300025942 Ga0207689_10563622 Ga0207689_105636221 207
449 3300025949 Ga0207667_10350994 Ga0207667_103509942 207
450 3300026023 Ga0207677_10012494 Ga0207677_100124945 207
451 3300026041 Ga0207639_10024872 Ga0207639_100248722 207
452 3300026088 Ga0207641_10477984 Ga0207641_104779842 207
453 3300026116 Ga0207674_11079463 Ga0207674_110794631 207
454 3300026121 Ga0207683_10984286 Ga0207683_109842862 207
455 3300026121 Ga0207683_11314589 Ga0207683_113145891 207
456 3300027111 Ga0209281_1000020 Ga0209281_1000020290 207
457 3300027424 Ga0209984_1014278 Ga0209984_10142782 207
458 3300027614 Ga0209970_1000415 Ga0209970_10004153 207
459 3300027666 Ga0209282_1000127 Ga0209282_100012745 207
460 3300027666 Ga0209282_1123307 Ga0209282_11233072 207
461 3300027876 Ga0209974_10029328 Ga0209974_100293282 207
462 3300027876 Ga0209974_10053136 Ga0209974_100531362 207
463 3300028573 Ga0265334_10026852 Ga0265334_100268521 207
464 3300030732 Ga0316176_1081397 Ga0316176_10813971 207
465 3300030733 Ga0314311_1026854 Ga0314311_10268542 207
466 3300030742 Ga0316183_1152609 Ga0316183_11526092 207
467 3300030744 Ga0316181_1185892 Ga0316181_11858921 207
468 3300031235 Ga0265330_10000032 Ga0265330_1000003260 207
469 3300031238 Ga0265332_10000001 Ga0265332_1000000167 207
470 3300031238 Ga0265332_10008632 Ga0265332_100086322 207
471 3300031241 Ga0265325_10017822 Ga0265325_100178223 207
472 3300031247 Ga0265340_10071377 Ga0265340_100713772 207
473 3300031247 Ga0265340_10072242 Ga0265340_100722422 207
474 3300031251 Ga0265327_10000842 Ga0265327_1000084232 207
475 3300031251 Ga0265327_10009661 Ga0265327_100096615 207
476 3300031456 Ga0307513_10000006 Ga0307513_10000006362 207
477 3300031456 Ga0307513_10000011 Ga0307513_1000001120 207
478 3300031456 Ga0307513_10354415 Ga0307513_103544151 207
479 3300031548 Ga0307408_100000048 Ga0307408_10000004856 207
480 3300031548 Ga0307408_100005071 Ga0307408_1000050712 207
481 3300031548 Ga0307408_100005727 Ga0307408_1000057275 207
482 3300031548 Ga0307408_100027533 Ga0307408_1000275331 207
483 3300031649 Ga0307514_10024041 Ga0307514_100240413 207
484 3300031711 Ga0265314_10000022 Ga0265314_1000002267 207
485 3300031711 Ga0265314_10027819 Ga0265314_100278192 207
486 3300031711 Ga0265314_10187104 Ga0265314_101871041 207
487 3300031730 Ga0307516_10210348 Ga0307516_102103483 207
488 3300031824 Ga0307413_10337263 Ga0307413_103372632 207
489 3300031901 Ga0307406_10000575 Ga0307406_1000057513 207
490 3300031901 Ga0307406_10003389 Ga0307406_100033895 207
491 3300031911 Ga0307412_10003407 Ga0307412_100034074 207
492 3300031911 Ga0307412_10053482 Ga0307412_100534822 207
493 3300031911 Ga0307412_10368830 Ga0307412_103688302 207
494 3300031911 Ga0307412_10487675 Ga0307412_104876752 207
495 3300032002 Ga0307416_100293906 Ga0307416_1002939062 207
496 3300032002 Ga0307416_100608617 Ga0307416_1006086171 207
497 3300032004 Ga0307414_10030245 Ga0307414_100302453 207
498 3300032004 Ga0307414_10171863 Ga0307414_101718632 207
499 3300032005 Ga0307411_10161100 Ga0307411_101611002 207
500 3300032005 Ga0307411_10167987 Ga0307411_101679872 207
501 3300032005 Ga0307411_10402030 Ga0307411_104020302 207
502 3300032005 Ga0307411_11259227 Ga0307411_112592271 207
503 3300032126 Ga0307415_100957934 Ga0307415_1009579341 207
504 3300037312 Ga0395899_0011805 Ga0395899_0011805_2478_3116 207
505 3300037312 Ga0395899_0032509 Ga0395899_0032509_1164_1802 207
506 3300037418 Ga0395900_0009935 Ga0395900_0009935_152_790 207
507 3300037418 Ga0395900_0120862 Ga0395900_0120862_1830_2468 207
508 3300037418 Ga0395900_0130517 Ga0395900_0130517_1205_1843 207
509 3300037418 Ga0395900_0268895 Ga0395900_0268895_907_1545 207
510 3300037466 Ga0395898_0014216 Ga0395898_0014216_2738_3376 207
511 3300037471 Ga0395905_0000249 Ga0395905_0000249_7925_8563 207
512 3300037471 Ga0395905_0000704 Ga0395905_0000704_13869_14507 207
513 3300037471 Ga0395905_0024829 Ga0395905_0024829_1416_2051 207
514 3300037471 Ga0395905_0087681 Ga0395905_0087681_1547_2185 207
515 3300037471 Ga0395905_0185233 Ga0395905_0185233_279_917 207
516 3300037471 Ga0395905_0336830 Ga0395905_0336830_685_1323 207
517 3300038443 Ga0395901_0037770 Ga0395901_0037770_1915_2553 207
518 3300038443 Ga0395901_0044289 Ga0395901_0044289_427_1065 207
519 3300038443 Ga0395901_0077228 Ga0395901_0077228_1714_2352 207
520 3300038443 Ga0395901_1125135 Ga0395901_1125135_16_654 207
521 3300039437 Ga0436365_0442834 Ga0436365_0442834_730_1368 207
522 3300041404 Ga0439436_0051941 Ga0439436_0051941_240_878 207
523 3300041406 Ga0439439_0041034 Ga0439439_0041034_331_969 207
524 3300041406 Ga0439439_0068984 Ga0439439_0068984_141_779 207
525 3300041407 Ga0439447_051123 Ga0439447_051123_44_682 207
526 3300041413 Ga0439465_0001001 Ga0439465_0001001_1761_2399 207
527 3300041997 Ga0439431_0000135 Ga0439431_0000135_7976_8614 207
528 3300041999 Ga0439433_0005311 Ga0439433_0005311_1450_2088 207
529 3300042006 Ga0439432_099548 Ga0439432_099548_177_815 207
530 3300042007 Ga0439449_0002755 Ga0439449_0002755_3271_3909 207
531 3300042007 Ga0439449_0011957 Ga0439449_0011957_232_870 207
532 3300042015 Ga0439462_0042294 Ga0439462_0042294_229_867 207
533 3300042134 Ga0450898_008464 Ga0450898_008464_837_1475 207
534 3300042435 Ga0439434_0030089 Ga0439434_0030089_290_928 207
535 3300044673 Ga0453683_0001511 Ga0453683_0001511_4456_5094 207
536 3300044693 Ga0466961_0196671 Ga0466961_0196671_500_1138 207
537 3300045051 Ga0451576_0009548 Ga0451576_0009548_6077_6715 207
538 3300046475 Ga0495639_0003038 Ga0495639_0003038_2841_3479 207
539 3300046512 Ga0495610_0011303 Ga0495610_0011303_2364_3002 207
540 3300046514 Ga0495618_0284887 Ga0495618_0284887_278_913 207
541 3300046515 Ga0495620_0048787 Ga0495620_0048787_991_1629 207
542 3300046525 Ga0495663_0033616 Ga0495663_0033616_260_898 207
543 3300046539 Ga0495621_0045216 Ga0495621_0045216_357_995 207
544 3300046539 Ga0495621_0119144 Ga0495621_0119144_236_877 207
545 3300046542 Ga0495597_0000251 Ga0495597_0000251_48087_48725 207
546 3300046615 Ga0495656_0000072 Ga0495656_0000072_5586_6224 207
547 3300046660 Ga0495625_0054015 Ga0495625_0054015_217_855 207
548 3300046663 Ga0495635_0187482 Ga0495635_0187482_690_1328 207
549 3300046674 Ga0495588_0095435 Ga0495588_0095435_658_1296 207
550 3300046691 Ga0495670_0038087 Ga0495670_0038087_292_930 207
551 3300047321 Ga0495676_0007228 Ga0495676_0007228_4116_4754 207
552 3300048089 Ga0495614_0006650 Ga0495614_0006650_182_820 207
553 3300048904 Ga0496101_0009683 Ga0496101_0009683_5291_5929 207
554 3300048906 Ga0496103_0032658 Ga0496103_0032658_2342_2980 207
555 3300048907 Ga0496104_0003204 Ga0496104_0003204_9259_9897 207
556 3300048908 Ga0496105_0003462 Ga0496105_0003462_5675_6313 207
557 3300048910 Ga0496107_0020407 Ga0496107_0020407_1034_1672 207
558 3300048910 Ga0496107_0728200 Ga0496107_0728200_65_703 207
559 3300048911 Ga0496108_0114489 Ga0496108_0114489_719_1357 207
560 3300048912 Ga0496109_0337033 Ga0496109_0337033_207_845 207
561 3300048919 Ga0496116_0052530 Ga0496116_0052530_571_1209 207
562 3300048920 Ga0496117_0024823 Ga0496117_0024823_396_1034 207
563 3300048924 Ga0496121_0036698 Ga0496121_0036698_475_1113 207
564 3300048924 Ga0496121_0167049 Ga0496121_0167049_924_1562 207
565 3300048926 Ga0496123_0000057 Ga0496123_0000057_93518_94156 207
566 3300048926 Ga0496123_0034513 Ga0496123_0034513_2772_3410 207
567 3300048927 Ga0496124_0081990 Ga0496124_0081990_578_1216 207
568 3300048928 Ga0496125_0033728 Ga0496125_0033728_412_1050 207
569 3300050489 nmdc:mga03683_81758_c1 nmdc:mga03683_81758_c1_568_1206 207
570 3300053087 Ga0500643_004495 Ga0500643_004495_1026_1664 207
571 3300053093 Ga0500651_0000052 Ga0500651_0000052_40359_40997 207
572 3300053122 Ga0500608_135974 Ga0500608_135974_318_956 207
573 3300053128 Ga0500626_073827 Ga0500626_073827_364_1002 207
574 3300053133 Ga0500655_000281 Ga0500655_000281_7057_7695 207
575 3300053134 Ga0500658_0000033 Ga0500658_0000033_65514_66152 207
576 3300053134 Ga0500658_0000040 Ga0500658_0000040_31174_31812 207
577 3300053136 Ga0500559_0006122 Ga0500559_0006122_4293_4931 207
578 3300053139 Ga0500568_0004186 Ga0500568_0004186_430_1068 207
579 3300053141 Ga0500574_066915 Ga0500574_066915_37_675 207
580 3300053153 Ga0500616_0219060 Ga0500616_0219060_34_672 207
581 3300059477 Ga0587084_048259 Ga0587084_048259_93_731 207
582 3300059508 Ga0587088_008258 Ga0587088_008258_820_1455 207
583 iso_pu_bacteria 2595698237 2596375848 207
584 iso_pu_bacteria 2643221614 2644087942 207
585 iso_pu_bacteria 2643221637 2644207495 207
586 iso_pu_bacteria 2643221661 2644344171 207
587 iso_pu_bacteria 2643221666 2644367299 207
588 iso_pu_bacteria 2643221718 2644651244 207
589 iso_pu_bacteria 2643221723 2644675278 207
590 iso_pu_bacteria 2739367756 2739790265 207
591 iso_pu_bacteria 2896429255 2896430966 207
592 iso_pu_bacteria 2902330777 2902331375 207
593 iso_pu_bacteria 2902405164 2902408447 207
594 iso_pu_bacteria 2928125067 2928125394 207
595 3300003759 Ga0055525_1000046 Ga0055525_100004671 208
596 3300003761 Ga0055535_1001710 Ga0055535_10017106 208
597 3300003763 Ga0055529_1000306 Ga0055529_10003066 208
598 3300003771 Ga0055526_1002557 Ga0055526_100255710 208
599 3300003784 Ga0055534_1000820 Ga0055534_100082010 208
600 3300004625 Ga0055543_1003203 Ga0055543_10032031 208
601 3300005262 Ga0065165_1000600 Ga0065165_100060033 208
602 3300005262 Ga0065165_1001802 Ga0065165_100180212 208
603 3300005288 Ga0065714_10151557 Ga0065714_101515572 208
604 3300005289 Ga0065704_10457162 Ga0065704_104571621 208
605 3300005290 Ga0065712_10250585 Ga0065712_102505852 208
606 3300005295 Ga0065707_10085375 Ga0065707_100853754 208
607 3300005327 Ga0070658_10327550 Ga0070658_103275502 208
608 3300005328 Ga0070676_10124788 Ga0070676_101247882 208
609 3300005328 Ga0070676_10138541 Ga0070676_101385411 208
610 3300005329 Ga0070683_100421886 Ga0070683_1004218862 208
611 3300005331 Ga0070670_100049854 Ga0070670_1000498544 208
612 3300005331 Ga0070670_100074892 Ga0070670_1000748922 208
613 3300005331 Ga0070670_100299937 Ga0070670_1002999372 208
614 3300005331 Ga0070670_100555591 Ga0070670_1005555911 208
615 3300005333 Ga0070677_10000523 Ga0070677_1000052310 208
616 3300005333 Ga0070677_10032192 Ga0070677_100321922 208
617 3300005334 Ga0068869_100008423 Ga0068869_1000084234 208
618 3300005334 Ga0068869_100249632 Ga0068869_1002496321 208
619 3300005336 Ga0070680_100006104 Ga0070680_1000061042 208
620 3300005338 Ga0068868_100001107 Ga0068868_10000110716 208
621 3300005339 Ga0070660_100259759 Ga0070660_1002597592 208
622 3300005339 Ga0070660_100406251 Ga0070660_1004062511 208
623 3300005340 Ga0070689_100318277 Ga0070689_1003182772 208
624 3300005344 Ga0070661_100000994 Ga0070661_1000009948 208
625 3300005347 Ga0070668_100008742 Ga0070668_1000087423 208
626 3300005347 Ga0070668_100129046 Ga0070668_1001290462 208
627 3300005347 Ga0070668_100576965 Ga0070668_1005769652 208
628 3300005353 Ga0070669_100012993 Ga0070669_1000129936 208
629 3300005353 Ga0070669_100040177 Ga0070669_1000401772 208
630 3300005353 Ga0070669_100265299 Ga0070669_1002652992 208
631 3300005353 Ga0070669_100267171 Ga0070669_1002671712 208
632 3300005354 Ga0070675_100002143 Ga0070675_10000214311 208
633 3300005354 Ga0070675_100002327 Ga0070675_10000232712 208
634 3300005354 Ga0070675_100091547 Ga0070675_1000915472 208
635 3300005354 Ga0070675_100133314 Ga0070675_1001333142 208
636 3300005355 Ga0070671_100003169 Ga0070671_1000031696 208
637 3300005355 Ga0070671_100011946 Ga0070671_1000119464 208
638 3300005355 Ga0070671_100022247 Ga0070671_1000222472 208
639 3300005355 Ga0070671_100250235 Ga0070671_1002502352 208
640 3300005355 Ga0070671_100342328 Ga0070671_1003423281 208
641 3300005356 Ga0070674_100034507 Ga0070674_1000345073 208
642 3300005356 Ga0070674_100044141 Ga0070674_1000441413 208
643 3300005356 Ga0070674_100182252 Ga0070674_1001822522 208
644 3300005356 Ga0070674_100348366 Ga0070674_1003483662 208
645 3300005356 Ga0070674_100406579 Ga0070674_1004065791 208
646 3300005356 Ga0070674_100452768 Ga0070674_1004527681 208
647 3300005364 Ga0070673_100007098 Ga0070673_1000070984 208
648 3300005364 Ga0070673_100021209 Ga0070673_1000212091 208
649 3300005364 Ga0070673_100043576 Ga0070673_1000435762 208
650 3300005364 Ga0070673_100174672 Ga0070673_1001746722 208
651 3300005364 Ga0070673_100182855 Ga0070673_1001828551 208
652 3300005364 Ga0070673_100186388 Ga0070673_1001863882 208
653 3300005364 Ga0070673_100767541 Ga0070673_1007675411 208
654 3300005365 Ga0070688_100473180 Ga0070688_1004731801 208
655 3300005366 Ga0070659_100000929 Ga0070659_1000009294 208
656 3300005366 Ga0070659_100324528 Ga0070659_1003245282 208
657 3300005367 Ga0070667_100480287 Ga0070667_1004802872 208
658 3300005367 Ga0070667_100732944 Ga0070667_1007329441 208
659 3300005436 Ga0070713_100858097 Ga0070713_1008580972 208
660 3300005441 Ga0070700_100170991 Ga0070700_1001709912 208
661 3300005441 Ga0070700_100315320 Ga0070700_1003153201 208
662 3300005455 Ga0070663_100012236 Ga0070663_1000122364 208
663 3300005455 Ga0070663_100451472 Ga0070663_1004514721 208
664 3300005456 Ga0070678_100004119 Ga0070678_1000041198 208
665 3300005456 Ga0070678_100359840 Ga0070678_1003598402 208
666 3300005458 Ga0070681_10269042 Ga0070681_102690422 208
667 3300005459 Ga0068867_100000048 Ga0068867_10000004833 208
668 3300005459 Ga0068867_100004827 Ga0068867_1000048279 208
669 3300005459 Ga0068867_100025498 Ga0068867_1000254985 208
670 3300005459 Ga0068867_100090559 Ga0068867_1000905593 208
671 3300005459 Ga0068867_100134811 Ga0068867_1001348112 208
672 3300005459 Ga0068867_100290668 Ga0068867_1002906682 208
673 3300005530 Ga0070679_100380720 Ga0070679_1003807202 208
674 3300005543 Ga0070672_100023179 Ga0070672_1000231793 208
675 3300005543 Ga0070672_100089641 Ga0070672_1000896413 208
676 3300005543 Ga0070672_100487623 Ga0070672_1004876232 208
677 3300005547 Ga0070693_100232520 Ga0070693_1002325202 208
678 3300005548 Ga0070665_100280727 Ga0070665_1002807272 208
679 3300005548 Ga0070665_100498020 Ga0070665_1004980201 208
680 3300005563 Ga0068855_100950038 Ga0068855_1009500381 208
681 3300005564 Ga0070664_100000282 Ga0070664_10000028222 208
682 3300005564 Ga0070664_100019344 Ga0070664_1000193442 208
683 3300005577 Ga0068857_100114219 Ga0068857_1001142192 208
684 3300005616 Ga0068852_100004013 Ga0068852_1000040136 208
685 3300005616 Ga0068852_100127977 Ga0068852_1001279773 208
686 3300005616 Ga0068852_100314395 Ga0068852_1003143952 208
687 3300005616 Ga0068852_100443706 Ga0068852_1004437062 208
688 3300005616 Ga0068852_100574432 Ga0068852_1005744322 208
689 3300005616 Ga0068852_100945954 Ga0068852_1009459542 208
690 3300005617 Ga0068859_100036992 Ga0068859_1000369922 208
691 3300005617 Ga0068859_100097644 Ga0068859_1000976442 208
692 3300005618 Ga0068864_100002769 Ga0068864_1000027694 208
693 3300005618 Ga0068864_100011909 Ga0068864_1000119093 208
694 3300005618 Ga0068864_100063454 Ga0068864_1000634542 208
695 3300005719 Ga0068861_100010229 Ga0068861_1000102295 208
696 3300005719 Ga0068861_100694602 Ga0068861_1006946022 208
697 3300005834 Ga0068851_10126671 Ga0068851_101266712 208
698 3300005834 Ga0068851_10190658 Ga0068851_101906582 208
699 3300005841 Ga0068863_100014569 Ga0068863_1000145691 208
700 3300005841 Ga0068863_100358823 Ga0068863_1003588232 208
701 3300005842 Ga0068858_100002948 Ga0068858_10000294816 208
702 3300005843 Ga0068860_100000524 Ga0068860_10000052436 208
703 3300005843 Ga0068860_100011518 Ga0068860_1000115184 208
704 3300005843 Ga0068860_100509105 Ga0068860_1005091052 208
705 3300005844 Ga0068862_100082302 Ga0068862_1000823022 208
706 3300006038 Ga0075365_10005295 Ga0075365_100052957 208
707 3300006048 Ga0075363_100125351 Ga0075363_1001253511 208
708 3300006186 Ga0075369_10219067 Ga0075369_102190671 208
709 3300006195 Ga0075366_10085752 Ga0075366_100857522 208
710 3300006195 Ga0075366_10134051 Ga0075366_101340512 208
711 3300006195 Ga0075366_10194514 Ga0075366_101945142 208
712 3300006237 Ga0097621_100026937 Ga0097621_1000269374 208
713 3300006237 Ga0097621_100030071 Ga0097621_1000300714 208
714 3300006353 Ga0075370_10006235 Ga0075370_100062354 208
715 3300006353 Ga0075370_10008342 Ga0075370_100083426 208
716 3300006353 Ga0075370_10050137 Ga0075370_100501373 208
717 3300006358 Ga0068871_100147195 Ga0068871_1001471952 208
718 3300006358 Ga0068871_100246610 Ga0068871_1002466102 208
719 3300006358 Ga0068871_100406335 Ga0068871_1004063352 208
720 3300006881 Ga0068865_100145391 Ga0068865_1001453913 208
721 3300006881 Ga0068865_100153063 Ga0068865_1001530633 208
722 3300006931 Ga0097620_100036992 Ga0097620_1000369922 208
723 3300006931 Ga0097620_100097647 Ga0097620_1000976472 208
724 3300009093 Ga0105240_10385039 Ga0105240_103850391 208
725 3300009098 Ga0105245_10731934 Ga0105245_107319342 208
726 3300009176 Ga0105242_10236947 Ga0105242_102369472 208
727 3300009177 Ga0105248_10006497 Ga0105248_100064975 208
728 3300009177 Ga0105248_10028876 Ga0105248_100288764 208
729 3300009551 Ga0105238_10177187 Ga0105238_101771873 208
730 3300009551 Ga0105238_10556574 Ga0105238_105565742 208
731 3300009551 Ga0105238_10977881 Ga0105238_109778811 208
732 3300009553 Ga0105249_10132588 Ga0105249_101325883 208
733 3300009553 Ga0105249_11837142 Ga0105249_118371421 208
734 3300013296 Ga0157374_10139935 Ga0157374_101399354 208
735 3300013297 Ga0157378_10020749 Ga0157378_100207493 208
736 3300013306 Ga0163162_10003717 Ga0163162_1000371716 208
737 3300013306 Ga0163162_10020731 Ga0163162_100207315 208
738 3300013306 Ga0163162_10084914 Ga0163162_100849142 208
739 3300013306 Ga0163162_10318325 Ga0163162_103183252 208
740 3300013307 Ga0157372_10081286 Ga0157372_100812862 208
741 3300013308 Ga0157375_10198861 Ga0157375_101988613 208
742 3300013308 Ga0157375_10491870 Ga0157375_104918702 208
743 3300013308 Ga0157375_10516563 Ga0157375_105165632 208
744 3300014325 Ga0163163_10008501 Ga0163163_100085012 208
745 3300014968 Ga0157379_10025217 Ga0157379_100252174 208
746 3300014968 Ga0157379_10029132 Ga0157379_100291322 208
747 3300014968 Ga0157379_10082697 Ga0157379_100826973 208
748 3300014969 Ga0157376_10278536 Ga0157376_102785362 208
749 3300014969 Ga0157376_10295651 Ga0157376_102956512 208
750 3300017792 Ga0163161_10021781 Ga0163161_100217815 208
751 3300021361 Ga0213872_10000051 Ga0213872_1000005166 208
752 3300021361 Ga0213872_10000060 Ga0213872_1000006082 208
753 3300021361 Ga0213872_10000632 Ga0213872_100006326 208
754 3300021361 Ga0213872_10002848 Ga0213872_100028486 208
755 3300021361 Ga0213872_10018060 Ga0213872_100180601 208
756 3300025230 Ga0209563_100005 Ga0209563_100005809 208
757 3300025242 Ga0209258_100960 Ga0209258_1009609 208
758 3300025245 Ga0207425_1010697 Ga0207425_10106972 208
759 3300025253 Ga0209677_101739 Ga0209677_1017398 208
760 3300025254 Ga0209148_1016130 Ga0209148_10161302 208
761 3300025256 Ga0209759_1001021 Ga0209759_10010219 208
762 3300025256 Ga0209759_1022906 Ga0209759_10229062 208
763 3300025256 Ga0209759_1029416 Ga0209759_10294162 208
764 3300025272 Ga0209455_1000128 Ga0209455_1000128153 208
765 3300025273 Ga0209673_1008587 Ga0209673_10085872 208
766 3300025273 Ga0209673_1046346 Ga0209673_10463461 208
767 3300025284 Ga0209130_1005762 Ga0209130_10057622 208
768 3300025291 Ga0209675_1001309 Ga0209675_10013098 208
769 3300025292 Ga0209676_1040847 Ga0209676_10408471 208
770 3300025295 Ga0209564_1000005 Ga0209564_100000528 208
771 3300025295 Ga0209564_1045708 Ga0209564_10457082 208
772 3300025298 Ga0209050_1004615 Ga0209050_10046154 208
773 3300025299 Ga0209256_1000078 Ga0209256_1000078161 208
774 3300025299 Ga0209256_1001512 Ga0209256_100151212 208
775 3300025303 Ga0209051_1001071 Ga0209051_10010713 208
776 3300025304 Ga0209257_1000978 Ga0209257_100097820 208
777 3300025304 Ga0209257_1001479 Ga0209257_100147921 208
778 3300025321 Ga0207656_10070612 Ga0207656_100706122 208
779 3300025903 Ga0207680_10011979 Ga0207680_100119792 208
780 3300025907 Ga0207645_10004606 Ga0207645_100046066 208
781 3300025907 Ga0207645_10085170 Ga0207645_100851703 208
782 3300025909 Ga0207705_10058677 Ga0207705_100586772 208
783 3300025909 Ga0207705_10225361 Ga0207705_102253612 208
784 3300025912 Ga0207707_10768950 Ga0207707_107689501 208
785 3300025914 Ga0207671_10306396 Ga0207671_103063962 208
786 3300025919 Ga0207657_10031155 Ga0207657_100311557 208
787 3300025919 Ga0207657_10090441 Ga0207657_100904412 208
788 3300025920 Ga0207649_10001607 Ga0207649_100016073 208
789 3300025920 Ga0207649_10014094 Ga0207649_100140942 208
790 3300025920 Ga0207649_10545329 Ga0207649_105453292 208
791 3300025921 Ga0207652_10010127 Ga0207652_100101274 208
792 3300025921 Ga0207652_10351826 Ga0207652_103518262 208
793 3300025924 Ga0207694_10801042 Ga0207694_108010422 208
794 3300025925 Ga0207650_10001122 Ga0207650_100011224 208
795 3300025925 Ga0207650_10599609 Ga0207650_105996091 208
796 3300025925 Ga0207650_10958335 Ga0207650_109583351 208
797 3300025925 Ga0207650_11044370 Ga0207650_110443701 208
798 3300025926 Ga0207659_10000333 Ga0207659_100003336 208
799 3300025926 Ga0207659_10000725 Ga0207659_100007254 208
800 3300025926 Ga0207659_10022085 Ga0207659_100220852 208
801 3300025926 Ga0207659_10144382 Ga0207659_101443822 208
802 3300025926 Ga0207659_10204591 Ga0207659_102045912 208
803 3300025931 Ga0207644_10002789 Ga0207644_100027897 208
804 3300025931 Ga0207644_10003511 Ga0207644_100035118 208
805 3300025931 Ga0207644_10047328 Ga0207644_100473282 208
806 3300025931 Ga0207644_10072487 Ga0207644_100724872 208
807 3300025931 Ga0207644_10240434 Ga0207644_102404342 208
808 3300025932 Ga0207690_10001881 Ga0207690_100018818 208
809 3300025932 Ga0207690_10076710 Ga0207690_100767102 208
810 3300025932 Ga0207690_10283359 Ga0207690_102833592 208
811 3300025934 Ga0207686_10039242 Ga0207686_100392423 208
812 3300025935 Ga0207709_10001810 Ga0207709_100018104 208
813 3300025935 Ga0207709_10108818 Ga0207709_101088182 208
814 3300025936 Ga0207670_10228915 Ga0207670_102289152 208
815 3300025937 Ga0207669_10103836 Ga0207669_101038361 208
816 3300025937 Ga0207669_10174610 Ga0207669_101746102 208
817 3300025937 Ga0207669_10301771 Ga0207669_103017712 208
818 3300025940 Ga0207691_10002459 Ga0207691_1000245911 208
819 3300025940 Ga0207691_10102062 Ga0207691_101020623 208
820 3300025940 Ga0207691_10221545 Ga0207691_102215452 208
821 3300025940 Ga0207691_10270086 Ga0207691_102700861 208
822 3300025941 Ga0207711_10011843 Ga0207711_100118434 208
823 3300025941 Ga0207711_10030939 Ga0207711_100309393 208
824 3300025942 Ga0207689_10031365 Ga0207689_100313652 208
825 3300025942 Ga0207689_10197185 Ga0207689_101971853 208
826 3300025945 Ga0207679_10000225 Ga0207679_1000022543 208
827 3300025960 Ga0207651_10027621 Ga0207651_100276214 208
828 3300025960 Ga0207651_10076827 Ga0207651_100768272 208
829 3300025960 Ga0207651_10178377 Ga0207651_101783772 208
830 3300025961 Ga0207712_10009979 Ga0207712_100099793 208
831 3300025961 Ga0207712_10174343 Ga0207712_101743431 208
832 3300025981 Ga0207640_10319771 Ga0207640_103197712 208
833 3300025986 Ga0207658_10010270 Ga0207658_100102705 208
834 3300025986 Ga0207658_10053260 Ga0207658_100532601 208
835 3300025986 Ga0207658_10353477 Ga0207658_103534772 208
836 3300026023 Ga0207677_10003064 Ga0207677_100030648 208
837 3300026023 Ga0207677_10041078 Ga0207677_100410782 208
838 3300026035 Ga0207703_10071820 Ga0207703_100718204 208
839 3300026041 Ga0207639_10089385 Ga0207639_100893853 208
840 3300026075 Ga0207708_10107984 Ga0207708_101079842 208
841 3300026075 Ga0207708_10226676 Ga0207708_102266763 208
842 3300026075 Ga0207708_10236071 Ga0207708_102360711 208
843 3300026078 Ga0207702_10221863 Ga0207702_102218632 208
844 3300026088 Ga0207641_10056121 Ga0207641_100561213 208
845 3300026089 Ga0207648_10000319 Ga0207648_1000031953 208
846 3300026089 Ga0207648_10000492 Ga0207648_1000049233 208
847 3300026089 Ga0207648_10029637 Ga0207648_100296375 208
848 3300026089 Ga0207648_10152670 Ga0207648_101526703 208
849 3300026095 Ga0207676_10001271 Ga0207676_1000127117 208
850 3300026118 Ga0207675_100007230 Ga0207675_1000072305 208
851 3300026118 Ga0207675_100712457 Ga0207675_1007124572 208
852 3300026121 Ga0207683_10005156 Ga0207683_100051567 208
853 3300026121 Ga0207683_10006290 Ga0207683_100062905 208
854 3300026121 Ga0207683_10036312 Ga0207683_100363122 208
855 3300026121 Ga0207683_10099365 Ga0207683_100993652 208
856 3300026121 Ga0207683_10121982 Ga0207683_101219822 208
857 3300026121 Ga0207683_10407401 Ga0207683_104074012 208
858 3300026142 Ga0207698_10003576 Ga0207698_100035765 208
859 3300026142 Ga0207698_10063424 Ga0207698_100634242 208
860 3300026142 Ga0207698_10174145 Ga0207698_101741453 208
861 3300026142 Ga0207698_10225014 Ga0207698_102250141 208
862 3300026142 Ga0207698_10522221 Ga0207698_105222212 208
863 3300027296 Ga0209389_1007187 Ga0209389_10071873 208
864 3300027312 Ga0209371_1018881 Ga0209371_10188812 208
865 3300027395 Ga0209996_1000765 Ga0209996_10007654 208
866 3300027526 Ga0209968_1000652 Ga0209968_10006525 208
867 3300027695 Ga0209966_1000005 Ga0209966_100000577 208
868 3300028379 Ga0268266_10538720 Ga0268266_105387202 208
869 3300028379 Ga0268266_11042751 Ga0268266_110427511 208
870 3300028380 Ga0268265_10003864 Ga0268265_100038643 208
871 3300028381 Ga0268264_10001666 Ga0268264_100016669 208
872 3300028381 Ga0268264_10233019 Ga0268264_102330192 208
873 3300028381 Ga0268264_11198878 Ga0268264_111988781 208
874 3300028786 Ga0307517_10097661 Ga0307517_100976613 208
875 3300028794 Ga0307515_10000459 Ga0307515_1000045924 208
876 3300028794 Ga0307515_10001963 Ga0307515_1000196330 208
877 3300028794 Ga0307515_10014710 Ga0307515_100147106 208
878 3300028794 Ga0307515_10026050 Ga0307515_100260503 208
879 3300028794 Ga0307515_10033350 Ga0307515_1003335010 208
880 3300028794 Ga0307515_10123381 Ga0307515_101233812 208
881 3300028794 Ga0307515_10238926 Ga0307515_102389262 208
882 3300029957 Ga0265324_10018140 Ga0265324_100181402 208
883 3300030500 Ga0268256_1025697 Ga0268256_10256971 208
884 3300030522 Ga0307512_10113847 Ga0307512_101138472 208
885 3300030522 Ga0307512_10310328 Ga0307512_103103281 208
886 3300031238 Ga0265332_10000014 Ga0265332_10000014123 208
887 3300031240 Ga0265320_10025753 Ga0265320_100257532 208
888 3300031250 Ga0265331_10013807 Ga0265331_100138072 208
889 3300031251 Ga0265327_10000028 Ga0265327_1000002825 208
890 3300031456 Ga0307513_10008993 Ga0307513_100089932 208
891 3300031456 Ga0307513_10141275 Ga0307513_101412752 208
892 3300031456 Ga0307513_10177890 Ga0307513_101778903 208
893 3300031456 Ga0307513_10221498 Ga0307513_102214981 208
894 3300031507 Ga0307509_10000120 Ga0307509_1000012069 208
895 3300031507 Ga0307509_10060404 Ga0307509_100604045 208
896 3300031507 Ga0307509_10100657 Ga0307509_101006572 208
897 3300031548 Ga0307408_100000046 Ga0307408_10000004685 208
898 3300031548 Ga0307408_100012484 Ga0307408_1000124842 208
899 3300031548 Ga0307408_100049122 Ga0307408_1000491221 208
900 3300031548 Ga0307408_100154703 Ga0307408_1001547032 208
901 3300031548 Ga0307408_100241318 Ga0307408_1002413182 208
902 3300031548 Ga0307408_100281943 Ga0307408_1002819431 208
903 3300031548 Ga0307408_100374721 Ga0307408_1003747212 208
904 3300031548 Ga0307408_101257036 Ga0307408_1012570361 208
905 3300031616 Ga0307508_10000163 Ga0307508_1000016337 208
906 3300031616 Ga0307508_10078880 Ga0307508_100788802 208
907 3300031616 Ga0307508_10120167 Ga0307508_101201672 208
908 3300031649 Ga0307514_10000225 Ga0307514_10000225126 208
909 3300031730 Ga0307516_10000446 Ga0307516_100004464 208
910 3300031730 Ga0307516_10003308 Ga0307516_100033082 208
911 3300031730 Ga0307516_10004343 Ga0307516_1000434317 208
912 3300031730 Ga0307516_10014293 Ga0307516_100142935 208
913 3300031730 Ga0307516_10076972 Ga0307516_100769722 208
914 3300031730 Ga0307516_10137321 Ga0307516_101373212 208
915 3300031730 Ga0307516_10325589 Ga0307516_103255892 208
916 3300031730 Ga0307516_10579188 Ga0307516_105791882 208
917 3300031731 Ga0307405_10042818 Ga0307405_100428182 208
918 3300031731 Ga0307405_10108573 Ga0307405_101085731 208
919 3300031731 Ga0307405_10749787 Ga0307405_107497871 208
920 3300031824 Ga0307413_10001777 Ga0307413_1000177710 208
921 3300031852 Ga0307410_10169218 Ga0307410_101692181 208
922 3300031852 Ga0307410_10280996 Ga0307410_102809962 208
923 3300031852 Ga0307410_10428096 Ga0307410_104280961 208
924 3300031852 Ga0307410_10490870 Ga0307410_104908701 208
925 3300031911 Ga0307412_10113530 Ga0307412_101135302 208
926 3300031995 Ga0307409_100309358 Ga0307409_1003093582 208
927 3300031995 Ga0307409_100380848 Ga0307409_1003808482 208
928 3300032002 Ga0307416_100010513 Ga0307416_1000105133 208
929 3300032004 Ga0307414_10022421 Ga0307414_100224212 208
930 3300032005 Ga0307411_10033683 Ga0307411_100336832 208
931 3300032126 Ga0307415_100005526 Ga0307415_1000055265 208
932 3300033179 Ga0307507_10074397 Ga0307507_100743973 208
933 3300033179 Ga0307507_10293737 Ga0307507_102937372 208
934 3300033180 Ga0307510_10002394 Ga0307510_100023942 208
935 3300033180 Ga0307510_10052763 Ga0307510_100527635 208
936 3300035114 Ga0373939_0000004 Ga0373939_0000004_55857_56495 208
937 3300035114 Ga0373939_0186460 Ga0373939_0186460_25_666 208
938 3300035121 Ga0373960_0001434 Ga0373960_0001434_499_1137 208
939 3300035691 Ga0373931_0001005 Ga0373931_0001005_9094_9732 208
940 3300037068 Ga0373925_0018543 Ga0373925_0018543_3458_4096 208
941 3300037418 Ga0395900_0079898 Ga0395900_0079898_2467_3108 208
942 3300037418 Ga0395900_0086114 Ga0395900_0086114_2351_2992 208
943 3300037466 Ga0395898_0000337 Ga0395898_0000337_17046_17687 208
944 3300037471 Ga0395905_0052002 Ga0395905_0052002_1943_2581 208
945 3300038443 Ga0395901_0311600 Ga0395901_0311600_311_952 208
946 3300039447 Ga0436361_0120947 Ga0436361_0120947_6534_7172 208
947 3300039447 Ga0436361_0174260 Ga0436361_0174260_98595_99233 208
948 3300039447 Ga0436361_0292057 Ga0436361_0292057_20175_20813 208
949 3300039447 Ga0436361_0829339 Ga0436361_0829339_285_923 208
950 3300039447 Ga0436361_0939166 Ga0436361_0939166_83249_83887 208
951 3300042115 Ga0450911_000860 Ga0450911_000860_3993_4631 208
952 3300042119 Ga0450915_006225 Ga0450915_006225_41_679 208
953 3300042120 Ga0450917_001159 Ga0450917_001159_437_1075 208
954 3300042126 Ga0450888_000211 Ga0450888_000211_922_1560 208
955 3300042127 Ga0450890_002103 Ga0450890_002103_2094_2732 208
956 3300042127 Ga0450890_002841 Ga0450890_002841_1541_2179 208
957 3300042129 Ga0450891_002311 Ga0450891_002311_909_1547 208
958 3300042130 Ga0450892_000342 Ga0450892_000342_2847_3485 208
959 3300042144 Ga0450889_000406 Ga0450889_000406_101_739 208
960 3300042438 Ga0439459_0000732 Ga0439459_0000732_908_1546 208
961 3300042439 Ga0439464_0009922 Ga0439464_0009922_942_1580 208
962 3300042532 Ga0450893_0003052 Ga0450893_0003052_1863_2501 208
963 3300042876 Ga0451577_0007579 Ga0451577_0007579_8868_9506 208
964 3300042876 Ga0451577_0012178 Ga0451577_0012178_4622_5260 208
965 3300042876 Ga0451577_0014424 Ga0451577_0014424_5409_6050 208
966 3300044673 Ga0453683_0040629 Ga0453683_0040629_1484_2122 208
967 3300044712 Ga0453684_0713817 Ga0453684_0713817_56_694 208
968 3300045051 Ga0451576_0030419 Ga0451576_0030419_2586_3224 208
969 3300045051 Ga0451576_0065938 Ga0451576_0065938_2845_3483 208
970 3300046516 Ga0495628_0125817 Ga0495628_0125817_140_778 208
971 3300046519 Ga0495632_0030570 Ga0495632_0030570_337_975 208
972 3300046522 Ga0495643_0126760 Ga0495643_0126760_569_1207 208
973 3300046543 Ga0495645_0289206 Ga0495645_0289206_110_751 208
974 3300046660 Ga0495625_0027726 Ga0495625_0027726_2655_3314 208
975 3300046810 Ga0495660_0090374 Ga0495660_0090374_786_1445 208
976 3300047321 Ga0495676_0007289 Ga0495676_0007289_4947_5585 208
977 3300047472 Ga0495686_0010836 Ga0495686_0010836_1389_2027 208
978 3300048924 Ga0496121_0006746 Ga0496121_0006746_11931_12569 208
979 3300048927 Ga0496124_0298057 Ga0496124_0298057_455_1093 208
980 3300049569 Ga0501032_0409307 Ga0501032_0409307_14_652 208
981 3300049649 Ga0501198_000021 Ga0501198_000021_60347_60985 208
982 3300049662 Ga0501222_000018 Ga0501222_000018_9672_10310 208
983 3300049706 Ga0501229_013039 Ga0501229_013039_412_1050 208
984 3300049823 Ga0501044_0032525 Ga0501044_0032525_4697_5335 208
985 3300050493 nmdc:mga0k408_119132_c1 nmdc:mga0k408_119132_c1_445_1083 208
986 3300050493 nmdc:mga0k408_5324_c1 nmdc:mga0k408_5324_c1_3324_3962 208
987 3300050496 nmdc:mga07m45_3456_c1 nmdc:mga07m45_3456_c1_5206_5844 208
988 3300053088 Ga0500644_0118860 Ga0500644_0118860_190_828 208
989 3300053118 Ga0500594_0028715 Ga0500594_0028715_438_1076 208
990 3300053136 Ga0500559_0000011 Ga0500559_0000011_55383_56021 208
991 3300053148 Ga0500590_001152 Ga0500590_001152_9529_10167 208
992 3300053154 Ga0500619_000035 Ga0500619_000035_40643_41284 208
993 3300053156 Ga0500622_0013799 Ga0500622_0013799_3684_4322 208
994 3300053156 Ga0500622_0017687 Ga0500622_0017687_509_1168 208
995 3300053156 Ga0500622_0018708 Ga0500622_0018708_2615_3253 208
996 3300059424 Ga0590075_036627 Ga0590075_036627_467_1105 208
997 3300059426 Ga0590077_033052 Ga0590077_033052_483_1124 208
998 3300001991 JGI24743J22301_10001118 JGI24743J22301_100011183 209
999 3300002737 JGI25162J39368_1000001 JGI25162J39368_1000001671 209
1000 3300002737 JGI25162J39368_1006819 JGI25162J39368_10068192 209
1001 3300002772 JGI25164J39214_1001808 JGI25164J39214_10018081 209
1002 3300003214 JGI25165J46597_1000001 JGI25165J46597_1000001655 209
1003 3300003215 JGI25153J46596_10021825 JGI25153J46596_100218252 209
1004 3300003544 Ga0007417J51691_1023165 Ga0007417J51691_10231652 209
1005 3300003574 Ga0007410J51695_1034713 Ga0007410J51695_10347132 209
1006 3300003575 Ga0007409J51694_1016496 Ga0007409J51694_10164962 209
1007 3300003577 Ga0007416J51690_1013575 Ga0007416J51690_10135752 209
1008 3300003577 Ga0007416J51690_1033019 Ga0007416J51690_10330192 209
1009 3300003611 Ga0007411J51799_112918 Ga0007411J51799_1129182 209
1010 3300003693 Ga0032354_1022659 Ga0032354_10226593 209
1011 3300003751 Ga0055538_1000001 Ga0055538_1000001379 209
1012 3300003752 Ga0055539_1000001 Ga0055539_1000001379 209
1013 3300003756 Ga0055533_1000003 Ga0055533_1000003655 209
1014 3300003759 Ga0055525_1000001 Ga0055525_1000001754 209
1015 3300003759 Ga0055525_1000003 Ga0055525_1000003655 209
1016 3300003761 Ga0055535_1003636 Ga0055535_10036362 209
1017 3300003763 Ga0055529_1000032 Ga0055529_100003235 209
1018 3300003771 Ga0055526_1000951 Ga0055526_100095117 209
1019 3300003773 Ga0055537_1000030 Ga0055537_100003075 209
1020 3300003775 Ga0055524_1002681 Ga0055524_100268113 209
1021 3300003784 Ga0055534_1000447 Ga0055534_10004473 209
1022 3300003790 Ga0055528_1000439 Ga0055528_100043916 209
1023 3300003841 Ga0055541_1000001 Ga0055541_1000001655 209
1024 3300005327 Ga0070658_10009563 Ga0070658_100095634 209
1025 3300005327 Ga0070658_10080132 Ga0070658_100801323 209
1026 3300005329 Ga0070683_100001966 Ga0070683_1000019666 209
1027 3300005329 Ga0070683_100036898 Ga0070683_1000368982 209
1028 3300005331 Ga0070670_100002397 Ga0070670_10000239716 209
1029 3300005334 Ga0068869_100010764 Ga0068869_1000107643 209
1030 3300005335 Ga0070666_10084706 Ga0070666_100847063 209
1031 3300005338 Ga0068868_100000004 Ga0068868_100000004118 209
1032 3300005339 Ga0070660_100176833 Ga0070660_1001768331 209
1033 3300005344 Ga0070661_100006933 Ga0070661_1000069334 209
1034 3300005353 Ga0070669_100049127 Ga0070669_1000491274 209
1035 3300005353 Ga0070669_100201034 Ga0070669_1002010342 209
1036 3300005355 Ga0070671_100009039 Ga0070671_1000090393 209
1037 3300005366 Ga0070659_100006995 Ga0070659_1000069955 209
1038 3300005366 Ga0070659_100259547 Ga0070659_1002595472 209
1039 3300005367 Ga0070667_100001557 Ga0070667_1000015576 209
1040 3300005436 Ga0070713_100089448 Ga0070713_1000894482 209
1041 3300005439 Ga0070711_100071388 Ga0070711_1000713882 209
1042 3300005439 Ga0070711_100747873 Ga0070711_1007478731 209
1043 3300005466 Ga0070685_10191940 Ga0070685_101919402 209
1044 3300005468 Ga0070707_100181678 Ga0070707_1001816784 209
1045 3300005471 Ga0070698_100095994 Ga0070698_1000959941 209
1046 3300005535 Ga0070684_100004982 Ga0070684_1000049822 209
1047 3300005539 Ga0068853_100385407 Ga0068853_1003854072 209
1048 3300005543 Ga0070672_100049884 Ga0070672_1000498843 209
1049 3300005548 Ga0070665_100033278 Ga0070665_1000332783 209
1050 3300005563 Ga0068855_100004740 Ga0068855_1000047409 209
1051 3300005563 Ga0068855_100011354 Ga0068855_1000113545 209
1052 3300005564 Ga0070664_100038293 Ga0070664_1000382935 209
1053 3300005564 Ga0070664_100061503 Ga0070664_1000615032 209
1054 3300005577 Ga0068857_100016086 Ga0068857_1000160863 209
1055 3300005577 Ga0068857_100292839 Ga0068857_1002928392 209
1056 3300005578 Ga0068854_100186459 Ga0068854_1001864592 209
1057 3300005614 Ga0068856_100034658 Ga0068856_1000346585 209
1058 3300005614 Ga0068856_100128445 Ga0068856_1001284453 209
1059 3300005614 Ga0068856_100646647 Ga0068856_1006466472 209
1060 3300005616 Ga0068852_100000048 Ga0068852_10000004826 209
1061 3300005616 Ga0068852_100109695 Ga0068852_1001096952 209
1062 3300005616 Ga0068852_100155854 Ga0068852_1001558543 209
1063 3300005617 Ga0068859_100013690 Ga0068859_1000136906 209
1064 3300005834 Ga0068851_10028110 Ga0068851_100281102 209
1065 3300005841 Ga0068863_100001631 Ga0068863_1000016318 209
1066 3300005842 Ga0068858_100002617 Ga0068858_1000026175 209
1067 3300005843 Ga0068860_100000069 Ga0068860_100000069143 209
1068 3300005844 Ga0068862_100009227 Ga0068862_1000092275 209
1069 3300006051 Ga0075364_10014348 Ga0075364_100143485 209
1070 3300006051 Ga0075364_10055355 Ga0075364_100553553 209
1071 3300006051 Ga0075364_10175136 Ga0075364_101751362 209
1072 3300006237 Ga0097621_100065452 Ga0097621_1000654523 209
1073 3300006358 Ga0068871_100002247 Ga0068871_1000022476 209
1074 3300006358 Ga0068871_100077837 Ga0068871_1000778372 209
1075 3300006880 Ga0075429_100478892 Ga0075429_1004788921 209
1076 3300006881 Ga0068865_100076478 Ga0068865_1000764782 209
1077 3300006931 Ga0097620_100013690 Ga0097620_1000136903 209
1078 3300006946 Ga0079104_1005881 Ga0079104_10058815 209
1079 3300009011 Ga0105251_10166054 Ga0105251_101660542 209
1080 3300009036 Ga0105244_10121953 Ga0105244_101219532 209
1081 3300009092 Ga0105250_10056123 Ga0105250_100561232 209
1082 3300009092 Ga0105250_10103416 Ga0105250_101034162 209
1083 3300009093 Ga0105240_10000084 Ga0105240_1000008417 209
1084 3300009093 Ga0105240_10004442 Ga0105240_100044428 209
1085 3300009093 Ga0105240_10008224 Ga0105240_100082245 209
1086 3300009093 Ga0105240_10153246 Ga0105240_101532462 209
1087 3300009093 Ga0105240_11019860 Ga0105240_110198601 209
1088 3300009098 Ga0105245_10001510 Ga0105245_100015106 209
1089 3300009101 Ga0105247_10001822 Ga0105247_1000182213 209
1090 3300009148 Ga0105243_10000005 Ga0105243_10000005322 209
1091 3300009177 Ga0105248_10001008 Ga0105248_1000100826 209
1092 3300009545 Ga0105237_10010106 Ga0105237_100101066 209
1093 3300009545 Ga0105237_10048803 Ga0105237_100488033 209
1094 3300009545 Ga0105237_10158718 Ga0105237_101587183 209
1095 3300009551 Ga0105238_10000113 Ga0105238_1000011315 209
1096 3300009551 Ga0105238_10000160 Ga0105238_1000016060 209
1097 3300009551 Ga0105238_10017512 Ga0105238_100175122 209
1098 3300009551 Ga0105238_10455046 Ga0105238_104550462 209
1099 3300010375 Ga0105239_10000289 Ga0105239_1000028916 209
1100 3300010375 Ga0105239_10003397 Ga0105239_100033976 209
1101 3300011119 Ga0105246_10000618 Ga0105246_1000061814 209
1102 3300013104 Ga0157370_10002535 Ga0157370_1000253514 209
1103 3300013105 Ga0157369_10000334 Ga0157369_100003348 209
1104 3300013105 Ga0157369_10003357 Ga0157369_1000335711 209
1105 3300013105 Ga0157369_10232759 Ga0157369_102327593 209
1106 3300013105 Ga0157369_10303725 Ga0157369_103037252 209
1107 3300013296 Ga0157374_10020568 Ga0157374_100205683 209
1108 3300013306 Ga0163162_10046081 Ga0163162_100460812 209
1109 3300013307 Ga0157372_10000092 Ga0157372_1000009265 209
1110 3300013307 Ga0157372_10034949 Ga0157372_100349497 209
1111 3300013308 Ga0157375_10002806 Ga0157375_100028069 209
1112 3300014325 Ga0163163_10001715 Ga0163163_100017156 209
1113 3300014497 Ga0182008_10106183 Ga0182008_101061832 209
1114 3300014745 Ga0157377_10236796 Ga0157377_102367962 209
1115 3300014968 Ga0157379_10002856 Ga0157379_100028567 209
1116 3300015262 Ga0182007_10005649 Ga0182007_100056495 209
1117 3300015262 Ga0182007_10013824 Ga0182007_100138244 209
1118 3300015265 Ga0182005_1000534 Ga0182005_10005344 209
1119 3300017792 Ga0163161_10019141 Ga0163161_100191413 209
1120 3300017792 Ga0163161_10503648 Ga0163161_105036481 209
1121 3300021361 Ga0213872_10000001 Ga0213872_10000001358 209
1122 3300021361 Ga0213872_10008989 Ga0213872_100089893 209
1123 3300025224 Ga0209784_100004 Ga0209784_100004650 209
1124 3300025225 Ga0209566_100004 Ga0209566_100004807 209
1125 3300025226 Ga0209674_100006 Ga0209674_100006807 209
1126 3300025229 Ga0209147_100004 Ga0209147_100004566 209
1127 3300025229 Ga0209147_100097 Ga0209147_10009734 209
1128 3300025230 Ga0209563_100007 Ga0209563_100007344 209
1129 3300025230 Ga0209563_100009 Ga0209563_100009650 209
1130 3300025231 Ga0207427_100310 Ga0207427_10031010 209
1131 3300025231 Ga0207427_112082 Ga0207427_1120821 209
1132 3300025233 Ga0209437_100004 Ga0209437_100004650 209
1133 3300025233 Ga0209437_100053 Ga0209437_1000535 209
1134 3300025233 Ga0209437_100234 Ga0209437_10023431 209
1135 3300025233 Ga0209437_103429 Ga0209437_1034292 209
1136 3300025242 Ga0209258_100504 Ga0209258_10050434 209
1137 3300025242 Ga0209258_100720 Ga0209258_1007201 209
1138 3300025245 Ga0207425_1000262 Ga0207425_100026216 209
1139 3300025246 Ga0209646_1000103 Ga0209646_100010334 209
1140 3300025246 Ga0209646_1000109 Ga0209646_1000109113 209
1141 3300025250 Ga0209026_1000467 Ga0209026_10004672 209
1142 3300025253 Ga0209677_100005 Ga0209677_100005650 209
1143 3300025253 Ga0209677_105152 Ga0209677_1051524 209
1144 3300025254 Ga0209148_1006589 Ga0209148_10065894 209
1145 3300025256 Ga0209759_1000064 Ga0209759_1000064148 209
1146 3300025256 Ga0209759_1000091 Ga0209759_100009134 209
1147 3300025256 Ga0209759_1001647 Ga0209759_100164714 209
1148 3300025261 Ga0209233_1000005 Ga0209233_1000005807 209
1149 3300025261 Ga0209233_1016765 Ga0209233_10167652 209
1150 3300025263 Ga0209565_1000017 Ga0209565_100001731 209
1151 3300025272 Ga0209455_1000043 Ga0209455_1000043129 209
1152 3300025272 Ga0209455_1005410 Ga0209455_10054103 209
1153 3300025273 Ga0209673_1000007 Ga0209673_1000007398 209
1154 3300025291 Ga0209675_1000009 Ga0209675_1000009120 209
1155 3300025294 Ga0209025_1039236 Ga0209025_10392362 209
1156 3300025295 Ga0209564_1000055 Ga0209564_100005555 209
1157 3300025297 Ga0209758_1000625 Ga0209758_100062527 209
1158 3300025299 Ga0209256_1000559 Ga0209256_100055925 209
1159 3300025315 Ga0207697_10016149 Ga0207697_100161493 209
1160 3300025321 Ga0207656_10006575 Ga0207656_100065754 209
1161 3300025321 Ga0207656_10084810 Ga0207656_100848102 209
1162 3300025711 Ga0207696_1010086 Ga0207696_10100863 209
1163 3300025711 Ga0207696_1060660 Ga0207696_10606602 209
1164 3300025728 Ga0207655_1000490 Ga0207655_100049055 209
1165 3300025728 Ga0207655_1001848 Ga0207655_100184814 209
1166 3300025728 Ga0207655_1032591 Ga0207655_10325912 209
1167 3300025735 Ga0207713_1023413 Ga0207713_10234133 209
1168 3300025735 Ga0207713_1043269 Ga0207713_10432692 209
1169 3300025900 Ga0207710_10000839 Ga0207710_100008396 209
1170 3300025909 Ga0207705_10011480 Ga0207705_100114806 209
1171 3300025911 Ga0207654_10000122 Ga0207654_100001221 209
1172 3300025911 Ga0207654_10072187 Ga0207654_100721872 209
1173 3300025913 Ga0207695_10000115 Ga0207695_1000011555 209
1174 3300025913 Ga0207695_10002097 Ga0207695_1000209716 209
1175 3300025913 Ga0207695_10002265 Ga0207695_1000226513 209
1176 3300025913 Ga0207695_10009870 Ga0207695_100098709 209
1177 3300025914 Ga0207671_10000032 Ga0207671_10000032196 209
1178 3300025914 Ga0207671_10003511 Ga0207671_100035118 209
1179 3300025914 Ga0207671_10148734 Ga0207671_101487342 209
1180 3300025919 Ga0207657_10027318 Ga0207657_100273184 209
1181 3300025919 Ga0207657_10337918 Ga0207657_103379182 209
1182 3300025920 Ga0207649_10011954 Ga0207649_100119545 209
1183 3300025921 Ga0207652_10730030 Ga0207652_107300301 209
1184 3300025924 Ga0207694_10000029 Ga0207694_1000002917 209
1185 3300025924 Ga0207694_10000075 Ga0207694_1000007573 209
1186 3300025924 Ga0207694_10223310 Ga0207694_102233102 209
1187 3300025925 Ga0207650_10001617 Ga0207650_100016172 209
1188 3300025925 Ga0207650_10031834 Ga0207650_100318342 209
1189 3300025925 Ga0207650_10408127 Ga0207650_104081272 209
1190 3300025926 Ga0207659_10167568 Ga0207659_101675683 209
1191 3300025927 Ga0207687_10001035 Ga0207687_1000103514 209
1192 3300025927 Ga0207687_10030036 Ga0207687_100300362 209
1193 3300025928 Ga0207700_10089054 Ga0207700_100890543 209
1194 3300025928 Ga0207700_10372829 Ga0207700_103728291 209
1195 3300025931 Ga0207644_10074243 Ga0207644_100742433 209
1196 3300025931 Ga0207644_10510565 Ga0207644_105105652 209
1197 3300025932 Ga0207690_10004240 Ga0207690_100042405 209
1198 3300025932 Ga0207690_10017400 Ga0207690_100174004 209
1199 3300025933 Ga0207706_10003714 Ga0207706_100037147 209
1200 3300025934 Ga0207686_10275904 Ga0207686_102759042 209
1201 3300025935 Ga0207709_10000001 Ga0207709_100000011105 209
1202 3300025935 Ga0207709_10239070 Ga0207709_102390702 209
1203 3300025940 Ga0207691_10005340 Ga0207691_100053409 209
1204 3300025941 Ga0207711_10008206 Ga0207711_100082066 209
1205 3300025942 Ga0207689_10002718 Ga0207689_1000271812 209
1206 3300025942 Ga0207689_10023944 Ga0207689_100239444 209
1207 3300025944 Ga0207661_10001150 Ga0207661_1000115013 209
1208 3300025944 Ga0207661_10112065 Ga0207661_101120652 209
1209 3300025945 Ga0207679_10018810 Ga0207679_100188102 209
1210 3300025945 Ga0207679_10077585 Ga0207679_100775853 209
1211 3300025949 Ga0207667_10000110 Ga0207667_1000011082 209
1212 3300025949 Ga0207667_10003481 Ga0207667_100034812 209
1213 3300025949 Ga0207667_10004567 Ga0207667_100045679 209
1214 3300025949 Ga0207667_10005512 Ga0207667_1000551215 209
1215 3300025949 Ga0207667_10009897 Ga0207667_1000989710 209
1216 3300025960 Ga0207651_10067104 Ga0207651_100671042 209
1217 3300025961 Ga0207712_10304926 Ga0207712_103049262 209
1218 3300025972 Ga0207668_10162136 Ga0207668_101621363 209
1219 3300025981 Ga0207640_10008128 Ga0207640_100081283 209
1220 3300025986 Ga0207658_10001341 Ga0207658_1000134116 209
1221 3300026023 Ga0207677_10000023 Ga0207677_1000002394 209
1222 3300026023 Ga0207677_10087194 Ga0207677_100871942 209
1223 3300026035 Ga0207703_10002320 Ga0207703_1000232016 209
1224 3300026035 Ga0207703_10212890 Ga0207703_102128902 209
1225 3300026078 Ga0207702_10001243 Ga0207702_100012438 209
1226 3300026078 Ga0207702_10189621 Ga0207702_101896212 209
1227 3300026078 Ga0207702_10620691 Ga0207702_106206912 209
1228 3300026088 Ga0207641_10000283 Ga0207641_1000028345 209
1229 3300026088 Ga0207641_10125187 Ga0207641_101251872 209
1230 3300026116 Ga0207674_10022394 Ga0207674_100223943 209
1231 3300026116 Ga0207674_10362669 Ga0207674_103626692 209
1232 3300026142 Ga0207698_10000011 Ga0207698_1000001165 209
1233 3300026142 Ga0207698_10127545 Ga0207698_101275452 209
1234 3300026142 Ga0207698_10152899 Ga0207698_101528992 209
1235 3300026142 Ga0207698_10169428 Ga0207698_101694282 209
1236 3300027111 Ga0209281_1009167 Ga0209281_10091671 209
1237 3300027312 Ga0209371_1000006 Ga0209371_1000006240 209
1238 3300027312 Ga0209371_1023446 Ga0209371_10234462 209
1239 3300028380 Ga0268265_10084197 Ga0268265_100841972 209
1240 3300028381 Ga0268264_10000086 Ga0268264_10000086176 209
1241 3300028381 Ga0268264_10977864 Ga0268264_109778642 209
1242 3300030500 Ga0268256_1000007 Ga0268256_1000007240 209
1243 3300030500 Ga0268256_1026567 Ga0268256_10265671 209
1244 3300031251 Ga0265327_10153951 Ga0265327_101539511 209
1245 3300031344 Ga0265316_10004128 Ga0265316_1000412811 209
1246 3300031824 Ga0307413_10095542 Ga0307413_100955422 209
1247 3300037312 Ga0395899_0001751 Ga0395899_0001751_7060_7713 209
1248 3300037312 Ga0395899_0033535 Ga0395899_0033535_3176_3826 209
1249 3300037418 Ga0395900_0008788 Ga0395900_0008788_9618_10271 209
1250 3300037418 Ga0395900_0437272 Ga0395900_0437272_469_1119 209
1251 3300037466 Ga0395898_0184649 Ga0395898_0184649_363_1016 209
1252 3300037466 Ga0395898_0390742 Ga0395898_0390742_65_715 209
1253 3300037471 Ga0395905_0000416 Ga0395905_0000416_1489_2142 209
1254 3300037471 Ga0395905_0003638 Ga0395905_0003638_3586_4239 209
1255 3300037471 Ga0395905_0012379 Ga0395905_0012379_5648_6301 209
1256 3300037471 Ga0395905_0018706 Ga0395905_0018706_2732_3385 209
1257 3300037471 Ga0395905_0074093 Ga0395905_0074093_1136_1789 209
1258 3300037471 Ga0395905_0261590 Ga0395905_0261590_342_995 209
1259 3300038443 Ga0395901_0003716 Ga0395901_0003716_13931_14584 209
1260 3300038443 Ga0395901_0157318 Ga0395901_0157318_1385_2038 209
1261 3300039447 Ga0436361_0287651 Ga0436361_0287651_25109_25759 209
1262 3300039447 Ga0436361_0457180 Ga0436361_0457180_19_669 209
1263 3300039447 Ga0436361_0727856 Ga0436361_0727856_331_981 209
1264 3300039447 Ga0436361_0810743 Ga0436361_0810743_30_680 209
1265 3300039447 Ga0436361_0850691 Ga0436361_0850691_2236_2889 209
1266 3300041452 Ga0451793_0331504 Ga0451793_0331504_234_863 209
1267 3300042532 Ga0450893_0027811 Ga0450893_0027811_197_838 209
1268 3300042876 Ga0451577_0254152 Ga0451577_0254152_410_1066 209
1269 3300044656 Ga0466969_0014612 Ga0466969_0014612_3056_3739 209
1270 3300044673 Ga0453683_0151115 Ga0453683_0151115_249_902 209
1271 3300044684 Ga0466966_0016505 Ga0466966_0016505_787_1437 209
1272 3300044684 Ga0466966_0075667 Ga0466966_0075667_610_1293 209
1273 3300044842 Ga0466957_0109818 Ga0466957_0109818_1023_1676 209
1274 3300046454 Ga0495592_0033858 Ga0495592_0033858_3139_3792 209
1275 3300046459 Ga0495629_0052790 Ga0495629_0052790_1400_2050 209
1276 3300046462 Ga0495651_0014296 Ga0495651_0014296_4926_5579 209
1277 3300046462 Ga0495651_0056416 Ga0495651_0056416_1059_1712 209
1278 3300046463 Ga0495653_0007349 Ga0495653_0007349_7066_7719 209
1279 3300046472 Ga0495580_0095758 Ga0495580_0095758_271_903 209
1280 3300046492 Ga0495585_0004598 Ga0495585_0004598_48_698 209
1281 3300046492 Ga0495585_0007926 Ga0495585_0007926_4480_5130 209
1282 3300046501 Ga0495607_0021370 Ga0495607_0021370_1972_2622 209
1283 3300046506 Ga0495583_0000127 Ga0495583_0000127_81147_81797 209
1284 3300046507 Ga0495606_0000001 Ga0495606_0000001_464703_465353 209
1285 3300046507 Ga0495606_0008822 Ga0495606_0008822_2254_2907 209
1286 3300046511 Ga0495608_0004989 Ga0495608_0004989_1460_2113 209
1287 3300046512 Ga0495610_0004596 Ga0495610_0004596_956_1606 209
1288 3300046514 Ga0495618_0029268 Ga0495618_0029268_488_1141 209
1289 3300046516 Ga0495628_0008815 Ga0495628_0008815_1725_2378 209
1290 3300046516 Ga0495628_0013432 Ga0495628_0013432_3476_4129 209
1291 3300046522 Ga0495643_0000630 Ga0495643_0000630_6743_7393 209
1292 3300046522 Ga0495643_0001320 Ga0495643_0001320_9348_9998 209
1293 3300046524 Ga0495648_0061322 Ga0495648_0061322_369_1019 209
1294 3300046524 Ga0495648_0085982 Ga0495648_0085982_706_1356 209
1295 3300046528 Ga0495642_0002999 Ga0495642_0002999_3122_3775 209
1296 3300046529 Ga0495652_0004595 Ga0495652_0004595_2633_3286 209
1297 3300046529 Ga0495652_0019591 Ga0495652_0019591_2953_3606 209
1298 3300046529 Ga0495652_0027916 Ga0495652_0027916_1127_1780 209
1299 3300046542 Ga0495597_0002116 Ga0495597_0002116_11201_11851 209
1300 3300046543 Ga0495645_0072307 Ga0495645_0072307_1759_2412 209
1301 3300046543 Ga0495645_0169277 Ga0495645_0169277_782_1411 209
1302 3300046558 Ga0495633_0002178 Ga0495633_0002178_13339_13989 209
1303 3300046558 Ga0495633_0066789 Ga0495633_0066789_53_703 209
1304 3300046616 Ga0495668_0000285 Ga0495668_0000285_18201_18851 209
1305 3300046616 Ga0495668_0001521 Ga0495668_0001521_16009_16659 209
1306 3300046663 Ga0495635_0025468 Ga0495635_0025468_1654_2304 209
1307 3300046663 Ga0495635_0033601 Ga0495635_0033601_813_1466 209
1308 3300046665 Ga0495661_0021839 Ga0495661_0021839_255_908 209
1309 3300046665 Ga0495661_0049153 Ga0495661_0049153_371_1021 209
1310 3300046674 Ga0495588_0054750 Ga0495588_0054750_612_1262 209
1311 3300046675 Ga0495657_0139398 Ga0495657_0139398_158_811 209
1312 3300046678 Ga0495599_0021832 Ga0495599_0021832_430_1083 209
1313 3300046679 Ga0495623_0003590 Ga0495623_0003590_45_698 209
1314 3300046680 Ga0495646_0279299 Ga0495646_0279299_67_699 209
1315 3300046809 Ga0495600_0003478 Ga0495600_0003478_2915_3568 209
1316 3300047317 Ga0495604_0013119 Ga0495604_0013119_3034_3687 209
1317 3300047317 Ga0495604_0030390 Ga0495604_0030390_1484_2134 209
1318 3300047319 Ga0495674_0025320 Ga0495674_0025320_1325_1975 209
1319 3300047320 Ga0495672_0001684 Ga0495672_0001684_13158_13808 209
1320 3300047322 Ga0495680_0041286 Ga0495680_0041286_658_1308 209
1321 3300047443 Ga0495687_011487 Ga0495687_011487_1968_2621 209
1322 3300047444 Ga0495675_0103322 Ga0495675_0103322_431_1081 209
1323 3300047444 Ga0495675_0286106 Ga0495675_0286106_260_910 209
1324 3300047470 Ga0495681_0003047 Ga0495681_0003047_4311_4961 209
1325 3300047470 Ga0495681_0064113 Ga0495681_0064113_203_853 209
1326 3300047472 Ga0495686_0006497 Ga0495686_0006497_265_915 209
1327 3300047472 Ga0495686_0017129 Ga0495686_0017129_1732_2382 209
1328 3300048088 Ga0495602_0029352 Ga0495602_0029352_2315_2947 209
1329 3300048091 Ga0495626_0001165 Ga0495626_0001165_5629_6279 209
1330 3300048907 Ga0496104_0305695 Ga0496104_0305695_793_1425 209
1331 3300048918 Ga0496115_0284153 Ga0496115_0284153_556_1188 209
1332 3300048924 Ga0496121_0026546 Ga0496121_0026546_690_1346 209
1333 3300048925 Ga0496122_0005337 Ga0496122_0005337_10023_10673 209
1334 3300048925 Ga0496122_0196473 Ga0496122_0196473_214_870 209
1335 3300048927 Ga0496124_0000024 Ga0496124_0000024_65934_66590 209
1336 3300049459 Ga0495678_001541 Ga0495678_001541_13211_13861 209
1337 3300049568 Ga0501031_0004268 Ga0501031_0004268_3188_3841 209
1338 3300049569 Ga0501032_0001868 Ga0501032_0001868_3605_4258 209
1339 3300049570 Ga0501033_0000491 Ga0501033_0000491_36109_36762 209
1340 3300049571 Ga0501034_0273556 Ga0501034_0273556_32_685 209
1341 3300049571 Ga0501034_0462341 Ga0501034_0462341_461_1114 209
1342 3300049572 Ga0501036_0000389 Ga0501036_0000389_486_1139 209
1343 3300049573 Ga0501037_0001552 Ga0501037_0001552_9770_10423 209
1344 3300049573 Ga0501037_0003775 Ga0501037_0003775_1682_2335 209
1345 3300049574 Ga0501038_0000414 Ga0501038_0000414_28342_28995 209
1346 3300049579 Ga0501043_0015683 Ga0501043_0015683_67_720 209
1347 3300049580 Ga0501046_0028661 Ga0501046_0028661_1591_2244 209
1348 3300049581 Ga0501047_0007765 Ga0501047_0007765_8963_9616 209
1349 3300049742 Ga0501080_0787502 Ga0501080_0787502_41_676 209
1350 3300049822 Ga0501035_0002711 Ga0501035_0002711_1078_1731 209
1351 3300049823 Ga0501044_0001117 Ga0501044_0001117_27725_28378 209
1352 3300053077 Ga0495601_0164118 Ga0495601_0164118_177_830 209
1353 3300053085 Ga0495619_0416771 Ga0495619_0416771_224_877 209
1354 3300053125 Ga0500618_001117 Ga0500618_001117_11950_12600 209
1355 3300053141 Ga0500574_000287 Ga0500574_000287_3694_4347 209
1356 3300059512 Ga0587092_019830 Ga0587092_019830_227_880 209
1357 3300059643 Ga0587072_003368 Ga0587072_003368_500_1153 209
1358 3300005436 Ga0070713_100501445 Ga0070713_1005014452 210
1359 3300005437 Ga0070710_10202944 Ga0070710_102029442 210
1360 3300006028 Ga0070717_10575880 Ga0070717_105758801 210
1361 3300006175 Ga0070712_100003162 Ga0070712_10000316211 210
1362 3300006175 Ga0070712_100063584 Ga0070712_1000635842 210
1363 3300006914 Ga0075436_100554577 Ga0075436_1005545771 210
1364 3300021388 Ga0213875_10059590 Ga0213875_100595903 210
1365 3300025906 Ga0207699_10282769 Ga0207699_102827692 210
1366 3300025915 Ga0207693_10001513 Ga0207693_1000151314 210
1367 3300025915 Ga0207693_10052921 Ga0207693_100529212 210
1368 3300025915 Ga0207693_10164553 Ga0207693_101645532 210
1369 3300025916 Ga0207663_10026185 Ga0207663_100261853 210
1370 3300025920 Ga0207649_10084561 Ga0207649_100845612 210
1371 3300025928 Ga0207700_10051821 Ga0207700_100518212 210
1372 3300025928 Ga0207700_10070877 Ga0207700_100708773 210
1373 3300025929 Ga0207664_10021867 Ga0207664_100218674 210
1374 3300031090 Ga0265760_10021726 Ga0265760_100217262 210
1375 3300031251 Ga0265327_10011906 Ga0265327_100119066 210
1376 3300035083 Ga0373926_0002266 Ga0373926_0002266_4365_5015 210
1377 3300035113 Ga0373936_0244956 Ga0373936_0244956_35_685 210
1378 3300035116 Ga0373945_0042844 Ga0373945_0042844_665_1315 210
1379 3300035120 Ga0373957_0077988 Ga0373957_0077988_554_1204 210
1380 3300035170 Ga0373943_0000102 Ga0373943_0000102_21785_22435 210
1381 3300035170 Ga0373943_0027135 Ga0373943_0027135_675_1325 210
1382 3300035171 Ga0373946_0000763 Ga0373946_0000763_2462_3112 210
1383 3300035171 Ga0373946_0024658 Ga0373946_0024658_464_1114 210
1384 3300035172 Ga0373955_0010364 Ga0373955_0010364_3734_4384 210
1385 3300035410 Ga0373924_0239035 Ga0373924_0239035_113_763 210
1386 3300035692 Ga0373935_0005950 Ga0373935_0005950_2117_2767 210
1387 3300035692 Ga0373935_0014152 Ga0373935_0014152_1395_2045 210
1388 3300035695 Ga0373927_0003194 Ga0373927_0003194_3117_3767 210
1389 3300035695 Ga0373927_0013278 Ga0373927_0013278_1359_2009 210
1390 3300035695 Ga0373927_0109177 Ga0373927_0109177_322_972 210
1391 3300035724 Ga0373933_0005427 Ga0373933_0005427_4552_5202 210
1392 3300035725 Ga0373947_0002970 Ga0373947_0002970_7797_8447 210
1393 3300035725 Ga0373947_0008316 Ga0373947_0008316_1325_1975 210
1394 3300037068 Ga0373925_0001514 Ga0373925_0001514_10038_10688 210
1395 3300037068 Ga0373925_0033277 Ga0373925_0033277_1070_1720 210
1396 3300037853 Ga0436364_0543976 Ga0436364_0543976_363_1013 210
1397 3300037853 Ga0436364_1388333 Ga0436364_1388333_1010_1660 210
1398 3300039437 Ga0436365_1653741 Ga0436365_1653741_2421_3071 210
1399 3300041460 Ga0451802_0500530 Ga0451802_0500530_1252_1905 210
1400 3300046454 Ga0495592_0005124 Ga0495592_0005124_2877_3527 210
1401 3300046459 Ga0495629_0080113 Ga0495629_0080113_1005_1655 210
1402 3300046462 Ga0495651_0000976 Ga0495651_0000976_11948_12598 210
1403 3300046463 Ga0495653_0002352 Ga0495653_0002352_3756_4406 210
1404 3300046475 Ga0495639_0011256 Ga0495639_0011256_1897_2547 210
1405 3300046476 Ga0495662_0001205 Ga0495662_0001205_2816_3466 210
1406 3300046477 Ga0495664_0000600 Ga0495664_0000600_13888_14538 210
1407 3300046477 Ga0495664_0187161 Ga0495664_0187161_17_667 210
1408 3300046511 Ga0495608_0307865 Ga0495608_0307865_201_851 210
1409 3300046514 Ga0495618_0005805 Ga0495618_0005805_3224_3874 210
1410 3300046514 Ga0495618_0131487 Ga0495618_0131487_794_1444 210
1411 3300046516 Ga0495628_0483126 Ga0495628_0483126_183_833 210
1412 3300046517 Ga0495630_0005764 Ga0495630_0005764_4818_5468 210
1413 3300046517 Ga0495630_0031440 Ga0495630_0031440_188_838 210
1414 3300046526 Ga0495666_0030665 Ga0495666_0030665_1925_2575 210
1415 3300046529 Ga0495652_0092105 Ga0495652_0092105_785_1435 210
1416 3300046533 Ga0495640_0002848 Ga0495640_0002848_8247_8897 210
1417 3300046533 Ga0495640_0003109 Ga0495640_0003109_9192_9842 210
1418 3300046533 Ga0495640_0093329 Ga0495640_0093329_1255_1905 210
1419 3300046535 Ga0495586_0307160 Ga0495586_0307160_200_850 210
1420 3300046642 Ga0495634_0014172 Ga0495634_0014172_1189_1839 210
1421 3300046642 Ga0495634_0054769 Ga0495634_0054769_1010_1660 210
1422 3300046663 Ga0495635_0014561 Ga0495635_0014561_3515_4165 210
1423 3300046663 Ga0495635_0043108 Ga0495635_0043108_2248_2898 210
1424 3300046679 Ga0495623_0015491 Ga0495623_0015491_1873_2523 210
1425 3300046680 Ga0495646_0002551 Ga0495646_0002551_5388_6038 210
1426 3300046680 Ga0495646_0066311 Ga0495646_0066311_605_1255 210
1427 3300046683 Ga0495658_0228703 Ga0495658_0228703_210_860 210
1428 3300046689 Ga0495613_0023024 Ga0495613_0023024_1539_2189 210
1429 3300046690 Ga0495624_0005580 Ga0495624_0005580_5302_5952 210
1430 3300047315 Ga0495581_0087492 Ga0495581_0087492_701_1351 210
1431 3300047319 Ga0495674_0004086 Ga0495674_0004086_10242_10892 210
1432 3300047321 Ga0495676_0016920 Ga0495676_0016920_751_1401 210
1433 3300047322 Ga0495680_0003432 Ga0495680_0003432_4379_5029 210
1434 3300047471 Ga0495684_0013069 Ga0495684_0013069_1350_2000 210
1435 3300047471 Ga0495684_0021915 Ga0495684_0021915_2905_3555 210
1436 3300047673 Ga0495593_0090265 Ga0495593_0090265_908_1558 210
1437 3300048088 Ga0495602_0006678 Ga0495602_0006678_804_1454 210
1438 3300053077 Ga0495601_0001015 Ga0495601_0001015_1934_2584 210
1439 3300053078 Ga0495612_0000523 Ga0495612_0000523_4039_4689 210
1440 3300053085 Ga0495619_0001492 Ga0495619_0001492_8617_9267 210
1441 3300002067 JGI24735J21928_10018757 JGI24735J21928_100187573 211
1442 3300002067 JGI24735J21928_10052533 JGI24735J21928_100525332 211
1443 3300002773 JGI25152J39213_1015800 JGI25152J39213_10158002 211
1444 3300002774 JGI25150J39212_1000428 JGI25150J39212_10004282 211
1445 3300002987 JGI25159J45721_1000675 JGI25159J45721_100067512 211
1446 3300003187 JGI25151J46595_10010417 JGI25151J46595_100104172 211
1447 3300003187 JGI25151J46595_10023110 JGI25151J46595_100231102 211
1448 3300003215 JGI25153J46596_10000395 JGI25153J46596_1000039524 211
1449 3300003354 JGI25160J50197_1000962 JGI25160J50197_10009626 211
1450 3300003374 JGI25161J50226_1003326 JGI25161J50226_10033262 211
1451 3300003771 Ga0055526_1004461 Ga0055526_10044617 211
1452 3300003781 Ga0055536_1000715 Ga0055536_10007156 211
1453 3300003781 Ga0055536_1003152 Ga0055536_10031525 211
1454 3300003794 Ga0055531_10002978 Ga0055531_100029783 211
1455 3300003794 Ga0055531_10042077 Ga0055531_100420772 211
1456 3300004625 Ga0055543_1001474 Ga0055543_10014744 211
1457 3300005262 Ga0065165_1002550 Ga0065165_100255012 211
1458 3300005327 Ga0070658_10028610 Ga0070658_100286103 211
1459 3300005344 Ga0070661_100000006 Ga0070661_100000006149 211
1460 3300005458 Ga0070681_10011352 Ga0070681_100113527 211
1461 3300005530 Ga0070679_100000001 Ga0070679_10000000128 211
1462 3300005563 Ga0068855_100109993 Ga0068855_1001099932 211
1463 3300005563 Ga0068855_100191596 Ga0068855_1001915962 211
1464 3300009093 Ga0105240_10106546 Ga0105240_101065463 211
1465 3300009093 Ga0105240_10211667 Ga0105240_102116673 211
1466 3300009093 Ga0105240_11265032 Ga0105240_112650322 211
1467 3300009545 Ga0105237_10130578 Ga0105237_101305783 211
1468 3300009551 Ga0105238_10450889 Ga0105238_104508891 211
1469 3300013100 Ga0157373_10147263 Ga0157373_101472632 211
1470 3300013250 Ga0171462_1031 Ga0171462_103146 211
1471 3300021384 Ga0213876_10005332 Ga0213876_100053325 211
1472 3300025208 Ga0209436_100633 Ga0209436_1006336 211
1473 3300025245 Ga0207425_1000041 Ga0207425_100004154 211
1474 3300025254 Ga0209148_1002934 Ga0209148_10029343 211
1475 3300025258 Ga0209129_1004143 Ga0209129_10041432 211
1476 3300025272 Ga0209455_1001018 Ga0209455_10010186 211
1477 3300025284 Ga0209130_1001496 Ga0209130_100149611 211
1478 3300025292 Ga0209676_1000182 Ga0209676_100018297 211
1479 3300025292 Ga0209676_1001975 Ga0209676_10019758 211
1480 3300025292 Ga0209676_1003684 Ga0209676_10036843 211
1481 3300025294 Ga0209025_1000068 Ga0209025_1000068223 211
1482 3300025294 Ga0209025_1000301 Ga0209025_100030170 211
1483 3300025295 Ga0209564_1002177 Ga0209564_10021778 211
1484 3300025297 Ga0209758_1000004 Ga0209758_1000004122 211
1485 3300025298 Ga0209050_1000001 Ga0209050_10000012051 211
1486 3300025298 Ga0209050_1006167 Ga0209050_10061674 211
1487 3300025299 Ga0209256_1002806 Ga0209256_10028066 211
1488 3300025302 Ga0207426_1001904 Ga0207426_100190411 211
1489 3300025303 Ga0209051_1000191 Ga0209051_100019118 211
1490 3300025303 Ga0209051_1010665 Ga0209051_10106655 211
1491 3300025304 Ga0209257_1000234 Ga0209257_100023440 211
1492 3300025304 Ga0209257_1005496 Ga0209257_100549610 211
1493 3300025909 Ga0207705_10000022 Ga0207705_10000022113 211
1494 3300025912 Ga0207707_10020223 Ga0207707_100202233 211
1495 3300025913 Ga0207695_10075549 Ga0207695_100755491 211
1496 3300025913 Ga0207695_10662262 Ga0207695_106622622 211
1497 3300025914 Ga0207671_10030516 Ga0207671_100305164 211
1498 3300025919 Ga0207657_10009497 Ga0207657_100094978 211
1499 3300025920 Ga0207649_10000043 Ga0207649_1000004382 211
1500 3300025921 Ga0207652_10000001 Ga0207652_10000001138 211
1501 3300025921 Ga0207652_10000002 Ga0207652_10000002589 211
1502 3300025949 Ga0207667_10090353 Ga0207667_100903535 211
1503 3300028800 Ga0265338_10042032 Ga0265338_100420323 211
1504 3300031240 Ga0265320_10006647 Ga0265320_100066473 211
1505 3300031249 Ga0265339_10229013 Ga0265339_102290132 211
1506 3300031251 Ga0265327_10025911 Ga0265327_100259115 211
1507 3300031456 Ga0307513_10000433 Ga0307513_1000043311 211
1508 3300031711 Ga0265314_10014338 Ga0265314_100143383 211
1509 3300031730 Ga0307516_10005782 Ga0307516_100057824 211
1510 3300032002 Ga0307416_100481892 Ga0307416_1004818922 211
1511 3300032004 Ga0307414_10023710 Ga0307414_100237105 211
1512 3300035114 Ga0373939_0016008 Ga0373939_0016008_197_835 211
1513 3300035115 Ga0373941_0094452 Ga0373941_0094452_62_700 211
1514 3300039437 Ga0436365_0267961 Ga0436365_0267961_3015_3671 211
1515 3300041494 Ga0451837_0453168 Ga0451837_0453168_10_651 211
1516 3300044683 Ga0466965_0004319 Ga0466965_0004319_3228_3863 211
1517 3300044901 Ga0466960_0266513 Ga0466960_0266513_158_820 211
1518 3300046455 Ga0495603_0030464 Ga0495603_0030464_1205_1843 211
1519 3300046473 Ga0495582_0400906 Ga0495582_0400906_74_712 211
1520 3300046557 Ga0495622_0011733 Ga0495622_0011733_2162_2800 211
1521 3300046558 Ga0495633_0001747 Ga0495633_0001747_3756_4412 211
1522 3300046648 Ga0495611_0167124 Ga0495611_0167124_355_1005 211
1523 3300046660 Ga0495625_0112635 Ga0495625_0112635_903_1553 211
1524 3300046683 Ga0495658_0025453 Ga0495658_0025453_2148_2786 211
1525 3300046684 Ga0495669_0000164 Ga0495669_0000164_20468_21103 211
1526 3300046694 Ga0495649_0001564 Ga0495649_0001564_11383_12033 211
1527 3300046694 Ga0495649_0121797 Ga0495649_0121797_534_1172 211
1528 3300047320 Ga0495672_0021435 Ga0495672_0021435_105_743 211
1529 3300047323 Ga0495683_0139536 Ga0495683_0139536_339_989 211
1530 3300048919 Ga0496116_0036895 Ga0496116_0036895_2653_3303 211
1531 3300048924 Ga0496121_0000567 Ga0496121_0000567_13511_14149 211
1532 3300048924 Ga0496121_0028452 Ga0496121_0028452_645_1301 211
1533 3300049592 Ga0501076_0347967 Ga0501076_0347967_69_728 211
1534 3300049686 Ga0501257_003248 Ga0501257_003248_2192_2842 211
1535 3300049758 Ga0501241_004893 Ga0501241_004893_1500_2144 211
1536 3300053087 Ga0500643_002719 Ga0500643_002719_2080_2715 211
1537 3300053088 Ga0500644_0008465 Ga0500644_0008465_467_1120 211
1538 3300053094 Ga0500566_0090743 Ga0500566_0090743_780_1430 211
1539 3300053094 Ga0500566_0221184 Ga0500566_0221184_294_929 211
1540 3300053121 Ga0500607_000003 Ga0500607_000003_127398_128033 211
1541 3300053136 Ga0500559_0000400 Ga0500559_0000400_17790_18425 211
1542 3300053139 Ga0500568_0006369 Ga0500568_0006369_4731_5387 211
1543 3300053140 Ga0500573_0005745 Ga0500573_0005745_5449_6102 211
1544 3300053151 Ga0500604_0000025 Ga0500604_0000025_23509_24144 211
1545 3300053153 Ga0500616_0000254 Ga0500616_0000254_60859_61494 211
1546 3300053730 Ga0500645_002612 Ga0500645_002612_5082_5717 211
1547 3300059604 Ga0587098_014045 Ga0587098_014045_91_741 211
1548 3300025981 Ga0207640_10328359 Ga0207640_103283592 212
1549 3300044712 Ga0453684_0000126 Ga0453684_0000126_140485_141141 214
1550 3300053078 Ga0495612_0142801 Ga0495612_0142801_71_739 214
1551 3300053085 Ga0495619_0216970 Ga0495619_0216970_287_955 214
1552 3300047320 Ga0495672_0018332 Ga0495672_0018332_3749_4465 215
1553 iso_pu_bacteria 2896253425 2896256048 217
1554 3300001976 JGI24752J21851_1000255 JGI24752J21851_10002557 218
1555 3300002074 JGI24748J21848_1000053 JGI24748J21848_100005347 218
1556 3300002076 JGI24749J21850_1001230 JGI24749J21850_10012303 218
1557 3300002239 JGI24034J26672_10000036 JGI24034J26672_1000003632 218
1558 3300002244 JGI24742J22300_10002780 JGI24742J22300_100027803 218
1559 3300005355 Ga0070671_100125957 Ga0070671_1001259573 218
1560 3300005355 Ga0070671_100224309 Ga0070671_1002243091 218
1561 3300005367 Ga0070667_100865492 Ga0070667_1008654921 218
1562 3300005455 Ga0070663_100024503 Ga0070663_1000245036 218
1563 3300005577 Ga0068857_100405795 Ga0068857_1004057952 218
1564 3300005578 Ga0068854_100064887 Ga0068854_1000648874 218
1565 3300005616 Ga0068852_100018978 Ga0068852_1000189782 218
1566 3300005618 Ga0068864_100325041 Ga0068864_1003250413 218
1567 3300005841 Ga0068863_100000323 Ga0068863_10000032311 218
1568 3300009174 Ga0105241_10174653 Ga0105241_101746533 218
1569 3300009177 Ga0105248_10180654 Ga0105248_101806543 218
1570 3300013297 Ga0157378_10127308 Ga0157378_101273084 218
1571 3300013306 Ga0163162_10070533 Ga0163162_100705332 218
1572 3300014325 Ga0163163_10335608 Ga0163163_103356082 218
1573 3300025223 Ga0207672_1000282 Ga0207672_10002827 218
1574 3300025900 Ga0207710_10138408 Ga0207710_101384082 218
1575 3300025907 Ga0207645_10074675 Ga0207645_100746753 218
1576 3300025919 Ga0207657_10074311 Ga0207657_100743111 218
1577 3300025924 Ga0207694_10355031 Ga0207694_103550312 218
1578 3300025925 Ga0207650_10410813 Ga0207650_104108132 218
1579 3300025925 Ga0207650_10568842 Ga0207650_105688422 218
1580 3300025931 Ga0207644_10000004 Ga0207644_10000004172 218
1581 3300025931 Ga0207644_10037827 Ga0207644_100378273 218
1582 3300025931 Ga0207644_10106918 Ga0207644_101069182 218
1583 3300025933 Ga0207706_10388187 Ga0207706_103881871 218
1584 3300025945 Ga0207679_11066314 Ga0207679_110663141 218
1585 3300025981 Ga0207640_10002493 Ga0207640_1000249313 218
1586 3300025986 Ga0207658_10422575 Ga0207658_104225751 218
1587 3300026067 Ga0207678_10001628 Ga0207678_100016283 218
1588 3300026088 Ga0207641_10000216 Ga0207641_1000021657 218
1589 3300026089 Ga0207648_10035867 Ga0207648_100358671 218
1590 3300026116 Ga0207674_10184816 Ga0207674_101848163 218
1591 3300026142 Ga0207698_10002619 Ga0207698_100026197 218
1592 3300037418 Ga0395900_0449471 Ga0395900_0449471_72_728 218
1593 3300037471 Ga0395905_0090163 Ga0395905_0090163_1192_1848 218
1594 3300048905 Ga0496102_0946470 Ga0496102_0946470_63_719 218
1595 3300048906 Ga0496103_0170893 Ga0496103_0170893_206_862 218
1596 3300048907 Ga0496104_0157257 Ga0496104_0157257_262_918 218
1597 3300048908 Ga0496105_0025378 Ga0496105_0025378_3558_4214 218
1598 3300048908 Ga0496105_0072207 Ga0496105_0072207_1980_2639 218
1599 3300048914 Ga0496111_0044917 Ga0496111_0044917_1444_2103 218
1600 3300048915 Ga0496112_0150025 Ga0496112_0150025_558_1217 218
1601 3300048915 Ga0496112_0213950 Ga0496112_0213950_1061_1717 218
1602 3300048916 Ga0496113_0012960 Ga0496113_0012960_2400_3059 218
1603 3300048922 Ga0496119_0018999 Ga0496119_0018999_3879_4535 218
1604 3300053122 Ga0500608_000074 Ga0500608_000074_28649_29308 218

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01144

CoA_trans

Coenzyme A transferase

5

204

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3k6m-assembly2.cif.gz_C dynamic domains of succinyl-coa:3-ketoacid-coenzyme a transferase from pig heart. 0.9195 12 217
3oxo-assembly3.cif.gz_E succinyl-coa:3-ketoacid coa transferase from pig heart covalently bound to coa 0.915 15 217
3oxo-assembly3.cif.gz_F succinyl-coa:3-ketoacid coa transferase from pig heart covalently bound to coa 0.9148 15 217
3oxo-assembly4.cif.gz_H succinyl-coa:3-ketoacid coa transferase from pig heart covalently bound to coa 0.9134 18 217
3oxo-assembly4.cif.gz_G succinyl-coa:3-ketoacid coa transferase from pig heart covalently bound to coa 0.9095 15 217
ID Description Score Start End Superfamily
5dbnD00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8831 10 216 3.40.1080.10
2nrcB02 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8684 12 217 3.40.1080.10
5dbnD00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8407 10 216 3.40.1080.10
1o9lB02 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8376 10 217 3.40.1080.10
2nrcB02 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8279 12 217 3.40.1080.10
ID Description Score Start End GO Terms
AF-A0A2N3DP54-F1-model_v4 Succinyl-CoA--3-ketoacid-CoA transferase 0.9986 138 218 GO:0008410
AF-A0A2N3DP54-F1-model_v4 Succinyl-CoA--3-ketoacid-CoA transferase 0.9746 138 218 GO:0008410
AF-A0A352H4X5-F1-model_v4 deleted 0.9648 98 217
AF-A0A5A4WCF4-F1-model_v4 deleted 0.9418 98 217
AF-A0A3D4T0Q5-F1-model_v4 Succinyl-CoA--3-ketoacid-CoA transferase 0.9404 102 217 GO:0008410
GO:0016787

Feature Viewer

pLDDT pTM Quality
86.09 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map