F495012
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1604 | 646 | 1497 | 213 |
Family's Representative Sequence
| Representative Sequence | 3300028800|Ga0265338_10042032|Ga0265338_100420323 |
| Length | 225 |
| Sequence | MAWNRDQMAARAARELRDGFYVNLGIGIPTLVANFIPDGMEVTLQSENGMLGMGPFPFAGDEDPDLINAGKQTITQLPKTSYFSSADSFAMIRGGHIDLSILGAMQVSATGDLANWMVPGKMVKGMGGAMDLVAGVKKVVVVMEHTNKDGEHKIRDWCSLPLTGVGVVDMIITDLAVFTVDKHAGGLTLIELAPGVELAEIGDKTGAPFDVKLADGVRGSFAPAM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 2 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 3 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 4 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 5 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 6 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 7 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 8 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 9 | 2639762793 | Acinetobacter calcoaceticus GK1 | Isolate | Rhizosphere |
| 10 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 11 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 12 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 13 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 14 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 15 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 16 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 17 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 18 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 19 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 20 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 21 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 22 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 23 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 24 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 25 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 26 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 27 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 28 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 29 | 2675903507 | Acinetobacter calcoaceticus GK2 | Isolate | Unclassified |
| 30 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 31 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 32 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 33 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 34 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 35 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 36 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 37 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 38 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 39 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 40 | 2739367756 | Asticcacaulis sp. CF398 | Isolate | Unclassified |
| 41 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 42 | 2773857761 | Acinetobacter sp. 3664 | Isolate | Unclassified |
| 43 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 44 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 45 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 46 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 47 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 48 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 49 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 50 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 51 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 52 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 53 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 54 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 55 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 56 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 57 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 58 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 59 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 60 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 61 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 62 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 63 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 64 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 65 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 66 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 67 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 68 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 69 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 70 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 71 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 72 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 73 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 74 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 75 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 76 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 77 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 78 | 2896429255 | Sphingomonas rhizophila KACC 19189 | Isolate | Rhizosphere |
| 79 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 80 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 81 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 82 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 83 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 84 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 85 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 86 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 87 | 2916699645 | Acinetobacter ursingii M3 | Isolate | Unclassified |
| 88 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 89 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 90 | 2919182534 | Acinetobacter calcoaceticus 2589 | Isolate | Rhizosphere |
| 91 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 92 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 93 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 94 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 95 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 96 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 97 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 98 | 2941479691 | |||
| 99 | 2952252522 | Salinicola sp. DM10 | Isolate | Unclassified |
| 100 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 101 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 102 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 103 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 104 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 105 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 106 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 107 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 108 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 109 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 110 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 111 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 112 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 113 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 114 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 115 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 116 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 117 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 118 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 119 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 120 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 121 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 122 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 123 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 124 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 125 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 126 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 127 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 128 | 3300003611 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 129 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 130 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 131 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 132 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 133 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 134 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 135 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 136 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 137 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 138 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 139 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 140 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 141 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 142 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 143 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 144 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 145 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 146 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 147 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 148 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 149 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 150 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 151 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 152 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 153 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 155 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 156 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 157 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 158 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 159 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 160 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 161 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 162 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 163 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 164 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 165 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 166 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 167 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 168 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 169 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 170 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 171 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 172 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 173 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 174 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 175 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 176 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 177 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 178 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 179 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 180 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 181 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 182 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 183 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 184 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 185 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 186 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 187 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 188 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 189 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 190 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 191 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 192 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 193 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 194 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 195 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 196 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 197 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 198 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 199 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 200 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 201 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 202 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 203 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 204 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 205 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 206 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 207 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 208 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 209 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 210 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 211 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 212 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 213 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 214 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 215 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 216 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 218 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 219 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 220 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 221 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 222 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 224 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 225 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 226 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 227 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 228 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 229 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 230 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 231 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 232 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 233 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 234 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 235 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 236 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 237 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 238 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 239 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 240 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 241 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 242 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 243 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 244 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 245 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 246 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 247 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 248 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 249 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 250 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 251 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 252 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 253 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 254 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 255 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 256 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 257 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 258 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 259 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 260 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 261 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 262 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 263 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 264 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 265 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 267 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 268 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 269 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 270 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 271 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 272 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 273 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 274 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 275 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 276 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 277 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 278 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 279 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 280 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 281 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 282 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 283 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 284 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 285 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 286 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 287 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 288 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 289 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 290 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 291 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 292 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 293 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 294 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 295 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 296 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 297 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 354 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 355 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 361 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 363 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 368 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 369 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 370 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 371 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 372 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 373 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 374 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 375 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 376 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 377 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 378 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 380 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 381 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 382 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 383 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 384 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 385 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 386 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 387 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 388 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 389 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 390 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 391 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 392 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 393 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 394 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 395 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 396 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 397 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 398 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 399 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 400 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 401 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 402 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 403 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 404 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 405 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 406 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 407 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 408 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 409 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 410 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 411 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 412 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 413 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 414 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 415 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 416 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 417 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 418 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 419 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 420 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 421 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 422 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 423 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 424 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 425 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 426 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 427 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 428 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 429 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 430 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 431 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 432 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 433 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 434 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 435 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 436 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 437 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 438 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 439 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 440 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 441 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 442 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 443 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 444 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 445 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 446 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 447 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 448 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 449 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 450 | 3300042119 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 | Metagenome | Rhizosphere |
| 451 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 452 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 453 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 454 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 455 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 456 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 457 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 458 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 459 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 460 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 461 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 462 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 463 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 464 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 465 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 466 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 467 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 468 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 469 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 470 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 471 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 472 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 473 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 474 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 552 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 553 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 559 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 560 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 561 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 562 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 563 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 564 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 565 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 566 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 567 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 568 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 569 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 570 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 571 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 572 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 573 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 574 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 575 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 576 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 577 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 578 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 579 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 580 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 581 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 582 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 583 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 584 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 585 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 586 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 587 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 588 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 589 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 590 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 591 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 592 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 593 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 594 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 595 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 596 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 597 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 598 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 599 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 600 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 601 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 602 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 603 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 604 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 605 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 606 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 607 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 608 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 609 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 610 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 611 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 612 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 613 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 614 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 615 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 616 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 617 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 618 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 619 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 620 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 621 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 622 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 623 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 624 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 625 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 626 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 627 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 628 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 629 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 630 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 631 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 632 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 633 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 634 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 635 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 636 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 637 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 638 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 639 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 640 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 641 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 642 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 643 | 8002392321 | Alcaligenes faecalis Mc250 | Isolate | Rhizosphere |
| 644 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
| 645 | 8048746797 | Alcaligenes endophyticus DSM 100498 | Isolate | Unclassified |
| 646 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.46 |
| Metatranscriptomes | 0.87 |
| Isolates | 6.67 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 20.57 |
| Nodule | 0.81 |
| Rhizoplane | 2.18 |
| Rhizosphere | 65.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.6 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1000255 | 3300001976 | Bacteria | 7368 |
| 2 | JGI24740J21852_10003031 | 3300001979 | Bacteria | 7435 |
| 3 | JGI24739J22299_10038407 | 3300001989 | Bacteria | 1609 |
| 4 | JGI24743J22301_10001118 | 3300001991 | Bacteria | 3593 |
| 5 | JGI24735J21928_10018757 | 3300002067 | Bacteria | 2131 |
| 6 | JGI24735J21928_10052533 | 3300002067 | Bacteria | 1175 |
| 7 | JGI24748J21848_1000053 | 3300002074 | Bacteria | 50665 |
| 8 | JGI24749J21850_1001230 | 3300002076 | Bacteria | 3642 |
| 9 | JGI24034J26672_10000036 | 3300002239 | Bacteria | 84333 |
| 10 | JGI24742J22300_10002780 | 3300002244 | Bacteria | 2822 |
| 11 | JGI25155J39150_1000073 | 3300002704 | Bacteria | 62972 |
| 12 | JGI25156J39149_1000609 | 3300002705 | Bacteria | 19855 |
| 13 | JGI25156J39149_1004731 | 3300002705 | Bacteria | 4079 |
| 14 | JGI25162J39368_1000001 | 3300002737 | Bacteria | 740113 |
| 15 | JGI25162J39368_1006819 | 3300002737 | Bacteria | 1886 |
| 16 | JGI25154J39366_1000118 | 3300002738 | Bacteria | 64203 |
| 17 | JGI25154J39366_1000258 | 3300002738 | Bacteria | 33918 |
| 18 | JGI25154J39366_1000270 | 3300002738 | Bacteria | 32293 |
| 19 | JGI25157J39369_1000001 | 3300002741 | Bacteria | 363277 |
| 20 | JGI25164J39214_1001808 | 3300002772 | Bacteria | 4125 |
| 21 | JGI25152J39213_1001584 | 3300002773 | Bacteria | 9542 |
| 22 | JGI25152J39213_1015800 | 3300002773 | Bacteria | 1478 |
| 23 | JGI25150J39212_1000428 | 3300002774 | Bacteria | 19227 |
| 24 | JGI25150J39212_1001402 | 3300002774 | Bacteria | 6805 |
| 25 | JGI25150J39212_1010535 | 3300002774 | Bacteria | 1713 |
| 26 | JGI25159J45721_1000675 | 3300002987 | Bacteria | 15067 |
| 27 | JGI25159J45721_1001076 | 3300002987 | Bacteria | 11675 |
| 28 | JGI25159J45721_1001508 | 3300002987 | Bacteria | 9542 |
| 29 | JGI25159J45721_1001707 | 3300002987 | Bacteria | 8878 |
| 30 | JGI25159J45721_1007198 | 3300002987 | Bacteria | 3219 |
| 31 | JGI25151J46595_10003026 | 3300003187 | Bacteria | 9542 |
| 32 | JGI25151J46595_10010417 | 3300003187 | Bacteria | 4324 |
| 33 | JGI25151J46595_10023110 | 3300003187 | Bacteria | 2568 |
| 34 | JGI25151J46595_10036981 | 3300003187 | Bacteria | 1835 |
| 35 | JGI25165J46597_1000001 | 3300003214 | Bacteria | 1111887 |
| 36 | JGI25153J46596_10000395 | 3300003215 | Bacteria | 29365 |
| 37 | JGI25153J46596_10021825 | 3300003215 | Bacteria | 2378 |
| 38 | JGI25160J50197_1000259 | 3300003354 | Bacteria | 39883 |
| 39 | JGI25160J50197_1000962 | 3300003354 | Bacteria | 15067 |
| 40 | JGI25160J50197_1002071 | 3300003354 | Bacteria | 9542 |
| 41 | JGI25160J50197_1003470 | 3300003354 | Bacteria | 7046 |
| 42 | JGI25161J50226_1000092 | 3300003374 | Bacteria | 72932 |
| 43 | JGI25161J50226_1002450 | 3300003374 | Bacteria | 4751 |
| 44 | JGI25161J50226_1003326 | 3300003374 | Bacteria | 3724 |
| 45 | Ga0007417J51691_1023165 | 3300003544 | Bacteria | 2041 |
| 46 | Ga0007410J51695_1034713 | 3300003574 | Bacteria | 1937 |
| 47 | Ga0007409J51694_1016496 | 3300003575 | Bacteria | 2565 |
| 48 | Ga0007416J51690_1013575 | 3300003577 | Bacteria | 2318 |
| 49 | Ga0007416J51690_1033019 | 3300003577 | Bacteria | 1140 |
| 50 | Ga0006562J51391_1148455 | 3300003578 | Bacteria | 1322 |
| 51 | Ga0007411J51799_112918 | 3300003611 | Bacteria | 981 |
| 52 | Ga0032354_1022659 | 3300003693 | Bacteria | 3337 |
| 53 | Ga0055538_1000001 | 3300003751 | Bacteria | 1111887 |
| 54 | Ga0055539_1000001 | 3300003752 | Bacteria | 1111887 |
| 55 | Ga0055533_1000003 | 3300003756 | Bacteria | 1111887 |
| 56 | Ga0055525_1000001 | 3300003759 | Bacteria | 1016948 |
| 57 | Ga0055525_1000003 | 3300003759 | Bacteria | 962094 |
| 58 | Ga0055525_1000046 | 3300003759 | Bacteria | 261587 |
| 59 | Ga0055535_1000215 | 3300003761 | Bacteria | 61211 |
| 60 | Ga0055535_1001710 | 3300003761 | Bacteria | 9959 |
| 61 | Ga0055535_1003636 | 3300003761 | Bacteria | 4215 |
| 62 | Ga0055542_1000004 | 3300003762 | Bacteria | 553532 |
| 63 | Ga0055542_1000412 | 3300003762 | Bacteria | 41756 |
| 64 | Ga0055529_1000032 | 3300003763 | Bacteria | 255895 |
| 65 | Ga0055529_1000306 | 3300003763 | Bacteria | 56382 |
| 66 | Ga0055526_1000951 | 3300003771 | Bacteria | 21419 |
| 67 | Ga0055526_1001576 | 3300003771 | Bacteria | 16041 |
| 68 | Ga0055526_1002557 | 3300003771 | Bacteria | 12209 |
| 69 | Ga0055526_1003709 | 3300003771 | Bacteria | 9542 |
| 70 | Ga0055526_1004461 | 3300003771 | Bacteria | 8396 |
| 71 | Ga0055526_1004811 | 3300003771 | Bacteria | 7981 |
| 72 | Ga0055526_1006869 | 3300003771 | Bacteria | 6066 |
| 73 | Ga0055526_1008931 | 3300003771 | Bacteria | 4912 |
| 74 | Ga0055537_1000030 | 3300003773 | Bacteria | 100491 |
| 75 | Ga0055537_1000086 | 3300003773 | Bacteria | 67416 |
| 76 | Ga0055537_1000587 | 3300003773 | Bacteria | 20267 |
| 77 | Ga0055537_1001401 | 3300003773 | Bacteria | 9542 |
| 78 | Ga0055524_1000093 | 3300003775 | Bacteria | 111953 |
| 79 | Ga0055524_1000194 | 3300003775 | Bacteria | 66522 |
| 80 | Ga0055524_1002243 | 3300003775 | Bacteria | 10121 |
| 81 | Ga0055524_1002452 | 3300003775 | Bacteria | 9542 |
| 82 | Ga0055524_1002681 | 3300003775 | Bacteria | 9017 |
| 83 | Ga0055536_1000715 | 3300003781 | Bacteria | 22226 |
| 84 | Ga0055536_1003152 | 3300003781 | Bacteria | 8948 |
| 85 | Ga0055536_1014255 | 3300003781 | Bacteria | 2806 |
| 86 | Ga0055534_1000024 | 3300003784 | Bacteria | 131674 |
| 87 | Ga0055534_1000447 | 3300003784 | Bacteria | 24217 |
| 88 | Ga0055534_1000820 | 3300003784 | Bacteria | 14368 |
| 89 | Ga0055534_1001417 | 3300003784 | Bacteria | 9542 |
| 90 | Ga0055534_1001838 | 3300003784 | Bacteria | 7925 |
| 91 | Ga0055534_1021827 | 3300003784 | Bacteria | 1066 |
| 92 | Ga0055528_1000439 | 3300003790 | Bacteria | 33348 |
| 93 | Ga0055528_1000961 | 3300003790 | Bacteria | 19107 |
| 94 | Ga0055528_1002611 | 3300003790 | Bacteria | 9542 |
| 95 | Ga0055528_1014420 | 3300003790 | Bacteria | 2924 |
| 96 | Ga0055530_10000541 | 3300003791 | Bacteria | 32834 |
| 97 | Ga0055530_10057965 | 3300003791 | Bacteria | 873 |
| 98 | Ga0055540_1000089 | 3300003792 | Bacteria | 100214 |
| 99 | Ga0055540_1004954 | 3300003792 | Bacteria | 5802 |
| 100 | Ga0055540_1006243 | 3300003792 | Bacteria | 4778 |
| 101 | Ga0055540_1013378 | 3300003792 | Bacteria | 2509 |
| 102 | Ga0055531_10000269 | 3300003794 | Bacteria | 53905 |
| 103 | Ga0055531_10002978 | 3300003794 | Bacteria | 11006 |
| 104 | Ga0055531_10005739 | 3300003794 | Bacteria | 7190 |
| 105 | Ga0055531_10009722 | 3300003794 | Bacteria | 4882 |
| 106 | Ga0055531_10042077 | 3300003794 | Bacteria | 1312 |
| 107 | Ga0055541_1000001 | 3300003841 | Bacteria | 1111887 |
| 108 | Ga0055541_1001138 | 3300003841 | Bacteria | 5964 |
| 109 | Ga0055543_1001474 | 3300004625 | Bacteria | 9297 |
| 110 | Ga0055543_1003203 | 3300004625 | Bacteria | 4977 |
| 111 | Ga0055543_1004025 | 3300004625 | Bacteria | 4123 |
| 112 | Ga0055543_1005432 | 3300004625 | Bacteria | 3256 |
| 113 | Ga0055543_1009685 | 3300004625 | Bacteria | 2056 |
| 114 | Ga0065165_1000353 | 3300005262 | Bacteria | 75343 |
| 115 | Ga0065165_1000600 | 3300005262 | Bacteria | 52753 |
| 116 | Ga0065165_1001802 | 3300005262 | Bacteria | 21054 |
| 117 | Ga0065165_1002550 | 3300005262 | Bacteria | 15105 |
| 118 | Ga0065165_1005751 | 3300005262 | Bacteria | 6806 |
| 119 | Ga0065165_1014470 | 3300005262 | Bacteria | 3060 |
| 120 | Ga0065165_1036832 | 3300005262 | Bacteria | 1488 |
| 121 | Ga0065165_1038483 | 3300005262 | Bacteria | 1441 |
| 122 | Ga0065714_10014905 | 3300005288 | Bacteria | 2916 |
| 123 | Ga0065714_10151557 | 3300005288 | Bacteria | 1103 |
| 124 | Ga0065704_10180239 | 3300005289 | Bacteria | 1241 |
| 125 | Ga0065704_10198711 | 3300005289 | Bacteria | 1156 |
| 126 | Ga0065704_10215718 | 3300005289 | Bacteria | 1092 |
| 127 | Ga0065704_10457162 | 3300005289 | Bacteria | 700 |
| 128 | Ga0065712_10250585 | 3300005290 | Bacteria | 957 |
| 129 | Ga0065707_10085375 | 3300005295 | Bacteria | 6202 |
| 130 | Ga0070658_10009563 | 3300005327 | Bacteria | 7783 |
| 131 | Ga0070658_10028610 | 3300005327 | Bacteria | 4475 |
| 132 | Ga0070658_10080132 | 3300005327 | Bacteria | 2682 |
| 133 | Ga0070658_10327550 | 3300005327 | Bacteria | 1308 |
| 134 | Ga0070658_10452422 | 3300005327 | Bacteria | 1106 |
| 135 | Ga0070676_10124788 | 3300005328 | Bacteria | 1620 |
| 136 | Ga0070676_10138541 | 3300005328 | Bacteria | 1546 |
| 137 | Ga0070683_100001966 | 3300005329 | Bacteria | 16104 |
| 138 | Ga0070683_100036898 | 3300005329 | Bacteria | 4472 |
| 139 | Ga0070683_100421886 | 3300005329 | Bacteria | 1273 |
| 140 | Ga0070670_100002397 | 3300005331 | Bacteria | 15444 |
| 141 | Ga0070670_100049854 | 3300005331 | Bacteria | 3599 |
| 142 | Ga0070670_100074892 | 3300005331 | Bacteria | 2908 |
| 143 | Ga0070670_100299937 | 3300005331 | Bacteria | 1405 |
| 144 | Ga0070670_100555591 | 3300005331 | Bacteria | 1024 |
| 145 | Ga0070677_10000523 | 3300005333 | Bacteria | 13180 |
| 146 | Ga0070677_10032192 | 3300005333 | Bacteria | 2009 |
| 147 | Ga0068869_100008423 | 3300005334 | Bacteria | 6649 |
| 148 | Ga0068869_100010764 | 3300005334 | Bacteria | 5975 |
| 149 | Ga0068869_100249632 | 3300005334 | Bacteria | 1417 |
| 150 | Ga0070666_10084706 | 3300005335 | Bacteria | 2170 |
| 151 | Ga0070680_100006104 | 3300005336 | Bacteria | 9131 |
| 152 | Ga0068868_100000004 | 3300005338 | Bacteria | 150718 |
| 153 | Ga0068868_100001107 | 3300005338 | Bacteria | 18443 |
| 154 | Ga0070660_100176833 | 3300005339 | Bacteria | 1726 |
| 155 | Ga0070660_100259759 | 3300005339 | Bacteria | 1418 |
| 156 | Ga0070660_100406251 | 3300005339 | Bacteria | 1126 |
| 157 | Ga0070689_100318277 | 3300005340 | Bacteria | 1298 |
| 158 | Ga0070661_100000006 | 3300005344 | Bacteria | 216544 |
| 159 | Ga0070661_100000994 | 3300005344 | Bacteria | 20120 |
| 160 | Ga0070661_100006933 | 3300005344 | Bacteria | 7821 |
| 161 | Ga0070668_100008742 | 3300005347 | Bacteria | 7522 |
| 162 | Ga0070668_100129046 | 3300005347 | Bacteria | 2028 |
| 163 | Ga0070668_100239734 | 3300005347 | Bacteria | 1502 |
| 164 | Ga0070668_100576965 | 3300005347 | Bacteria | 981 |
| 165 | Ga0070669_100012993 | 3300005353 | Bacteria | 5912 |
| 166 | Ga0070669_100040177 | 3300005353 | Bacteria | 3400 |
| 167 | Ga0070669_100049127 | 3300005353 | Bacteria | 3080 |
| 168 | Ga0070669_100201034 | 3300005353 | Bacteria | 1568 |
| 169 | Ga0070669_100265299 | 3300005353 | Bacteria | 1371 |
| 170 | Ga0070669_100267171 | 3300005353 | Bacteria | 1367 |
| 171 | Ga0070675_100002143 | 3300005354 | Bacteria | 14606 |
| 172 | Ga0070675_100002327 | 3300005354 | Bacteria | 14133 |
| 173 | Ga0070675_100091547 | 3300005354 | Bacteria | 2548 |
| 174 | Ga0070675_100133314 | 3300005354 | Bacteria | 2119 |
| 175 | Ga0070671_100003169 | 3300005355 | Bacteria | 12826 |
| 176 | Ga0070671_100009039 | 3300005355 | Bacteria | 7995 |
| 177 | Ga0070671_100011946 | 3300005355 | Bacteria | 6986 |
| 178 | Ga0070671_100022247 | 3300005355 | Bacteria | 5179 |
| 179 | Ga0070671_100125957 | 3300005355 | Bacteria | 2156 |
| 180 | Ga0070671_100224309 | 3300005355 | Bacteria | 1594 |
| 181 | Ga0070671_100250235 | 3300005355 | Bacteria | 1505 |
| 182 | Ga0070671_100342328 | 3300005355 | Bacteria | 1276 |
| 183 | Ga0070674_100034507 | 3300005356 | Bacteria | 3380 |
| 184 | Ga0070674_100044141 | 3300005356 | Bacteria | 3037 |
| 185 | Ga0070674_100182252 | 3300005356 | Bacteria | 1609 |
| 186 | Ga0070674_100348366 | 3300005356 | Bacteria | 1195 |
| 187 | Ga0070674_100406579 | 3300005356 | Bacteria | 1114 |
| 188 | Ga0070674_100452768 | 3300005356 | Bacteria | 1060 |
| 189 | Ga0070673_100007098 | 3300005364 | Bacteria | 7356 |
| 190 | Ga0070673_100021209 | 3300005364 | Bacteria | 4703 |
| 191 | Ga0070673_100043576 | 3300005364 | Bacteria | 3469 |
| 192 | Ga0070673_100174672 | 3300005364 | Bacteria | 1835 |
| 193 | Ga0070673_100182855 | 3300005364 | Bacteria | 1795 |
| 194 | Ga0070673_100186388 | 3300005364 | Bacteria | 1779 |
| 195 | Ga0070673_100767541 | 3300005364 | Bacteria | 889 |
| 196 | Ga0070688_100473180 | 3300005365 | Bacteria | 941 |
| 197 | Ga0070659_100000929 | 3300005366 | Bacteria | 21500 |
| 198 | Ga0070659_100006995 | 3300005366 | Bacteria | 8167 |
| 199 | Ga0070659_100259547 | 3300005366 | Bacteria | 1441 |
| 200 | Ga0070659_100324528 | 3300005366 | Bacteria | 1287 |
| 201 | Ga0070667_100001557 | 3300005367 | Bacteria | 20558 |
| 202 | Ga0070667_100016942 | 3300005367 | Bacteria | 6030 |
| 203 | Ga0070667_100480287 | 3300005367 | Bacteria | 1138 |
| 204 | Ga0070667_100732944 | 3300005367 | Bacteria | 916 |
| 205 | Ga0070667_100865492 | 3300005367 | Bacteria | 840 |
| 206 | Ga0070714_100089631 | 3300005435 | Bacteria | 2693 |
| 207 | Ga0070713_100089448 | 3300005436 | Bacteria | 2645 |
| 208 | Ga0070713_100501445 | 3300005436 | Bacteria | 1145 |
| 209 | Ga0070713_100858097 | 3300005436 | Bacteria | 872 |
| 210 | Ga0070710_10202944 | 3300005437 | Bacteria | 1253 |
| 211 | Ga0070711_100071388 | 3300005439 | Bacteria | 2447 |
| 212 | Ga0070711_100747873 | 3300005439 | Bacteria | 826 |
| 213 | Ga0070700_100170991 | 3300005441 | Bacteria | 1505 |
| 214 | Ga0070700_100315320 | 3300005441 | Bacteria | 1147 |
| 215 | Ga0070663_100012236 | 3300005455 | Bacteria | 5418 |
| 216 | Ga0070663_100024503 | 3300005455 | Bacteria | 4063 |
| 217 | Ga0070663_100451472 | 3300005455 | Bacteria | 1059 |
| 218 | Ga0070678_100004119 | 3300005456 | Bacteria | 8191 |
| 219 | Ga0070678_100359840 | 3300005456 | Bacteria | 1253 |
| 220 | Ga0070681_10011352 | 3300005458 | Bacteria | 8812 |
| 221 | Ga0070681_10269042 | 3300005458 | Bacteria | 1616 |
| 222 | Ga0068867_100000048 | 3300005459 | Bacteria | 73813 |
| 223 | Ga0068867_100004827 | 3300005459 | Bacteria | 9491 |
| 224 | Ga0068867_100025498 | 3300005459 | Bacteria | 4242 |
| 225 | Ga0068867_100090559 | 3300005459 | Bacteria | 2321 |
| 226 | Ga0068867_100134811 | 3300005459 | Bacteria | 1923 |
| 227 | Ga0068867_100290668 | 3300005459 | Bacteria | 1344 |
| 228 | Ga0070685_10191940 | 3300005466 | Bacteria | 1322 |
| 229 | Ga0070707_100181678 | 3300005468 | Bacteria | 2051 |
| 230 | Ga0070698_100095994 | 3300005471 | Bacteria | 2941 |
| 231 | Ga0070679_100000001 | 3300005530 | Bacteria | 764811 |
| 232 | Ga0070679_100058491 | 3300005530 | Bacteria | 3841 |
| 233 | Ga0070679_100380720 | 3300005530 | Bacteria | 1358 |
| 234 | Ga0070684_100004982 | 3300005535 | Bacteria | 10141 |
| 235 | Ga0068853_100268022 | 3300005539 | Bacteria | 1572 |
| 236 | Ga0068853_100385407 | 3300005539 | Bacteria | 1309 |
| 237 | Ga0070672_100023179 | 3300005543 | Bacteria | 4572 |
| 238 | Ga0070672_100049884 | 3300005543 | Bacteria | 3258 |
| 239 | Ga0070672_100089641 | 3300005543 | Bacteria | 2478 |
| 240 | Ga0070672_100360506 | 3300005543 | Bacteria | 1241 |
| 241 | Ga0070672_100487623 | 3300005543 | Bacteria | 1065 |
| 242 | Ga0070693_100232520 | 3300005547 | Bacteria | 1213 |
| 243 | Ga0070665_100033278 | 3300005548 | Bacteria | 5187 |
| 244 | Ga0070665_100280727 | 3300005548 | Bacteria | 1667 |
| 245 | Ga0070665_100498020 | 3300005548 | Bacteria | 1229 |
| 246 | Ga0068855_100004740 | 3300005563 | Bacteria | 16602 |
| 247 | Ga0068855_100004765 | 3300005563 | Bacteria | 16563 |
| 248 | Ga0068855_100011354 | 3300005563 | Bacteria | 10754 |
| 249 | Ga0068855_100080833 | 3300005563 | Bacteria | 3769 |
| 250 | Ga0068855_100109993 | 3300005563 | Bacteria | 3164 |
| 251 | Ga0068855_100191596 | 3300005563 | Bacteria | 2306 |
| 252 | Ga0068855_100278184 | 3300005563 | Bacteria | 1859 |
| 253 | Ga0068855_100950038 | 3300005563 | Bacteria | 905 |
| 254 | Ga0070664_100000282 | 3300005564 | Bacteria | 36692 |
| 255 | Ga0070664_100019344 | 3300005564 | Bacteria | 5603 |
| 256 | Ga0070664_100038293 | 3300005564 | Bacteria | 4036 |
| 257 | Ga0070664_100061503 | 3300005564 | Bacteria | 3200 |
| 258 | Ga0068857_100016086 | 3300005577 | Bacteria | 6554 |
| 259 | Ga0068857_100114219 | 3300005577 | Bacteria | 2428 |
| 260 | Ga0068857_100292839 | 3300005577 | Bacteria | 1499 |
| 261 | Ga0068857_100405795 | 3300005577 | Bacteria | 1268 |
| 262 | Ga0068854_100064887 | 3300005578 | Bacteria | 2654 |
| 263 | Ga0068854_100186459 | 3300005578 | Bacteria | 1623 |
| 264 | Ga0068856_100034658 | 3300005614 | Bacteria | 4944 |
| 265 | Ga0068856_100128445 | 3300005614 | Bacteria | 2538 |
| 266 | Ga0068856_100646647 | 3300005614 | Bacteria | 1078 |
| 267 | Ga0068856_100728763 | 3300005614 | Bacteria | 1012 |
| 268 | Ga0068852_100000048 | 3300005616 | Bacteria | 87297 |
| 269 | Ga0068852_100004013 | 3300005616 | Bacteria | 10352 |
| 270 | Ga0068852_100018978 | 3300005616 | Bacteria | 5431 |
| 271 | Ga0068852_100109695 | 3300005616 | Bacteria | 2506 |
| 272 | Ga0068852_100127977 | 3300005616 | Bacteria | 2335 |
| 273 | Ga0068852_100155854 | 3300005616 | Bacteria | 2128 |
| 274 | Ga0068852_100314395 | 3300005616 | Bacteria | 1519 |
| 275 | Ga0068852_100443706 | 3300005616 | Bacteria | 1283 |
| 276 | Ga0068852_100574432 | 3300005616 | Bacteria | 1130 |
| 277 | Ga0068852_100945954 | 3300005616 | Bacteria | 879 |
| 278 | Ga0068859_100013690 | 3300005617 | Bacteria | 8132 |
| 279 | Ga0068859_100036992 | 3300005617 | Bacteria | 4900 |
| 280 | Ga0068859_100097644 | 3300005617 | Bacteria | 2991 |
| 281 | Ga0068864_100002769 | 3300005618 | Bacteria | 14470 |
| 282 | Ga0068864_100011909 | 3300005618 | Bacteria | 7183 |
| 283 | Ga0068864_100063454 | 3300005618 | Bacteria | 3201 |
| 284 | Ga0068864_100325041 | 3300005618 | Bacteria | 1445 |
| 285 | Ga0068861_100010229 | 3300005719 | Bacteria | 6512 |
| 286 | Ga0068861_100694602 | 3300005719 | Bacteria | 945 |
| 287 | Ga0068851_10007313 | 3300005834 | Bacteria | 5064 |
| 288 | Ga0068851_10028110 | 3300005834 | Bacteria | 2776 |
| 289 | Ga0068851_10126671 | 3300005834 | Bacteria | 1377 |
| 290 | Ga0068851_10190658 | 3300005834 | Bacteria | 1139 |
| 291 | Ga0068863_100000323 | 3300005841 | Bacteria | 48685 |
| 292 | Ga0068863_100001631 | 3300005841 | Bacteria | 22176 |
| 293 | Ga0068863_100014569 | 3300005841 | Bacteria | 7569 |
| 294 | Ga0068863_100198971 | 3300005841 | Bacteria | 1927 |
| 295 | Ga0068863_100358823 | 3300005841 | Bacteria | 1420 |
| 296 | Ga0068858_100002617 | 3300005842 | Bacteria | 18131 |
| 297 | Ga0068858_100002948 | 3300005842 | Bacteria | 17114 |
| 298 | Ga0068860_100000069 | 3300005843 | Bacteria | 179064 |
| 299 | Ga0068860_100000524 | 3300005843 | Bacteria | 46839 |
| 300 | Ga0068860_100011518 | 3300005843 | Bacteria | 8717 |
| 301 | Ga0068860_100509105 | 3300005843 | Bacteria | 1203 |
| 302 | Ga0068862_100009227 | 3300005844 | Bacteria | 8170 |
| 303 | Ga0068862_100082302 | 3300005844 | Bacteria | 2793 |
| 304 | Ga0070717_10575880 | 3300006028 | Bacteria | 1020 |
| 305 | Ga0075365_10005295 | 3300006038 | Bacteria | 6943 |
| 306 | Ga0075365_10009750 | 3300006038 | Bacteria | 5547 |
| 307 | Ga0075365_10027139 | 3300006038 | Bacteria | 3640 |
| 308 | Ga0075363_100002405 | 3300006048 | Bacteria | 7638 |
| 309 | Ga0075363_100014482 | 3300006048 | Bacteria | 3856 |
| 310 | Ga0075363_100125351 | 3300006048 | Bacteria | 1437 |
| 311 | Ga0075364_10001014 | 3300006051 | Bacteria | 14889 |
| 312 | Ga0075364_10014348 | 3300006051 | Bacteria | 4895 |
| 313 | Ga0075364_10037369 | 3300006051 | Bacteria | 3143 |
| 314 | Ga0075364_10055355 | 3300006051 | Bacteria | 2595 |
| 315 | Ga0075364_10175136 | 3300006051 | Bacteria | 1451 |
| 316 | Ga0075364_10644528 | 3300006051 | Bacteria | 723 |
| 317 | Ga0075432_10021123 | 3300006058 | Bacteria | 2226 |
| 318 | Ga0070712_100003162 | 3300006175 | Bacteria | 10145 |
| 319 | Ga0070712_100063584 | 3300006175 | Bacteria | 2614 |
| 320 | Ga0075362_10003092 | 3300006177 | Bacteria | 5737 |
| 321 | Ga0075362_10045866 | 3300006177 | Bacteria | 1942 |
| 322 | Ga0075367_10018656 | 3300006178 | Bacteria | 3832 |
| 323 | Ga0075367_10044803 | 3300006178 | Bacteria | 2594 |
| 324 | Ga0075369_10019058 | 3300006186 | Bacteria | 2798 |
| 325 | Ga0075369_10219067 | 3300006186 | Bacteria | 881 |
| 326 | Ga0075366_10023990 | 3300006195 | Bacteria | 3556 |
| 327 | Ga0075366_10085752 | 3300006195 | Bacteria | 1884 |
| 328 | Ga0075366_10134051 | 3300006195 | Bacteria | 1495 |
| 329 | Ga0075366_10136681 | 3300006195 | Bacteria | 1480 |
| 330 | Ga0075366_10174826 | 3300006195 | Bacteria | 1303 |
| 331 | Ga0075366_10194514 | 3300006195 | Bacteria | 1233 |
| 332 | Ga0075366_10492522 | 3300006195 | Bacteria | 758 |
| 333 | Ga0097621_100026937 | 3300006237 | Bacteria | 4516 |
| 334 | Ga0097621_100030071 | 3300006237 | Bacteria | 4296 |
| 335 | Ga0097621_100065452 | 3300006237 | Bacteria | 2991 |
| 336 | Ga0075370_10001129 | 3300006353 | Bacteria | 11193 |
| 337 | Ga0075370_10006235 | 3300006353 | Bacteria | 5982 |
| 338 | Ga0075370_10006846 | 3300006353 | Bacteria | 5765 |
| 339 | Ga0075370_10008342 | 3300006353 | Bacteria | 5327 |
| 340 | Ga0075370_10050137 | 3300006353 | Bacteria | 2368 |
| 341 | Ga0068871_100002247 | 3300006358 | Bacteria | 13129 |
| 342 | Ga0068871_100077837 | 3300006358 | Bacteria | 2741 |
| 343 | Ga0068871_100147195 | 3300006358 | Bacteria | 2006 |
| 344 | Ga0068871_100246610 | 3300006358 | Bacteria | 1554 |
| 345 | Ga0068871_100406335 | 3300006358 | Bacteria | 1213 |
| 346 | Ga0075429_100478892 | 3300006880 | Bacteria | 1091 |
| 347 | Ga0075429_100880813 | 3300006880 | Bacteria | 784 |
| 348 | Ga0068865_100076478 | 3300006881 | Bacteria | 2390 |
| 349 | Ga0068865_100145391 | 3300006881 | Bacteria | 1793 |
| 350 | Ga0068865_100153063 | 3300006881 | Bacteria | 1751 |
| 351 | Ga0075436_100554577 | 3300006914 | Bacteria | 844 |
| 352 | Ga0097620_100013690 | 3300006931 | Bacteria | 8132 |
| 353 | Ga0097620_100036992 | 3300006931 | Bacteria | 4900 |
| 354 | Ga0097620_100097647 | 3300006931 | Bacteria | 2991 |
| 355 | Ga0079104_1000007 | 3300006946 | Bacteria | 390531 |
| 356 | Ga0079104_1005881 | 3300006946 | Bacteria | 4778 |
| 357 | Ga0099826_10000132 | 3300006948 | Bacteria | 31946 |
| 358 | Ga0105251_10166054 | 3300009011 | Bacteria | 995 |
| 359 | Ga0105244_10121953 | 3300009036 | Bacteria | 1262 |
| 360 | Ga0105250_10056123 | 3300009092 | Bacteria | 1581 |
| 361 | Ga0105250_10103416 | 3300009092 | Bacteria | 1163 |
| 362 | Ga0105240_10000084 | 3300009093 | Bacteria | 192787 |
| 363 | Ga0105240_10004442 | 3300009093 | Bacteria | 21388 |
| 364 | Ga0105240_10008224 | 3300009093 | Bacteria | 14951 |
| 365 | Ga0105240_10106546 | 3300009093 | Bacteria | 3399 |
| 366 | Ga0105240_10153246 | 3300009093 | Bacteria | 2743 |
| 367 | Ga0105240_10211667 | 3300009093 | Bacteria | 2265 |
| 368 | Ga0105240_10385039 | 3300009093 | Bacteria | 1583 |
| 369 | Ga0105240_11019860 | 3300009093 | Bacteria | 884 |
| 370 | Ga0105240_11265032 | 3300009093 | Bacteria | 779 |
| 371 | Ga0105245_10001510 | 3300009098 | Bacteria | 21074 |
| 372 | Ga0105245_10731934 | 3300009098 | Bacteria | 1024 |
| 373 | Ga0105247_10001822 | 3300009101 | Bacteria | 14946 |
| 374 | Ga0105243_10000005 | 3300009148 | Bacteria | 576265 |
| 375 | Ga0105241_10174653 | 3300009174 | Bacteria | 1777 |
| 376 | Ga0105242_10236947 | 3300009176 | Bacteria | 1638 |
| 377 | Ga0105248_10001008 | 3300009177 | Bacteria | 31117 |
| 378 | Ga0105248_10006497 | 3300009177 | Bacteria | 12823 |
| 379 | Ga0105248_10028876 | 3300009177 | Bacteria | 6183 |
| 380 | Ga0105248_10180654 | 3300009177 | Bacteria | 2378 |
| 381 | Ga0105237_10010106 | 3300009545 | Bacteria | 10062 |
| 382 | Ga0105237_10048803 | 3300009545 | Bacteria | 4255 |
| 383 | Ga0105237_10130578 | 3300009545 | Bacteria | 2506 |
| 384 | Ga0105237_10158718 | 3300009545 | Bacteria | 2259 |
| 385 | Ga0105238_10000113 | 3300009551 | Bacteria | 89675 |
| 386 | Ga0105238_10000160 | 3300009551 | Bacteria | 73564 |
| 387 | Ga0105238_10017512 | 3300009551 | Bacteria | 7285 |
| 388 | Ga0105238_10177187 | 3300009551 | Bacteria | 2109 |
| 389 | Ga0105238_10194328 | 3300009551 | Bacteria | 2005 |
| 390 | Ga0105238_10450889 | 3300009551 | Bacteria | 1283 |
| 391 | Ga0105238_10455046 | 3300009551 | Bacteria | 1277 |
| 392 | Ga0105238_10556574 | 3300009551 | Bacteria | 1152 |
| 393 | Ga0105238_10977881 | 3300009551 | Bacteria | 867 |
| 394 | Ga0105249_10132588 | 3300009553 | Bacteria | 2380 |
| 395 | Ga0105249_11837142 | 3300009553 | Bacteria | 679 |
| 396 | Ga0105239_10000289 | 3300010375 | Bacteria | 74109 |
| 397 | Ga0105239_10003397 | 3300010375 | Bacteria | 19526 |
| 398 | Ga0105246_10000618 | 3300011119 | Bacteria | 19835 |
| 399 | Ga0157373_10147263 | 3300013100 | Bacteria | 1656 |
| 400 | Ga0157371_10548477 | 3300013102 | Bacteria | 857 |
| 401 | Ga0157370_10002535 | 3300013104 | Bacteria | 21958 |
| 402 | Ga0157369_10000334 | 3300013105 | Bacteria | 62941 |
| 403 | Ga0157369_10003357 | 3300013105 | Bacteria | 19001 |
| 404 | Ga0157369_10232759 | 3300013105 | Bacteria | 1926 |
| 405 | Ga0157369_10303725 | 3300013105 | Bacteria | 1660 |
| 406 | Ga0171462_1031 | 3300013250 | Bacteria | 104981 |
| 407 | Ga0157374_10020568 | 3300013296 | Bacteria | 5858 |
| 408 | Ga0157374_10139935 | 3300013296 | Bacteria | 2349 |
| 409 | Ga0157378_10020749 | 3300013297 | Bacteria | 5778 |
| 410 | Ga0157378_10127308 | 3300013297 | Bacteria | 2354 |
| 411 | Ga0163162_10003717 | 3300013306 | Bacteria | 14623 |
| 412 | Ga0163162_10020731 | 3300013306 | Bacteria | 6461 |
| 413 | Ga0163162_10046081 | 3300013306 | Bacteria | 4370 |
| 414 | Ga0163162_10070533 | 3300013306 | Bacteria | 3546 |
| 415 | Ga0163162_10084914 | 3300013306 | Bacteria | 3242 |
| 416 | Ga0163162_10318325 | 3300013306 | Bacteria | 1688 |
| 417 | Ga0157372_10000092 | 3300013307 | Bacteria | 93247 |
| 418 | Ga0157372_10034949 | 3300013307 | Bacteria | 5531 |
| 419 | Ga0157372_10081286 | 3300013307 | Bacteria | 3668 |
| 420 | Ga0157372_10594982 | 3300013307 | Bacteria | 1289 |
| 421 | Ga0157375_10002806 | 3300013308 | Bacteria | 15079 |
| 422 | Ga0157375_10198861 | 3300013308 | Bacteria | 2160 |
| 423 | Ga0157375_10491870 | 3300013308 | Bacteria | 1391 |
| 424 | Ga0157375_10516563 | 3300013308 | Bacteria | 1358 |
| 425 | Ga0163163_10001715 | 3300014325 | Bacteria | 18487 |
| 426 | Ga0163163_10008501 | 3300014325 | Bacteria | 9123 |
| 427 | Ga0163163_10335608 | 3300014325 | Bacteria | 1567 |
| 428 | Ga0182008_10009226 | 3300014497 | Bacteria | 5333 |
| 429 | Ga0182008_10059354 | 3300014497 | Bacteria | 1887 |
| 430 | Ga0182008_10071746 | 3300014497 | Bacteria | 1704 |
| 431 | Ga0182008_10106183 | 3300014497 | Bacteria | 1390 |
| 432 | Ga0157377_10236796 | 3300014745 | Bacteria | 1176 |
| 433 | Ga0157379_10002856 | 3300014968 | Bacteria | 14562 |
| 434 | Ga0157379_10025217 | 3300014968 | Bacteria | 5279 |
| 435 | Ga0157379_10029132 | 3300014968 | Bacteria | 4911 |
| 436 | Ga0157379_10082697 | 3300014968 | Bacteria | 2877 |
| 437 | Ga0157376_10278536 | 3300014969 | Bacteria | 1574 |
| 438 | Ga0157376_10295651 | 3300014969 | Bacteria | 1531 |
| 439 | Ga0182006_1031937 | 3300015261 | Bacteria | 2119 |
| 440 | Ga0182007_10000921 | 3300015262 | Bacteria | 16266 |
| 441 | Ga0182007_10005649 | 3300015262 | Bacteria | 5459 |
| 442 | Ga0182007_10013824 | 3300015262 | Bacteria | 3064 |
| 443 | Ga0182005_1000534 | 3300015265 | Bacteria | 19265 |
| 444 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 445 | Ga0163161_10019141 | 3300017792 | Bacteria | 4800 |
| 446 | Ga0163161_10021781 | 3300017792 | Bacteria | 4507 |
| 447 | Ga0163161_10071729 | 3300017792 | Bacteria | 2535 |
| 448 | Ga0163161_10503648 | 3300017792 | Bacteria | 986 |
| 449 | Ga0213872_10000001 | 3300021361 | Bacteria | 662532 |
| 450 | Ga0213872_10000051 | 3300021361 | Bacteria | 107261 |
| 451 | Ga0213872_10000060 | 3300021361 | Bacteria | 100249 |
| 452 | Ga0213872_10000632 | 3300021361 | Bacteria | 26629 |
| 453 | Ga0213872_10002848 | 3300021361 | Bacteria | 9879 |
| 454 | Ga0213872_10008989 | 3300021361 | Bacteria | 4804 |
| 455 | Ga0213872_10018060 | 3300021361 | Bacteria | 3254 |
| 456 | Ga0213876_10005332 | 3300021384 | Bacteria | 7074 |
| 457 | Ga0213875_10059590 | 3300021388 | Bacteria | 1787 |
| 458 | Ga0209435_100001 | 3300025206 | Bacteria | 1424171 |
| 459 | Ga0209436_100633 | 3300025208 | Bacteria | 15033 |
| 460 | Ga0209436_103318 | 3300025208 | Bacteria | 4334 |
| 461 | Ga0207672_1000282 | 3300025223 | Bacteria | 6890 |
| 462 | Ga0209784_100004 | 3300025224 | Bacteria | 1378156 |
| 463 | Ga0209784_100638 | 3300025224 | Bacteria | 10668 |
| 464 | Ga0209566_100004 | 3300025225 | Bacteria | 1531866 |
| 465 | Ga0209566_100651 | 3300025225 | Bacteria | 20982 |
| 466 | Ga0209674_100006 | 3300025226 | Bacteria | 1531866 |
| 467 | Ga0209674_100160 | 3300025226 | Bacteria | 88210 |
| 468 | Ga0209672_101339 | 3300025228 | Bacteria | 9292 |
| 469 | Ga0209147_100004 | 3300025229 | Bacteria | 1371850 |
| 470 | Ga0209147_100097 | 3300025229 | Bacteria | 164034 |
| 471 | Ga0209147_103938 | 3300025229 | Bacteria | 2647 |
| 472 | Ga0209563_100005 | 3300025230 | Bacteria | 1774893 |
| 473 | Ga0209563_100007 | 3300025230 | Bacteria | 1579402 |
| 474 | Ga0209563_100009 | 3300025230 | Bacteria | 1378156 |
| 475 | Ga0207427_100310 | 3300025231 | Bacteria | 33900 |
| 476 | Ga0207427_112082 | 3300025231 | Bacteria | 868 |
| 477 | Ga0209437_100004 | 3300025233 | Bacteria | 1378156 |
| 478 | Ga0209437_100053 | 3300025233 | Bacteria | 375580 |
| 479 | Ga0209437_100234 | 3300025233 | Bacteria | 92856 |
| 480 | Ga0209437_103429 | 3300025233 | Bacteria | 2875 |
| 481 | Ga0209258_100022 | 3300025242 | Bacteria | 553584 |
| 482 | Ga0209258_100504 | 3300025242 | Bacteria | 38241 |
| 483 | Ga0209258_100720 | 3300025242 | Bacteria | 22119 |
| 484 | Ga0209258_100960 | 3300025242 | Bacteria | 13681 |
| 485 | Ga0207425_1000041 | 3300025245 | Bacteria | 210441 |
| 486 | Ga0207425_1000262 | 3300025245 | Bacteria | 38967 |
| 487 | Ga0207425_1001031 | 3300025245 | Bacteria | 12991 |
| 488 | Ga0207425_1002773 | 3300025245 | Bacteria | 5951 |
| 489 | Ga0207425_1004638 | 3300025245 | Bacteria | 4071 |
| 490 | Ga0207425_1010697 | 3300025245 | Bacteria | 2221 |
| 491 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 492 | Ga0209646_1000019 | 3300025246 | Bacteria | 475248 |
| 493 | Ga0209646_1000103 | 3300025246 | Bacteria | 164034 |
| 494 | Ga0209646_1000109 | 3300025246 | Bacteria | 158348 |
| 495 | Ga0209026_1000001 | 3300025250 | Bacteria | 1228671 |
| 496 | Ga0209026_1000467 | 3300025250 | Bacteria | 31163 |
| 497 | Ga0209026_1005641 | 3300025250 | Bacteria | 3302 |
| 498 | Ga0209677_100005 | 3300025253 | Bacteria | 1378156 |
| 499 | Ga0209677_101739 | 3300025253 | Bacteria | 9066 |
| 500 | Ga0209677_105152 | 3300025253 | Bacteria | 3503 |
| 501 | Ga0209677_109555 | 3300025253 | Bacteria | 1723 |
| 502 | Ga0209148_1000034 | 3300025254 | Bacteria | 553584 |
| 503 | Ga0209148_1000118 | 3300025254 | Bacteria | 188330 |
| 504 | Ga0209148_1002934 | 3300025254 | Bacteria | 5173 |
| 505 | Ga0209148_1006589 | 3300025254 | Bacteria | 2502 |
| 506 | Ga0209148_1016130 | 3300025254 | Bacteria | 1291 |
| 507 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 508 | Ga0209759_1000064 | 3300025256 | Bacteria | 193120 |
| 509 | Ga0209759_1000091 | 3300025256 | Bacteria | 164034 |
| 510 | Ga0209759_1001021 | 3300025256 | Bacteria | 18791 |
| 511 | Ga0209759_1001647 | 3300025256 | Bacteria | 11774 |
| 512 | Ga0209759_1004695 | 3300025256 | Bacteria | 5005 |
| 513 | Ga0209759_1022906 | 3300025256 | Bacteria | 1387 |
| 514 | Ga0209759_1029416 | 3300025256 | Bacteria | 1100 |
| 515 | Ga0209129_1000111 | 3300025258 | Bacteria | 148853 |
| 516 | Ga0209129_1000667 | 3300025258 | Bacteria | 22744 |
| 517 | Ga0209129_1004143 | 3300025258 | Bacteria | 5862 |
| 518 | Ga0209129_1005500 | 3300025258 | Bacteria | 4454 |
| 519 | Ga0209233_1000005 | 3300025261 | Bacteria | 1531866 |
| 520 | Ga0209233_1016765 | 3300025261 | Bacteria | 2011 |
| 521 | Ga0209565_1000017 | 3300025263 | Bacteria | 462438 |
| 522 | Ga0209565_1000028 | 3300025263 | Bacteria | 348536 |
| 523 | Ga0209565_1000040 | 3300025263 | Bacteria | 266543 |
| 524 | Ga0209565_1000110 | 3300025263 | Bacteria | 119879 |
| 525 | Ga0209565_1000673 | 3300025263 | Bacteria | 21605 |
| 526 | Ga0209565_1021834 | 3300025263 | Bacteria | 1332 |
| 527 | Ga0209455_1000043 | 3300025272 | Bacteria | 413928 |
| 528 | Ga0209455_1000128 | 3300025272 | Bacteria | 162413 |
| 529 | Ga0209455_1001018 | 3300025272 | Bacteria | 14039 |
| 530 | Ga0209455_1005410 | 3300025272 | Bacteria | 3950 |
| 531 | Ga0209673_1000007 | 3300025273 | Bacteria | 634477 |
| 532 | Ga0209673_1000035 | 3300025273 | Bacteria | 328411 |
| 533 | Ga0209673_1000109 | 3300025273 | Bacteria | 183000 |
| 534 | Ga0209673_1000175 | 3300025273 | Bacteria | 131239 |
| 535 | Ga0209673_1000664 | 3300025273 | Bacteria | 49941 |
| 536 | Ga0209673_1000944 | 3300025273 | Bacteria | 36333 |
| 537 | Ga0209673_1008587 | 3300025273 | Bacteria | 4533 |
| 538 | Ga0209673_1046346 | 3300025273 | Bacteria | 1187 |
| 539 | Ga0209130_1000118 | 3300025284 | Bacteria | 129005 |
| 540 | Ga0209130_1000156 | 3300025284 | Bacteria | 101929 |
| 541 | Ga0209130_1000205 | 3300025284 | Bacteria | 79260 |
| 542 | Ga0209130_1000231 | 3300025284 | Bacteria | 73279 |
| 543 | Ga0209130_1000332 | 3300025284 | Bacteria | 54263 |
| 544 | Ga0209130_1001496 | 3300025284 | Bacteria | 15119 |
| 545 | Ga0209130_1005762 | 3300025284 | Bacteria | 4196 |
| 546 | Ga0209130_1027397 | 3300025284 | Bacteria | 1211 |
| 547 | Ga0209675_1000009 | 3300025291 | Bacteria | 562872 |
| 548 | Ga0209675_1000024 | 3300025291 | Bacteria | 312615 |
| 549 | Ga0209675_1000111 | 3300025291 | Bacteria | 114805 |
| 550 | Ga0209675_1000677 | 3300025291 | Bacteria | 23818 |
| 551 | Ga0209675_1001309 | 3300025291 | Bacteria | 14763 |
| 552 | Ga0209675_1002194 | 3300025291 | Bacteria | 10241 |
| 553 | Ga0209675_1004947 | 3300025291 | Bacteria | 5748 |
| 554 | Ga0209675_1005028 | 3300025291 | Bacteria | 5666 |
| 555 | Ga0209676_1000005 | 3300025292 | Bacteria | 1076001 |
| 556 | Ga0209676_1000054 | 3300025292 | Bacteria | 365890 |
| 557 | Ga0209676_1000182 | 3300025292 | Bacteria | 146373 |
| 558 | Ga0209676_1000478 | 3300025292 | Bacteria | 65984 |
| 559 | Ga0209676_1001275 | 3300025292 | Bacteria | 26098 |
| 560 | Ga0209676_1001975 | 3300025292 | Bacteria | 16337 |
| 561 | Ga0209676_1003684 | 3300025292 | Bacteria | 9169 |
| 562 | Ga0209676_1030840 | 3300025292 | Bacteria | 1633 |
| 563 | Ga0209676_1040847 | 3300025292 | Bacteria | 1302 |
| 564 | Ga0209025_1000068 | 3300025294 | Bacteria | 294129 |
| 565 | Ga0209025_1000096 | 3300025294 | Bacteria | 239153 |
| 566 | Ga0209025_1000116 | 3300025294 | Bacteria | 218293 |
| 567 | Ga0209025_1000301 | 3300025294 | Bacteria | 110450 |
| 568 | Ga0209025_1000493 | 3300025294 | Bacteria | 75884 |
| 569 | Ga0209025_1002157 | 3300025294 | Bacteria | 21934 |
| 570 | Ga0209025_1009771 | 3300025294 | Bacteria | 6621 |
| 571 | Ga0209025_1010236 | 3300025294 | Bacteria | 6384 |
| 572 | Ga0209025_1027558 | 3300025294 | Bacteria | 2814 |
| 573 | Ga0209025_1039236 | 3300025294 | Bacteria | 2069 |
| 574 | Ga0209025_1089606 | 3300025294 | Bacteria | 1010 |
| 575 | Ga0209564_1000005 | 3300025295 | Bacteria | 1147192 |
| 576 | Ga0209564_1000055 | 3300025295 | Bacteria | 343782 |
| 577 | Ga0209564_1000089 | 3300025295 | Bacteria | 249694 |
| 578 | Ga0209564_1000155 | 3300025295 | Bacteria | 165859 |
| 579 | Ga0209564_1000298 | 3300025295 | Bacteria | 99805 |
| 580 | Ga0209564_1001181 | 3300025295 | Bacteria | 30229 |
| 581 | Ga0209564_1001242 | 3300025295 | Bacteria | 28585 |
| 582 | Ga0209564_1002177 | 3300025295 | Bacteria | 16470 |
| 583 | Ga0209564_1045708 | 3300025295 | Bacteria | 1123 |
| 584 | Ga0209758_1000004 | 3300025297 | Bacteria | 1375322 |
| 585 | Ga0209758_1000107 | 3300025297 | Bacteria | 218293 |
| 586 | Ga0209758_1000625 | 3300025297 | Bacteria | 54181 |
| 587 | Ga0209758_1011921 | 3300025297 | Bacteria | 4949 |
| 588 | Ga0209758_1012663 | 3300025297 | Bacteria | 4692 |
| 589 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 590 | Ga0209050_1000007 | 3300025298 | Bacteria | 1187891 |
| 591 | Ga0209050_1000066 | 3300025298 | Bacteria | 305458 |
| 592 | Ga0209050_1001192 | 3300025298 | Bacteria | 30549 |
| 593 | Ga0209050_1002423 | 3300025298 | Bacteria | 16073 |
| 594 | Ga0209050_1004030 | 3300025298 | Bacteria | 10326 |
| 595 | Ga0209050_1004615 | 3300025298 | Bacteria | 9201 |
| 596 | Ga0209050_1006167 | 3300025298 | Bacteria | 7210 |
| 597 | Ga0209050_1046647 | 3300025298 | Bacteria | 1136 |
| 598 | Ga0209256_1000003 | 3300025299 | Bacteria | 1661127 |
| 599 | Ga0209256_1000038 | 3300025299 | Bacteria | 375225 |
| 600 | Ga0209256_1000078 | 3300025299 | Bacteria | 225992 |
| 601 | Ga0209256_1000087 | 3300025299 | Bacteria | 218290 |
| 602 | Ga0209256_1000559 | 3300025299 | Bacteria | 53325 |
| 603 | Ga0209256_1001512 | 3300025299 | Bacteria | 23519 |
| 604 | Ga0209256_1002806 | 3300025299 | Bacteria | 13344 |
| 605 | Ga0207426_1000090 | 3300025302 | Bacteria | 280662 |
| 606 | Ga0207426_1000123 | 3300025302 | Bacteria | 218290 |
| 607 | Ga0207426_1000197 | 3300025302 | Bacteria | 146366 |
| 608 | Ga0207426_1001904 | 3300025302 | Bacteria | 15119 |
| 609 | Ga0209051_1000009 | 3300025303 | Bacteria | 706778 |
| 610 | Ga0209051_1000044 | 3300025303 | Bacteria | 305458 |
| 611 | Ga0209051_1000092 | 3300025303 | Bacteria | 170056 |
| 612 | Ga0209051_1000115 | 3300025303 | Bacteria | 152010 |
| 613 | Ga0209051_1000191 | 3300025303 | Bacteria | 108763 |
| 614 | Ga0209051_1000598 | 3300025303 | Bacteria | 42554 |
| 615 | Ga0209051_1001071 | 3300025303 | Bacteria | 25392 |
| 616 | Ga0209051_1010665 | 3300025303 | Bacteria | 4610 |
| 617 | Ga0209051_1022825 | 3300025303 | Bacteria | 2622 |
| 618 | Ga0209051_1023358 | 3300025303 | Bacteria | 2574 |
| 619 | Ga0209257_1000011 | 3300025304 | Bacteria | 1112630 |
| 620 | Ga0209257_1000055 | 3300025304 | Bacteria | 415534 |
| 621 | Ga0209257_1000082 | 3300025304 | Bacteria | 305458 |
| 622 | Ga0209257_1000234 | 3300025304 | Bacteria | 129712 |
| 623 | Ga0209257_1000576 | 3300025304 | Bacteria | 61751 |
| 624 | Ga0209257_1000978 | 3300025304 | Bacteria | 38851 |
| 625 | Ga0209257_1001479 | 3300025304 | Bacteria | 27607 |
| 626 | Ga0209257_1004829 | 3300025304 | Bacteria | 9989 |
| 627 | Ga0209257_1005159 | 3300025304 | Bacteria | 9427 |
| 628 | Ga0209257_1005496 | 3300025304 | Bacteria | 8855 |
| 629 | Ga0207697_10016149 | 3300025315 | Bacteria | 3079 |
| 630 | Ga0207656_10006575 | 3300025321 | Bacteria | 4189 |
| 631 | Ga0207656_10070612 | 3300025321 | Bacteria | 1551 |
| 632 | Ga0207656_10084810 | 3300025321 | Bacteria | 1429 |
| 633 | Ga0207696_1010086 | 3300025711 | Bacteria | 3484 |
| 634 | Ga0207696_1060660 | 3300025711 | Bacteria | 1064 |
| 635 | Ga0207655_1000490 | 3300025728 | Bacteria | 50941 |
| 636 | Ga0207655_1001848 | 3300025728 | Bacteria | 18290 |
| 637 | Ga0207655_1032591 | 3300025728 | Bacteria | 2378 |
| 638 | Ga0207713_1023413 | 3300025735 | Bacteria | 2907 |
| 639 | Ga0207713_1043269 | 3300025735 | Bacteria | 1862 |
| 640 | Ga0207710_10000839 | 3300025900 | Bacteria | 16567 |
| 641 | Ga0207710_10138408 | 3300025900 | Bacteria | 1174 |
| 642 | Ga0207680_10011979 | 3300025903 | Bacteria | 4404 |
| 643 | Ga0207699_10282769 | 3300025906 | Bacteria | 1153 |
| 644 | Ga0207645_10004606 | 3300025907 | Bacteria | 10162 |
| 645 | Ga0207645_10074675 | 3300025907 | Bacteria | 2170 |
| 646 | Ga0207645_10085170 | 3300025907 | Bacteria | 2029 |
| 647 | Ga0207705_10000022 | 3300025909 | Bacteria | 302232 |
| 648 | Ga0207705_10011480 | 3300025909 | Bacteria | 6407 |
| 649 | Ga0207705_10054399 | 3300025909 | Bacteria | 2885 |
| 650 | Ga0207705_10058677 | 3300025909 | Bacteria | 2776 |
| 651 | Ga0207705_10225361 | 3300025909 | Bacteria | 1425 |
| 652 | Ga0207705_10232500 | 3300025909 | Bacteria | 1403 |
| 653 | Ga0207654_10000122 | 3300025911 | Bacteria | 50286 |
| 654 | Ga0207654_10072187 | 3300025911 | Bacteria | 2054 |
| 655 | Ga0207654_10111551 | 3300025911 | Bacteria | 1703 |
| 656 | Ga0207707_10020223 | 3300025912 | Bacteria | 5812 |
| 657 | Ga0207707_10768950 | 3300025912 | Bacteria | 804 |
| 658 | Ga0207695_10000115 | 3300025913 | Bacteria | 240394 |
| 659 | Ga0207695_10002097 | 3300025913 | Bacteria | 30292 |
| 660 | Ga0207695_10002265 | 3300025913 | Bacteria | 28809 |
| 661 | Ga0207695_10009870 | 3300025913 | Bacteria | 11730 |
| 662 | Ga0207695_10075283 | 3300025913 | Bacteria | 3435 |
| 663 | Ga0207695_10075549 | 3300025913 | Bacteria | 3428 |
| 664 | Ga0207695_10662262 | 3300025913 | Bacteria | 925 |
| 665 | Ga0207671_10000032 | 3300025914 | Bacteria | 245878 |
| 666 | Ga0207671_10003511 | 3300025914 | Bacteria | 15567 |
| 667 | Ga0207671_10030516 | 3300025914 | Bacteria | 4020 |
| 668 | Ga0207671_10148734 | 3300025914 | Bacteria | 1808 |
| 669 | Ga0207671_10187463 | 3300025914 | Bacteria | 1612 |
| 670 | Ga0207671_10306396 | 3300025914 | Bacteria | 1255 |
| 671 | Ga0207693_10001513 | 3300025915 | Bacteria | 20519 |
| 672 | Ga0207693_10052921 | 3300025915 | Bacteria | 3185 |
| 673 | Ga0207693_10164553 | 3300025915 | Bacteria | 1746 |
| 674 | Ga0207663_10026185 | 3300025916 | Bacteria | 3382 |
| 675 | Ga0207657_10009497 | 3300025919 | Bacteria | 9770 |
| 676 | Ga0207657_10027318 | 3300025919 | Bacteria | 5228 |
| 677 | Ga0207657_10031155 | 3300025919 | Bacteria | 4834 |
| 678 | Ga0207657_10074311 | 3300025919 | Bacteria | 2871 |
| 679 | Ga0207657_10090441 | 3300025919 | Bacteria | 2554 |
| 680 | Ga0207657_10337918 | 3300025919 | Bacteria | 1189 |
| 681 | Ga0207649_10000043 | 3300025920 | Bacteria | 115777 |
| 682 | Ga0207649_10001607 | 3300025920 | Bacteria | 13119 |
| 683 | Ga0207649_10011954 | 3300025920 | Bacteria | 4802 |
| 684 | Ga0207649_10014094 | 3300025920 | Bacteria | 4473 |
| 685 | Ga0207649_10084561 | 3300025920 | Bacteria | 2063 |
| 686 | Ga0207649_10545329 | 3300025920 | Bacteria | 887 |
| 687 | Ga0207652_10000001 | 3300025921 | Bacteria | 1006643 |
| 688 | Ga0207652_10000002 | 3300025921 | Bacteria | 878035 |
| 689 | Ga0207652_10010127 | 3300025921 | Bacteria | 7595 |
| 690 | Ga0207652_10351826 | 3300025921 | Bacteria | 1330 |
| 691 | Ga0207652_10730030 | 3300025921 | Bacteria | 883 |
| 692 | Ga0207694_10000029 | 3300025924 | Bacteria | 239107 |
| 693 | Ga0207694_10000075 | 3300025924 | Bacteria | 114693 |
| 694 | Ga0207694_10044937 | 3300025924 | Bacteria | 3411 |
| 695 | Ga0207694_10223310 | 3300025924 | Bacteria | 1537 |
| 696 | Ga0207694_10355031 | 3300025924 | Bacteria | 1214 |
| 697 | Ga0207694_10801042 | 3300025924 | Bacteria | 796 |
| 698 | Ga0207650_10001122 | 3300025925 | Bacteria | 19719 |
| 699 | Ga0207650_10001617 | 3300025925 | Bacteria | 16075 |
| 700 | Ga0207650_10031834 | 3300025925 | Bacteria | 3812 |
| 701 | Ga0207650_10408127 | 3300025925 | Bacteria | 1125 |
| 702 | Ga0207650_10410813 | 3300025925 | Bacteria | 1122 |
| 703 | Ga0207650_10568842 | 3300025925 | Bacteria | 951 |
| 704 | Ga0207650_10599609 | 3300025925 | Bacteria | 926 |
| 705 | Ga0207650_10958335 | 3300025925 | Bacteria | 727 |
| 706 | Ga0207650_11044370 | 3300025925 | Bacteria | 695 |
| 707 | Ga0207659_10000333 | 3300025926 | Bacteria | 28322 |
| 708 | Ga0207659_10000725 | 3300025926 | Bacteria | 19531 |
| 709 | Ga0207659_10022085 | 3300025926 | Bacteria | 4234 |
| 710 | Ga0207659_10144382 | 3300025926 | Bacteria | 1851 |
| 711 | Ga0207659_10167568 | 3300025926 | Bacteria | 1730 |
| 712 | Ga0207659_10204591 | 3300025926 | Bacteria | 1579 |
| 713 | Ga0207687_10001035 | 3300025927 | Bacteria | 18903 |
| 714 | Ga0207687_10030036 | 3300025927 | Bacteria | 3661 |
| 715 | Ga0207700_10051821 | 3300025928 | Bacteria | 3065 |
| 716 | Ga0207700_10070877 | 3300025928 | Bacteria | 2681 |
| 717 | Ga0207700_10089054 | 3300025928 | Bacteria | 2432 |
| 718 | Ga0207700_10372829 | 3300025928 | Bacteria | 1246 |
| 719 | Ga0207664_10021867 | 3300025929 | Bacteria | 4766 |
| 720 | Ga0207644_10000004 | 3300025931 | Bacteria | 566613 |
| 721 | Ga0207644_10002789 | 3300025931 | Bacteria | 11256 |
| 722 | Ga0207644_10003511 | 3300025931 | Bacteria | 10148 |
| 723 | Ga0207644_10037827 | 3300025931 | Bacteria | 3397 |
| 724 | Ga0207644_10047328 | 3300025931 | Bacteria | 3068 |
| 725 | Ga0207644_10072487 | 3300025931 | Bacteria | 2522 |
| 726 | Ga0207644_10074243 | 3300025931 | Bacteria | 2495 |
| 727 | Ga0207644_10106918 | 3300025931 | Bacteria | 2110 |
| 728 | Ga0207644_10240434 | 3300025931 | Bacteria | 1441 |
| 729 | Ga0207644_10510565 | 3300025931 | Bacteria | 992 |
| 730 | Ga0207690_10001881 | 3300025932 | Bacteria | 12883 |
| 731 | Ga0207690_10004240 | 3300025932 | Bacteria | 8469 |
| 732 | Ga0207690_10017400 | 3300025932 | Bacteria | 4387 |
| 733 | Ga0207690_10068256 | 3300025932 | Bacteria | 2442 |
| 734 | Ga0207690_10076710 | 3300025932 | Bacteria | 2321 |
| 735 | Ga0207690_10283359 | 3300025932 | Bacteria | 1291 |
| 736 | Ga0207706_10003714 | 3300025933 | Bacteria | 14563 |
| 737 | Ga0207706_10388187 | 3300025933 | Bacteria | 1211 |
| 738 | Ga0207686_10001449 | 3300025934 | Bacteria | 13451 |
| 739 | Ga0207686_10039242 | 3300025934 | Bacteria | 2873 |
| 740 | Ga0207686_10169483 | 3300025934 | Bacteria | 1538 |
| 741 | Ga0207686_10275904 | 3300025934 | Bacteria | 1239 |
| 742 | Ga0207686_10328274 | 3300025934 | Bacteria | 1145 |
| 743 | Ga0207709_10000001 | 3300025935 | Bacteria | 2228154 |
| 744 | Ga0207709_10000112 | 3300025935 | Bacteria | 127357 |
| 745 | Ga0207709_10001810 | 3300025935 | Bacteria | 14277 |
| 746 | Ga0207709_10108818 | 3300025935 | Bacteria | 1849 |
| 747 | Ga0207709_10239070 | 3300025935 | Bacteria | 1320 |
| 748 | Ga0207670_10228915 | 3300025936 | Bacteria | 1427 |
| 749 | Ga0207669_10103836 | 3300025937 | Bacteria | 1886 |
| 750 | Ga0207669_10174610 | 3300025937 | Bacteria | 1533 |
| 751 | Ga0207669_10301771 | 3300025937 | Bacteria | 1217 |
| 752 | Ga0207691_10002459 | 3300025940 | Bacteria | 18118 |
| 753 | Ga0207691_10005340 | 3300025940 | Bacteria | 12402 |
| 754 | Ga0207691_10102062 | 3300025940 | Bacteria | 2559 |
| 755 | Ga0207691_10221545 | 3300025940 | Bacteria | 1640 |
| 756 | Ga0207691_10270086 | 3300025940 | Bacteria | 1464 |
| 757 | Ga0207711_10008206 | 3300025941 | Bacteria | 8740 |
| 758 | Ga0207711_10011843 | 3300025941 | Bacteria | 7247 |
| 759 | Ga0207711_10030939 | 3300025941 | Bacteria | 4515 |
| 760 | Ga0207711_10873743 | 3300025941 | Bacteria | 836 |
| 761 | Ga0207689_10002718 | 3300025942 | Bacteria | 16358 |
| 762 | Ga0207689_10023944 | 3300025942 | Bacteria | 5122 |
| 763 | Ga0207689_10031365 | 3300025942 | Bacteria | 4425 |
| 764 | Ga0207689_10079531 | 3300025942 | Bacteria | 2694 |
| 765 | Ga0207689_10197185 | 3300025942 | Bacteria | 1662 |
| 766 | Ga0207689_10563622 | 3300025942 | Bacteria | 957 |
| 767 | Ga0207661_10001150 | 3300025944 | Bacteria | 17677 |
| 768 | Ga0207661_10112065 | 3300025944 | Bacteria | 2309 |
| 769 | Ga0207679_10000225 | 3300025945 | Bacteria | 44668 |
| 770 | Ga0207679_10018810 | 3300025945 | Bacteria | 4634 |
| 771 | Ga0207679_10077585 | 3300025945 | Bacteria | 2528 |
| 772 | Ga0207679_11066314 | 3300025945 | Bacteria | 741 |
| 773 | Ga0207667_10000110 | 3300025949 | Bacteria | 131872 |
| 774 | Ga0207667_10003481 | 3300025949 | Bacteria | 19435 |
| 775 | Ga0207667_10004567 | 3300025949 | Bacteria | 16975 |
| 776 | Ga0207667_10005512 | 3300025949 | Bacteria | 15434 |
| 777 | Ga0207667_10009897 | 3300025949 | Bacteria | 11183 |
| 778 | Ga0207667_10090353 | 3300025949 | Bacteria | 3165 |
| 779 | Ga0207667_10350994 | 3300025949 | Bacteria | 1504 |
| 780 | Ga0207651_10027621 | 3300025960 | Bacteria | 3567 |
| 781 | Ga0207651_10067104 | 3300025960 | Bacteria | 2523 |
| 782 | Ga0207651_10076827 | 3300025960 | Bacteria | 2388 |
| 783 | Ga0207651_10178377 | 3300025960 | Bacteria | 1682 |
| 784 | Ga0207712_10009979 | 3300025961 | Bacteria | 6018 |
| 785 | Ga0207712_10174343 | 3300025961 | Bacteria | 1684 |
| 786 | Ga0207712_10304926 | 3300025961 | Bacteria | 1308 |
| 787 | Ga0207668_10162136 | 3300025972 | Bacteria | 1743 |
| 788 | Ga0207640_10002493 | 3300025981 | Bacteria | 9864 |
| 789 | Ga0207640_10008128 | 3300025981 | Bacteria | 5809 |
| 790 | Ga0207640_10319771 | 3300025981 | Bacteria | 1235 |
| 791 | Ga0207640_10328359 | 3300025981 | Bacteria | 1221 |
| 792 | Ga0207658_10001341 | 3300025986 | Bacteria | 19263 |
| 793 | Ga0207658_10010270 | 3300025986 | Bacteria | 6361 |
| 794 | Ga0207658_10053260 | 3300025986 | Bacteria | 2989 |
| 795 | Ga0207658_10353477 | 3300025986 | Bacteria | 1280 |
| 796 | Ga0207658_10422575 | 3300025986 | Bacteria | 1175 |
| 797 | Ga0207677_10000023 | 3300026023 | Bacteria | 128514 |
| 798 | Ga0207677_10003064 | 3300026023 | Bacteria | 8834 |
| 799 | Ga0207677_10012494 | 3300026023 | Bacteria | 4885 |
| 800 | Ga0207677_10041078 | 3300026023 | Bacteria | 3055 |
| 801 | Ga0207677_10087194 | 3300026023 | Bacteria | 2259 |
| 802 | Ga0207703_10002320 | 3300026035 | Bacteria | 16616 |
| 803 | Ga0207703_10071820 | 3300026035 | Bacteria | 2859 |
| 804 | Ga0207703_10212890 | 3300026035 | Bacteria | 1724 |
| 805 | Ga0207639_10024872 | 3300026041 | Bacteria | 4338 |
| 806 | Ga0207639_10089385 | 3300026041 | Bacteria | 2461 |
| 807 | Ga0207678_10001628 | 3300026067 | Bacteria | 20589 |
| 808 | Ga0207708_10107984 | 3300026075 | Bacteria | 2158 |
| 809 | Ga0207708_10226676 | 3300026075 | Bacteria | 1499 |
| 810 | Ga0207708_10236071 | 3300026075 | Bacteria | 1469 |
| 811 | Ga0207702_10001243 | 3300026078 | Bacteria | 25735 |
| 812 | Ga0207702_10189621 | 3300026078 | Bacteria | 1899 |
| 813 | Ga0207702_10221863 | 3300026078 | Bacteria | 1762 |
| 814 | Ga0207702_10620691 | 3300026078 | Bacteria | 1062 |
| 815 | Ga0207641_10000216 | 3300026088 | Bacteria | 74765 |
| 816 | Ga0207641_10000283 | 3300026088 | Bacteria | 63661 |
| 817 | Ga0207641_10056121 | 3300026088 | Bacteria | 3346 |
| 818 | Ga0207641_10125187 | 3300026088 | Bacteria | 2300 |
| 819 | Ga0207641_10477984 | 3300026088 | Bacteria | 1207 |
| 820 | Ga0207648_10000319 | 3300026089 | Bacteria | 52621 |
| 821 | Ga0207648_10000492 | 3300026089 | Bacteria | 44104 |
| 822 | Ga0207648_10029637 | 3300026089 | Bacteria | 4853 |
| 823 | Ga0207648_10035867 | 3300026089 | Bacteria | 4370 |
| 824 | Ga0207648_10152670 | 3300026089 | Bacteria | 2038 |
| 825 | Ga0207676_10001271 | 3300026095 | Bacteria | 18758 |
| 826 | Ga0207674_10022394 | 3300026116 | Bacteria | 6786 |
| 827 | Ga0207674_10184816 | 3300026116 | Bacteria | 2035 |
| 828 | Ga0207674_10362669 | 3300026116 | Bacteria | 1401 |
| 829 | Ga0207674_11079463 | 3300026116 | Bacteria | 772 |
| 830 | Ga0207675_100007230 | 3300026118 | Bacteria | 10492 |
| 831 | Ga0207675_100712457 | 3300026118 | Bacteria | 1013 |
| 832 | Ga0207683_10005156 | 3300026121 | Bacteria | 11217 |
| 833 | Ga0207683_10006290 | 3300026121 | Bacteria | 10176 |
| 834 | Ga0207683_10036312 | 3300026121 | Bacteria | 4290 |
| 835 | Ga0207683_10099365 | 3300026121 | Bacteria | 2597 |
| 836 | Ga0207683_10121982 | 3300026121 | Bacteria | 2341 |
| 837 | Ga0207683_10407401 | 3300026121 | Bacteria | 1251 |
| 838 | Ga0207683_10984286 | 3300026121 | Bacteria | 783 |
| 839 | Ga0207683_11314589 | 3300026121 | Bacteria | 669 |
| 840 | Ga0207698_10000011 | 3300026142 | Bacteria | 260352 |
| 841 | Ga0207698_10002619 | 3300026142 | Bacteria | 10698 |
| 842 | Ga0207698_10003576 | 3300026142 | Bacteria | 9380 |
| 843 | Ga0207698_10063424 | 3300026142 | Bacteria | 2892 |
| 844 | Ga0207698_10127545 | 3300026142 | Bacteria | 2167 |
| 845 | Ga0207698_10152899 | 3300026142 | Bacteria | 2006 |
| 846 | Ga0207698_10169428 | 3300026142 | Bacteria | 1921 |
| 847 | Ga0207698_10174145 | 3300026142 | Bacteria | 1898 |
| 848 | Ga0207698_10225014 | 3300026142 | Bacteria | 1699 |
| 849 | Ga0207698_10522221 | 3300026142 | Bacteria | 1159 |
| 850 | Ga0209281_1000020 | 3300027111 | Bacteria | 575972 |
| 851 | Ga0209281_1009167 | 3300027111 | Bacteria | 2340 |
| 852 | Ga0209389_1007187 | 3300027296 | Bacteria | 9782 |
| 853 | Ga0209371_1000006 | 3300027312 | Bacteria | 1055642 |
| 854 | Ga0209371_1018881 | 3300027312 | Bacteria | 1738 |
| 855 | Ga0209371_1023446 | 3300027312 | Bacteria | 1453 |
| 856 | Ga0209996_1000765 | 3300027395 | Bacteria | 3822 |
| 857 | Ga0209984_1014278 | 3300027424 | Bacteria | 1047 |
| 858 | Ga0209968_1000652 | 3300027526 | Bacteria | 5356 |
| 859 | Ga0209970_1000415 | 3300027614 | Bacteria | 7224 |
| 860 | Ga0209282_1000127 | 3300027666 | Bacteria | 48767 |
| 861 | Ga0209282_1123307 | 3300027666 | Bacteria | 1292 |
| 862 | Ga0209966_1000005 | 3300027695 | Bacteria | 103734 |
| 863 | Ga0209813_10002725 | 3300027866 | Bacteria | 4070 |
| 864 | Ga0209974_10029328 | 3300027876 | Bacteria | 1822 |
| 865 | Ga0209974_10053136 | 3300027876 | Bacteria | 1364 |
| 866 | Ga0268266_10538720 | 3300028379 | Bacteria | 1117 |
| 867 | Ga0268266_11042751 | 3300028379 | Bacteria | 791 |
| 868 | Ga0268265_10003864 | 3300028380 | Bacteria | 10577 |
| 869 | Ga0268265_10084197 | 3300028380 | Bacteria | 2520 |
| 870 | Ga0268264_10000086 | 3300028381 | Bacteria | 239021 |
| 871 | Ga0268264_10001666 | 3300028381 | Bacteria | 20465 |
| 872 | Ga0268264_10233019 | 3300028381 | Bacteria | 1701 |
| 873 | Ga0268264_10977864 | 3300028381 | Bacteria | 852 |
| 874 | Ga0268264_11198878 | 3300028381 | Bacteria | 769 |
| 875 | Ga0265334_10026852 | 3300028573 | Bacteria | 2322 |
| 876 | Ga0307517_10097661 | 3300028786 | Bacteria | 2343 |
| 877 | Ga0307515_10000459 | 3300028794 | Bacteria | 97482 |
| 878 | Ga0307515_10001963 | 3300028794 | Bacteria | 45524 |
| 879 | Ga0307515_10014710 | 3300028794 | Bacteria | 14482 |
| 880 | Ga0307515_10026050 | 3300028794 | Bacteria | 10085 |
| 881 | Ga0307515_10033350 | 3300028794 | Bacteria | 8483 |
| 882 | Ga0307515_10123381 | 3300028794 | Bacteria | 2914 |
| 883 | Ga0307515_10238926 | 3300028794 | Bacteria | 1592 |
| 884 | Ga0265338_10042032 | 3300028800 | Bacteria | 4265 |
| 885 | Ga0265338_10290040 | 3300028800 | Bacteria | 1193 |
| 886 | Ga0265324_10018140 | 3300029957 | Bacteria | 2552 |
| 887 | Ga0268256_1000007 | 3300030500 | Bacteria | 1055326 |
| 888 | Ga0268256_1025697 | 3300030500 | Bacteria | 1492 |
| 889 | Ga0268256_1026567 | 3300030500 | Bacteria | 1453 |
| 890 | Ga0307512_10113847 | 3300030522 | Bacteria | 1768 |
| 891 | Ga0307512_10310328 | 3300030522 | Bacteria | 726 |
| 892 | Ga0316176_1081397 | 3300030732 | Bacteria | 863 |
| 893 | Ga0314311_1026854 | 3300030733 | Bacteria | 1868 |
| 894 | Ga0316183_1152609 | 3300030742 | Bacteria | 1364 |
| 895 | Ga0316181_1185892 | 3300030744 | Bacteria | 676 |
| 896 | Ga0265760_10021726 | 3300031090 | Bacteria | 1858 |
| 897 | Ga0265330_10000032 | 3300031235 | Bacteria | 130592 |
| 898 | Ga0265332_10000001 | 3300031238 | Bacteria | 863783 |
| 899 | Ga0265332_10000014 | 3300031238 | Bacteria | 249035 |
| 900 | Ga0265332_10008632 | 3300031238 | Bacteria | 4573 |
| 901 | Ga0265320_10006647 | 3300031240 | Bacteria | 7266 |
| 902 | Ga0265320_10025753 | 3300031240 | Bacteria | 3088 |
| 903 | Ga0265325_10017822 | 3300031241 | Bacteria | 3945 |
| 904 | Ga0265340_10071377 | 3300031247 | Bacteria | 1646 |
| 905 | Ga0265340_10072242 | 3300031247 | Bacteria | 1634 |
| 906 | Ga0265339_10229013 | 3300031249 | Bacteria | 906 |
| 907 | Ga0265331_10013807 | 3300031250 | Bacteria | 4330 |
| 908 | Ga0265327_10000028 | 3300031251 | Bacteria | 361066 |
| 909 | Ga0265327_10000842 | 3300031251 | Bacteria | 45767 |
| 910 | Ga0265327_10009661 | 3300031251 | Bacteria | 6919 |
| 911 | Ga0265327_10011906 | 3300031251 | Bacteria | 5935 |
| 912 | Ga0265327_10025911 | 3300031251 | Bacteria | 3408 |
| 913 | Ga0265327_10153951 | 3300031251 | Bacteria | 1066 |
| 914 | Ga0265316_10004128 | 3300031344 | Bacteria | 14537 |
| 915 | Ga0307513_10000006 | 3300031456 | Bacteria | 470848 |
| 916 | Ga0307513_10000011 | 3300031456 | Bacteria | 354929 |
| 917 | Ga0307513_10000433 | 3300031456 | Bacteria | 60335 |
| 918 | Ga0307513_10008993 | 3300031456 | Bacteria | 12672 |
| 919 | Ga0307513_10141275 | 3300031456 | Bacteria | 2334 |
| 920 | Ga0307513_10177890 | 3300031456 | Bacteria | 1995 |
| 921 | Ga0307513_10221498 | 3300031456 | Bacteria | 1713 |
| 922 | Ga0307513_10354415 | 3300031456 | Bacteria | 1214 |
| 923 | Ga0307509_10000120 | 3300031507 | Bacteria | 114238 |
| 924 | Ga0307509_10060404 | 3300031507 | Bacteria | 4007 |
| 925 | Ga0307509_10100657 | 3300031507 | Bacteria | 2927 |
| 926 | Ga0307408_100000046 | 3300031548 | Bacteria | 167686 |
| 927 | Ga0307408_100000048 | 3300031548 | Bacteria | 165579 |
| 928 | Ga0307408_100005071 | 3300031548 | Bacteria | 8838 |
| 929 | Ga0307408_100005727 | 3300031548 | Bacteria | 8282 |
| 930 | Ga0307408_100012484 | 3300031548 | Bacteria | 5630 |
| 931 | Ga0307408_100027533 | 3300031548 | Bacteria | 3918 |
| 932 | Ga0307408_100049122 | 3300031548 | Bacteria | 3029 |
| 933 | Ga0307408_100154703 | 3300031548 | Bacteria | 1814 |
| 934 | Ga0307408_100241318 | 3300031548 | Bacteria | 1485 |
| 935 | Ga0307408_100281943 | 3300031548 | Bacteria | 1384 |
| 936 | Ga0307408_100374721 | 3300031548 | Bacteria | 1215 |
| 937 | Ga0307408_101257036 | 3300031548 | Bacteria | 692 |
| 938 | Ga0307508_10000163 | 3300031616 | Bacteria | 80086 |
| 939 | Ga0307508_10078880 | 3300031616 | Bacteria | 2873 |
| 940 | Ga0307508_10120167 | 3300031616 | Bacteria | 2229 |
| 941 | Ga0307514_10000225 | 3300031649 | Bacteria | 151002 |
| 942 | Ga0307514_10024041 | 3300031649 | Bacteria | 4936 |
| 943 | Ga0265314_10000022 | 3300031711 | Bacteria | 297299 |
| 944 | Ga0265314_10014338 | 3300031711 | Bacteria | 6350 |
| 945 | Ga0265314_10027819 | 3300031711 | Bacteria | 4226 |
| 946 | Ga0265314_10187104 | 3300031711 | Bacteria | 1235 |
| 947 | Ga0307516_10000446 | 3300031730 | Bacteria | 54416 |
| 948 | Ga0307516_10003308 | 3300031730 | Bacteria | 20859 |
| 949 | Ga0307516_10004343 | 3300031730 | Bacteria | 17529 |
| 950 | Ga0307516_10005782 | 3300031730 | Bacteria | 14650 |
| 951 | Ga0307516_10014293 | 3300031730 | Bacteria | 8405 |
| 952 | Ga0307516_10076972 | 3300031730 | Bacteria | 3186 |
| 953 | Ga0307516_10137321 | 3300031730 | Bacteria | 2218 |
| 954 | Ga0307516_10210348 | 3300031730 | Bacteria | 1660 |
| 955 | Ga0307516_10325589 | 3300031730 | Bacteria | 1207 |
| 956 | Ga0307516_10579188 | 3300031730 | Bacteria | 776 |
| 957 | Ga0307405_10042818 | 3300031731 | Bacteria | 2758 |
| 958 | Ga0307405_10108573 | 3300031731 | Bacteria | 1875 |
| 959 | Ga0307405_10749787 | 3300031731 | Bacteria | 813 |
| 960 | Ga0307413_10001777 | 3300031824 | Bacteria | 8441 |
| 961 | Ga0307413_10095542 | 3300031824 | Bacteria | 1949 |
| 962 | Ga0307413_10337263 | 3300031824 | Bacteria | 1158 |
| 963 | Ga0307410_10169218 | 3300031852 | Bacteria | 1645 |
| 964 | Ga0307410_10280996 | 3300031852 | Bacteria | 1306 |
| 965 | Ga0307410_10428096 | 3300031852 | Bacteria | 1075 |
| 966 | Ga0307410_10490870 | 3300031852 | Bacteria | 1009 |
| 967 | Ga0307406_10000575 | 3300031901 | Bacteria | 21150 |
| 968 | Ga0307406_10003389 | 3300031901 | Bacteria | 8685 |
| 969 | Ga0307412_10001140 | 3300031911 | Bacteria | 15222 |
| 970 | Ga0307412_10003407 | 3300031911 | Bacteria | 8831 |
| 971 | Ga0307412_10053482 | 3300031911 | Bacteria | 2676 |
| 972 | Ga0307412_10113530 | 3300031911 | Bacteria | 1938 |
| 973 | Ga0307412_10368830 | 3300031911 | Bacteria | 1158 |
| 974 | Ga0307412_10487675 | 3300031911 | Bacteria | 1023 |
| 975 | Ga0307409_100309358 | 3300031995 | Bacteria | 1474 |
| 976 | Ga0307409_100380848 | 3300031995 | Bacteria | 1341 |
| 977 | Ga0307416_100010513 | 3300032002 | Bacteria | 6117 |
| 978 | Ga0307416_100293906 | 3300032002 | Bacteria | 1610 |
| 979 | Ga0307416_100481892 | 3300032002 | Bacteria | 1301 |
| 980 | Ga0307416_100608617 | 3300032002 | Bacteria | 1173 |
| 981 | Ga0307414_10022421 | 3300032004 | Bacteria | 3982 |
| 982 | Ga0307414_10023710 | 3300032004 | Bacteria | 3897 |
| 983 | Ga0307414_10030245 | 3300032004 | Bacteria | 3535 |
| 984 | Ga0307414_10171863 | 3300032004 | Bacteria | 1733 |
| 985 | Ga0307411_10033683 | 3300032005 | Bacteria | 3179 |
| 986 | Ga0307411_10161100 | 3300032005 | Bacteria | 1680 |
| 987 | Ga0307411_10167987 | 3300032005 | Bacteria | 1651 |
| 988 | Ga0307411_10402030 | 3300032005 | Bacteria | 1132 |
| 989 | Ga0307411_11259227 | 3300032005 | Bacteria | 672 |
| 990 | Ga0307415_100005526 | 3300032126 | Bacteria | 6723 |
| 991 | Ga0307415_100957934 | 3300032126 | Bacteria | 793 |
| 992 | Ga0307507_10074397 | 3300033179 | Bacteria | 3046 |
| 993 | Ga0307507_10293737 | 3300033179 | Bacteria | 1003 |
| 994 | Ga0307510_10002394 | 3300033180 | Bacteria | 21269 |
| 995 | Ga0307510_10052763 | 3300033180 | Bacteria | 4281 |
| 996 | Ga0307510_10137639 | 3300033180 | Bacteria | 2095 |
| 997 | Ga0373926_0002266 | 3300035083 | Bacteria | 6080 |
| 998 | Ga0373936_0244956 | 3300035113 | Bacteria | 799 |
| 999 | Ga0373939_0000004 | 3300035114 | Bacteria | 106519 |
| 1000 | Ga0373939_0016008 | 3300035114 | Bacteria | 1971 |
| 1001 | Ga0373939_0186460 | 3300035114 | Bacteria | 777 |
| 1002 | Ga0373941_0094452 | 3300035115 | Bacteria | 1031 |
| 1003 | Ga0373945_0042844 | 3300035116 | Bacteria | 1641 |
| 1004 | Ga0373957_0077988 | 3300035120 | Bacteria | 1304 |
| 1005 | Ga0373960_0001434 | 3300035121 | Bacteria | 5279 |
| 1006 | Ga0373943_0000102 | 3300035170 | Bacteria | 31578 |
| 1007 | Ga0373943_0027135 | 3300035170 | Bacteria | 2688 |
| 1008 | Ga0373946_0000763 | 3300035171 | Bacteria | 10962 |
| 1009 | Ga0373946_0024658 | 3300035171 | Bacteria | 2359 |
| 1010 | Ga0373946_0028107 | 3300035171 | Bacteria | 2229 |
| 1011 | Ga0373955_0010364 | 3300035172 | Bacteria | 4399 |
| 1012 | Ga0373924_0239035 | 3300035410 | Bacteria | 803 |
| 1013 | Ga0373931_0001005 | 3300035691 | Bacteria | 11928 |
| 1014 | Ga0373935_0005950 | 3300035692 | Bacteria | 7236 |
| 1015 | Ga0373935_0014152 | 3300035692 | Bacteria | 4816 |
| 1016 | Ga0373927_0003194 | 3300035695 | Bacteria | 11808 |
| 1017 | Ga0373927_0013278 | 3300035695 | Bacteria | 5475 |
| 1018 | Ga0373927_0109177 | 3300035695 | Bacteria | 1802 |
| 1019 | Ga0373933_0005427 | 3300035724 | Bacteria | 6939 |
| 1020 | Ga0373947_0002970 | 3300035725 | Bacteria | 10120 |
| 1021 | Ga0373947_0008316 | 3300035725 | Bacteria | 5976 |
| 1022 | Ga0373937_0027556 | 3300036401 | Bacteria | 5138 |
| 1023 | Ga0373925_0001514 | 3300037068 | Bacteria | 19868 |
| 1024 | Ga0373925_0018543 | 3300037068 | Bacteria | 5058 |
| 1025 | Ga0373925_0033277 | 3300037068 | Bacteria | 3799 |
| 1026 | Ga0395899_0001751 | 3300037312 | Bacteria | 18046 |
| 1027 | Ga0395899_0003063 | 3300037312 | Bacteria | 13332 |
| 1028 | Ga0395899_0011805 | 3300037312 | Bacteria | 6686 |
| 1029 | Ga0395899_0032509 | 3300037312 | Bacteria | 3919 |
| 1030 | Ga0395899_0033535 | 3300037312 | Bacteria | 3855 |
| 1031 | Ga0395900_0008788 | 3300037418 | Bacteria | 10380 |
| 1032 | Ga0395900_0009935 | 3300037418 | Bacteria | 9742 |
| 1033 | Ga0395900_0012770 | 3300037418 | Bacteria | 8584 |
| 1034 | Ga0395900_0029682 | 3300037418 | Bacteria | 5610 |
| 1035 | Ga0395900_0079898 | 3300037418 | Bacteria | 3360 |
| 1036 | Ga0395900_0086114 | 3300037418 | Bacteria | 3229 |
| 1037 | Ga0395900_0120862 | 3300037418 | Bacteria | 2687 |
| 1038 | Ga0395900_0130517 | 3300037418 | Bacteria | 2575 |
| 1039 | Ga0395900_0268895 | 3300037418 | Bacteria | 1700 |
| 1040 | Ga0395900_0437272 | 3300037418 | Bacteria | 1266 |
| 1041 | Ga0395900_0449471 | 3300037418 | Bacteria | 1245 |
| 1042 | Ga0395900_0474203 | 3300037418 | Bacteria | 1205 |
| 1043 | Ga0395898_0000337 | 3300037466 | Bacteria | 106044 |
| 1044 | Ga0395898_0014216 | 3300037466 | Bacteria | 8185 |
| 1045 | Ga0395898_0184649 | 3300037466 | Bacteria | 1993 |
| 1046 | Ga0395898_0390742 | 3300037466 | Bacteria | 1326 |
| 1047 | Ga0395905_0000249 | 3300037471 | Bacteria | 80584 |
| 1048 | Ga0395905_0000416 | 3300037471 | Bacteria | 59735 |
| 1049 | Ga0395905_0000704 | 3300037471 | Bacteria | 44377 |
| 1050 | Ga0395905_0003638 | 3300037471 | Bacteria | 16382 |
| 1051 | Ga0395905_0012379 | 3300037471 | Bacteria | 8213 |
| 1052 | Ga0395905_0018706 | 3300037471 | Bacteria | 6571 |
| 1053 | Ga0395905_0024829 | 3300037471 | Bacteria | 5656 |
| 1054 | Ga0395905_0052002 | 3300037471 | Bacteria | 3836 |
| 1055 | Ga0395905_0074093 | 3300037471 | Bacteria | 3190 |
| 1056 | Ga0395905_0087681 | 3300037471 | Bacteria | 2917 |
| 1057 | Ga0395905_0090163 | 3300037471 | Bacteria | 2874 |
| 1058 | Ga0395905_0185233 | 3300037471 | Bacteria | 1954 |
| 1059 | Ga0395905_0261590 | 3300037471 | Bacteria | 1615 |
| 1060 | Ga0395905_0336830 | 3300037471 | Bacteria | 1399 |
| 1061 | Ga0436364_0543976 | 3300037853 | Bacteria | 1192 |
| 1062 | Ga0436364_1388333 | 3300037853 | Bacteria | 18576 |
| 1063 | Ga0395901_0003716 | 3300038443 | Bacteria | 15380 |
| 1064 | Ga0395901_0037770 | 3300038443 | Bacteria | 4994 |
| 1065 | Ga0395901_0044289 | 3300038443 | Bacteria | 4615 |
| 1066 | Ga0395901_0077228 | 3300038443 | Bacteria | 3476 |
| 1067 | Ga0395901_0157318 | 3300038443 | Bacteria | 2387 |
| 1068 | Ga0395901_0311600 | 3300038443 | Bacteria | 1630 |
| 1069 | Ga0395901_1125135 | 3300038443 | Bacteria | 754 |
| 1070 | Ga0436365_0267961 | 3300039437 | Bacteria | 8545 |
| 1071 | Ga0436365_0442834 | 3300039437 | Bacteria | 1389 |
| 1072 | Ga0436365_1653741 | 3300039437 | Bacteria | 3486 |
| 1073 | Ga0436361_0120947 | 3300039447 | Bacteria | 26467 |
| 1074 | Ga0436361_0174260 | 3300039447 | Bacteria | 101834 |
| 1075 | Ga0436361_0287651 | 3300039447 | Bacteria | 35780 |
| 1076 | Ga0436361_0292057 | 3300039447 | Bacteria | 25019 |
| 1077 | Ga0436361_0360722 | 3300039447 | Bacteria | 3555 |
| 1078 | Ga0436361_0457180 | 3300039447 | Bacteria | 5473 |
| 1079 | Ga0436361_0727856 | 3300039447 | Bacteria | 4487 |
| 1080 | Ga0436361_0810743 | 3300039447 | Bacteria | 2785 |
| 1081 | Ga0436361_0829339 | 3300039447 | Bacteria | 5899 |
| 1082 | Ga0436361_0850691 | 3300039447 | Bacteria | 5463 |
| 1083 | Ga0436361_0939166 | 3300039447 | Bacteria | 85026 |
| 1084 | Ga0439436_0051941 | 3300041404 | Bacteria | 1157 |
| 1085 | Ga0439438_042417 | 3300041405 | Bacteria | 1177 |
| 1086 | Ga0439439_0041034 | 3300041406 | Bacteria | 1199 |
| 1087 | Ga0439439_0068984 | 3300041406 | Bacteria | 945 |
| 1088 | Ga0439447_051123 | 3300041407 | Bacteria | 987 |
| 1089 | Ga0439465_0001001 | 3300041413 | Bacteria | 9009 |
| 1090 | Ga0451793_0331504 | 3300041452 | Bacteria | 1356 |
| 1091 | Ga0451802_0500530 | 3300041460 | Bacteria | 2018 |
| 1092 | Ga0451837_0453168 | 3300041494 | Bacteria | 688 |
| 1093 | Ga0439431_0000135 | 3300041997 | Bacteria | 13228 |
| 1094 | Ga0439433_0005311 | 3300041999 | Bacteria | 2767 |
| 1095 | Ga0439448_0134225 | 3300042005 | Bacteria | 854 |
| 1096 | Ga0439432_099548 | 3300042006 | Bacteria | 870 |
| 1097 | Ga0439449_0002755 | 3300042007 | Bacteria | 6839 |
| 1098 | Ga0439449_0011957 | 3300042007 | Bacteria | 3262 |
| 1099 | Ga0439451_000253 | 3300042009 | Bacteria | 10322 |
| 1100 | Ga0439456_015159 | 3300042013 | Bacteria | 1609 |
| 1101 | Ga0439462_0042294 | 3300042015 | Bacteria | 1217 |
| 1102 | Ga0450911_000860 | 3300042115 | Bacteria | 8275 |
| 1103 | Ga0450915_006225 | 3300042119 | Bacteria | 755 |
| 1104 | Ga0450917_001159 | 3300042120 | Bacteria | 1921 |
| 1105 | Ga0450888_000211 | 3300042126 | Bacteria | 5225 |
| 1106 | Ga0450890_002103 | 3300042127 | Bacteria | 2792 |
| 1107 | Ga0450890_002841 | 3300042127 | Bacteria | 2344 |
| 1108 | Ga0450891_002311 | 3300042129 | Bacteria | 1929 |
| 1109 | Ga0450892_000342 | 3300042130 | Bacteria | 5523 |
| 1110 | Ga0450898_008464 | 3300042134 | Bacteria | 1624 |
| 1111 | Ga0450889_000406 | 3300042144 | Bacteria | 4808 |
| 1112 | Ga0439434_0030089 | 3300042435 | Bacteria | 1647 |
| 1113 | Ga0439459_0000732 | 3300042438 | Bacteria | 4495 |
| 1114 | Ga0439464_0009922 | 3300042439 | Bacteria | 2511 |
| 1115 | Ga0450893_0003052 | 3300042532 | Bacteria | 2634 |
| 1116 | Ga0450893_0027811 | 3300042532 | Bacteria | 998 |
| 1117 | Ga0451577_0007579 | 3300042876 | Bacteria | 10645 |
| 1118 | Ga0451577_0012178 | 3300042876 | Bacteria | 8086 |
| 1119 | Ga0451577_0014424 | 3300042876 | Bacteria | 7368 |
| 1120 | Ga0451577_0254152 | 3300042876 | Bacteria | 1591 |
| 1121 | Ga0466969_0014612 | 3300044656 | Bacteria | 4127 |
| 1122 | Ga0453683_0001511 | 3300044673 | Bacteria | 19858 |
| 1123 | Ga0453683_0040629 | 3300044673 | Bacteria | 2920 |
| 1124 | Ga0453683_0151115 | 3300044673 | Bacteria | 1467 |
| 1125 | Ga0466965_0004319 | 3300044683 | Bacteria | 6313 |
| 1126 | Ga0466966_0016505 | 3300044684 | Bacteria | 4876 |
| 1127 | Ga0466966_0058836 | 3300044684 | Bacteria | 2428 |
| 1128 | Ga0466966_0075667 | 3300044684 | Bacteria | 2103 |
| 1129 | Ga0466966_0153289 | 3300044684 | Bacteria | 1404 |
| 1130 | Ga0466961_0013324 | 3300044693 | Bacteria | 5263 |
| 1131 | Ga0466961_0116803 | 3300044693 | Bacteria | 1676 |
| 1132 | Ga0466961_0196671 | 3300044693 | Bacteria | 1248 |
| 1133 | Ga0453684_0000126 | 3300044712 | Bacteria | 336395 |
| 1134 | Ga0453684_0713817 | 3300044712 | Bacteria | 1088 |
| 1135 | Ga0466957_0109818 | 3300044842 | Bacteria | 1748 |
| 1136 | Ga0466960_0266513 | 3300044901 | Bacteria | 956 |
| 1137 | Ga0466959_0065867 | 3300045049 | Bacteria | 2628 |
| 1138 | Ga0466959_0097689 | 3300045049 | Bacteria | 2104 |
| 1139 | Ga0451576_0009548 | 3300045051 | Bacteria | 11238 |
| 1140 | Ga0451576_0030419 | 3300045051 | Bacteria | 5770 |
| 1141 | Ga0451576_0065938 | 3300045051 | Bacteria | 3769 |
| 1142 | Ga0466967_0066727 | 3300045976 | Bacteria | 3207 |
| 1143 | Ga0495592_0005124 | 3300046454 | Bacteria | 9653 |
| 1144 | Ga0495592_0033858 | 3300046454 | Bacteria | 3853 |
| 1145 | Ga0495603_0012974 | 3300046455 | Bacteria | 5038 |
| 1146 | Ga0495603_0030464 | 3300046455 | Bacteria | 3249 |
| 1147 | Ga0495629_0001156 | 3300046459 | Bacteria | 20848 |
| 1148 | Ga0495629_0052790 | 3300046459 | Bacteria | 2844 |
| 1149 | Ga0495629_0080113 | 3300046459 | Bacteria | 2280 |
| 1150 | Ga0495651_0000976 | 3300046462 | Bacteria | 22172 |
| 1151 | Ga0495651_0014296 | 3300046462 | Bacteria | 6135 |
| 1152 | Ga0495651_0056416 | 3300046462 | Bacteria | 3017 |
| 1153 | Ga0495653_0002352 | 3300046463 | Bacteria | 15015 |
| 1154 | Ga0495653_0007349 | 3300046463 | Bacteria | 9024 |
| 1155 | Ga0495653_0036253 | 3300046463 | Bacteria | 3885 |
| 1156 | Ga0495650_0000224 | 3300046471 | Bacteria | 118058 |
| 1157 | Ga0495650_0047032 | 3300046471 | Bacteria | 1807 |
| 1158 | Ga0495580_0095758 | 3300046472 | Bacteria | 2065 |
| 1159 | Ga0495582_0158586 | 3300046473 | Bacteria | 1286 |
| 1160 | Ga0495582_0400906 | 3300046473 | Bacteria | 791 |
| 1161 | Ga0495639_0003038 | 3300046475 | Bacteria | 7306 |
| 1162 | Ga0495639_0011256 | 3300046475 | Bacteria | 3854 |
| 1163 | Ga0495662_0001205 | 3300046476 | Bacteria | 12769 |
| 1164 | Ga0495664_0000600 | 3300046477 | Bacteria | 18276 |
| 1165 | Ga0495664_0187161 | 3300046477 | Bacteria | 1255 |
| 1166 | Ga0495584_0088564 | 3300046491 | Bacteria | 1560 |
| 1167 | Ga0495585_0000102 | 3300046492 | Bacteria | 91414 |
| 1168 | Ga0495585_0004598 | 3300046492 | Bacteria | 8919 |
| 1169 | Ga0495585_0007926 | 3300046492 | Bacteria | 6458 |
| 1170 | Ga0495594_0005917 | 3300046499 | Bacteria | 6285 |
| 1171 | Ga0495594_0028138 | 3300046499 | Bacteria | 3031 |
| 1172 | Ga0495594_0120239 | 3300046499 | Bacteria | 1484 |
| 1173 | Ga0495607_0008021 | 3300046501 | Bacteria | 7251 |
| 1174 | Ga0495607_0021370 | 3300046501 | Bacteria | 4073 |
| 1175 | Ga0495583_0000127 | 3300046506 | Bacteria | 127780 |
| 1176 | Ga0495606_0000001 | 3300046507 | Bacteria | 592123 |
| 1177 | Ga0495606_0008822 | 3300046507 | Bacteria | 8647 |
| 1178 | Ga0495608_0002654 | 3300046511 | Bacteria | 12846 |
| 1179 | Ga0495608_0004989 | 3300046511 | Bacteria | 9503 |
| 1180 | Ga0495608_0307865 | 3300046511 | Bacteria | 980 |
| 1181 | Ga0495610_0004596 | 3300046512 | Bacteria | 10125 |
| 1182 | Ga0495610_0011303 | 3300046512 | Bacteria | 5467 |
| 1183 | Ga0495616_0000184 | 3300046513 | Bacteria | 52694 |
| 1184 | Ga0495616_0005947 | 3300046513 | Bacteria | 7441 |
| 1185 | Ga0495616_0094813 | 3300046513 | Bacteria | 1407 |
| 1186 | Ga0495618_0005805 | 3300046514 | Bacteria | 7504 |
| 1187 | Ga0495618_0029268 | 3300046514 | Bacteria | 3435 |
| 1188 | Ga0495618_0131487 | 3300046514 | Bacteria | 1601 |
| 1189 | Ga0495618_0284887 | 3300046514 | Bacteria | 1030 |
| 1190 | Ga0495620_0048787 | 3300046515 | Bacteria | 1815 |
| 1191 | Ga0495628_0008815 | 3300046516 | Bacteria | 8632 |
| 1192 | Ga0495628_0013432 | 3300046516 | Bacteria | 6889 |
| 1193 | Ga0495628_0125817 | 3300046516 | Bacteria | 1964 |
| 1194 | Ga0495628_0483126 | 3300046516 | Bacteria | 896 |
| 1195 | Ga0495630_0005764 | 3300046517 | Bacteria | 8754 |
| 1196 | Ga0495630_0031440 | 3300046517 | Bacteria | 3953 |
| 1197 | Ga0495630_0670853 | 3300046517 | Bacteria | 793 |
| 1198 | Ga0495632_0000081 | 3300046519 | Bacteria | 99136 |
| 1199 | Ga0495632_0030420 | 3300046519 | Bacteria | 2802 |
| 1200 | Ga0495632_0030570 | 3300046519 | Bacteria | 2794 |
| 1201 | Ga0495637_0023019 | 3300046520 | Bacteria | 2836 |
| 1202 | Ga0495643_0000630 | 3300046522 | Bacteria | 41718 |
| 1203 | Ga0495643_0001320 | 3300046522 | Bacteria | 23471 |
| 1204 | Ga0495643_0056018 | 3300046522 | Bacteria | 2105 |
| 1205 | Ga0495643_0126760 | 3300046522 | Bacteria | 1285 |
| 1206 | Ga0495648_0061322 | 3300046524 | Bacteria | 2234 |
| 1207 | Ga0495648_0085982 | 3300046524 | Bacteria | 1775 |
| 1208 | Ga0495663_0033616 | 3300046525 | Bacteria | 1532 |
| 1209 | Ga0495666_0030665 | 3300046526 | Bacteria | 2637 |
| 1210 | Ga0495642_0002999 | 3300046528 | Bacteria | 6728 |
| 1211 | Ga0495652_0004595 | 3300046529 | Bacteria | 13160 |
| 1212 | Ga0495652_0019591 | 3300046529 | Bacteria | 6023 |
| 1213 | Ga0495652_0023823 | 3300046529 | Bacteria | 5423 |
| 1214 | Ga0495652_0027916 | 3300046529 | Bacteria | 4971 |
| 1215 | Ga0495652_0092105 | 3300046529 | Bacteria | 2477 |
| 1216 | Ga0495665_0016891 | 3300046531 | Bacteria | 3929 |
| 1217 | Ga0495665_0136570 | 3300046531 | Bacteria | 1282 |
| 1218 | Ga0495640_0002848 | 3300046533 | Bacteria | 13917 |
| 1219 | Ga0495640_0003109 | 3300046533 | Bacteria | 13396 |
| 1220 | Ga0495640_0093329 | 3300046533 | Bacteria | 1983 |
| 1221 | Ga0495586_0036434 | 3300046535 | Bacteria | 2640 |
| 1222 | Ga0495586_0307160 | 3300046535 | Bacteria | 909 |
| 1223 | Ga0495587_0000911 | 3300046536 | Bacteria | 19535 |
| 1224 | Ga0495587_0051847 | 3300046536 | Bacteria | 2423 |
| 1225 | Ga0495609_0000039 | 3300046538 | Bacteria | 179384 |
| 1226 | Ga0495621_0045216 | 3300046539 | Bacteria | 1559 |
| 1227 | Ga0495621_0119144 | 3300046539 | Bacteria | 1019 |
| 1228 | Ga0495597_0000251 | 3300046542 | Bacteria | 48899 |
| 1229 | Ga0495597_0000514 | 3300046542 | Bacteria | 32036 |
| 1230 | Ga0495597_0002116 | 3300046542 | Bacteria | 13162 |
| 1231 | Ga0495645_0010920 | 3300046543 | Bacteria | 6381 |
| 1232 | Ga0495645_0036308 | 3300046543 | Bacteria | 3592 |
| 1233 | Ga0495645_0072307 | 3300046543 | Bacteria | 2485 |
| 1234 | Ga0495645_0169277 | 3300046543 | Bacteria | 1504 |
| 1235 | Ga0495645_0289206 | 3300046543 | Bacteria | 1075 |
| 1236 | Ga0495622_0011733 | 3300046557 | Bacteria | 4051 |
| 1237 | Ga0495633_0001747 | 3300046558 | Bacteria | 16154 |
| 1238 | Ga0495633_0002178 | 3300046558 | Bacteria | 14050 |
| 1239 | Ga0495633_0066789 | 3300046558 | Bacteria | 1679 |
| 1240 | Ga0495667_0013049 | 3300046559 | Bacteria | 5627 |
| 1241 | Ga0495656_0000072 | 3300046615 | Bacteria | 45119 |
| 1242 | Ga0495668_0000285 | 3300046616 | Bacteria | 70023 |
| 1243 | Ga0495668_0001521 | 3300046616 | Bacteria | 22039 |
| 1244 | Ga0495634_0004529 | 3300046642 | Bacteria | 10883 |
| 1245 | Ga0495634_0014172 | 3300046642 | Bacteria | 5752 |
| 1246 | Ga0495634_0054769 | 3300046642 | Bacteria | 2668 |
| 1247 | Ga0495611_0006200 | 3300046648 | Bacteria | 5101 |
| 1248 | Ga0495611_0167124 | 3300046648 | Bacteria | 1028 |
| 1249 | Ga0495625_0000877 | 3300046660 | Bacteria | 40871 |
| 1250 | Ga0495625_0023894 | 3300046660 | Bacteria | 4661 |
| 1251 | Ga0495625_0027726 | 3300046660 | Bacteria | 4256 |
| 1252 | Ga0495625_0054015 | 3300046660 | Bacteria | 2870 |
| 1253 | Ga0495625_0112635 | 3300046660 | Bacteria | 1858 |
| 1254 | Ga0495635_0014561 | 3300046663 | Bacteria | 5501 |
| 1255 | Ga0495635_0025468 | 3300046663 | Bacteria | 4121 |
| 1256 | Ga0495635_0033601 | 3300046663 | Bacteria | 3558 |
| 1257 | Ga0495635_0043108 | 3300046663 | Bacteria | 3114 |
| 1258 | Ga0495635_0187482 | 3300046663 | Bacteria | 1405 |
| 1259 | Ga0495635_0409522 | 3300046663 | Bacteria | 900 |
| 1260 | Ga0495659_0011166 | 3300046664 | Bacteria | 2893 |
| 1261 | Ga0495661_0000094 | 3300046665 | Bacteria | 109394 |
| 1262 | Ga0495661_0021839 | 3300046665 | Bacteria | 4166 |
| 1263 | Ga0495661_0035155 | 3300046665 | Bacteria | 3147 |
| 1264 | Ga0495661_0049153 | 3300046665 | Bacteria | 2559 |
| 1265 | Ga0495588_0054750 | 3300046674 | Bacteria | 2058 |
| 1266 | Ga0495588_0095435 | 3300046674 | Bacteria | 1559 |
| 1267 | Ga0495657_0139398 | 3300046675 | Bacteria | 1513 |
| 1268 | Ga0495599_0021832 | 3300046678 | Bacteria | 3996 |
| 1269 | Ga0495623_0003590 | 3300046679 | Bacteria | 10258 |
| 1270 | Ga0495623_0015491 | 3300046679 | Bacteria | 4928 |
| 1271 | Ga0495623_0047779 | 3300046679 | Bacteria | 2716 |
| 1272 | Ga0495646_0001661 | 3300046680 | Bacteria | 13293 |
| 1273 | Ga0495646_0002551 | 3300046680 | Bacteria | 11188 |
| 1274 | Ga0495646_0066311 | 3300046680 | Bacteria | 2135 |
| 1275 | Ga0495646_0279299 | 3300046680 | Bacteria | 888 |
| 1276 | Ga0495658_0025453 | 3300046683 | Bacteria | 3163 |
| 1277 | Ga0495658_0228703 | 3300046683 | Bacteria | 1166 |
| 1278 | Ga0495669_0000164 | 3300046684 | Bacteria | 42542 |
| 1279 | Ga0495613_0023024 | 3300046689 | Bacteria | 4642 |
| 1280 | Ga0495613_0026725 | 3300046689 | Bacteria | 4299 |
| 1281 | Ga0495624_0004448 | 3300046690 | Bacteria | 10256 |
| 1282 | Ga0495624_0005580 | 3300046690 | Bacteria | 9047 |
| 1283 | Ga0495670_0038087 | 3300046691 | Bacteria | 2397 |
| 1284 | Ga0495649_0001564 | 3300046694 | Bacteria | 17171 |
| 1285 | Ga0495649_0121797 | 3300046694 | Bacteria | 1379 |
| 1286 | Ga0495589_0000019 | 3300046794 | Bacteria | 200814 |
| 1287 | Ga0495589_0001712 | 3300046794 | Bacteria | 12483 |
| 1288 | Ga0495589_0110138 | 3300046794 | Bacteria | 1329 |
| 1289 | Ga0495600_0003478 | 3300046809 | Bacteria | 9261 |
| 1290 | Ga0495600_0006775 | 3300046809 | Bacteria | 6987 |
| 1291 | Ga0495660_0090374 | 3300046810 | Bacteria | 1592 |
| 1292 | Ga0495581_0087492 | 3300047315 | Bacteria | 1806 |
| 1293 | Ga0495581_0272960 | 3300047315 | Bacteria | 988 |
| 1294 | Ga0495604_0001863 | 3300047317 | Bacteria | 17177 |
| 1295 | Ga0495604_0013119 | 3300047317 | Bacteria | 6601 |
| 1296 | Ga0495604_0030390 | 3300047317 | Bacteria | 4290 |
| 1297 | Ga0495604_0255656 | 3300047317 | Bacteria | 1192 |
| 1298 | Ga0495604_0344532 | 3300047317 | Bacteria | 991 |
| 1299 | Ga0495636_0012076 | 3300047318 | Bacteria | 3423 |
| 1300 | Ga0495674_0001578 | 3300047319 | Bacteria | 22344 |
| 1301 | Ga0495674_0004086 | 3300047319 | Bacteria | 14114 |
| 1302 | Ga0495674_0025320 | 3300047319 | Bacteria | 5441 |
| 1303 | Ga0495672_0001684 | 3300047320 | Bacteria | 21407 |
| 1304 | Ga0495672_0018332 | 3300047320 | Bacteria | 4651 |
| 1305 | Ga0495672_0021435 | 3300047320 | Bacteria | 4215 |
| 1306 | Ga0495676_0007228 | 3300047321 | Bacteria | 10184 |
| 1307 | Ga0495676_0007289 | 3300047321 | Bacteria | 10143 |
| 1308 | Ga0495676_0016920 | 3300047321 | Bacteria | 6456 |
| 1309 | Ga0495676_0100509 | 3300047321 | Bacteria | 2141 |
| 1310 | Ga0495676_0316428 | 3300047321 | Bacteria | 1049 |
| 1311 | Ga0495680_0003432 | 3300047322 | Bacteria | 15646 |
| 1312 | Ga0495680_0041286 | 3300047322 | Bacteria | 3670 |
| 1313 | Ga0495683_0139536 | 3300047323 | Bacteria | 1137 |
| 1314 | Ga0495687_000059 | 3300047443 | Bacteria | 179357 |
| 1315 | Ga0495687_011487 | 3300047443 | Bacteria | 4755 |
| 1316 | Ga0495675_0103322 | 3300047444 | Bacteria | 1782 |
| 1317 | Ga0495675_0286106 | 3300047444 | Bacteria | 982 |
| 1318 | Ga0495677_0000006 | 3300047445 | Bacteria | 199230 |
| 1319 | Ga0495685_013611 | 3300047447 | Bacteria | 2761 |
| 1320 | Ga0495681_0003047 | 3300047470 | Bacteria | 11774 |
| 1321 | Ga0495681_0064113 | 3300047470 | Bacteria | 1684 |
| 1322 | Ga0495684_0013069 | 3300047471 | Bacteria | 6408 |
| 1323 | Ga0495684_0021915 | 3300047471 | Bacteria | 4919 |
| 1324 | Ga0495686_0006497 | 3300047472 | Bacteria | 8936 |
| 1325 | Ga0495686_0010836 | 3300047472 | Bacteria | 6461 |
| 1326 | Ga0495686_0017129 | 3300047472 | Bacteria | 4891 |
| 1327 | Ga0495593_0090265 | 3300047673 | Bacteria | 1578 |
| 1328 | Ga0495602_0006678 | 3300048088 | Bacteria | 12091 |
| 1329 | Ga0495602_0029352 | 3300048088 | Bacteria | 5239 |
| 1330 | Ga0495614_0006650 | 3300048089 | Bacteria | 5177 |
| 1331 | Ga0495626_0000494 | 3300048091 | Bacteria | 39727 |
| 1332 | Ga0495626_0000821 | 3300048091 | Bacteria | 27909 |
| 1333 | Ga0495626_0001165 | 3300048091 | Bacteria | 21902 |
| 1334 | Ga0495626_0001278 | 3300048091 | Bacteria | 20542 |
| 1335 | Ga0496101_0009683 | 3300048904 | Bacteria | 6341 |
| 1336 | Ga0496102_0037805 | 3300048905 | Bacteria | 4355 |
| 1337 | Ga0496102_0946470 | 3300048905 | Bacteria | 782 |
| 1338 | Ga0496102_0997117 | 3300048905 | Bacteria | 758 |
| 1339 | Ga0496103_0032658 | 3300048906 | Bacteria | 3177 |
| 1340 | Ga0496103_0170893 | 3300048906 | Bacteria | 1396 |
| 1341 | Ga0496104_0003204 | 3300048907 | Bacteria | 14068 |
| 1342 | Ga0496104_0086164 | 3300048907 | Bacteria | 2999 |
| 1343 | Ga0496104_0157257 | 3300048907 | Bacteria | 2181 |
| 1344 | Ga0496104_0305695 | 3300048907 | Bacteria | 1503 |
| 1345 | Ga0496105_0003462 | 3300048908 | Bacteria | 11674 |
| 1346 | Ga0496105_0025378 | 3300048908 | Bacteria | 4825 |
| 1347 | Ga0496105_0072207 | 3300048908 | Bacteria | 2852 |
| 1348 | Ga0496105_0093421 | 3300048908 | Bacteria | 2484 |
| 1349 | Ga0496107_0020407 | 3300048910 | Bacteria | 4680 |
| 1350 | Ga0496107_0521993 | 3300048910 | Bacteria | 880 |
| 1351 | Ga0496107_0728200 | 3300048910 | Bacteria | 729 |
| 1352 | Ga0496108_0114489 | 3300048911 | Bacteria | 2309 |
| 1353 | Ga0496108_0309879 | 3300048911 | Bacteria | 1375 |
| 1354 | Ga0496109_0100430 | 3300048912 | Bacteria | 2684 |
| 1355 | Ga0496109_0337033 | 3300048912 | Bacteria | 1424 |
| 1356 | Ga0496110_0054927 | 3300048913 | Bacteria | 3503 |
| 1357 | Ga0496110_0907212 | 3300048913 | Bacteria | 787 |
| 1358 | Ga0496111_0030956 | 3300048914 | Bacteria | 3808 |
| 1359 | Ga0496111_0044917 | 3300048914 | Bacteria | 3176 |
| 1360 | Ga0496112_0150025 | 3300048915 | Bacteria | 2298 |
| 1361 | Ga0496112_0213950 | 3300048915 | Bacteria | 1884 |
| 1362 | Ga0496113_0012960 | 3300048916 | Bacteria | 5624 |
| 1363 | Ga0496114_0686916 | 3300048917 | Bacteria | 898 |
| 1364 | Ga0496115_0284153 | 3300048918 | Bacteria | 1358 |
| 1365 | Ga0496116_0033181 | 3300048919 | Bacteria | 3666 |
| 1366 | Ga0496116_0036895 | 3300048919 | Bacteria | 3415 |
| 1367 | Ga0496116_0052530 | 3300048919 | Bacteria | 2699 |
| 1368 | Ga0496117_0024823 | 3300048920 | Bacteria | 4727 |
| 1369 | Ga0496118_0011398 | 3300048921 | Bacteria | 8681 |
| 1370 | Ga0496119_0012065 | 3300048922 | Bacteria | 7062 |
| 1371 | Ga0496119_0018999 | 3300048922 | Bacteria | 5086 |
| 1372 | Ga0496121_0000567 | 3300048924 | Bacteria | 69706 |
| 1373 | Ga0496121_0006746 | 3300048924 | Bacteria | 14087 |
| 1374 | Ga0496121_0012939 | 3300048924 | Bacteria | 9020 |
| 1375 | Ga0496121_0026546 | 3300048924 | Bacteria | 5452 |
| 1376 | Ga0496121_0028452 | 3300048924 | Bacteria | 5201 |
| 1377 | Ga0496121_0036698 | 3300048924 | Bacteria | 4364 |
| 1378 | Ga0496121_0167049 | 3300048924 | Bacteria | 1602 |
| 1379 | Ga0496122_0000644 | 3300048925 | Bacteria | 70937 |
| 1380 | Ga0496122_0005337 | 3300048925 | Bacteria | 15366 |
| 1381 | Ga0496122_0196473 | 3300048925 | Bacteria | 1184 |
| 1382 | Ga0496123_0000057 | 3300048926 | Bacteria | 228608 |
| 1383 | Ga0496123_0000203 | 3300048926 | Bacteria | 121361 |
| 1384 | Ga0496123_0034513 | 3300048926 | Bacteria | 3622 |
| 1385 | Ga0496124_0000024 | 3300048927 | Bacteria | 414291 |
| 1386 | Ga0496124_0034858 | 3300048927 | Bacteria | 4409 |
| 1387 | Ga0496124_0081990 | 3300048927 | Bacteria | 2649 |
| 1388 | Ga0496124_0298057 | 3300048927 | Bacteria | 1166 |
| 1389 | Ga0496125_0000011 | 3300048928 | Bacteria | 655895 |
| 1390 | Ga0496125_0033728 | 3300048928 | Bacteria | 4524 |
| 1391 | Ga0495678_001541 | 3300049459 | Bacteria | 17802 |
| 1392 | Ga0501031_0004268 | 3300049568 | Bacteria | 9236 |
| 1393 | Ga0501032_0001868 | 3300049569 | Bacteria | 16653 |
| 1394 | Ga0501032_0271036 | 3300049569 | Bacteria | 1100 |
| 1395 | Ga0501032_0409307 | 3300049569 | Bacteria | 871 |
| 1396 | Ga0501033_0000491 | 3300049570 | Bacteria | 37247 |
| 1397 | Ga0501033_0014446 | 3300049570 | Bacteria | 5996 |
| 1398 | Ga0501034_0165962 | 3300049571 | Bacteria | 2176 |
| 1399 | Ga0501034_0273556 | 3300049571 | Bacteria | 1629 |
| 1400 | Ga0501034_0462341 | 3300049571 | Bacteria | 1185 |
| 1401 | Ga0501036_0000389 | 3300049572 | Bacteria | 30927 |
| 1402 | Ga0501036_0178885 | 3300049572 | Bacteria | 1786 |
| 1403 | Ga0501037_0001552 | 3300049573 | Bacteria | 16758 |
| 1404 | Ga0501037_0003775 | 3300049573 | Bacteria | 10987 |
| 1405 | Ga0501037_0142292 | 3300049573 | Bacteria | 1716 |
| 1406 | Ga0501038_0000414 | 3300049574 | Bacteria | 36995 |
| 1407 | Ga0501038_0026046 | 3300049574 | Bacteria | 5209 |
| 1408 | Ga0501038_0348534 | 3300049574 | Bacteria | 1154 |
| 1409 | Ga0501043_0015683 | 3300049579 | Bacteria | 5939 |
| 1410 | Ga0501043_0222465 | 3300049579 | Bacteria | 1460 |
| 1411 | Ga0501046_0028661 | 3300049580 | Bacteria | 4533 |
| 1412 | Ga0501047_0007765 | 3300049581 | Bacteria | 10101 |
| 1413 | Ga0501047_0019806 | 3300049581 | Bacteria | 6457 |
| 1414 | Ga0501076_0347967 | 3300049592 | Bacteria | 1217 |
| 1415 | Ga0501198_000021 | 3300049649 | Bacteria | 70854 |
| 1416 | Ga0501222_000018 | 3300049662 | Bacteria | 71805 |
| 1417 | Ga0501257_003248 | 3300049686 | Bacteria | 3474 |
| 1418 | Ga0501229_013039 | 3300049706 | Bacteria | 1065 |
| 1419 | Ga0501080_0787502 | 3300049742 | Bacteria | 835 |
| 1420 | Ga0501241_004893 | 3300049758 | Bacteria | 2500 |
| 1421 | Ga0501035_0002711 | 3300049822 | Bacteria | 17218 |
| 1422 | Ga0501035_0010322 | 3300049822 | Bacteria | 8665 |
| 1423 | Ga0501035_0015605 | 3300049822 | Bacteria | 7010 |
| 1424 | Ga0501035_0100847 | 3300049822 | Bacteria | 2534 |
| 1425 | Ga0501044_0001056 | 3300049823 | Bacteria | 33138 |
| 1426 | Ga0501044_0001117 | 3300049823 | Bacteria | 31880 |
| 1427 | Ga0501044_0005223 | 3300049823 | Bacteria | 14450 |
| 1428 | Ga0501044_0032525 | 3300049823 | Bacteria | 5483 |
| 1429 | Ga0501044_0043140 | 3300049823 | Bacteria | 4687 |
| 1430 | nmdc:mga03683_1332_c1 | 3300050489 | Bacteria | 7311 |
| 1431 | nmdc:mga03683_81758_c1 | 3300050489 | Bacteria | 1396 |
| 1432 | nmdc:mga03n38_8009_c1 | 3300050490 | Bacteria | 3770 |
| 1433 | nmdc:mga00v17_114337_c1 | 3300050491 | Bacteria | 1714 |
| 1434 | nmdc:mga00v17_7626_c1 | 3300050491 | Bacteria | 5786 |
| 1435 | nmdc:mga0yw44_10267_c1 | 3300050492 | Bacteria | 4776 |
| 1436 | nmdc:mga0k408_119132_c1 | 3300050493 | Bacteria | 1563 |
| 1437 | nmdc:mga0k408_32769_c1 | 3300050493 | Bacteria | 2969 |
| 1438 | nmdc:mga0k408_5324_c1 | 3300050493 | Bacteria | 6835 |
| 1439 | nmdc:mga06z11_16406_c1 | 3300050494 | Bacteria | 3336 |
| 1440 | nmdc:mga04h51_2254_c1 | 3300050495 | Bacteria | 4546 |
| 1441 | nmdc:mga07m45_3456_c1 | 3300050496 | Bacteria | 7619 |
| 1442 | nmdc:mga07m45_81165_c1 | 3300050496 | Bacteria | 1852 |
| 1443 | Ga0495601_0001015 | 3300053077 | Bacteria | 15352 |
| 1444 | Ga0495601_0062988 | 3300053077 | Bacteria | 2356 |
| 1445 | Ga0495601_0164118 | 3300053077 | Bacteria | 1452 |
| 1446 | Ga0495601_0277200 | 3300053077 | Bacteria | 1093 |
| 1447 | Ga0495612_0000523 | 3300053078 | Bacteria | 15440 |
| 1448 | Ga0495612_0142801 | 3300053078 | Bacteria | 1039 |
| 1449 | Ga0495595_0000244 | 3300053084 | Bacteria | 21433 |
| 1450 | Ga0495619_0001492 | 3300053085 | Bacteria | 15422 |
| 1451 | Ga0495619_0007733 | 3300053085 | Bacteria | 6802 |
| 1452 | Ga0495619_0216970 | 3300053085 | Bacteria | 1325 |
| 1453 | Ga0495619_0416771 | 3300053085 | Bacteria | 927 |
| 1454 | Ga0500643_002719 | 3300053087 | Bacteria | 8878 |
| 1455 | Ga0500643_004495 | 3300053087 | Bacteria | 6283 |
| 1456 | Ga0500644_0008465 | 3300053088 | Bacteria | 2717 |
| 1457 | Ga0500644_0118860 | 3300053088 | Bacteria | 1027 |
| 1458 | Ga0500583_0019278 | 3300053092 | Bacteria | 2793 |
| 1459 | Ga0500651_0000052 | 3300053093 | Bacteria | 76301 |
| 1460 | Ga0500566_0090743 | 3300053094 | Bacteria | 1689 |
| 1461 | Ga0500566_0221184 | 3300053094 | Bacteria | 941 |
| 1462 | Ga0500594_0028715 | 3300053118 | Bacteria | 1449 |
| 1463 | Ga0500594_0094382 | 3300053118 | Bacteria | 912 |
| 1464 | Ga0500607_000003 | 3300053121 | Bacteria | 149664 |
| 1465 | Ga0500608_000074 | 3300053122 | Bacteria | 42636 |
| 1466 | Ga0500608_135974 | 3300053122 | Bacteria | 1096 |
| 1467 | Ga0500618_001117 | 3300053125 | Bacteria | 13113 |
| 1468 | Ga0500626_073827 | 3300053128 | Bacteria | 1515 |
| 1469 | Ga0500655_000281 | 3300053133 | Bacteria | 11746 |
| 1470 | Ga0500658_0000033 | 3300053134 | Bacteria | 89738 |
| 1471 | Ga0500658_0000040 | 3300053134 | Bacteria | 79293 |
| 1472 | Ga0500559_0000011 | 3300053136 | Bacteria | 164751 |
| 1473 | Ga0500559_0000400 | 3300053136 | Bacteria | 31323 |
| 1474 | Ga0500559_0006122 | 3300053136 | Bacteria | 5446 |
| 1475 | Ga0500568_0004186 | 3300053139 | Bacteria | 7782 |
| 1476 | Ga0500568_0006369 | 3300053139 | Bacteria | 5930 |
| 1477 | Ga0500573_0005745 | 3300053140 | Bacteria | 6656 |
| 1478 | Ga0500574_000287 | 3300053141 | Bacteria | 6183 |
| 1479 | Ga0500574_066915 | 3300053141 | Bacteria | 1049 |
| 1480 | Ga0500590_001152 | 3300053148 | Bacteria | 10437 |
| 1481 | Ga0500604_0000025 | 3300053151 | Bacteria | 68203 |
| 1482 | Ga0500604_0007438 | 3300053151 | Bacteria | 2901 |
| 1483 | Ga0500616_0000254 | 3300053153 | Bacteria | 82664 |
| 1484 | Ga0500616_0219060 | 3300053153 | Bacteria | 831 |
| 1485 | Ga0500619_000035 | 3300053154 | Bacteria | 41663 |
| 1486 | Ga0500622_0013799 | 3300053156 | Bacteria | 4352 |
| 1487 | Ga0500622_0017687 | 3300053156 | Bacteria | 3793 |
| 1488 | Ga0500622_0018708 | 3300053156 | Bacteria | 3680 |
| 1489 | Ga0500645_002612 | 3300053730 | Bacteria | 7896 |
| 1490 | Ga0590075_036627 | 3300059424 | Bacteria | 1250 |
| 1491 | Ga0590077_033052 | 3300059426 | Bacteria | 1134 |
| 1492 | Ga0587084_048259 | 3300059477 | Bacteria | 746 |
| 1493 | Ga0587088_008258 | 3300059508 | Bacteria | 1467 |
| 1494 | Ga0587092_019830 | 3300059512 | Bacteria | 1029 |
| 1495 | Ga0587098_014045 | 3300059604 | Bacteria | 939 |
| 1496 | Ga0587072_003368 | 3300059643 | Bacteria | 2241 |
| 1497 | Ga0466962_0009549 | 3300061719 | Bacteria | 4652 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050489 | nmdc:mga03683_1332_c1 | nmdc:mga03683_1332_c1_6247_6882 | 199 |
| 2 | 3300050490 | nmdc:mga03n38_8009_c1 | nmdc:mga03n38_8009_c1_1305_1940 | 199 |
| 3 | 3300050491 | nmdc:mga00v17_7626_c1 | nmdc:mga00v17_7626_c1_1305_1940 | 199 |
| 4 | 3300050492 | nmdc:mga0yw44_10267_c1 | nmdc:mga0yw44_10267_c1_3847_4482 | 199 |
| 5 | 3300050493 | nmdc:mga0k408_32769_c1 | nmdc:mga0k408_32769_c1_1588_2223 | 199 |
| 6 | 3300050494 | nmdc:mga06z11_16406_c1 | nmdc:mga06z11_16406_c1_537_1172 | 199 |
| 7 | 3300050495 | nmdc:mga04h51_2254_c1 | nmdc:mga04h51_2254_c1_1423_2058 | 199 |
| 8 | 3300050496 | nmdc:mga07m45_81165_c1 | nmdc:mga07m45_81165_c1_837_1472 | 199 |
| 9 | 3300053092 | Ga0500583_0019278 | Ga0500583_0019278_640_1275 | 199 |
| 10 | 3300053118 | Ga0500594_0094382 | Ga0500594_0094382_107_742 | 199 |
| 11 | 3300053151 | Ga0500604_0007438 | Ga0500604_0007438_1799_2434 | 199 |
| 12 | 3300033180 | Ga0307510_10137639 | Ga0307510_101376393 | 200 |
| 13 | 3300013102 | Ga0157371_10548477 | Ga0157371_105484771 | 201 |
| 14 | 3300048919 | Ga0496116_0033181 | Ga0496116_0033181_1648_2301 | 201 |
| 15 | 3300048922 | Ga0496119_0012065 | Ga0496119_0012065_1301_1954 | 201 |
| 16 | 3300048928 | Ga0496125_0000011 | Ga0496125_0000011_211429_212082 | 201 |
| 17 | 3300009551 | Ga0105238_10194328 | Ga0105238_101943282 | 202 |
| 18 | 3300013307 | Ga0157372_10594982 | Ga0157372_105949822 | 202 |
| 19 | 3300014497 | Ga0182008_10071746 | Ga0182008_100717462 | 202 |
| 20 | 3300015261 | Ga0182006_1031937 | Ga0182006_10319373 | 202 |
| 21 | 3300025298 | Ga0209050_1002423 | Ga0209050_10024233 | 202 |
| 22 | 3300025303 | Ga0209051_1023358 | Ga0209051_10233584 | 202 |
| 23 | 3300037312 | Ga0395899_0003063 | Ga0395899_0003063_12529_13158 | 202 |
| 24 | 3300037418 | Ga0395900_0012770 | Ga0395900_0012770_81_710 | 202 |
| 25 | 3300037418 | Ga0395900_0029682 | Ga0395900_0029682_4492_5121 | 202 |
| 26 | 3300037418 | Ga0395900_0474203 | Ga0395900_0474203_498_1130 | 202 |
| 27 | 3300039447 | Ga0436361_0360722 | Ga0436361_0360722_378_1007 | 202 |
| 28 | 3300042005 | Ga0439448_0134225 | Ga0439448_0134225_205_834 | 202 |
| 29 | 3300044684 | Ga0466966_0058836 | Ga0466966_0058836_354_986 | 202 |
| 30 | 3300044684 | Ga0466966_0153289 | Ga0466966_0153289_78_707 | 202 |
| 31 | 3300044693 | Ga0466961_0013324 | Ga0466961_0013324_2409_3041 | 202 |
| 32 | 3300044693 | Ga0466961_0116803 | Ga0466961_0116803_1031_1660 | 202 |
| 33 | 3300045049 | Ga0466959_0065867 | Ga0466959_0065867_808_1437 | 202 |
| 34 | 3300045049 | Ga0466959_0097689 | Ga0466959_0097689_1019_1651 | 202 |
| 35 | 3300045976 | Ga0466967_0066727 | Ga0466967_0066727_1713_2342 | 202 |
| 36 | 3300046455 | Ga0495603_0012974 | Ga0495603_0012974_2596_3225 | 202 |
| 37 | 3300046463 | Ga0495653_0036253 | Ga0495653_0036253_3162_3791 | 202 |
| 38 | 3300046471 | Ga0495650_0000224 | Ga0495650_0000224_107380_108009 | 202 |
| 39 | 3300046499 | Ga0495594_0005917 | Ga0495594_0005917_957_1586 | 202 |
| 40 | 3300046499 | Ga0495594_0028138 | Ga0495594_0028138_170_799 | 202 |
| 41 | 3300046499 | Ga0495594_0120239 | Ga0495594_0120239_609_1238 | 202 |
| 42 | 3300046501 | Ga0495607_0008021 | Ga0495607_0008021_6446_7075 | 202 |
| 43 | 3300046513 | Ga0495616_0000184 | Ga0495616_0000184_32822_33451 | 202 |
| 44 | 3300046513 | Ga0495616_0005947 | Ga0495616_0005947_1493_2122 | 202 |
| 45 | 3300046519 | Ga0495632_0000081 | Ga0495632_0000081_41121_41750 | 202 |
| 46 | 3300046520 | Ga0495637_0023019 | Ga0495637_0023019_532_1182 | 202 |
| 47 | 3300046531 | Ga0495665_0016891 | Ga0495665_0016891_90_719 | 202 |
| 48 | 3300046531 | Ga0495665_0136570 | Ga0495665_0136570_564_1193 | 202 |
| 49 | 3300046535 | Ga0495586_0036434 | Ga0495586_0036434_186_815 | 202 |
| 50 | 3300046536 | Ga0495587_0051847 | Ga0495587_0051847_766_1395 | 202 |
| 51 | 3300046538 | Ga0495609_0000039 | Ga0495609_0000039_105764_106393 | 202 |
| 52 | 3300046542 | Ga0495597_0000514 | Ga0495597_0000514_3038_3667 | 202 |
| 53 | 3300046543 | Ga0495645_0036308 | Ga0495645_0036308_870_1502 | 202 |
| 54 | 3300046660 | Ga0495625_0000877 | Ga0495625_0000877_7374_8003 | 202 |
| 55 | 3300046663 | Ga0495635_0409522 | Ga0495635_0409522_259_888 | 202 |
| 56 | 3300046664 | Ga0495659_0011166 | Ga0495659_0011166_2201_2830 | 202 |
| 57 | 3300046665 | Ga0495661_0000094 | Ga0495661_0000094_1176_1805 | 202 |
| 58 | 3300046665 | Ga0495661_0035155 | Ga0495661_0035155_998_1627 | 202 |
| 59 | 3300046679 | Ga0495623_0047779 | Ga0495623_0047779_639_1268 | 202 |
| 60 | 3300046680 | Ga0495646_0001661 | Ga0495646_0001661_10179_10811 | 202 |
| 61 | 3300046690 | Ga0495624_0004448 | Ga0495624_0004448_5583_6212 | 202 |
| 62 | 3300046794 | Ga0495589_0000019 | Ga0495589_0000019_107535_108164 | 202 |
| 63 | 3300046794 | Ga0495589_0001712 | Ga0495589_0001712_8566_9195 | 202 |
| 64 | 3300047315 | Ga0495581_0272960 | Ga0495581_0272960_90_719 | 202 |
| 65 | 3300047317 | Ga0495604_0255656 | Ga0495604_0255656_373_1002 | 202 |
| 66 | 3300047317 | Ga0495604_0344532 | Ga0495604_0344532_319_948 | 202 |
| 67 | 3300047318 | Ga0495636_0012076 | Ga0495636_0012076_849_1478 | 202 |
| 68 | 3300047321 | Ga0495676_0100509 | Ga0495676_0100509_1261_1890 | 202 |
| 69 | 3300047321 | Ga0495676_0316428 | Ga0495676_0316428_41_670 | 202 |
| 70 | 3300047443 | Ga0495687_000059 | Ga0495687_000059_105764_106393 | 202 |
| 71 | 3300047445 | Ga0495677_0000006 | Ga0495677_0000006_92838_93467 | 202 |
| 72 | 3300048091 | Ga0495626_0000494 | Ga0495626_0000494_17540_18169 | 202 |
| 73 | 3300048091 | Ga0495626_0000821 | Ga0495626_0000821_3191_3820 | 202 |
| 74 | 3300048091 | Ga0495626_0001278 | Ga0495626_0001278_14154_14783 | 202 |
| 75 | 3300048905 | Ga0496102_0037805 | Ga0496102_0037805_177_830 | 202 |
| 76 | 3300048905 | Ga0496102_0997117 | Ga0496102_0997117_22_675 | 202 |
| 77 | 3300048907 | Ga0496104_0086164 | Ga0496104_0086164_1474_2127 | 202 |
| 78 | 3300048908 | Ga0496105_0093421 | Ga0496105_0093421_1689_2342 | 202 |
| 79 | 3300048910 | Ga0496107_0521993 | Ga0496107_0521993_174_827 | 202 |
| 80 | 3300048911 | Ga0496108_0309879 | Ga0496108_0309879_29_682 | 202 |
| 81 | 3300048912 | Ga0496109_0100430 | Ga0496109_0100430_747_1400 | 202 |
| 82 | 3300048913 | Ga0496110_0054927 | Ga0496110_0054927_269_922 | 202 |
| 83 | 3300048914 | Ga0496111_0030956 | Ga0496111_0030956_2932_3585 | 202 |
| 84 | 3300048917 | Ga0496114_0686916 | Ga0496114_0686916_89_742 | 202 |
| 85 | 3300048924 | Ga0496121_0012939 | Ga0496121_0012939_1992_2630 | 202 |
| 86 | 3300049569 | Ga0501032_0271036 | Ga0501032_0271036_34_666 | 202 |
| 87 | 3300049571 | Ga0501034_0165962 | Ga0501034_0165962_1380_2012 | 202 |
| 88 | 3300049572 | Ga0501036_0178885 | Ga0501036_0178885_703_1335 | 202 |
| 89 | 3300049573 | Ga0501037_0142292 | Ga0501037_0142292_621_1253 | 202 |
| 90 | 3300049574 | Ga0501038_0026046 | Ga0501038_0026046_2451_3083 | 202 |
| 91 | 3300049579 | Ga0501043_0222465 | Ga0501043_0222465_750_1382 | 202 |
| 92 | 3300049581 | Ga0501047_0019806 | Ga0501047_0019806_2402_3034 | 202 |
| 93 | 3300049822 | Ga0501035_0010322 | Ga0501035_0010322_1397_2029 | 202 |
| 94 | 3300049822 | Ga0501035_0015605 | Ga0501035_0015605_4205_4837 | 202 |
| 95 | 3300049823 | Ga0501044_0001056 | Ga0501044_0001056_7988_8620 | 202 |
| 96 | 3300049823 | Ga0501044_0005223 | Ga0501044_0005223_2726_3358 | 202 |
| 97 | 3300050491 | nmdc:mga00v17_114337_c1 | nmdc:mga00v17_114337_c1_1036_1668 | 202 |
| 98 | 3300061719 | Ga0466962_0009549 | Ga0466962_0009549_710_1342 | 202 |
| 99 | iso_pu_bacteria | 2856287931 | 2856294109 | 202 |
| 100 | iso_pu_bacteria | 2857357740 | 2857366272 | 202 |
| 101 | 3300002987 | JGI25159J45721_1001076 | JGI25159J45721_10010767 | 203 |
| 102 | 3300003771 | Ga0055526_1001576 | Ga0055526_100157614 | 203 |
| 103 | 3300004625 | Ga0055543_1005432 | Ga0055543_10054324 | 203 |
| 104 | 3300005262 | Ga0065165_1000353 | Ga0065165_100035362 | 203 |
| 105 | 3300025284 | Ga0209130_1000156 | Ga0209130_100015686 | 203 |
| 106 | 3300025295 | Ga0209564_1000089 | Ga0209564_1000089122 | 203 |
| 107 | 3300025941 | Ga0207711_10873743 | Ga0207711_108737432 | 203 |
| 108 | 3300028800 | Ga0265338_10290040 | Ga0265338_102900402 | 203 |
| 109 | 3300031911 | Ga0307412_10001140 | Ga0307412_100011403 | 203 |
| 110 | 3300035171 | Ga0373946_0028107 | Ga0373946_0028107_1324_1953 | 203 |
| 111 | 3300036401 | Ga0373937_0027556 | Ga0373937_0027556_3814_4443 | 203 |
| 112 | 3300041405 | Ga0439438_042417 | Ga0439438_042417_462_1112 | 203 |
| 113 | 3300046459 | Ga0495629_0001156 | Ga0495629_0001156_7233_7862 | 203 |
| 114 | 3300046471 | Ga0495650_0047032 | Ga0495650_0047032_1101_1751 | 203 |
| 115 | 3300046473 | Ga0495582_0158586 | Ga0495582_0158586_93_722 | 203 |
| 116 | 3300046511 | Ga0495608_0002654 | Ga0495608_0002654_10631_11260 | 203 |
| 117 | 3300046517 | Ga0495630_0670853 | Ga0495630_0670853_134_763 | 203 |
| 118 | 3300046529 | Ga0495652_0023823 | Ga0495652_0023823_4346_4975 | 203 |
| 119 | 3300046536 | Ga0495587_0000911 | Ga0495587_0000911_7288_7917 | 203 |
| 120 | 3300046543 | Ga0495645_0010920 | Ga0495645_0010920_3653_4282 | 203 |
| 121 | 3300046559 | Ga0495667_0013049 | Ga0495667_0013049_4701_5330 | 203 |
| 122 | 3300046642 | Ga0495634_0004529 | Ga0495634_0004529_9235_9864 | 203 |
| 123 | 3300046689 | Ga0495613_0026725 | Ga0495613_0026725_3540_4169 | 203 |
| 124 | 3300046809 | Ga0495600_0006775 | Ga0495600_0006775_2166_2795 | 203 |
| 125 | 3300047317 | Ga0495604_0001863 | Ga0495604_0001863_6345_6974 | 203 |
| 126 | 3300047319 | Ga0495674_0001578 | Ga0495674_0001578_10639_11268 | 203 |
| 127 | 3300048913 | Ga0496110_0907212 | Ga0496110_0907212_63_716 | 203 |
| 128 | 3300048921 | Ga0496118_0011398 | Ga0496118_0011398_7122_7925 | 203 |
| 129 | 3300048925 | Ga0496122_0000644 | Ga0496122_0000644_54720_55373 | 203 |
| 130 | 3300048926 | Ga0496123_0000203 | Ga0496123_0000203_107349_108002 | 203 |
| 131 | 3300048927 | Ga0496124_0034858 | Ga0496124_0034858_1650_2303 | 203 |
| 132 | 3300053077 | Ga0495601_0062988 | Ga0495601_0062988_143_772 | 203 |
| 133 | 3300053077 | Ga0495601_0277200 | Ga0495601_0277200_166_795 | 203 |
| 134 | 3300053084 | Ga0495595_0000244 | Ga0495595_0000244_10653_11282 | 203 |
| 135 | 3300053085 | Ga0495619_0007733 | Ga0495619_0007733_3949_4578 | 203 |
| 136 | iso_pu_bacteria | 2818991435 | 2819539152 | 203 |
| 137 | iso_pu_bacteria | 2818991454 | 2819648334 | 203 |
| 138 | iso_pu_bacteria | 2904479285 | 2904481859 | 203 |
| 139 | iso_pu_bacteria | 2952252522 | 2952255615 | 203 |
| 140 | 3300006051 | Ga0075364_10001014 | Ga0075364_100010149 | 204 |
| 141 | 3300046491 | Ga0495584_0088564 | Ga0495584_0088564_812_1462 | 204 |
| 142 | 3300046492 | Ga0495585_0000102 | Ga0495585_0000102_36745_37395 | 204 |
| 143 | 3300046513 | Ga0495616_0094813 | Ga0495616_0094813_466_1116 | 204 |
| 144 | 3300046519 | Ga0495632_0030420 | Ga0495632_0030420_2139_2789 | 204 |
| 145 | 3300046522 | Ga0495643_0056018 | Ga0495643_0056018_228_878 | 204 |
| 146 | 3300046648 | Ga0495611_0006200 | Ga0495611_0006200_4032_4682 | 204 |
| 147 | 3300046660 | Ga0495625_0023894 | Ga0495625_0023894_2617_3267 | 204 |
| 148 | 3300046794 | Ga0495589_0110138 | Ga0495589_0110138_61_711 | 204 |
| 149 | 3300047447 | Ga0495685_013611 | Ga0495685_013611_1929_2579 | 204 |
| 150 | 3300049570 | Ga0501033_0014446 | Ga0501033_0014446_5137_5778 | 204 |
| 151 | 3300049574 | Ga0501038_0348534 | Ga0501038_0348534_194_835 | 204 |
| 152 | 3300049822 | Ga0501035_0100847 | Ga0501035_0100847_503_1144 | 204 |
| 153 | 3300049823 | Ga0501044_0043140 | Ga0501044_0043140_471_1112 | 204 |
| 154 | iso_pu_bacteria | 2643221570 | 2643866594 | 204 |
| 155 | iso_pu_bacteria | 2643221640 | 2644225910 | 204 |
| 156 | iso_pu_bacteria | 2643221642 | 2644235399 | 204 |
| 157 | iso_pu_bacteria | 2643221652 | 2644296352 | 204 |
| 158 | iso_pu_bacteria | 2881101125 | 2881104189 | 204 |
| 159 | iso_pu_bacteria | 2939631187 | 2939632171 | 204 |
| 160 | 3300042009 | Ga0439451_000253 | Ga0439451_000253_2277_2906 | 205 |
| 161 | 3300042013 | Ga0439456_015159 | Ga0439456_015159_41_670 | 205 |
| 162 | iso_pu_bacteria | 2511231003 | 2511248470 | 205 |
| 163 | iso_pu_bacteria | 2511231026 | 2511385044 | 205 |
| 164 | iso_pu_bacteria | 2521172590 | 2521560555 | 205 |
| 165 | iso_pu_bacteria | 2551306416 | 2553005660 | 205 |
| 166 | iso_pu_bacteria | 2599185292 | 2599903268 | 205 |
| 167 | iso_pu_bacteria | 2600255292 | 2601669708 | 205 |
| 168 | iso_pu_bacteria | 2639762793 | 2640734230 | 205 |
| 169 | iso_pu_bacteria | 2643221554 | 2643790602 | 205 |
| 170 | iso_pu_bacteria | 2643221556 | 2643799913 | 205 |
| 171 | iso_pu_bacteria | 2643221569 | 2643862236 | 205 |
| 172 | iso_pu_bacteria | 2643221594 | 2643980737 | 205 |
| 173 | iso_pu_bacteria | 2643221603 | 2644028954 | 205 |
| 174 | iso_pu_bacteria | 2643221621 | 2644122162 | 205 |
| 175 | iso_pu_bacteria | 2643221645 | 2644253376 | 205 |
| 176 | iso_pu_bacteria | 2643221664 | 2644355576 | 205 |
| 177 | iso_pu_bacteria | 2643221684 | 2644474914 | 205 |
| 178 | iso_pu_bacteria | 2675903507 | 2678231208 | 205 |
| 179 | iso_pu_bacteria | 2738541280 | 2738737303 | 205 |
| 180 | iso_pu_bacteria | 2738541297 | 2738830074 | 205 |
| 181 | iso_pu_bacteria | 2738541300 | 2738841524 | 205 |
| 182 | iso_pu_bacteria | 2738541357 | 2739153870 | 205 |
| 183 | iso_pu_bacteria | 2738543003 | 2739195790 | 205 |
| 184 | iso_pu_bacteria | 2738543018 | 2739272395 | 205 |
| 185 | iso_pu_bacteria | 2738543026 | 2739322266 | 205 |
| 186 | iso_pu_bacteria | 2738543029 | 2739340507 | 205 |
| 187 | iso_pu_bacteria | 2738543030 | 2739341439 | 205 |
| 188 | iso_pu_bacteria | 2739367655 | 2739612225 | 205 |
| 189 | iso_pu_bacteria | 2765235838 | 2765571806 | 205 |
| 190 | iso_pu_bacteria | 2773857761 | 2774388237 | 205 |
| 191 | iso_pu_bacteria | 2808606386 | 2808982188 | 205 |
| 192 | iso_pu_bacteria | 2808606395 | 2809031946 | 205 |
| 193 | iso_pu_bacteria | 2808606415 | 2809130012 | 205 |
| 194 | iso_pu_bacteria | 2808606418 | 2809146730 | 205 |
| 195 | iso_pu_bacteria | 2808606419 | 2809148933 | 205 |
| 196 | iso_pu_bacteria | 2818991436 | 2819540680 | 205 |
| 197 | iso_pu_bacteria | 2818991445 | 2819593496 | 205 |
| 198 | iso_pu_bacteria | 2818991449 | 2819617248 | 205 |
| 199 | iso_pu_bacteria | 2821131069 | 2821132013 | 205 |
| 200 | iso_pu_bacteria | 2839094727 | 2839098473 | 205 |
| 201 | iso_pu_bacteria | 2842711865 | 2842712744 | 205 |
| 202 | iso_pu_bacteria | 2852618963 | 2852619069 | 205 |
| 203 | iso_pu_bacteria | 2855730933 | 2855734543 | 205 |
| 204 | iso_pu_bacteria | 2855767633 | 2855770133 | 205 |
| 205 | iso_pu_bacteria | 2857537821 | 2857538428 | 205 |
| 206 | iso_pu_bacteria | 2857542790 | 2857545256 | 205 |
| 207 | iso_pu_bacteria | 2857547612 | 2857551225 | 205 |
| 208 | iso_pu_bacteria | 2857553236 | 2857557717 | 205 |
| 209 | iso_pu_bacteria | 2857558681 | 2857563989 | 205 |
| 210 | iso_pu_bacteria | 2857564685 | 2857568532 | 205 |
| 211 | iso_pu_bacteria | 2857576091 | 2857578636 | 205 |
| 212 | iso_pu_bacteria | 2858950400 | 2858955689 | 205 |
| 213 | iso_pu_bacteria | 2881412998 | 2881414347 | 205 |
| 214 | iso_pu_bacteria | 2881927736 | 2881930324 | 205 |
| 215 | iso_pu_bacteria | 2884811622 | 2884812569 | 205 |
| 216 | iso_pu_bacteria | 2884811622 | 2884816163 | 205 |
| 217 | iso_pu_bacteria | 2884836552 | 2884839394 | 205 |
| 218 | iso_pu_bacteria | 2884836552 | 2884840030 | 205 |
| 219 | iso_pu_bacteria | 2884852848 | 2884856796 | 205 |
| 220 | iso_pu_bacteria | 2884852848 | 2884857202 | 205 |
| 221 | iso_pu_bacteria | 2887375801 | 2887377920 | 205 |
| 222 | iso_pu_bacteria | 2896154374 | 2896157789 | 205 |
| 223 | iso_pu_bacteria | 2896154374 | 2896158142 | 205 |
| 224 | iso_pu_bacteria | 2904439833 | 2904442886 | 205 |
| 225 | iso_pu_bacteria | 2904530477 | 2904534918 | 205 |
| 226 | iso_pu_bacteria | 2904584206 | 2904588743 | 205 |
| 227 | iso_pu_bacteria | 2904589729 | 2904594183 | 205 |
| 228 | iso_pu_bacteria | 2904601388 | 2904604979 | 205 |
| 229 | iso_pu_bacteria | 2916699645 | 2916699728 | 205 |
| 230 | iso_pu_bacteria | 2919046199 | 2919048618 | 205 |
| 231 | iso_pu_bacteria | 2919079590 | 2919083212 | 205 |
| 232 | iso_pu_bacteria | 2919182534 | 2919184125 | 205 |
| 233 | iso_pu_bacteria | 2919476304 | 2919480296 | 205 |
| 234 | iso_pu_bacteria | 2923510766 | 2923514333 | 205 |
| 235 | iso_pu_bacteria | 2928130867 | 2928133069 | 205 |
| 236 | iso_pu_bacteria | 2932410948 | 2932413194 | 205 |
| 237 | iso_pu_bacteria | 2932416698 | 2932417255 | 205 |
| 238 | iso_pu_bacteria | 2941479691 | 2941481975 | 205 |
| 239 | iso_pu_bacteria | 8002392321 | 8002394976 | 205 |
| 240 | iso_pu_bacteria | 8047673197 | 8047673309 | 205 |
| 241 | iso_pu_bacteria | 8048746797 | 8048749800 | 205 |
| 242 | iso_pu_bacteria | 8055225921 | 8055227904 | 205 |
| 243 | 3300006048 | Ga0075363_100002405 | Ga0075363_1000024052 | 206 |
| 244 | 3300006051 | Ga0075364_10644528 | Ga0075364_106445281 | 206 |
| 245 | 3300006177 | Ga0075362_10003092 | Ga0075362_100030923 | 206 |
| 246 | 3300006178 | Ga0075367_10018656 | Ga0075367_100186562 | 206 |
| 247 | 3300006186 | Ga0075369_10019058 | Ga0075369_100190582 | 206 |
| 248 | 3300006195 | Ga0075366_10136681 | Ga0075366_101366811 | 206 |
| 249 | 3300027866 | Ga0209813_10002725 | Ga0209813_100027252 | 206 |
| 250 | iso_pu_bacteria | 2599185352 | 2600197984 | 206 |
| 251 | 3300001979 | JGI24740J21852_10003031 | JGI24740J21852_100030316 | 207 |
| 252 | 3300001989 | JGI24739J22299_10038407 | JGI24739J22299_100384072 | 207 |
| 253 | 3300002704 | JGI25155J39150_1000073 | JGI25155J39150_10000736 | 207 |
| 254 | 3300002705 | JGI25156J39149_1000609 | JGI25156J39149_10006096 | 207 |
| 255 | 3300002705 | JGI25156J39149_1004731 | JGI25156J39149_10047313 | 207 |
| 256 | 3300002738 | JGI25154J39366_1000118 | JGI25154J39366_100011856 | 207 |
| 257 | 3300002738 | JGI25154J39366_1000258 | JGI25154J39366_10002586 | 207 |
| 258 | 3300002738 | JGI25154J39366_1000270 | JGI25154J39366_100027016 | 207 |
| 259 | 3300002741 | JGI25157J39369_1000001 | JGI25157J39369_10000016 | 207 |
| 260 | 3300002773 | JGI25152J39213_1001584 | JGI25152J39213_10015844 | 207 |
| 261 | 3300002774 | JGI25150J39212_1001402 | JGI25150J39212_10014025 | 207 |
| 262 | 3300002774 | JGI25150J39212_1010535 | JGI25150J39212_10105353 | 207 |
| 263 | 3300002987 | JGI25159J45721_1001508 | JGI25159J45721_10015088 | 207 |
| 264 | 3300002987 | JGI25159J45721_1001707 | JGI25159J45721_100170710 | 207 |
| 265 | 3300002987 | JGI25159J45721_1007198 | JGI25159J45721_10071982 | 207 |
| 266 | 3300003187 | JGI25151J46595_10003026 | JGI25151J46595_100030268 | 207 |
| 267 | 3300003187 | JGI25151J46595_10036981 | JGI25151J46595_100369812 | 207 |
| 268 | 3300003354 | JGI25160J50197_1000259 | JGI25160J50197_100025910 | 207 |
| 269 | 3300003354 | JGI25160J50197_1002071 | JGI25160J50197_10020718 | 207 |
| 270 | 3300003354 | JGI25160J50197_1003470 | JGI25160J50197_100347010 | 207 |
| 271 | 3300003374 | JGI25161J50226_1000092 | JGI25161J50226_100009260 | 207 |
| 272 | 3300003374 | JGI25161J50226_1002450 | JGI25161J50226_10024504 | 207 |
| 273 | 3300003578 | Ga0006562J51391_1148455 | Ga0006562J51391_11484552 | 207 |
| 274 | 3300003761 | Ga0055535_1000215 | Ga0055535_10002157 | 207 |
| 275 | 3300003762 | Ga0055542_1000004 | Ga0055542_1000004419 | 207 |
| 276 | 3300003762 | Ga0055542_1000412 | Ga0055542_100041211 | 207 |
| 277 | 3300003771 | Ga0055526_1003709 | Ga0055526_10037098 | 207 |
| 278 | 3300003771 | Ga0055526_1004811 | Ga0055526_10048113 | 207 |
| 279 | 3300003771 | Ga0055526_1006869 | Ga0055526_10068694 | 207 |
| 280 | 3300003771 | Ga0055526_1008931 | Ga0055526_10089314 | 207 |
| 281 | 3300003773 | Ga0055537_1000086 | Ga0055537_100008619 | 207 |
| 282 | 3300003773 | Ga0055537_1000587 | Ga0055537_10005873 | 207 |
| 283 | 3300003773 | Ga0055537_1001401 | Ga0055537_10014014 | 207 |
| 284 | 3300003775 | Ga0055524_1000093 | Ga0055524_100009318 | 207 |
| 285 | 3300003775 | Ga0055524_1000194 | Ga0055524_100019439 | 207 |
| 286 | 3300003775 | Ga0055524_1002243 | Ga0055524_100224310 | 207 |
| 287 | 3300003775 | Ga0055524_1002452 | Ga0055524_10024524 | 207 |
| 288 | 3300003781 | Ga0055536_1014255 | Ga0055536_10142552 | 207 |
| 289 | 3300003784 | Ga0055534_1000024 | Ga0055534_100002495 | 207 |
| 290 | 3300003784 | Ga0055534_1001417 | Ga0055534_10014174 | 207 |
| 291 | 3300003784 | Ga0055534_1001838 | Ga0055534_10018386 | 207 |
| 292 | 3300003784 | Ga0055534_1021827 | Ga0055534_10218272 | 207 |
| 293 | 3300003790 | Ga0055528_1000961 | Ga0055528_10009614 | 207 |
| 294 | 3300003790 | Ga0055528_1002611 | Ga0055528_10026114 | 207 |
| 295 | 3300003790 | Ga0055528_1014420 | Ga0055528_10144203 | 207 |
| 296 | 3300003791 | Ga0055530_10000541 | Ga0055530_1000054120 | 207 |
| 297 | 3300003791 | Ga0055530_10057965 | Ga0055530_100579651 | 207 |
| 298 | 3300003792 | Ga0055540_1000089 | Ga0055540_100008943 | 207 |
| 299 | 3300003792 | Ga0055540_1004954 | Ga0055540_10049544 | 207 |
| 300 | 3300003792 | Ga0055540_1006243 | Ga0055540_10062432 | 207 |
| 301 | 3300003792 | Ga0055540_1013378 | Ga0055540_10133782 | 207 |
| 302 | 3300003794 | Ga0055531_10000269 | Ga0055531_1000026940 | 207 |
| 303 | 3300003794 | Ga0055531_10005739 | Ga0055531_100057394 | 207 |
| 304 | 3300003794 | Ga0055531_10009722 | Ga0055531_100097222 | 207 |
| 305 | 3300003841 | Ga0055541_1001138 | Ga0055541_10011382 | 207 |
| 306 | 3300004625 | Ga0055543_1004025 | Ga0055543_10040252 | 207 |
| 307 | 3300004625 | Ga0055543_1009685 | Ga0055543_10096852 | 207 |
| 308 | 3300005262 | Ga0065165_1005751 | Ga0065165_10057515 | 207 |
| 309 | 3300005262 | Ga0065165_1014470 | Ga0065165_10144702 | 207 |
| 310 | 3300005262 | Ga0065165_1036832 | Ga0065165_10368322 | 207 |
| 311 | 3300005262 | Ga0065165_1038483 | Ga0065165_10384832 | 207 |
| 312 | 3300005288 | Ga0065714_10014905 | Ga0065714_100149053 | 207 |
| 313 | 3300005289 | Ga0065704_10180239 | Ga0065704_101802392 | 207 |
| 314 | 3300005289 | Ga0065704_10198711 | Ga0065704_101987112 | 207 |
| 315 | 3300005289 | Ga0065704_10215718 | Ga0065704_102157181 | 207 |
| 316 | 3300005327 | Ga0070658_10452422 | Ga0070658_104524222 | 207 |
| 317 | 3300005347 | Ga0070668_100239734 | Ga0070668_1002397342 | 207 |
| 318 | 3300005367 | Ga0070667_100016942 | Ga0070667_1000169424 | 207 |
| 319 | 3300005435 | Ga0070714_100089631 | Ga0070714_1000896311 | 207 |
| 320 | 3300005530 | Ga0070679_100058491 | Ga0070679_1000584913 | 207 |
| 321 | 3300005539 | Ga0068853_100268022 | Ga0068853_1002680222 | 207 |
| 322 | 3300005543 | Ga0070672_100360506 | Ga0070672_1003605062 | 207 |
| 323 | 3300005563 | Ga0068855_100004765 | Ga0068855_1000047659 | 207 |
| 324 | 3300005563 | Ga0068855_100080833 | Ga0068855_1000808332 | 207 |
| 325 | 3300005563 | Ga0068855_100278184 | Ga0068855_1002781842 | 207 |
| 326 | 3300005614 | Ga0068856_100728763 | Ga0068856_1007287632 | 207 |
| 327 | 3300005834 | Ga0068851_10007313 | Ga0068851_100073132 | 207 |
| 328 | 3300005841 | Ga0068863_100198971 | Ga0068863_1001989712 | 207 |
| 329 | 3300006038 | Ga0075365_10009750 | Ga0075365_100097504 | 207 |
| 330 | 3300006038 | Ga0075365_10027139 | Ga0075365_100271392 | 207 |
| 331 | 3300006048 | Ga0075363_100014482 | Ga0075363_1000144822 | 207 |
| 332 | 3300006051 | Ga0075364_10037369 | Ga0075364_100373694 | 207 |
| 333 | 3300006058 | Ga0075432_10021123 | Ga0075432_100211232 | 207 |
| 334 | 3300006177 | Ga0075362_10045866 | Ga0075362_100458662 | 207 |
| 335 | 3300006178 | Ga0075367_10044803 | Ga0075367_100448033 | 207 |
| 336 | 3300006195 | Ga0075366_10023990 | Ga0075366_100239903 | 207 |
| 337 | 3300006195 | Ga0075366_10174826 | Ga0075366_101748262 | 207 |
| 338 | 3300006195 | Ga0075366_10492522 | Ga0075366_104925222 | 207 |
| 339 | 3300006353 | Ga0075370_10001129 | Ga0075370_100011293 | 207 |
| 340 | 3300006353 | Ga0075370_10006846 | Ga0075370_100068465 | 207 |
| 341 | 3300006880 | Ga0075429_100880813 | Ga0075429_1008808131 | 207 |
| 342 | 3300006946 | Ga0079104_1000007 | Ga0079104_1000007207 | 207 |
| 343 | 3300006948 | Ga0099826_10000132 | Ga0099826_1000013229 | 207 |
| 344 | 3300014497 | Ga0182008_10009226 | Ga0182008_100092262 | 207 |
| 345 | 3300014497 | Ga0182008_10059354 | Ga0182008_100593542 | 207 |
| 346 | 3300015262 | Ga0182007_10000921 | Ga0182007_100009216 | 207 |
| 347 | 3300015683 | Ga0183362_10001 | Ga0183362_100011801 | 207 |
| 348 | 3300017792 | Ga0163161_10071729 | Ga0163161_100717292 | 207 |
| 349 | 3300025206 | Ga0209435_100001 | Ga0209435_1000011307 | 207 |
| 350 | 3300025208 | Ga0209436_103318 | Ga0209436_1033184 | 207 |
| 351 | 3300025224 | Ga0209784_100638 | Ga0209784_1006384 | 207 |
| 352 | 3300025225 | Ga0209566_100651 | Ga0209566_10065120 | 207 |
| 353 | 3300025226 | Ga0209674_100160 | Ga0209674_10016085 | 207 |
| 354 | 3300025228 | Ga0209672_101339 | Ga0209672_1013397 | 207 |
| 355 | 3300025229 | Ga0209147_103938 | Ga0209147_1039381 | 207 |
| 356 | 3300025242 | Ga0209258_100022 | Ga0209258_100022419 | 207 |
| 357 | 3300025245 | Ga0207425_1001031 | Ga0207425_10010315 | 207 |
| 358 | 3300025245 | Ga0207425_1002773 | Ga0207425_10027732 | 207 |
| 359 | 3300025245 | Ga0207425_1004638 | Ga0207425_10046384 | 207 |
| 360 | 3300025246 | Ga0209646_1000001 | Ga0209646_10000011676 | 207 |
| 361 | 3300025246 | Ga0209646_1000019 | Ga0209646_1000019137 | 207 |
| 362 | 3300025250 | Ga0209026_1000001 | Ga0209026_1000001330 | 207 |
| 363 | 3300025250 | Ga0209026_1005641 | Ga0209026_10056414 | 207 |
| 364 | 3300025253 | Ga0209677_109555 | Ga0209677_1095552 | 207 |
| 365 | 3300025254 | Ga0209148_1000034 | Ga0209148_1000034419 | 207 |
| 366 | 3300025254 | Ga0209148_1000118 | Ga0209148_1000118180 | 207 |
| 367 | 3300025256 | Ga0209759_1000001 | Ga0209759_10000011307 | 207 |
| 368 | 3300025256 | Ga0209759_1004695 | Ga0209759_10046953 | 207 |
| 369 | 3300025258 | Ga0209129_1000111 | Ga0209129_100011199 | 207 |
| 370 | 3300025258 | Ga0209129_1000667 | Ga0209129_10006676 | 207 |
| 371 | 3300025258 | Ga0209129_1005500 | Ga0209129_10055006 | 207 |
| 372 | 3300025263 | Ga0209565_1000028 | Ga0209565_100002834 | 207 |
| 373 | 3300025263 | Ga0209565_1000040 | Ga0209565_100004045 | 207 |
| 374 | 3300025263 | Ga0209565_1000110 | Ga0209565_100011011 | 207 |
| 375 | 3300025263 | Ga0209565_1000673 | Ga0209565_100067324 | 207 |
| 376 | 3300025263 | Ga0209565_1021834 | Ga0209565_10218342 | 207 |
| 377 | 3300025273 | Ga0209673_1000035 | Ga0209673_1000035301 | 207 |
| 378 | 3300025273 | Ga0209673_1000109 | Ga0209673_1000109118 | 207 |
| 379 | 3300025273 | Ga0209673_1000175 | Ga0209673_100017544 | 207 |
| 380 | 3300025273 | Ga0209673_1000664 | Ga0209673_10006645 | 207 |
| 381 | 3300025273 | Ga0209673_1000944 | Ga0209673_10009441 | 207 |
| 382 | 3300025284 | Ga0209130_1000118 | Ga0209130_100011878 | 207 |
| 383 | 3300025284 | Ga0209130_1000205 | Ga0209130_100020511 | 207 |
| 384 | 3300025284 | Ga0209130_1000231 | Ga0209130_100023110 | 207 |
| 385 | 3300025284 | Ga0209130_1000332 | Ga0209130_100033246 | 207 |
| 386 | 3300025284 | Ga0209130_1027397 | Ga0209130_10273972 | 207 |
| 387 | 3300025291 | Ga0209675_1000024 | Ga0209675_1000024223 | 207 |
| 388 | 3300025291 | Ga0209675_1000111 | Ga0209675_100011158 | 207 |
| 389 | 3300025291 | Ga0209675_1000677 | Ga0209675_10006775 | 207 |
| 390 | 3300025291 | Ga0209675_1002194 | Ga0209675_100219412 | 207 |
| 391 | 3300025291 | Ga0209675_1004947 | Ga0209675_10049474 | 207 |
| 392 | 3300025291 | Ga0209675_1005028 | Ga0209675_10050284 | 207 |
| 393 | 3300025292 | Ga0209676_1000005 | Ga0209676_1000005284 | 207 |
| 394 | 3300025292 | Ga0209676_1000054 | Ga0209676_100005444 | 207 |
| 395 | 3300025292 | Ga0209676_1000478 | Ga0209676_10004785 | 207 |
| 396 | 3300025292 | Ga0209676_1001275 | Ga0209676_100127516 | 207 |
| 397 | 3300025292 | Ga0209676_1030840 | Ga0209676_10308401 | 207 |
| 398 | 3300025294 | Ga0209025_1000096 | Ga0209025_1000096136 | 207 |
| 399 | 3300025294 | Ga0209025_1000116 | Ga0209025_1000116107 | 207 |
| 400 | 3300025294 | Ga0209025_1000493 | Ga0209025_100049356 | 207 |
| 401 | 3300025294 | Ga0209025_1002157 | Ga0209025_100215730 | 207 |
| 402 | 3300025294 | Ga0209025_1009771 | Ga0209025_10097716 | 207 |
| 403 | 3300025294 | Ga0209025_1010236 | Ga0209025_10102364 | 207 |
| 404 | 3300025294 | Ga0209025_1027558 | Ga0209025_10275583 | 207 |
| 405 | 3300025294 | Ga0209025_1089606 | Ga0209025_10896062 | 207 |
| 406 | 3300025295 | Ga0209564_1000155 | Ga0209564_1000155107 | 207 |
| 407 | 3300025295 | Ga0209564_1000298 | Ga0209564_100029865 | 207 |
| 408 | 3300025295 | Ga0209564_1001181 | Ga0209564_100118116 | 207 |
| 409 | 3300025295 | Ga0209564_1001242 | Ga0209564_100124216 | 207 |
| 410 | 3300025297 | Ga0209758_1000107 | Ga0209758_1000107107 | 207 |
| 411 | 3300025297 | Ga0209758_1011921 | Ga0209758_10119214 | 207 |
| 412 | 3300025297 | Ga0209758_1012663 | Ga0209758_10126635 | 207 |
| 413 | 3300025298 | Ga0209050_1000007 | Ga0209050_1000007813 | 207 |
| 414 | 3300025298 | Ga0209050_1000066 | Ga0209050_100006644 | 207 |
| 415 | 3300025298 | Ga0209050_1001192 | Ga0209050_100119215 | 207 |
| 416 | 3300025298 | Ga0209050_1004030 | Ga0209050_10040302 | 207 |
| 417 | 3300025298 | Ga0209050_1046647 | Ga0209050_10466472 | 207 |
| 418 | 3300025299 | Ga0209256_1000003 | Ga0209256_10000031318 | 207 |
| 419 | 3300025299 | Ga0209256_1000038 | Ga0209256_1000038145 | 207 |
| 420 | 3300025299 | Ga0209256_1000087 | Ga0209256_1000087107 | 207 |
| 421 | 3300025302 | Ga0207426_1000090 | Ga0207426_100009096 | 207 |
| 422 | 3300025302 | Ga0207426_1000123 | Ga0207426_1000123107 | 207 |
| 423 | 3300025302 | Ga0207426_1000197 | Ga0207426_1000197119 | 207 |
| 424 | 3300025303 | Ga0209051_1000009 | Ga0209051_1000009284 | 207 |
| 425 | 3300025303 | Ga0209051_1000044 | Ga0209051_100004444 | 207 |
| 426 | 3300025303 | Ga0209051_1000092 | Ga0209051_100009230 | 207 |
| 427 | 3300025303 | Ga0209051_1000115 | Ga0209051_1000115138 | 207 |
| 428 | 3300025303 | Ga0209051_1000598 | Ga0209051_100059827 | 207 |
| 429 | 3300025303 | Ga0209051_1022825 | Ga0209051_10228253 | 207 |
| 430 | 3300025304 | Ga0209257_1000011 | Ga0209257_1000011258 | 207 |
| 431 | 3300025304 | Ga0209257_1000055 | Ga0209257_1000055173 | 207 |
| 432 | 3300025304 | Ga0209257_1000082 | Ga0209257_100008244 | 207 |
| 433 | 3300025304 | Ga0209257_1000576 | Ga0209257_100057652 | 207 |
| 434 | 3300025304 | Ga0209257_1004829 | Ga0209257_10048298 | 207 |
| 435 | 3300025304 | Ga0209257_1005159 | Ga0209257_10051598 | 207 |
| 436 | 3300025909 | Ga0207705_10054399 | Ga0207705_100543994 | 207 |
| 437 | 3300025909 | Ga0207705_10232500 | Ga0207705_102325002 | 207 |
| 438 | 3300025911 | Ga0207654_10111551 | Ga0207654_101115512 | 207 |
| 439 | 3300025913 | Ga0207695_10075283 | Ga0207695_100752832 | 207 |
| 440 | 3300025914 | Ga0207671_10187463 | Ga0207671_101874632 | 207 |
| 441 | 3300025924 | Ga0207694_10044937 | Ga0207694_100449375 | 207 |
| 442 | 3300025932 | Ga0207690_10068256 | Ga0207690_100682562 | 207 |
| 443 | 3300025934 | Ga0207686_10001449 | Ga0207686_100014496 | 207 |
| 444 | 3300025934 | Ga0207686_10169483 | Ga0207686_101694832 | 207 |
| 445 | 3300025934 | Ga0207686_10328274 | Ga0207686_103282741 | 207 |
| 446 | 3300025935 | Ga0207709_10000112 | Ga0207709_1000011255 | 207 |
| 447 | 3300025942 | Ga0207689_10079531 | Ga0207689_100795312 | 207 |
| 448 | 3300025942 | Ga0207689_10563622 | Ga0207689_105636221 | 207 |
| 449 | 3300025949 | Ga0207667_10350994 | Ga0207667_103509942 | 207 |
| 450 | 3300026023 | Ga0207677_10012494 | Ga0207677_100124945 | 207 |
| 451 | 3300026041 | Ga0207639_10024872 | Ga0207639_100248722 | 207 |
| 452 | 3300026088 | Ga0207641_10477984 | Ga0207641_104779842 | 207 |
| 453 | 3300026116 | Ga0207674_11079463 | Ga0207674_110794631 | 207 |
| 454 | 3300026121 | Ga0207683_10984286 | Ga0207683_109842862 | 207 |
| 455 | 3300026121 | Ga0207683_11314589 | Ga0207683_113145891 | 207 |
| 456 | 3300027111 | Ga0209281_1000020 | Ga0209281_1000020290 | 207 |
| 457 | 3300027424 | Ga0209984_1014278 | Ga0209984_10142782 | 207 |
| 458 | 3300027614 | Ga0209970_1000415 | Ga0209970_10004153 | 207 |
| 459 | 3300027666 | Ga0209282_1000127 | Ga0209282_100012745 | 207 |
| 460 | 3300027666 | Ga0209282_1123307 | Ga0209282_11233072 | 207 |
| 461 | 3300027876 | Ga0209974_10029328 | Ga0209974_100293282 | 207 |
| 462 | 3300027876 | Ga0209974_10053136 | Ga0209974_100531362 | 207 |
| 463 | 3300028573 | Ga0265334_10026852 | Ga0265334_100268521 | 207 |
| 464 | 3300030732 | Ga0316176_1081397 | Ga0316176_10813971 | 207 |
| 465 | 3300030733 | Ga0314311_1026854 | Ga0314311_10268542 | 207 |
| 466 | 3300030742 | Ga0316183_1152609 | Ga0316183_11526092 | 207 |
| 467 | 3300030744 | Ga0316181_1185892 | Ga0316181_11858921 | 207 |
| 468 | 3300031235 | Ga0265330_10000032 | Ga0265330_1000003260 | 207 |
| 469 | 3300031238 | Ga0265332_10000001 | Ga0265332_1000000167 | 207 |
| 470 | 3300031238 | Ga0265332_10008632 | Ga0265332_100086322 | 207 |
| 471 | 3300031241 | Ga0265325_10017822 | Ga0265325_100178223 | 207 |
| 472 | 3300031247 | Ga0265340_10071377 | Ga0265340_100713772 | 207 |
| 473 | 3300031247 | Ga0265340_10072242 | Ga0265340_100722422 | 207 |
| 474 | 3300031251 | Ga0265327_10000842 | Ga0265327_1000084232 | 207 |
| 475 | 3300031251 | Ga0265327_10009661 | Ga0265327_100096615 | 207 |
| 476 | 3300031456 | Ga0307513_10000006 | Ga0307513_10000006362 | 207 |
| 477 | 3300031456 | Ga0307513_10000011 | Ga0307513_1000001120 | 207 |
| 478 | 3300031456 | Ga0307513_10354415 | Ga0307513_103544151 | 207 |
| 479 | 3300031548 | Ga0307408_100000048 | Ga0307408_10000004856 | 207 |
| 480 | 3300031548 | Ga0307408_100005071 | Ga0307408_1000050712 | 207 |
| 481 | 3300031548 | Ga0307408_100005727 | Ga0307408_1000057275 | 207 |
| 482 | 3300031548 | Ga0307408_100027533 | Ga0307408_1000275331 | 207 |
| 483 | 3300031649 | Ga0307514_10024041 | Ga0307514_100240413 | 207 |
| 484 | 3300031711 | Ga0265314_10000022 | Ga0265314_1000002267 | 207 |
| 485 | 3300031711 | Ga0265314_10027819 | Ga0265314_100278192 | 207 |
| 486 | 3300031711 | Ga0265314_10187104 | Ga0265314_101871041 | 207 |
| 487 | 3300031730 | Ga0307516_10210348 | Ga0307516_102103483 | 207 |
| 488 | 3300031824 | Ga0307413_10337263 | Ga0307413_103372632 | 207 |
| 489 | 3300031901 | Ga0307406_10000575 | Ga0307406_1000057513 | 207 |
| 490 | 3300031901 | Ga0307406_10003389 | Ga0307406_100033895 | 207 |
| 491 | 3300031911 | Ga0307412_10003407 | Ga0307412_100034074 | 207 |
| 492 | 3300031911 | Ga0307412_10053482 | Ga0307412_100534822 | 207 |
| 493 | 3300031911 | Ga0307412_10368830 | Ga0307412_103688302 | 207 |
| 494 | 3300031911 | Ga0307412_10487675 | Ga0307412_104876752 | 207 |
| 495 | 3300032002 | Ga0307416_100293906 | Ga0307416_1002939062 | 207 |
| 496 | 3300032002 | Ga0307416_100608617 | Ga0307416_1006086171 | 207 |
| 497 | 3300032004 | Ga0307414_10030245 | Ga0307414_100302453 | 207 |
| 498 | 3300032004 | Ga0307414_10171863 | Ga0307414_101718632 | 207 |
| 499 | 3300032005 | Ga0307411_10161100 | Ga0307411_101611002 | 207 |
| 500 | 3300032005 | Ga0307411_10167987 | Ga0307411_101679872 | 207 |
| 501 | 3300032005 | Ga0307411_10402030 | Ga0307411_104020302 | 207 |
| 502 | 3300032005 | Ga0307411_11259227 | Ga0307411_112592271 | 207 |
| 503 | 3300032126 | Ga0307415_100957934 | Ga0307415_1009579341 | 207 |
| 504 | 3300037312 | Ga0395899_0011805 | Ga0395899_0011805_2478_3116 | 207 |
| 505 | 3300037312 | Ga0395899_0032509 | Ga0395899_0032509_1164_1802 | 207 |
| 506 | 3300037418 | Ga0395900_0009935 | Ga0395900_0009935_152_790 | 207 |
| 507 | 3300037418 | Ga0395900_0120862 | Ga0395900_0120862_1830_2468 | 207 |
| 508 | 3300037418 | Ga0395900_0130517 | Ga0395900_0130517_1205_1843 | 207 |
| 509 | 3300037418 | Ga0395900_0268895 | Ga0395900_0268895_907_1545 | 207 |
| 510 | 3300037466 | Ga0395898_0014216 | Ga0395898_0014216_2738_3376 | 207 |
| 511 | 3300037471 | Ga0395905_0000249 | Ga0395905_0000249_7925_8563 | 207 |
| 512 | 3300037471 | Ga0395905_0000704 | Ga0395905_0000704_13869_14507 | 207 |
| 513 | 3300037471 | Ga0395905_0024829 | Ga0395905_0024829_1416_2051 | 207 |
| 514 | 3300037471 | Ga0395905_0087681 | Ga0395905_0087681_1547_2185 | 207 |
| 515 | 3300037471 | Ga0395905_0185233 | Ga0395905_0185233_279_917 | 207 |
| 516 | 3300037471 | Ga0395905_0336830 | Ga0395905_0336830_685_1323 | 207 |
| 517 | 3300038443 | Ga0395901_0037770 | Ga0395901_0037770_1915_2553 | 207 |
| 518 | 3300038443 | Ga0395901_0044289 | Ga0395901_0044289_427_1065 | 207 |
| 519 | 3300038443 | Ga0395901_0077228 | Ga0395901_0077228_1714_2352 | 207 |
| 520 | 3300038443 | Ga0395901_1125135 | Ga0395901_1125135_16_654 | 207 |
| 521 | 3300039437 | Ga0436365_0442834 | Ga0436365_0442834_730_1368 | 207 |
| 522 | 3300041404 | Ga0439436_0051941 | Ga0439436_0051941_240_878 | 207 |
| 523 | 3300041406 | Ga0439439_0041034 | Ga0439439_0041034_331_969 | 207 |
| 524 | 3300041406 | Ga0439439_0068984 | Ga0439439_0068984_141_779 | 207 |
| 525 | 3300041407 | Ga0439447_051123 | Ga0439447_051123_44_682 | 207 |
| 526 | 3300041413 | Ga0439465_0001001 | Ga0439465_0001001_1761_2399 | 207 |
| 527 | 3300041997 | Ga0439431_0000135 | Ga0439431_0000135_7976_8614 | 207 |
| 528 | 3300041999 | Ga0439433_0005311 | Ga0439433_0005311_1450_2088 | 207 |
| 529 | 3300042006 | Ga0439432_099548 | Ga0439432_099548_177_815 | 207 |
| 530 | 3300042007 | Ga0439449_0002755 | Ga0439449_0002755_3271_3909 | 207 |
| 531 | 3300042007 | Ga0439449_0011957 | Ga0439449_0011957_232_870 | 207 |
| 532 | 3300042015 | Ga0439462_0042294 | Ga0439462_0042294_229_867 | 207 |
| 533 | 3300042134 | Ga0450898_008464 | Ga0450898_008464_837_1475 | 207 |
| 534 | 3300042435 | Ga0439434_0030089 | Ga0439434_0030089_290_928 | 207 |
| 535 | 3300044673 | Ga0453683_0001511 | Ga0453683_0001511_4456_5094 | 207 |
| 536 | 3300044693 | Ga0466961_0196671 | Ga0466961_0196671_500_1138 | 207 |
| 537 | 3300045051 | Ga0451576_0009548 | Ga0451576_0009548_6077_6715 | 207 |
| 538 | 3300046475 | Ga0495639_0003038 | Ga0495639_0003038_2841_3479 | 207 |
| 539 | 3300046512 | Ga0495610_0011303 | Ga0495610_0011303_2364_3002 | 207 |
| 540 | 3300046514 | Ga0495618_0284887 | Ga0495618_0284887_278_913 | 207 |
| 541 | 3300046515 | Ga0495620_0048787 | Ga0495620_0048787_991_1629 | 207 |
| 542 | 3300046525 | Ga0495663_0033616 | Ga0495663_0033616_260_898 | 207 |
| 543 | 3300046539 | Ga0495621_0045216 | Ga0495621_0045216_357_995 | 207 |
| 544 | 3300046539 | Ga0495621_0119144 | Ga0495621_0119144_236_877 | 207 |
| 545 | 3300046542 | Ga0495597_0000251 | Ga0495597_0000251_48087_48725 | 207 |
| 546 | 3300046615 | Ga0495656_0000072 | Ga0495656_0000072_5586_6224 | 207 |
| 547 | 3300046660 | Ga0495625_0054015 | Ga0495625_0054015_217_855 | 207 |
| 548 | 3300046663 | Ga0495635_0187482 | Ga0495635_0187482_690_1328 | 207 |
| 549 | 3300046674 | Ga0495588_0095435 | Ga0495588_0095435_658_1296 | 207 |
| 550 | 3300046691 | Ga0495670_0038087 | Ga0495670_0038087_292_930 | 207 |
| 551 | 3300047321 | Ga0495676_0007228 | Ga0495676_0007228_4116_4754 | 207 |
| 552 | 3300048089 | Ga0495614_0006650 | Ga0495614_0006650_182_820 | 207 |
| 553 | 3300048904 | Ga0496101_0009683 | Ga0496101_0009683_5291_5929 | 207 |
| 554 | 3300048906 | Ga0496103_0032658 | Ga0496103_0032658_2342_2980 | 207 |
| 555 | 3300048907 | Ga0496104_0003204 | Ga0496104_0003204_9259_9897 | 207 |
| 556 | 3300048908 | Ga0496105_0003462 | Ga0496105_0003462_5675_6313 | 207 |
| 557 | 3300048910 | Ga0496107_0020407 | Ga0496107_0020407_1034_1672 | 207 |
| 558 | 3300048910 | Ga0496107_0728200 | Ga0496107_0728200_65_703 | 207 |
| 559 | 3300048911 | Ga0496108_0114489 | Ga0496108_0114489_719_1357 | 207 |
| 560 | 3300048912 | Ga0496109_0337033 | Ga0496109_0337033_207_845 | 207 |
| 561 | 3300048919 | Ga0496116_0052530 | Ga0496116_0052530_571_1209 | 207 |
| 562 | 3300048920 | Ga0496117_0024823 | Ga0496117_0024823_396_1034 | 207 |
| 563 | 3300048924 | Ga0496121_0036698 | Ga0496121_0036698_475_1113 | 207 |
| 564 | 3300048924 | Ga0496121_0167049 | Ga0496121_0167049_924_1562 | 207 |
| 565 | 3300048926 | Ga0496123_0000057 | Ga0496123_0000057_93518_94156 | 207 |
| 566 | 3300048926 | Ga0496123_0034513 | Ga0496123_0034513_2772_3410 | 207 |
| 567 | 3300048927 | Ga0496124_0081990 | Ga0496124_0081990_578_1216 | 207 |
| 568 | 3300048928 | Ga0496125_0033728 | Ga0496125_0033728_412_1050 | 207 |
| 569 | 3300050489 | nmdc:mga03683_81758_c1 | nmdc:mga03683_81758_c1_568_1206 | 207 |
| 570 | 3300053087 | Ga0500643_004495 | Ga0500643_004495_1026_1664 | 207 |
| 571 | 3300053093 | Ga0500651_0000052 | Ga0500651_0000052_40359_40997 | 207 |
| 572 | 3300053122 | Ga0500608_135974 | Ga0500608_135974_318_956 | 207 |
| 573 | 3300053128 | Ga0500626_073827 | Ga0500626_073827_364_1002 | 207 |
| 574 | 3300053133 | Ga0500655_000281 | Ga0500655_000281_7057_7695 | 207 |
| 575 | 3300053134 | Ga0500658_0000033 | Ga0500658_0000033_65514_66152 | 207 |
| 576 | 3300053134 | Ga0500658_0000040 | Ga0500658_0000040_31174_31812 | 207 |
| 577 | 3300053136 | Ga0500559_0006122 | Ga0500559_0006122_4293_4931 | 207 |
| 578 | 3300053139 | Ga0500568_0004186 | Ga0500568_0004186_430_1068 | 207 |
| 579 | 3300053141 | Ga0500574_066915 | Ga0500574_066915_37_675 | 207 |
| 580 | 3300053153 | Ga0500616_0219060 | Ga0500616_0219060_34_672 | 207 |
| 581 | 3300059477 | Ga0587084_048259 | Ga0587084_048259_93_731 | 207 |
| 582 | 3300059508 | Ga0587088_008258 | Ga0587088_008258_820_1455 | 207 |
| 583 | iso_pu_bacteria | 2595698237 | 2596375848 | 207 |
| 584 | iso_pu_bacteria | 2643221614 | 2644087942 | 207 |
| 585 | iso_pu_bacteria | 2643221637 | 2644207495 | 207 |
| 586 | iso_pu_bacteria | 2643221661 | 2644344171 | 207 |
| 587 | iso_pu_bacteria | 2643221666 | 2644367299 | 207 |
| 588 | iso_pu_bacteria | 2643221718 | 2644651244 | 207 |
| 589 | iso_pu_bacteria | 2643221723 | 2644675278 | 207 |
| 590 | iso_pu_bacteria | 2739367756 | 2739790265 | 207 |
| 591 | iso_pu_bacteria | 2896429255 | 2896430966 | 207 |
| 592 | iso_pu_bacteria | 2902330777 | 2902331375 | 207 |
| 593 | iso_pu_bacteria | 2902405164 | 2902408447 | 207 |
| 594 | iso_pu_bacteria | 2928125067 | 2928125394 | 207 |
| 595 | 3300003759 | Ga0055525_1000046 | Ga0055525_100004671 | 208 |
| 596 | 3300003761 | Ga0055535_1001710 | Ga0055535_10017106 | 208 |
| 597 | 3300003763 | Ga0055529_1000306 | Ga0055529_10003066 | 208 |
| 598 | 3300003771 | Ga0055526_1002557 | Ga0055526_100255710 | 208 |
| 599 | 3300003784 | Ga0055534_1000820 | Ga0055534_100082010 | 208 |
| 600 | 3300004625 | Ga0055543_1003203 | Ga0055543_10032031 | 208 |
| 601 | 3300005262 | Ga0065165_1000600 | Ga0065165_100060033 | 208 |
| 602 | 3300005262 | Ga0065165_1001802 | Ga0065165_100180212 | 208 |
| 603 | 3300005288 | Ga0065714_10151557 | Ga0065714_101515572 | 208 |
| 604 | 3300005289 | Ga0065704_10457162 | Ga0065704_104571621 | 208 |
| 605 | 3300005290 | Ga0065712_10250585 | Ga0065712_102505852 | 208 |
| 606 | 3300005295 | Ga0065707_10085375 | Ga0065707_100853754 | 208 |
| 607 | 3300005327 | Ga0070658_10327550 | Ga0070658_103275502 | 208 |
| 608 | 3300005328 | Ga0070676_10124788 | Ga0070676_101247882 | 208 |
| 609 | 3300005328 | Ga0070676_10138541 | Ga0070676_101385411 | 208 |
| 610 | 3300005329 | Ga0070683_100421886 | Ga0070683_1004218862 | 208 |
| 611 | 3300005331 | Ga0070670_100049854 | Ga0070670_1000498544 | 208 |
| 612 | 3300005331 | Ga0070670_100074892 | Ga0070670_1000748922 | 208 |
| 613 | 3300005331 | Ga0070670_100299937 | Ga0070670_1002999372 | 208 |
| 614 | 3300005331 | Ga0070670_100555591 | Ga0070670_1005555911 | 208 |
| 615 | 3300005333 | Ga0070677_10000523 | Ga0070677_1000052310 | 208 |
| 616 | 3300005333 | Ga0070677_10032192 | Ga0070677_100321922 | 208 |
| 617 | 3300005334 | Ga0068869_100008423 | Ga0068869_1000084234 | 208 |
| 618 | 3300005334 | Ga0068869_100249632 | Ga0068869_1002496321 | 208 |
| 619 | 3300005336 | Ga0070680_100006104 | Ga0070680_1000061042 | 208 |
| 620 | 3300005338 | Ga0068868_100001107 | Ga0068868_10000110716 | 208 |
| 621 | 3300005339 | Ga0070660_100259759 | Ga0070660_1002597592 | 208 |
| 622 | 3300005339 | Ga0070660_100406251 | Ga0070660_1004062511 | 208 |
| 623 | 3300005340 | Ga0070689_100318277 | Ga0070689_1003182772 | 208 |
| 624 | 3300005344 | Ga0070661_100000994 | Ga0070661_1000009948 | 208 |
| 625 | 3300005347 | Ga0070668_100008742 | Ga0070668_1000087423 | 208 |
| 626 | 3300005347 | Ga0070668_100129046 | Ga0070668_1001290462 | 208 |
| 627 | 3300005347 | Ga0070668_100576965 | Ga0070668_1005769652 | 208 |
| 628 | 3300005353 | Ga0070669_100012993 | Ga0070669_1000129936 | 208 |
| 629 | 3300005353 | Ga0070669_100040177 | Ga0070669_1000401772 | 208 |
| 630 | 3300005353 | Ga0070669_100265299 | Ga0070669_1002652992 | 208 |
| 631 | 3300005353 | Ga0070669_100267171 | Ga0070669_1002671712 | 208 |
| 632 | 3300005354 | Ga0070675_100002143 | Ga0070675_10000214311 | 208 |
| 633 | 3300005354 | Ga0070675_100002327 | Ga0070675_10000232712 | 208 |
| 634 | 3300005354 | Ga0070675_100091547 | Ga0070675_1000915472 | 208 |
| 635 | 3300005354 | Ga0070675_100133314 | Ga0070675_1001333142 | 208 |
| 636 | 3300005355 | Ga0070671_100003169 | Ga0070671_1000031696 | 208 |
| 637 | 3300005355 | Ga0070671_100011946 | Ga0070671_1000119464 | 208 |
| 638 | 3300005355 | Ga0070671_100022247 | Ga0070671_1000222472 | 208 |
| 639 | 3300005355 | Ga0070671_100250235 | Ga0070671_1002502352 | 208 |
| 640 | 3300005355 | Ga0070671_100342328 | Ga0070671_1003423281 | 208 |
| 641 | 3300005356 | Ga0070674_100034507 | Ga0070674_1000345073 | 208 |
| 642 | 3300005356 | Ga0070674_100044141 | Ga0070674_1000441413 | 208 |
| 643 | 3300005356 | Ga0070674_100182252 | Ga0070674_1001822522 | 208 |
| 644 | 3300005356 | Ga0070674_100348366 | Ga0070674_1003483662 | 208 |
| 645 | 3300005356 | Ga0070674_100406579 | Ga0070674_1004065791 | 208 |
| 646 | 3300005356 | Ga0070674_100452768 | Ga0070674_1004527681 | 208 |
| 647 | 3300005364 | Ga0070673_100007098 | Ga0070673_1000070984 | 208 |
| 648 | 3300005364 | Ga0070673_100021209 | Ga0070673_1000212091 | 208 |
| 649 | 3300005364 | Ga0070673_100043576 | Ga0070673_1000435762 | 208 |
| 650 | 3300005364 | Ga0070673_100174672 | Ga0070673_1001746722 | 208 |
| 651 | 3300005364 | Ga0070673_100182855 | Ga0070673_1001828551 | 208 |
| 652 | 3300005364 | Ga0070673_100186388 | Ga0070673_1001863882 | 208 |
| 653 | 3300005364 | Ga0070673_100767541 | Ga0070673_1007675411 | 208 |
| 654 | 3300005365 | Ga0070688_100473180 | Ga0070688_1004731801 | 208 |
| 655 | 3300005366 | Ga0070659_100000929 | Ga0070659_1000009294 | 208 |
| 656 | 3300005366 | Ga0070659_100324528 | Ga0070659_1003245282 | 208 |
| 657 | 3300005367 | Ga0070667_100480287 | Ga0070667_1004802872 | 208 |
| 658 | 3300005367 | Ga0070667_100732944 | Ga0070667_1007329441 | 208 |
| 659 | 3300005436 | Ga0070713_100858097 | Ga0070713_1008580972 | 208 |
| 660 | 3300005441 | Ga0070700_100170991 | Ga0070700_1001709912 | 208 |
| 661 | 3300005441 | Ga0070700_100315320 | Ga0070700_1003153201 | 208 |
| 662 | 3300005455 | Ga0070663_100012236 | Ga0070663_1000122364 | 208 |
| 663 | 3300005455 | Ga0070663_100451472 | Ga0070663_1004514721 | 208 |
| 664 | 3300005456 | Ga0070678_100004119 | Ga0070678_1000041198 | 208 |
| 665 | 3300005456 | Ga0070678_100359840 | Ga0070678_1003598402 | 208 |
| 666 | 3300005458 | Ga0070681_10269042 | Ga0070681_102690422 | 208 |
| 667 | 3300005459 | Ga0068867_100000048 | Ga0068867_10000004833 | 208 |
| 668 | 3300005459 | Ga0068867_100004827 | Ga0068867_1000048279 | 208 |
| 669 | 3300005459 | Ga0068867_100025498 | Ga0068867_1000254985 | 208 |
| 670 | 3300005459 | Ga0068867_100090559 | Ga0068867_1000905593 | 208 |
| 671 | 3300005459 | Ga0068867_100134811 | Ga0068867_1001348112 | 208 |
| 672 | 3300005459 | Ga0068867_100290668 | Ga0068867_1002906682 | 208 |
| 673 | 3300005530 | Ga0070679_100380720 | Ga0070679_1003807202 | 208 |
| 674 | 3300005543 | Ga0070672_100023179 | Ga0070672_1000231793 | 208 |
| 675 | 3300005543 | Ga0070672_100089641 | Ga0070672_1000896413 | 208 |
| 676 | 3300005543 | Ga0070672_100487623 | Ga0070672_1004876232 | 208 |
| 677 | 3300005547 | Ga0070693_100232520 | Ga0070693_1002325202 | 208 |
| 678 | 3300005548 | Ga0070665_100280727 | Ga0070665_1002807272 | 208 |
| 679 | 3300005548 | Ga0070665_100498020 | Ga0070665_1004980201 | 208 |
| 680 | 3300005563 | Ga0068855_100950038 | Ga0068855_1009500381 | 208 |
| 681 | 3300005564 | Ga0070664_100000282 | Ga0070664_10000028222 | 208 |
| 682 | 3300005564 | Ga0070664_100019344 | Ga0070664_1000193442 | 208 |
| 683 | 3300005577 | Ga0068857_100114219 | Ga0068857_1001142192 | 208 |
| 684 | 3300005616 | Ga0068852_100004013 | Ga0068852_1000040136 | 208 |
| 685 | 3300005616 | Ga0068852_100127977 | Ga0068852_1001279773 | 208 |
| 686 | 3300005616 | Ga0068852_100314395 | Ga0068852_1003143952 | 208 |
| 687 | 3300005616 | Ga0068852_100443706 | Ga0068852_1004437062 | 208 |
| 688 | 3300005616 | Ga0068852_100574432 | Ga0068852_1005744322 | 208 |
| 689 | 3300005616 | Ga0068852_100945954 | Ga0068852_1009459542 | 208 |
| 690 | 3300005617 | Ga0068859_100036992 | Ga0068859_1000369922 | 208 |
| 691 | 3300005617 | Ga0068859_100097644 | Ga0068859_1000976442 | 208 |
| 692 | 3300005618 | Ga0068864_100002769 | Ga0068864_1000027694 | 208 |
| 693 | 3300005618 | Ga0068864_100011909 | Ga0068864_1000119093 | 208 |
| 694 | 3300005618 | Ga0068864_100063454 | Ga0068864_1000634542 | 208 |
| 695 | 3300005719 | Ga0068861_100010229 | Ga0068861_1000102295 | 208 |
| 696 | 3300005719 | Ga0068861_100694602 | Ga0068861_1006946022 | 208 |
| 697 | 3300005834 | Ga0068851_10126671 | Ga0068851_101266712 | 208 |
| 698 | 3300005834 | Ga0068851_10190658 | Ga0068851_101906582 | 208 |
| 699 | 3300005841 | Ga0068863_100014569 | Ga0068863_1000145691 | 208 |
| 700 | 3300005841 | Ga0068863_100358823 | Ga0068863_1003588232 | 208 |
| 701 | 3300005842 | Ga0068858_100002948 | Ga0068858_10000294816 | 208 |
| 702 | 3300005843 | Ga0068860_100000524 | Ga0068860_10000052436 | 208 |
| 703 | 3300005843 | Ga0068860_100011518 | Ga0068860_1000115184 | 208 |
| 704 | 3300005843 | Ga0068860_100509105 | Ga0068860_1005091052 | 208 |
| 705 | 3300005844 | Ga0068862_100082302 | Ga0068862_1000823022 | 208 |
| 706 | 3300006038 | Ga0075365_10005295 | Ga0075365_100052957 | 208 |
| 707 | 3300006048 | Ga0075363_100125351 | Ga0075363_1001253511 | 208 |
| 708 | 3300006186 | Ga0075369_10219067 | Ga0075369_102190671 | 208 |
| 709 | 3300006195 | Ga0075366_10085752 | Ga0075366_100857522 | 208 |
| 710 | 3300006195 | Ga0075366_10134051 | Ga0075366_101340512 | 208 |
| 711 | 3300006195 | Ga0075366_10194514 | Ga0075366_101945142 | 208 |
| 712 | 3300006237 | Ga0097621_100026937 | Ga0097621_1000269374 | 208 |
| 713 | 3300006237 | Ga0097621_100030071 | Ga0097621_1000300714 | 208 |
| 714 | 3300006353 | Ga0075370_10006235 | Ga0075370_100062354 | 208 |
| 715 | 3300006353 | Ga0075370_10008342 | Ga0075370_100083426 | 208 |
| 716 | 3300006353 | Ga0075370_10050137 | Ga0075370_100501373 | 208 |
| 717 | 3300006358 | Ga0068871_100147195 | Ga0068871_1001471952 | 208 |
| 718 | 3300006358 | Ga0068871_100246610 | Ga0068871_1002466102 | 208 |
| 719 | 3300006358 | Ga0068871_100406335 | Ga0068871_1004063352 | 208 |
| 720 | 3300006881 | Ga0068865_100145391 | Ga0068865_1001453913 | 208 |
| 721 | 3300006881 | Ga0068865_100153063 | Ga0068865_1001530633 | 208 |
| 722 | 3300006931 | Ga0097620_100036992 | Ga0097620_1000369922 | 208 |
| 723 | 3300006931 | Ga0097620_100097647 | Ga0097620_1000976472 | 208 |
| 724 | 3300009093 | Ga0105240_10385039 | Ga0105240_103850391 | 208 |
| 725 | 3300009098 | Ga0105245_10731934 | Ga0105245_107319342 | 208 |
| 726 | 3300009176 | Ga0105242_10236947 | Ga0105242_102369472 | 208 |
| 727 | 3300009177 | Ga0105248_10006497 | Ga0105248_100064975 | 208 |
| 728 | 3300009177 | Ga0105248_10028876 | Ga0105248_100288764 | 208 |
| 729 | 3300009551 | Ga0105238_10177187 | Ga0105238_101771873 | 208 |
| 730 | 3300009551 | Ga0105238_10556574 | Ga0105238_105565742 | 208 |
| 731 | 3300009551 | Ga0105238_10977881 | Ga0105238_109778811 | 208 |
| 732 | 3300009553 | Ga0105249_10132588 | Ga0105249_101325883 | 208 |
| 733 | 3300009553 | Ga0105249_11837142 | Ga0105249_118371421 | 208 |
| 734 | 3300013296 | Ga0157374_10139935 | Ga0157374_101399354 | 208 |
| 735 | 3300013297 | Ga0157378_10020749 | Ga0157378_100207493 | 208 |
| 736 | 3300013306 | Ga0163162_10003717 | Ga0163162_1000371716 | 208 |
| 737 | 3300013306 | Ga0163162_10020731 | Ga0163162_100207315 | 208 |
| 738 | 3300013306 | Ga0163162_10084914 | Ga0163162_100849142 | 208 |
| 739 | 3300013306 | Ga0163162_10318325 | Ga0163162_103183252 | 208 |
| 740 | 3300013307 | Ga0157372_10081286 | Ga0157372_100812862 | 208 |
| 741 | 3300013308 | Ga0157375_10198861 | Ga0157375_101988613 | 208 |
| 742 | 3300013308 | Ga0157375_10491870 | Ga0157375_104918702 | 208 |
| 743 | 3300013308 | Ga0157375_10516563 | Ga0157375_105165632 | 208 |
| 744 | 3300014325 | Ga0163163_10008501 | Ga0163163_100085012 | 208 |
| 745 | 3300014968 | Ga0157379_10025217 | Ga0157379_100252174 | 208 |
| 746 | 3300014968 | Ga0157379_10029132 | Ga0157379_100291322 | 208 |
| 747 | 3300014968 | Ga0157379_10082697 | Ga0157379_100826973 | 208 |
| 748 | 3300014969 | Ga0157376_10278536 | Ga0157376_102785362 | 208 |
| 749 | 3300014969 | Ga0157376_10295651 | Ga0157376_102956512 | 208 |
| 750 | 3300017792 | Ga0163161_10021781 | Ga0163161_100217815 | 208 |
| 751 | 3300021361 | Ga0213872_10000051 | Ga0213872_1000005166 | 208 |
| 752 | 3300021361 | Ga0213872_10000060 | Ga0213872_1000006082 | 208 |
| 753 | 3300021361 | Ga0213872_10000632 | Ga0213872_100006326 | 208 |
| 754 | 3300021361 | Ga0213872_10002848 | Ga0213872_100028486 | 208 |
| 755 | 3300021361 | Ga0213872_10018060 | Ga0213872_100180601 | 208 |
| 756 | 3300025230 | Ga0209563_100005 | Ga0209563_100005809 | 208 |
| 757 | 3300025242 | Ga0209258_100960 | Ga0209258_1009609 | 208 |
| 758 | 3300025245 | Ga0207425_1010697 | Ga0207425_10106972 | 208 |
| 759 | 3300025253 | Ga0209677_101739 | Ga0209677_1017398 | 208 |
| 760 | 3300025254 | Ga0209148_1016130 | Ga0209148_10161302 | 208 |
| 761 | 3300025256 | Ga0209759_1001021 | Ga0209759_10010219 | 208 |
| 762 | 3300025256 | Ga0209759_1022906 | Ga0209759_10229062 | 208 |
| 763 | 3300025256 | Ga0209759_1029416 | Ga0209759_10294162 | 208 |
| 764 | 3300025272 | Ga0209455_1000128 | Ga0209455_1000128153 | 208 |
| 765 | 3300025273 | Ga0209673_1008587 | Ga0209673_10085872 | 208 |
| 766 | 3300025273 | Ga0209673_1046346 | Ga0209673_10463461 | 208 |
| 767 | 3300025284 | Ga0209130_1005762 | Ga0209130_10057622 | 208 |
| 768 | 3300025291 | Ga0209675_1001309 | Ga0209675_10013098 | 208 |
| 769 | 3300025292 | Ga0209676_1040847 | Ga0209676_10408471 | 208 |
| 770 | 3300025295 | Ga0209564_1000005 | Ga0209564_100000528 | 208 |
| 771 | 3300025295 | Ga0209564_1045708 | Ga0209564_10457082 | 208 |
| 772 | 3300025298 | Ga0209050_1004615 | Ga0209050_10046154 | 208 |
| 773 | 3300025299 | Ga0209256_1000078 | Ga0209256_1000078161 | 208 |
| 774 | 3300025299 | Ga0209256_1001512 | Ga0209256_100151212 | 208 |
| 775 | 3300025303 | Ga0209051_1001071 | Ga0209051_10010713 | 208 |
| 776 | 3300025304 | Ga0209257_1000978 | Ga0209257_100097820 | 208 |
| 777 | 3300025304 | Ga0209257_1001479 | Ga0209257_100147921 | 208 |
| 778 | 3300025321 | Ga0207656_10070612 | Ga0207656_100706122 | 208 |
| 779 | 3300025903 | Ga0207680_10011979 | Ga0207680_100119792 | 208 |
| 780 | 3300025907 | Ga0207645_10004606 | Ga0207645_100046066 | 208 |
| 781 | 3300025907 | Ga0207645_10085170 | Ga0207645_100851703 | 208 |
| 782 | 3300025909 | Ga0207705_10058677 | Ga0207705_100586772 | 208 |
| 783 | 3300025909 | Ga0207705_10225361 | Ga0207705_102253612 | 208 |
| 784 | 3300025912 | Ga0207707_10768950 | Ga0207707_107689501 | 208 |
| 785 | 3300025914 | Ga0207671_10306396 | Ga0207671_103063962 | 208 |
| 786 | 3300025919 | Ga0207657_10031155 | Ga0207657_100311557 | 208 |
| 787 | 3300025919 | Ga0207657_10090441 | Ga0207657_100904412 | 208 |
| 788 | 3300025920 | Ga0207649_10001607 | Ga0207649_100016073 | 208 |
| 789 | 3300025920 | Ga0207649_10014094 | Ga0207649_100140942 | 208 |
| 790 | 3300025920 | Ga0207649_10545329 | Ga0207649_105453292 | 208 |
| 791 | 3300025921 | Ga0207652_10010127 | Ga0207652_100101274 | 208 |
| 792 | 3300025921 | Ga0207652_10351826 | Ga0207652_103518262 | 208 |
| 793 | 3300025924 | Ga0207694_10801042 | Ga0207694_108010422 | 208 |
| 794 | 3300025925 | Ga0207650_10001122 | Ga0207650_100011224 | 208 |
| 795 | 3300025925 | Ga0207650_10599609 | Ga0207650_105996091 | 208 |
| 796 | 3300025925 | Ga0207650_10958335 | Ga0207650_109583351 | 208 |
| 797 | 3300025925 | Ga0207650_11044370 | Ga0207650_110443701 | 208 |
| 798 | 3300025926 | Ga0207659_10000333 | Ga0207659_100003336 | 208 |
| 799 | 3300025926 | Ga0207659_10000725 | Ga0207659_100007254 | 208 |
| 800 | 3300025926 | Ga0207659_10022085 | Ga0207659_100220852 | 208 |
| 801 | 3300025926 | Ga0207659_10144382 | Ga0207659_101443822 | 208 |
| 802 | 3300025926 | Ga0207659_10204591 | Ga0207659_102045912 | 208 |
| 803 | 3300025931 | Ga0207644_10002789 | Ga0207644_100027897 | 208 |
| 804 | 3300025931 | Ga0207644_10003511 | Ga0207644_100035118 | 208 |
| 805 | 3300025931 | Ga0207644_10047328 | Ga0207644_100473282 | 208 |
| 806 | 3300025931 | Ga0207644_10072487 | Ga0207644_100724872 | 208 |
| 807 | 3300025931 | Ga0207644_10240434 | Ga0207644_102404342 | 208 |
| 808 | 3300025932 | Ga0207690_10001881 | Ga0207690_100018818 | 208 |
| 809 | 3300025932 | Ga0207690_10076710 | Ga0207690_100767102 | 208 |
| 810 | 3300025932 | Ga0207690_10283359 | Ga0207690_102833592 | 208 |
| 811 | 3300025934 | Ga0207686_10039242 | Ga0207686_100392423 | 208 |
| 812 | 3300025935 | Ga0207709_10001810 | Ga0207709_100018104 | 208 |
| 813 | 3300025935 | Ga0207709_10108818 | Ga0207709_101088182 | 208 |
| 814 | 3300025936 | Ga0207670_10228915 | Ga0207670_102289152 | 208 |
| 815 | 3300025937 | Ga0207669_10103836 | Ga0207669_101038361 | 208 |
| 816 | 3300025937 | Ga0207669_10174610 | Ga0207669_101746102 | 208 |
| 817 | 3300025937 | Ga0207669_10301771 | Ga0207669_103017712 | 208 |
| 818 | 3300025940 | Ga0207691_10002459 | Ga0207691_1000245911 | 208 |
| 819 | 3300025940 | Ga0207691_10102062 | Ga0207691_101020623 | 208 |
| 820 | 3300025940 | Ga0207691_10221545 | Ga0207691_102215452 | 208 |
| 821 | 3300025940 | Ga0207691_10270086 | Ga0207691_102700861 | 208 |
| 822 | 3300025941 | Ga0207711_10011843 | Ga0207711_100118434 | 208 |
| 823 | 3300025941 | Ga0207711_10030939 | Ga0207711_100309393 | 208 |
| 824 | 3300025942 | Ga0207689_10031365 | Ga0207689_100313652 | 208 |
| 825 | 3300025942 | Ga0207689_10197185 | Ga0207689_101971853 | 208 |
| 826 | 3300025945 | Ga0207679_10000225 | Ga0207679_1000022543 | 208 |
| 827 | 3300025960 | Ga0207651_10027621 | Ga0207651_100276214 | 208 |
| 828 | 3300025960 | Ga0207651_10076827 | Ga0207651_100768272 | 208 |
| 829 | 3300025960 | Ga0207651_10178377 | Ga0207651_101783772 | 208 |
| 830 | 3300025961 | Ga0207712_10009979 | Ga0207712_100099793 | 208 |
| 831 | 3300025961 | Ga0207712_10174343 | Ga0207712_101743431 | 208 |
| 832 | 3300025981 | Ga0207640_10319771 | Ga0207640_103197712 | 208 |
| 833 | 3300025986 | Ga0207658_10010270 | Ga0207658_100102705 | 208 |
| 834 | 3300025986 | Ga0207658_10053260 | Ga0207658_100532601 | 208 |
| 835 | 3300025986 | Ga0207658_10353477 | Ga0207658_103534772 | 208 |
| 836 | 3300026023 | Ga0207677_10003064 | Ga0207677_100030648 | 208 |
| 837 | 3300026023 | Ga0207677_10041078 | Ga0207677_100410782 | 208 |
| 838 | 3300026035 | Ga0207703_10071820 | Ga0207703_100718204 | 208 |
| 839 | 3300026041 | Ga0207639_10089385 | Ga0207639_100893853 | 208 |
| 840 | 3300026075 | Ga0207708_10107984 | Ga0207708_101079842 | 208 |
| 841 | 3300026075 | Ga0207708_10226676 | Ga0207708_102266763 | 208 |
| 842 | 3300026075 | Ga0207708_10236071 | Ga0207708_102360711 | 208 |
| 843 | 3300026078 | Ga0207702_10221863 | Ga0207702_102218632 | 208 |
| 844 | 3300026088 | Ga0207641_10056121 | Ga0207641_100561213 | 208 |
| 845 | 3300026089 | Ga0207648_10000319 | Ga0207648_1000031953 | 208 |
| 846 | 3300026089 | Ga0207648_10000492 | Ga0207648_1000049233 | 208 |
| 847 | 3300026089 | Ga0207648_10029637 | Ga0207648_100296375 | 208 |
| 848 | 3300026089 | Ga0207648_10152670 | Ga0207648_101526703 | 208 |
| 849 | 3300026095 | Ga0207676_10001271 | Ga0207676_1000127117 | 208 |
| 850 | 3300026118 | Ga0207675_100007230 | Ga0207675_1000072305 | 208 |
| 851 | 3300026118 | Ga0207675_100712457 | Ga0207675_1007124572 | 208 |
| 852 | 3300026121 | Ga0207683_10005156 | Ga0207683_100051567 | 208 |
| 853 | 3300026121 | Ga0207683_10006290 | Ga0207683_100062905 | 208 |
| 854 | 3300026121 | Ga0207683_10036312 | Ga0207683_100363122 | 208 |
| 855 | 3300026121 | Ga0207683_10099365 | Ga0207683_100993652 | 208 |
| 856 | 3300026121 | Ga0207683_10121982 | Ga0207683_101219822 | 208 |
| 857 | 3300026121 | Ga0207683_10407401 | Ga0207683_104074012 | 208 |
| 858 | 3300026142 | Ga0207698_10003576 | Ga0207698_100035765 | 208 |
| 859 | 3300026142 | Ga0207698_10063424 | Ga0207698_100634242 | 208 |
| 860 | 3300026142 | Ga0207698_10174145 | Ga0207698_101741453 | 208 |
| 861 | 3300026142 | Ga0207698_10225014 | Ga0207698_102250141 | 208 |
| 862 | 3300026142 | Ga0207698_10522221 | Ga0207698_105222212 | 208 |
| 863 | 3300027296 | Ga0209389_1007187 | Ga0209389_10071873 | 208 |
| 864 | 3300027312 | Ga0209371_1018881 | Ga0209371_10188812 | 208 |
| 865 | 3300027395 | Ga0209996_1000765 | Ga0209996_10007654 | 208 |
| 866 | 3300027526 | Ga0209968_1000652 | Ga0209968_10006525 | 208 |
| 867 | 3300027695 | Ga0209966_1000005 | Ga0209966_100000577 | 208 |
| 868 | 3300028379 | Ga0268266_10538720 | Ga0268266_105387202 | 208 |
| 869 | 3300028379 | Ga0268266_11042751 | Ga0268266_110427511 | 208 |
| 870 | 3300028380 | Ga0268265_10003864 | Ga0268265_100038643 | 208 |
| 871 | 3300028381 | Ga0268264_10001666 | Ga0268264_100016669 | 208 |
| 872 | 3300028381 | Ga0268264_10233019 | Ga0268264_102330192 | 208 |
| 873 | 3300028381 | Ga0268264_11198878 | Ga0268264_111988781 | 208 |
| 874 | 3300028786 | Ga0307517_10097661 | Ga0307517_100976613 | 208 |
| 875 | 3300028794 | Ga0307515_10000459 | Ga0307515_1000045924 | 208 |
| 876 | 3300028794 | Ga0307515_10001963 | Ga0307515_1000196330 | 208 |
| 877 | 3300028794 | Ga0307515_10014710 | Ga0307515_100147106 | 208 |
| 878 | 3300028794 | Ga0307515_10026050 | Ga0307515_100260503 | 208 |
| 879 | 3300028794 | Ga0307515_10033350 | Ga0307515_1003335010 | 208 |
| 880 | 3300028794 | Ga0307515_10123381 | Ga0307515_101233812 | 208 |
| 881 | 3300028794 | Ga0307515_10238926 | Ga0307515_102389262 | 208 |
| 882 | 3300029957 | Ga0265324_10018140 | Ga0265324_100181402 | 208 |
| 883 | 3300030500 | Ga0268256_1025697 | Ga0268256_10256971 | 208 |
| 884 | 3300030522 | Ga0307512_10113847 | Ga0307512_101138472 | 208 |
| 885 | 3300030522 | Ga0307512_10310328 | Ga0307512_103103281 | 208 |
| 886 | 3300031238 | Ga0265332_10000014 | Ga0265332_10000014123 | 208 |
| 887 | 3300031240 | Ga0265320_10025753 | Ga0265320_100257532 | 208 |
| 888 | 3300031250 | Ga0265331_10013807 | Ga0265331_100138072 | 208 |
| 889 | 3300031251 | Ga0265327_10000028 | Ga0265327_1000002825 | 208 |
| 890 | 3300031456 | Ga0307513_10008993 | Ga0307513_100089932 | 208 |
| 891 | 3300031456 | Ga0307513_10141275 | Ga0307513_101412752 | 208 |
| 892 | 3300031456 | Ga0307513_10177890 | Ga0307513_101778903 | 208 |
| 893 | 3300031456 | Ga0307513_10221498 | Ga0307513_102214981 | 208 |
| 894 | 3300031507 | Ga0307509_10000120 | Ga0307509_1000012069 | 208 |
| 895 | 3300031507 | Ga0307509_10060404 | Ga0307509_100604045 | 208 |
| 896 | 3300031507 | Ga0307509_10100657 | Ga0307509_101006572 | 208 |
| 897 | 3300031548 | Ga0307408_100000046 | Ga0307408_10000004685 | 208 |
| 898 | 3300031548 | Ga0307408_100012484 | Ga0307408_1000124842 | 208 |
| 899 | 3300031548 | Ga0307408_100049122 | Ga0307408_1000491221 | 208 |
| 900 | 3300031548 | Ga0307408_100154703 | Ga0307408_1001547032 | 208 |
| 901 | 3300031548 | Ga0307408_100241318 | Ga0307408_1002413182 | 208 |
| 902 | 3300031548 | Ga0307408_100281943 | Ga0307408_1002819431 | 208 |
| 903 | 3300031548 | Ga0307408_100374721 | Ga0307408_1003747212 | 208 |
| 904 | 3300031548 | Ga0307408_101257036 | Ga0307408_1012570361 | 208 |
| 905 | 3300031616 | Ga0307508_10000163 | Ga0307508_1000016337 | 208 |
| 906 | 3300031616 | Ga0307508_10078880 | Ga0307508_100788802 | 208 |
| 907 | 3300031616 | Ga0307508_10120167 | Ga0307508_101201672 | 208 |
| 908 | 3300031649 | Ga0307514_10000225 | Ga0307514_10000225126 | 208 |
| 909 | 3300031730 | Ga0307516_10000446 | Ga0307516_100004464 | 208 |
| 910 | 3300031730 | Ga0307516_10003308 | Ga0307516_100033082 | 208 |
| 911 | 3300031730 | Ga0307516_10004343 | Ga0307516_1000434317 | 208 |
| 912 | 3300031730 | Ga0307516_10014293 | Ga0307516_100142935 | 208 |
| 913 | 3300031730 | Ga0307516_10076972 | Ga0307516_100769722 | 208 |
| 914 | 3300031730 | Ga0307516_10137321 | Ga0307516_101373212 | 208 |
| 915 | 3300031730 | Ga0307516_10325589 | Ga0307516_103255892 | 208 |
| 916 | 3300031730 | Ga0307516_10579188 | Ga0307516_105791882 | 208 |
| 917 | 3300031731 | Ga0307405_10042818 | Ga0307405_100428182 | 208 |
| 918 | 3300031731 | Ga0307405_10108573 | Ga0307405_101085731 | 208 |
| 919 | 3300031731 | Ga0307405_10749787 | Ga0307405_107497871 | 208 |
| 920 | 3300031824 | Ga0307413_10001777 | Ga0307413_1000177710 | 208 |
| 921 | 3300031852 | Ga0307410_10169218 | Ga0307410_101692181 | 208 |
| 922 | 3300031852 | Ga0307410_10280996 | Ga0307410_102809962 | 208 |
| 923 | 3300031852 | Ga0307410_10428096 | Ga0307410_104280961 | 208 |
| 924 | 3300031852 | Ga0307410_10490870 | Ga0307410_104908701 | 208 |
| 925 | 3300031911 | Ga0307412_10113530 | Ga0307412_101135302 | 208 |
| 926 | 3300031995 | Ga0307409_100309358 | Ga0307409_1003093582 | 208 |
| 927 | 3300031995 | Ga0307409_100380848 | Ga0307409_1003808482 | 208 |
| 928 | 3300032002 | Ga0307416_100010513 | Ga0307416_1000105133 | 208 |
| 929 | 3300032004 | Ga0307414_10022421 | Ga0307414_100224212 | 208 |
| 930 | 3300032005 | Ga0307411_10033683 | Ga0307411_100336832 | 208 |
| 931 | 3300032126 | Ga0307415_100005526 | Ga0307415_1000055265 | 208 |
| 932 | 3300033179 | Ga0307507_10074397 | Ga0307507_100743973 | 208 |
| 933 | 3300033179 | Ga0307507_10293737 | Ga0307507_102937372 | 208 |
| 934 | 3300033180 | Ga0307510_10002394 | Ga0307510_100023942 | 208 |
| 935 | 3300033180 | Ga0307510_10052763 | Ga0307510_100527635 | 208 |
| 936 | 3300035114 | Ga0373939_0000004 | Ga0373939_0000004_55857_56495 | 208 |
| 937 | 3300035114 | Ga0373939_0186460 | Ga0373939_0186460_25_666 | 208 |
| 938 | 3300035121 | Ga0373960_0001434 | Ga0373960_0001434_499_1137 | 208 |
| 939 | 3300035691 | Ga0373931_0001005 | Ga0373931_0001005_9094_9732 | 208 |
| 940 | 3300037068 | Ga0373925_0018543 | Ga0373925_0018543_3458_4096 | 208 |
| 941 | 3300037418 | Ga0395900_0079898 | Ga0395900_0079898_2467_3108 | 208 |
| 942 | 3300037418 | Ga0395900_0086114 | Ga0395900_0086114_2351_2992 | 208 |
| 943 | 3300037466 | Ga0395898_0000337 | Ga0395898_0000337_17046_17687 | 208 |
| 944 | 3300037471 | Ga0395905_0052002 | Ga0395905_0052002_1943_2581 | 208 |
| 945 | 3300038443 | Ga0395901_0311600 | Ga0395901_0311600_311_952 | 208 |
| 946 | 3300039447 | Ga0436361_0120947 | Ga0436361_0120947_6534_7172 | 208 |
| 947 | 3300039447 | Ga0436361_0174260 | Ga0436361_0174260_98595_99233 | 208 |
| 948 | 3300039447 | Ga0436361_0292057 | Ga0436361_0292057_20175_20813 | 208 |
| 949 | 3300039447 | Ga0436361_0829339 | Ga0436361_0829339_285_923 | 208 |
| 950 | 3300039447 | Ga0436361_0939166 | Ga0436361_0939166_83249_83887 | 208 |
| 951 | 3300042115 | Ga0450911_000860 | Ga0450911_000860_3993_4631 | 208 |
| 952 | 3300042119 | Ga0450915_006225 | Ga0450915_006225_41_679 | 208 |
| 953 | 3300042120 | Ga0450917_001159 | Ga0450917_001159_437_1075 | 208 |
| 954 | 3300042126 | Ga0450888_000211 | Ga0450888_000211_922_1560 | 208 |
| 955 | 3300042127 | Ga0450890_002103 | Ga0450890_002103_2094_2732 | 208 |
| 956 | 3300042127 | Ga0450890_002841 | Ga0450890_002841_1541_2179 | 208 |
| 957 | 3300042129 | Ga0450891_002311 | Ga0450891_002311_909_1547 | 208 |
| 958 | 3300042130 | Ga0450892_000342 | Ga0450892_000342_2847_3485 | 208 |
| 959 | 3300042144 | Ga0450889_000406 | Ga0450889_000406_101_739 | 208 |
| 960 | 3300042438 | Ga0439459_0000732 | Ga0439459_0000732_908_1546 | 208 |
| 961 | 3300042439 | Ga0439464_0009922 | Ga0439464_0009922_942_1580 | 208 |
| 962 | 3300042532 | Ga0450893_0003052 | Ga0450893_0003052_1863_2501 | 208 |
| 963 | 3300042876 | Ga0451577_0007579 | Ga0451577_0007579_8868_9506 | 208 |
| 964 | 3300042876 | Ga0451577_0012178 | Ga0451577_0012178_4622_5260 | 208 |
| 965 | 3300042876 | Ga0451577_0014424 | Ga0451577_0014424_5409_6050 | 208 |
| 966 | 3300044673 | Ga0453683_0040629 | Ga0453683_0040629_1484_2122 | 208 |
| 967 | 3300044712 | Ga0453684_0713817 | Ga0453684_0713817_56_694 | 208 |
| 968 | 3300045051 | Ga0451576_0030419 | Ga0451576_0030419_2586_3224 | 208 |
| 969 | 3300045051 | Ga0451576_0065938 | Ga0451576_0065938_2845_3483 | 208 |
| 970 | 3300046516 | Ga0495628_0125817 | Ga0495628_0125817_140_778 | 208 |
| 971 | 3300046519 | Ga0495632_0030570 | Ga0495632_0030570_337_975 | 208 |
| 972 | 3300046522 | Ga0495643_0126760 | Ga0495643_0126760_569_1207 | 208 |
| 973 | 3300046543 | Ga0495645_0289206 | Ga0495645_0289206_110_751 | 208 |
| 974 | 3300046660 | Ga0495625_0027726 | Ga0495625_0027726_2655_3314 | 208 |
| 975 | 3300046810 | Ga0495660_0090374 | Ga0495660_0090374_786_1445 | 208 |
| 976 | 3300047321 | Ga0495676_0007289 | Ga0495676_0007289_4947_5585 | 208 |
| 977 | 3300047472 | Ga0495686_0010836 | Ga0495686_0010836_1389_2027 | 208 |
| 978 | 3300048924 | Ga0496121_0006746 | Ga0496121_0006746_11931_12569 | 208 |
| 979 | 3300048927 | Ga0496124_0298057 | Ga0496124_0298057_455_1093 | 208 |
| 980 | 3300049569 | Ga0501032_0409307 | Ga0501032_0409307_14_652 | 208 |
| 981 | 3300049649 | Ga0501198_000021 | Ga0501198_000021_60347_60985 | 208 |
| 982 | 3300049662 | Ga0501222_000018 | Ga0501222_000018_9672_10310 | 208 |
| 983 | 3300049706 | Ga0501229_013039 | Ga0501229_013039_412_1050 | 208 |
| 984 | 3300049823 | Ga0501044_0032525 | Ga0501044_0032525_4697_5335 | 208 |
| 985 | 3300050493 | nmdc:mga0k408_119132_c1 | nmdc:mga0k408_119132_c1_445_1083 | 208 |
| 986 | 3300050493 | nmdc:mga0k408_5324_c1 | nmdc:mga0k408_5324_c1_3324_3962 | 208 |
| 987 | 3300050496 | nmdc:mga07m45_3456_c1 | nmdc:mga07m45_3456_c1_5206_5844 | 208 |
| 988 | 3300053088 | Ga0500644_0118860 | Ga0500644_0118860_190_828 | 208 |
| 989 | 3300053118 | Ga0500594_0028715 | Ga0500594_0028715_438_1076 | 208 |
| 990 | 3300053136 | Ga0500559_0000011 | Ga0500559_0000011_55383_56021 | 208 |
| 991 | 3300053148 | Ga0500590_001152 | Ga0500590_001152_9529_10167 | 208 |
| 992 | 3300053154 | Ga0500619_000035 | Ga0500619_000035_40643_41284 | 208 |
| 993 | 3300053156 | Ga0500622_0013799 | Ga0500622_0013799_3684_4322 | 208 |
| 994 | 3300053156 | Ga0500622_0017687 | Ga0500622_0017687_509_1168 | 208 |
| 995 | 3300053156 | Ga0500622_0018708 | Ga0500622_0018708_2615_3253 | 208 |
| 996 | 3300059424 | Ga0590075_036627 | Ga0590075_036627_467_1105 | 208 |
| 997 | 3300059426 | Ga0590077_033052 | Ga0590077_033052_483_1124 | 208 |
| 998 | 3300001991 | JGI24743J22301_10001118 | JGI24743J22301_100011183 | 209 |
| 999 | 3300002737 | JGI25162J39368_1000001 | JGI25162J39368_1000001671 | 209 |
| 1000 | 3300002737 | JGI25162J39368_1006819 | JGI25162J39368_10068192 | 209 |
| 1001 | 3300002772 | JGI25164J39214_1001808 | JGI25164J39214_10018081 | 209 |
| 1002 | 3300003214 | JGI25165J46597_1000001 | JGI25165J46597_1000001655 | 209 |
| 1003 | 3300003215 | JGI25153J46596_10021825 | JGI25153J46596_100218252 | 209 |
| 1004 | 3300003544 | Ga0007417J51691_1023165 | Ga0007417J51691_10231652 | 209 |
| 1005 | 3300003574 | Ga0007410J51695_1034713 | Ga0007410J51695_10347132 | 209 |
| 1006 | 3300003575 | Ga0007409J51694_1016496 | Ga0007409J51694_10164962 | 209 |
| 1007 | 3300003577 | Ga0007416J51690_1013575 | Ga0007416J51690_10135752 | 209 |
| 1008 | 3300003577 | Ga0007416J51690_1033019 | Ga0007416J51690_10330192 | 209 |
| 1009 | 3300003611 | Ga0007411J51799_112918 | Ga0007411J51799_1129182 | 209 |
| 1010 | 3300003693 | Ga0032354_1022659 | Ga0032354_10226593 | 209 |
| 1011 | 3300003751 | Ga0055538_1000001 | Ga0055538_1000001379 | 209 |
| 1012 | 3300003752 | Ga0055539_1000001 | Ga0055539_1000001379 | 209 |
| 1013 | 3300003756 | Ga0055533_1000003 | Ga0055533_1000003655 | 209 |
| 1014 | 3300003759 | Ga0055525_1000001 | Ga0055525_1000001754 | 209 |
| 1015 | 3300003759 | Ga0055525_1000003 | Ga0055525_1000003655 | 209 |
| 1016 | 3300003761 | Ga0055535_1003636 | Ga0055535_10036362 | 209 |
| 1017 | 3300003763 | Ga0055529_1000032 | Ga0055529_100003235 | 209 |
| 1018 | 3300003771 | Ga0055526_1000951 | Ga0055526_100095117 | 209 |
| 1019 | 3300003773 | Ga0055537_1000030 | Ga0055537_100003075 | 209 |
| 1020 | 3300003775 | Ga0055524_1002681 | Ga0055524_100268113 | 209 |
| 1021 | 3300003784 | Ga0055534_1000447 | Ga0055534_10004473 | 209 |
| 1022 | 3300003790 | Ga0055528_1000439 | Ga0055528_100043916 | 209 |
| 1023 | 3300003841 | Ga0055541_1000001 | Ga0055541_1000001655 | 209 |
| 1024 | 3300005327 | Ga0070658_10009563 | Ga0070658_100095634 | 209 |
| 1025 | 3300005327 | Ga0070658_10080132 | Ga0070658_100801323 | 209 |
| 1026 | 3300005329 | Ga0070683_100001966 | Ga0070683_1000019666 | 209 |
| 1027 | 3300005329 | Ga0070683_100036898 | Ga0070683_1000368982 | 209 |
| 1028 | 3300005331 | Ga0070670_100002397 | Ga0070670_10000239716 | 209 |
| 1029 | 3300005334 | Ga0068869_100010764 | Ga0068869_1000107643 | 209 |
| 1030 | 3300005335 | Ga0070666_10084706 | Ga0070666_100847063 | 209 |
| 1031 | 3300005338 | Ga0068868_100000004 | Ga0068868_100000004118 | 209 |
| 1032 | 3300005339 | Ga0070660_100176833 | Ga0070660_1001768331 | 209 |
| 1033 | 3300005344 | Ga0070661_100006933 | Ga0070661_1000069334 | 209 |
| 1034 | 3300005353 | Ga0070669_100049127 | Ga0070669_1000491274 | 209 |
| 1035 | 3300005353 | Ga0070669_100201034 | Ga0070669_1002010342 | 209 |
| 1036 | 3300005355 | Ga0070671_100009039 | Ga0070671_1000090393 | 209 |
| 1037 | 3300005366 | Ga0070659_100006995 | Ga0070659_1000069955 | 209 |
| 1038 | 3300005366 | Ga0070659_100259547 | Ga0070659_1002595472 | 209 |
| 1039 | 3300005367 | Ga0070667_100001557 | Ga0070667_1000015576 | 209 |
| 1040 | 3300005436 | Ga0070713_100089448 | Ga0070713_1000894482 | 209 |
| 1041 | 3300005439 | Ga0070711_100071388 | Ga0070711_1000713882 | 209 |
| 1042 | 3300005439 | Ga0070711_100747873 | Ga0070711_1007478731 | 209 |
| 1043 | 3300005466 | Ga0070685_10191940 | Ga0070685_101919402 | 209 |
| 1044 | 3300005468 | Ga0070707_100181678 | Ga0070707_1001816784 | 209 |
| 1045 | 3300005471 | Ga0070698_100095994 | Ga0070698_1000959941 | 209 |
| 1046 | 3300005535 | Ga0070684_100004982 | Ga0070684_1000049822 | 209 |
| 1047 | 3300005539 | Ga0068853_100385407 | Ga0068853_1003854072 | 209 |
| 1048 | 3300005543 | Ga0070672_100049884 | Ga0070672_1000498843 | 209 |
| 1049 | 3300005548 | Ga0070665_100033278 | Ga0070665_1000332783 | 209 |
| 1050 | 3300005563 | Ga0068855_100004740 | Ga0068855_1000047409 | 209 |
| 1051 | 3300005563 | Ga0068855_100011354 | Ga0068855_1000113545 | 209 |
| 1052 | 3300005564 | Ga0070664_100038293 | Ga0070664_1000382935 | 209 |
| 1053 | 3300005564 | Ga0070664_100061503 | Ga0070664_1000615032 | 209 |
| 1054 | 3300005577 | Ga0068857_100016086 | Ga0068857_1000160863 | 209 |
| 1055 | 3300005577 | Ga0068857_100292839 | Ga0068857_1002928392 | 209 |
| 1056 | 3300005578 | Ga0068854_100186459 | Ga0068854_1001864592 | 209 |
| 1057 | 3300005614 | Ga0068856_100034658 | Ga0068856_1000346585 | 209 |
| 1058 | 3300005614 | Ga0068856_100128445 | Ga0068856_1001284453 | 209 |
| 1059 | 3300005614 | Ga0068856_100646647 | Ga0068856_1006466472 | 209 |
| 1060 | 3300005616 | Ga0068852_100000048 | Ga0068852_10000004826 | 209 |
| 1061 | 3300005616 | Ga0068852_100109695 | Ga0068852_1001096952 | 209 |
| 1062 | 3300005616 | Ga0068852_100155854 | Ga0068852_1001558543 | 209 |
| 1063 | 3300005617 | Ga0068859_100013690 | Ga0068859_1000136906 | 209 |
| 1064 | 3300005834 | Ga0068851_10028110 | Ga0068851_100281102 | 209 |
| 1065 | 3300005841 | Ga0068863_100001631 | Ga0068863_1000016318 | 209 |
| 1066 | 3300005842 | Ga0068858_100002617 | Ga0068858_1000026175 | 209 |
| 1067 | 3300005843 | Ga0068860_100000069 | Ga0068860_100000069143 | 209 |
| 1068 | 3300005844 | Ga0068862_100009227 | Ga0068862_1000092275 | 209 |
| 1069 | 3300006051 | Ga0075364_10014348 | Ga0075364_100143485 | 209 |
| 1070 | 3300006051 | Ga0075364_10055355 | Ga0075364_100553553 | 209 |
| 1071 | 3300006051 | Ga0075364_10175136 | Ga0075364_101751362 | 209 |
| 1072 | 3300006237 | Ga0097621_100065452 | Ga0097621_1000654523 | 209 |
| 1073 | 3300006358 | Ga0068871_100002247 | Ga0068871_1000022476 | 209 |
| 1074 | 3300006358 | Ga0068871_100077837 | Ga0068871_1000778372 | 209 |
| 1075 | 3300006880 | Ga0075429_100478892 | Ga0075429_1004788921 | 209 |
| 1076 | 3300006881 | Ga0068865_100076478 | Ga0068865_1000764782 | 209 |
| 1077 | 3300006931 | Ga0097620_100013690 | Ga0097620_1000136903 | 209 |
| 1078 | 3300006946 | Ga0079104_1005881 | Ga0079104_10058815 | 209 |
| 1079 | 3300009011 | Ga0105251_10166054 | Ga0105251_101660542 | 209 |
| 1080 | 3300009036 | Ga0105244_10121953 | Ga0105244_101219532 | 209 |
| 1081 | 3300009092 | Ga0105250_10056123 | Ga0105250_100561232 | 209 |
| 1082 | 3300009092 | Ga0105250_10103416 | Ga0105250_101034162 | 209 |
| 1083 | 3300009093 | Ga0105240_10000084 | Ga0105240_1000008417 | 209 |
| 1084 | 3300009093 | Ga0105240_10004442 | Ga0105240_100044428 | 209 |
| 1085 | 3300009093 | Ga0105240_10008224 | Ga0105240_100082245 | 209 |
| 1086 | 3300009093 | Ga0105240_10153246 | Ga0105240_101532462 | 209 |
| 1087 | 3300009093 | Ga0105240_11019860 | Ga0105240_110198601 | 209 |
| 1088 | 3300009098 | Ga0105245_10001510 | Ga0105245_100015106 | 209 |
| 1089 | 3300009101 | Ga0105247_10001822 | Ga0105247_1000182213 | 209 |
| 1090 | 3300009148 | Ga0105243_10000005 | Ga0105243_10000005322 | 209 |
| 1091 | 3300009177 | Ga0105248_10001008 | Ga0105248_1000100826 | 209 |
| 1092 | 3300009545 | Ga0105237_10010106 | Ga0105237_100101066 | 209 |
| 1093 | 3300009545 | Ga0105237_10048803 | Ga0105237_100488033 | 209 |
| 1094 | 3300009545 | Ga0105237_10158718 | Ga0105237_101587183 | 209 |
| 1095 | 3300009551 | Ga0105238_10000113 | Ga0105238_1000011315 | 209 |
| 1096 | 3300009551 | Ga0105238_10000160 | Ga0105238_1000016060 | 209 |
| 1097 | 3300009551 | Ga0105238_10017512 | Ga0105238_100175122 | 209 |
| 1098 | 3300009551 | Ga0105238_10455046 | Ga0105238_104550462 | 209 |
| 1099 | 3300010375 | Ga0105239_10000289 | Ga0105239_1000028916 | 209 |
| 1100 | 3300010375 | Ga0105239_10003397 | Ga0105239_100033976 | 209 |
| 1101 | 3300011119 | Ga0105246_10000618 | Ga0105246_1000061814 | 209 |
| 1102 | 3300013104 | Ga0157370_10002535 | Ga0157370_1000253514 | 209 |
| 1103 | 3300013105 | Ga0157369_10000334 | Ga0157369_100003348 | 209 |
| 1104 | 3300013105 | Ga0157369_10003357 | Ga0157369_1000335711 | 209 |
| 1105 | 3300013105 | Ga0157369_10232759 | Ga0157369_102327593 | 209 |
| 1106 | 3300013105 | Ga0157369_10303725 | Ga0157369_103037252 | 209 |
| 1107 | 3300013296 | Ga0157374_10020568 | Ga0157374_100205683 | 209 |
| 1108 | 3300013306 | Ga0163162_10046081 | Ga0163162_100460812 | 209 |
| 1109 | 3300013307 | Ga0157372_10000092 | Ga0157372_1000009265 | 209 |
| 1110 | 3300013307 | Ga0157372_10034949 | Ga0157372_100349497 | 209 |
| 1111 | 3300013308 | Ga0157375_10002806 | Ga0157375_100028069 | 209 |
| 1112 | 3300014325 | Ga0163163_10001715 | Ga0163163_100017156 | 209 |
| 1113 | 3300014497 | Ga0182008_10106183 | Ga0182008_101061832 | 209 |
| 1114 | 3300014745 | Ga0157377_10236796 | Ga0157377_102367962 | 209 |
| 1115 | 3300014968 | Ga0157379_10002856 | Ga0157379_100028567 | 209 |
| 1116 | 3300015262 | Ga0182007_10005649 | Ga0182007_100056495 | 209 |
| 1117 | 3300015262 | Ga0182007_10013824 | Ga0182007_100138244 | 209 |
| 1118 | 3300015265 | Ga0182005_1000534 | Ga0182005_10005344 | 209 |
| 1119 | 3300017792 | Ga0163161_10019141 | Ga0163161_100191413 | 209 |
| 1120 | 3300017792 | Ga0163161_10503648 | Ga0163161_105036481 | 209 |
| 1121 | 3300021361 | Ga0213872_10000001 | Ga0213872_10000001358 | 209 |
| 1122 | 3300021361 | Ga0213872_10008989 | Ga0213872_100089893 | 209 |
| 1123 | 3300025224 | Ga0209784_100004 | Ga0209784_100004650 | 209 |
| 1124 | 3300025225 | Ga0209566_100004 | Ga0209566_100004807 | 209 |
| 1125 | 3300025226 | Ga0209674_100006 | Ga0209674_100006807 | 209 |
| 1126 | 3300025229 | Ga0209147_100004 | Ga0209147_100004566 | 209 |
| 1127 | 3300025229 | Ga0209147_100097 | Ga0209147_10009734 | 209 |
| 1128 | 3300025230 | Ga0209563_100007 | Ga0209563_100007344 | 209 |
| 1129 | 3300025230 | Ga0209563_100009 | Ga0209563_100009650 | 209 |
| 1130 | 3300025231 | Ga0207427_100310 | Ga0207427_10031010 | 209 |
| 1131 | 3300025231 | Ga0207427_112082 | Ga0207427_1120821 | 209 |
| 1132 | 3300025233 | Ga0209437_100004 | Ga0209437_100004650 | 209 |
| 1133 | 3300025233 | Ga0209437_100053 | Ga0209437_1000535 | 209 |
| 1134 | 3300025233 | Ga0209437_100234 | Ga0209437_10023431 | 209 |
| 1135 | 3300025233 | Ga0209437_103429 | Ga0209437_1034292 | 209 |
| 1136 | 3300025242 | Ga0209258_100504 | Ga0209258_10050434 | 209 |
| 1137 | 3300025242 | Ga0209258_100720 | Ga0209258_1007201 | 209 |
| 1138 | 3300025245 | Ga0207425_1000262 | Ga0207425_100026216 | 209 |
| 1139 | 3300025246 | Ga0209646_1000103 | Ga0209646_100010334 | 209 |
| 1140 | 3300025246 | Ga0209646_1000109 | Ga0209646_1000109113 | 209 |
| 1141 | 3300025250 | Ga0209026_1000467 | Ga0209026_10004672 | 209 |
| 1142 | 3300025253 | Ga0209677_100005 | Ga0209677_100005650 | 209 |
| 1143 | 3300025253 | Ga0209677_105152 | Ga0209677_1051524 | 209 |
| 1144 | 3300025254 | Ga0209148_1006589 | Ga0209148_10065894 | 209 |
| 1145 | 3300025256 | Ga0209759_1000064 | Ga0209759_1000064148 | 209 |
| 1146 | 3300025256 | Ga0209759_1000091 | Ga0209759_100009134 | 209 |
| 1147 | 3300025256 | Ga0209759_1001647 | Ga0209759_100164714 | 209 |
| 1148 | 3300025261 | Ga0209233_1000005 | Ga0209233_1000005807 | 209 |
| 1149 | 3300025261 | Ga0209233_1016765 | Ga0209233_10167652 | 209 |
| 1150 | 3300025263 | Ga0209565_1000017 | Ga0209565_100001731 | 209 |
| 1151 | 3300025272 | Ga0209455_1000043 | Ga0209455_1000043129 | 209 |
| 1152 | 3300025272 | Ga0209455_1005410 | Ga0209455_10054103 | 209 |
| 1153 | 3300025273 | Ga0209673_1000007 | Ga0209673_1000007398 | 209 |
| 1154 | 3300025291 | Ga0209675_1000009 | Ga0209675_1000009120 | 209 |
| 1155 | 3300025294 | Ga0209025_1039236 | Ga0209025_10392362 | 209 |
| 1156 | 3300025295 | Ga0209564_1000055 | Ga0209564_100005555 | 209 |
| 1157 | 3300025297 | Ga0209758_1000625 | Ga0209758_100062527 | 209 |
| 1158 | 3300025299 | Ga0209256_1000559 | Ga0209256_100055925 | 209 |
| 1159 | 3300025315 | Ga0207697_10016149 | Ga0207697_100161493 | 209 |
| 1160 | 3300025321 | Ga0207656_10006575 | Ga0207656_100065754 | 209 |
| 1161 | 3300025321 | Ga0207656_10084810 | Ga0207656_100848102 | 209 |
| 1162 | 3300025711 | Ga0207696_1010086 | Ga0207696_10100863 | 209 |
| 1163 | 3300025711 | Ga0207696_1060660 | Ga0207696_10606602 | 209 |
| 1164 | 3300025728 | Ga0207655_1000490 | Ga0207655_100049055 | 209 |
| 1165 | 3300025728 | Ga0207655_1001848 | Ga0207655_100184814 | 209 |
| 1166 | 3300025728 | Ga0207655_1032591 | Ga0207655_10325912 | 209 |
| 1167 | 3300025735 | Ga0207713_1023413 | Ga0207713_10234133 | 209 |
| 1168 | 3300025735 | Ga0207713_1043269 | Ga0207713_10432692 | 209 |
| 1169 | 3300025900 | Ga0207710_10000839 | Ga0207710_100008396 | 209 |
| 1170 | 3300025909 | Ga0207705_10011480 | Ga0207705_100114806 | 209 |
| 1171 | 3300025911 | Ga0207654_10000122 | Ga0207654_100001221 | 209 |
| 1172 | 3300025911 | Ga0207654_10072187 | Ga0207654_100721872 | 209 |
| 1173 | 3300025913 | Ga0207695_10000115 | Ga0207695_1000011555 | 209 |
| 1174 | 3300025913 | Ga0207695_10002097 | Ga0207695_1000209716 | 209 |
| 1175 | 3300025913 | Ga0207695_10002265 | Ga0207695_1000226513 | 209 |
| 1176 | 3300025913 | Ga0207695_10009870 | Ga0207695_100098709 | 209 |
| 1177 | 3300025914 | Ga0207671_10000032 | Ga0207671_10000032196 | 209 |
| 1178 | 3300025914 | Ga0207671_10003511 | Ga0207671_100035118 | 209 |
| 1179 | 3300025914 | Ga0207671_10148734 | Ga0207671_101487342 | 209 |
| 1180 | 3300025919 | Ga0207657_10027318 | Ga0207657_100273184 | 209 |
| 1181 | 3300025919 | Ga0207657_10337918 | Ga0207657_103379182 | 209 |
| 1182 | 3300025920 | Ga0207649_10011954 | Ga0207649_100119545 | 209 |
| 1183 | 3300025921 | Ga0207652_10730030 | Ga0207652_107300301 | 209 |
| 1184 | 3300025924 | Ga0207694_10000029 | Ga0207694_1000002917 | 209 |
| 1185 | 3300025924 | Ga0207694_10000075 | Ga0207694_1000007573 | 209 |
| 1186 | 3300025924 | Ga0207694_10223310 | Ga0207694_102233102 | 209 |
| 1187 | 3300025925 | Ga0207650_10001617 | Ga0207650_100016172 | 209 |
| 1188 | 3300025925 | Ga0207650_10031834 | Ga0207650_100318342 | 209 |
| 1189 | 3300025925 | Ga0207650_10408127 | Ga0207650_104081272 | 209 |
| 1190 | 3300025926 | Ga0207659_10167568 | Ga0207659_101675683 | 209 |
| 1191 | 3300025927 | Ga0207687_10001035 | Ga0207687_1000103514 | 209 |
| 1192 | 3300025927 | Ga0207687_10030036 | Ga0207687_100300362 | 209 |
| 1193 | 3300025928 | Ga0207700_10089054 | Ga0207700_100890543 | 209 |
| 1194 | 3300025928 | Ga0207700_10372829 | Ga0207700_103728291 | 209 |
| 1195 | 3300025931 | Ga0207644_10074243 | Ga0207644_100742433 | 209 |
| 1196 | 3300025931 | Ga0207644_10510565 | Ga0207644_105105652 | 209 |
| 1197 | 3300025932 | Ga0207690_10004240 | Ga0207690_100042405 | 209 |
| 1198 | 3300025932 | Ga0207690_10017400 | Ga0207690_100174004 | 209 |
| 1199 | 3300025933 | Ga0207706_10003714 | Ga0207706_100037147 | 209 |
| 1200 | 3300025934 | Ga0207686_10275904 | Ga0207686_102759042 | 209 |
| 1201 | 3300025935 | Ga0207709_10000001 | Ga0207709_100000011105 | 209 |
| 1202 | 3300025935 | Ga0207709_10239070 | Ga0207709_102390702 | 209 |
| 1203 | 3300025940 | Ga0207691_10005340 | Ga0207691_100053409 | 209 |
| 1204 | 3300025941 | Ga0207711_10008206 | Ga0207711_100082066 | 209 |
| 1205 | 3300025942 | Ga0207689_10002718 | Ga0207689_1000271812 | 209 |
| 1206 | 3300025942 | Ga0207689_10023944 | Ga0207689_100239444 | 209 |
| 1207 | 3300025944 | Ga0207661_10001150 | Ga0207661_1000115013 | 209 |
| 1208 | 3300025944 | Ga0207661_10112065 | Ga0207661_101120652 | 209 |
| 1209 | 3300025945 | Ga0207679_10018810 | Ga0207679_100188102 | 209 |
| 1210 | 3300025945 | Ga0207679_10077585 | Ga0207679_100775853 | 209 |
| 1211 | 3300025949 | Ga0207667_10000110 | Ga0207667_1000011082 | 209 |
| 1212 | 3300025949 | Ga0207667_10003481 | Ga0207667_100034812 | 209 |
| 1213 | 3300025949 | Ga0207667_10004567 | Ga0207667_100045679 | 209 |
| 1214 | 3300025949 | Ga0207667_10005512 | Ga0207667_1000551215 | 209 |
| 1215 | 3300025949 | Ga0207667_10009897 | Ga0207667_1000989710 | 209 |
| 1216 | 3300025960 | Ga0207651_10067104 | Ga0207651_100671042 | 209 |
| 1217 | 3300025961 | Ga0207712_10304926 | Ga0207712_103049262 | 209 |
| 1218 | 3300025972 | Ga0207668_10162136 | Ga0207668_101621363 | 209 |
| 1219 | 3300025981 | Ga0207640_10008128 | Ga0207640_100081283 | 209 |
| 1220 | 3300025986 | Ga0207658_10001341 | Ga0207658_1000134116 | 209 |
| 1221 | 3300026023 | Ga0207677_10000023 | Ga0207677_1000002394 | 209 |
| 1222 | 3300026023 | Ga0207677_10087194 | Ga0207677_100871942 | 209 |
| 1223 | 3300026035 | Ga0207703_10002320 | Ga0207703_1000232016 | 209 |
| 1224 | 3300026035 | Ga0207703_10212890 | Ga0207703_102128902 | 209 |
| 1225 | 3300026078 | Ga0207702_10001243 | Ga0207702_100012438 | 209 |
| 1226 | 3300026078 | Ga0207702_10189621 | Ga0207702_101896212 | 209 |
| 1227 | 3300026078 | Ga0207702_10620691 | Ga0207702_106206912 | 209 |
| 1228 | 3300026088 | Ga0207641_10000283 | Ga0207641_1000028345 | 209 |
| 1229 | 3300026088 | Ga0207641_10125187 | Ga0207641_101251872 | 209 |
| 1230 | 3300026116 | Ga0207674_10022394 | Ga0207674_100223943 | 209 |
| 1231 | 3300026116 | Ga0207674_10362669 | Ga0207674_103626692 | 209 |
| 1232 | 3300026142 | Ga0207698_10000011 | Ga0207698_1000001165 | 209 |
| 1233 | 3300026142 | Ga0207698_10127545 | Ga0207698_101275452 | 209 |
| 1234 | 3300026142 | Ga0207698_10152899 | Ga0207698_101528992 | 209 |
| 1235 | 3300026142 | Ga0207698_10169428 | Ga0207698_101694282 | 209 |
| 1236 | 3300027111 | Ga0209281_1009167 | Ga0209281_10091671 | 209 |
| 1237 | 3300027312 | Ga0209371_1000006 | Ga0209371_1000006240 | 209 |
| 1238 | 3300027312 | Ga0209371_1023446 | Ga0209371_10234462 | 209 |
| 1239 | 3300028380 | Ga0268265_10084197 | Ga0268265_100841972 | 209 |
| 1240 | 3300028381 | Ga0268264_10000086 | Ga0268264_10000086176 | 209 |
| 1241 | 3300028381 | Ga0268264_10977864 | Ga0268264_109778642 | 209 |
| 1242 | 3300030500 | Ga0268256_1000007 | Ga0268256_1000007240 | 209 |
| 1243 | 3300030500 | Ga0268256_1026567 | Ga0268256_10265671 | 209 |
| 1244 | 3300031251 | Ga0265327_10153951 | Ga0265327_101539511 | 209 |
| 1245 | 3300031344 | Ga0265316_10004128 | Ga0265316_1000412811 | 209 |
| 1246 | 3300031824 | Ga0307413_10095542 | Ga0307413_100955422 | 209 |
| 1247 | 3300037312 | Ga0395899_0001751 | Ga0395899_0001751_7060_7713 | 209 |
| 1248 | 3300037312 | Ga0395899_0033535 | Ga0395899_0033535_3176_3826 | 209 |
| 1249 | 3300037418 | Ga0395900_0008788 | Ga0395900_0008788_9618_10271 | 209 |
| 1250 | 3300037418 | Ga0395900_0437272 | Ga0395900_0437272_469_1119 | 209 |
| 1251 | 3300037466 | Ga0395898_0184649 | Ga0395898_0184649_363_1016 | 209 |
| 1252 | 3300037466 | Ga0395898_0390742 | Ga0395898_0390742_65_715 | 209 |
| 1253 | 3300037471 | Ga0395905_0000416 | Ga0395905_0000416_1489_2142 | 209 |
| 1254 | 3300037471 | Ga0395905_0003638 | Ga0395905_0003638_3586_4239 | 209 |
| 1255 | 3300037471 | Ga0395905_0012379 | Ga0395905_0012379_5648_6301 | 209 |
| 1256 | 3300037471 | Ga0395905_0018706 | Ga0395905_0018706_2732_3385 | 209 |
| 1257 | 3300037471 | Ga0395905_0074093 | Ga0395905_0074093_1136_1789 | 209 |
| 1258 | 3300037471 | Ga0395905_0261590 | Ga0395905_0261590_342_995 | 209 |
| 1259 | 3300038443 | Ga0395901_0003716 | Ga0395901_0003716_13931_14584 | 209 |
| 1260 | 3300038443 | Ga0395901_0157318 | Ga0395901_0157318_1385_2038 | 209 |
| 1261 | 3300039447 | Ga0436361_0287651 | Ga0436361_0287651_25109_25759 | 209 |
| 1262 | 3300039447 | Ga0436361_0457180 | Ga0436361_0457180_19_669 | 209 |
| 1263 | 3300039447 | Ga0436361_0727856 | Ga0436361_0727856_331_981 | 209 |
| 1264 | 3300039447 | Ga0436361_0810743 | Ga0436361_0810743_30_680 | 209 |
| 1265 | 3300039447 | Ga0436361_0850691 | Ga0436361_0850691_2236_2889 | 209 |
| 1266 | 3300041452 | Ga0451793_0331504 | Ga0451793_0331504_234_863 | 209 |
| 1267 | 3300042532 | Ga0450893_0027811 | Ga0450893_0027811_197_838 | 209 |
| 1268 | 3300042876 | Ga0451577_0254152 | Ga0451577_0254152_410_1066 | 209 |
| 1269 | 3300044656 | Ga0466969_0014612 | Ga0466969_0014612_3056_3739 | 209 |
| 1270 | 3300044673 | Ga0453683_0151115 | Ga0453683_0151115_249_902 | 209 |
| 1271 | 3300044684 | Ga0466966_0016505 | Ga0466966_0016505_787_1437 | 209 |
| 1272 | 3300044684 | Ga0466966_0075667 | Ga0466966_0075667_610_1293 | 209 |
| 1273 | 3300044842 | Ga0466957_0109818 | Ga0466957_0109818_1023_1676 | 209 |
| 1274 | 3300046454 | Ga0495592_0033858 | Ga0495592_0033858_3139_3792 | 209 |
| 1275 | 3300046459 | Ga0495629_0052790 | Ga0495629_0052790_1400_2050 | 209 |
| 1276 | 3300046462 | Ga0495651_0014296 | Ga0495651_0014296_4926_5579 | 209 |
| 1277 | 3300046462 | Ga0495651_0056416 | Ga0495651_0056416_1059_1712 | 209 |
| 1278 | 3300046463 | Ga0495653_0007349 | Ga0495653_0007349_7066_7719 | 209 |
| 1279 | 3300046472 | Ga0495580_0095758 | Ga0495580_0095758_271_903 | 209 |
| 1280 | 3300046492 | Ga0495585_0004598 | Ga0495585_0004598_48_698 | 209 |
| 1281 | 3300046492 | Ga0495585_0007926 | Ga0495585_0007926_4480_5130 | 209 |
| 1282 | 3300046501 | Ga0495607_0021370 | Ga0495607_0021370_1972_2622 | 209 |
| 1283 | 3300046506 | Ga0495583_0000127 | Ga0495583_0000127_81147_81797 | 209 |
| 1284 | 3300046507 | Ga0495606_0000001 | Ga0495606_0000001_464703_465353 | 209 |
| 1285 | 3300046507 | Ga0495606_0008822 | Ga0495606_0008822_2254_2907 | 209 |
| 1286 | 3300046511 | Ga0495608_0004989 | Ga0495608_0004989_1460_2113 | 209 |
| 1287 | 3300046512 | Ga0495610_0004596 | Ga0495610_0004596_956_1606 | 209 |
| 1288 | 3300046514 | Ga0495618_0029268 | Ga0495618_0029268_488_1141 | 209 |
| 1289 | 3300046516 | Ga0495628_0008815 | Ga0495628_0008815_1725_2378 | 209 |
| 1290 | 3300046516 | Ga0495628_0013432 | Ga0495628_0013432_3476_4129 | 209 |
| 1291 | 3300046522 | Ga0495643_0000630 | Ga0495643_0000630_6743_7393 | 209 |
| 1292 | 3300046522 | Ga0495643_0001320 | Ga0495643_0001320_9348_9998 | 209 |
| 1293 | 3300046524 | Ga0495648_0061322 | Ga0495648_0061322_369_1019 | 209 |
| 1294 | 3300046524 | Ga0495648_0085982 | Ga0495648_0085982_706_1356 | 209 |
| 1295 | 3300046528 | Ga0495642_0002999 | Ga0495642_0002999_3122_3775 | 209 |
| 1296 | 3300046529 | Ga0495652_0004595 | Ga0495652_0004595_2633_3286 | 209 |
| 1297 | 3300046529 | Ga0495652_0019591 | Ga0495652_0019591_2953_3606 | 209 |
| 1298 | 3300046529 | Ga0495652_0027916 | Ga0495652_0027916_1127_1780 | 209 |
| 1299 | 3300046542 | Ga0495597_0002116 | Ga0495597_0002116_11201_11851 | 209 |
| 1300 | 3300046543 | Ga0495645_0072307 | Ga0495645_0072307_1759_2412 | 209 |
| 1301 | 3300046543 | Ga0495645_0169277 | Ga0495645_0169277_782_1411 | 209 |
| 1302 | 3300046558 | Ga0495633_0002178 | Ga0495633_0002178_13339_13989 | 209 |
| 1303 | 3300046558 | Ga0495633_0066789 | Ga0495633_0066789_53_703 | 209 |
| 1304 | 3300046616 | Ga0495668_0000285 | Ga0495668_0000285_18201_18851 | 209 |
| 1305 | 3300046616 | Ga0495668_0001521 | Ga0495668_0001521_16009_16659 | 209 |
| 1306 | 3300046663 | Ga0495635_0025468 | Ga0495635_0025468_1654_2304 | 209 |
| 1307 | 3300046663 | Ga0495635_0033601 | Ga0495635_0033601_813_1466 | 209 |
| 1308 | 3300046665 | Ga0495661_0021839 | Ga0495661_0021839_255_908 | 209 |
| 1309 | 3300046665 | Ga0495661_0049153 | Ga0495661_0049153_371_1021 | 209 |
| 1310 | 3300046674 | Ga0495588_0054750 | Ga0495588_0054750_612_1262 | 209 |
| 1311 | 3300046675 | Ga0495657_0139398 | Ga0495657_0139398_158_811 | 209 |
| 1312 | 3300046678 | Ga0495599_0021832 | Ga0495599_0021832_430_1083 | 209 |
| 1313 | 3300046679 | Ga0495623_0003590 | Ga0495623_0003590_45_698 | 209 |
| 1314 | 3300046680 | Ga0495646_0279299 | Ga0495646_0279299_67_699 | 209 |
| 1315 | 3300046809 | Ga0495600_0003478 | Ga0495600_0003478_2915_3568 | 209 |
| 1316 | 3300047317 | Ga0495604_0013119 | Ga0495604_0013119_3034_3687 | 209 |
| 1317 | 3300047317 | Ga0495604_0030390 | Ga0495604_0030390_1484_2134 | 209 |
| 1318 | 3300047319 | Ga0495674_0025320 | Ga0495674_0025320_1325_1975 | 209 |
| 1319 | 3300047320 | Ga0495672_0001684 | Ga0495672_0001684_13158_13808 | 209 |
| 1320 | 3300047322 | Ga0495680_0041286 | Ga0495680_0041286_658_1308 | 209 |
| 1321 | 3300047443 | Ga0495687_011487 | Ga0495687_011487_1968_2621 | 209 |
| 1322 | 3300047444 | Ga0495675_0103322 | Ga0495675_0103322_431_1081 | 209 |
| 1323 | 3300047444 | Ga0495675_0286106 | Ga0495675_0286106_260_910 | 209 |
| 1324 | 3300047470 | Ga0495681_0003047 | Ga0495681_0003047_4311_4961 | 209 |
| 1325 | 3300047470 | Ga0495681_0064113 | Ga0495681_0064113_203_853 | 209 |
| 1326 | 3300047472 | Ga0495686_0006497 | Ga0495686_0006497_265_915 | 209 |
| 1327 | 3300047472 | Ga0495686_0017129 | Ga0495686_0017129_1732_2382 | 209 |
| 1328 | 3300048088 | Ga0495602_0029352 | Ga0495602_0029352_2315_2947 | 209 |
| 1329 | 3300048091 | Ga0495626_0001165 | Ga0495626_0001165_5629_6279 | 209 |
| 1330 | 3300048907 | Ga0496104_0305695 | Ga0496104_0305695_793_1425 | 209 |
| 1331 | 3300048918 | Ga0496115_0284153 | Ga0496115_0284153_556_1188 | 209 |
| 1332 | 3300048924 | Ga0496121_0026546 | Ga0496121_0026546_690_1346 | 209 |
| 1333 | 3300048925 | Ga0496122_0005337 | Ga0496122_0005337_10023_10673 | 209 |
| 1334 | 3300048925 | Ga0496122_0196473 | Ga0496122_0196473_214_870 | 209 |
| 1335 | 3300048927 | Ga0496124_0000024 | Ga0496124_0000024_65934_66590 | 209 |
| 1336 | 3300049459 | Ga0495678_001541 | Ga0495678_001541_13211_13861 | 209 |
| 1337 | 3300049568 | Ga0501031_0004268 | Ga0501031_0004268_3188_3841 | 209 |
| 1338 | 3300049569 | Ga0501032_0001868 | Ga0501032_0001868_3605_4258 | 209 |
| 1339 | 3300049570 | Ga0501033_0000491 | Ga0501033_0000491_36109_36762 | 209 |
| 1340 | 3300049571 | Ga0501034_0273556 | Ga0501034_0273556_32_685 | 209 |
| 1341 | 3300049571 | Ga0501034_0462341 | Ga0501034_0462341_461_1114 | 209 |
| 1342 | 3300049572 | Ga0501036_0000389 | Ga0501036_0000389_486_1139 | 209 |
| 1343 | 3300049573 | Ga0501037_0001552 | Ga0501037_0001552_9770_10423 | 209 |
| 1344 | 3300049573 | Ga0501037_0003775 | Ga0501037_0003775_1682_2335 | 209 |
| 1345 | 3300049574 | Ga0501038_0000414 | Ga0501038_0000414_28342_28995 | 209 |
| 1346 | 3300049579 | Ga0501043_0015683 | Ga0501043_0015683_67_720 | 209 |
| 1347 | 3300049580 | Ga0501046_0028661 | Ga0501046_0028661_1591_2244 | 209 |
| 1348 | 3300049581 | Ga0501047_0007765 | Ga0501047_0007765_8963_9616 | 209 |
| 1349 | 3300049742 | Ga0501080_0787502 | Ga0501080_0787502_41_676 | 209 |
| 1350 | 3300049822 | Ga0501035_0002711 | Ga0501035_0002711_1078_1731 | 209 |
| 1351 | 3300049823 | Ga0501044_0001117 | Ga0501044_0001117_27725_28378 | 209 |
| 1352 | 3300053077 | Ga0495601_0164118 | Ga0495601_0164118_177_830 | 209 |
| 1353 | 3300053085 | Ga0495619_0416771 | Ga0495619_0416771_224_877 | 209 |
| 1354 | 3300053125 | Ga0500618_001117 | Ga0500618_001117_11950_12600 | 209 |
| 1355 | 3300053141 | Ga0500574_000287 | Ga0500574_000287_3694_4347 | 209 |
| 1356 | 3300059512 | Ga0587092_019830 | Ga0587092_019830_227_880 | 209 |
| 1357 | 3300059643 | Ga0587072_003368 | Ga0587072_003368_500_1153 | 209 |
| 1358 | 3300005436 | Ga0070713_100501445 | Ga0070713_1005014452 | 210 |
| 1359 | 3300005437 | Ga0070710_10202944 | Ga0070710_102029442 | 210 |
| 1360 | 3300006028 | Ga0070717_10575880 | Ga0070717_105758801 | 210 |
| 1361 | 3300006175 | Ga0070712_100003162 | Ga0070712_10000316211 | 210 |
| 1362 | 3300006175 | Ga0070712_100063584 | Ga0070712_1000635842 | 210 |
| 1363 | 3300006914 | Ga0075436_100554577 | Ga0075436_1005545771 | 210 |
| 1364 | 3300021388 | Ga0213875_10059590 | Ga0213875_100595903 | 210 |
| 1365 | 3300025906 | Ga0207699_10282769 | Ga0207699_102827692 | 210 |
| 1366 | 3300025915 | Ga0207693_10001513 | Ga0207693_1000151314 | 210 |
| 1367 | 3300025915 | Ga0207693_10052921 | Ga0207693_100529212 | 210 |
| 1368 | 3300025915 | Ga0207693_10164553 | Ga0207693_101645532 | 210 |
| 1369 | 3300025916 | Ga0207663_10026185 | Ga0207663_100261853 | 210 |
| 1370 | 3300025920 | Ga0207649_10084561 | Ga0207649_100845612 | 210 |
| 1371 | 3300025928 | Ga0207700_10051821 | Ga0207700_100518212 | 210 |
| 1372 | 3300025928 | Ga0207700_10070877 | Ga0207700_100708773 | 210 |
| 1373 | 3300025929 | Ga0207664_10021867 | Ga0207664_100218674 | 210 |
| 1374 | 3300031090 | Ga0265760_10021726 | Ga0265760_100217262 | 210 |
| 1375 | 3300031251 | Ga0265327_10011906 | Ga0265327_100119066 | 210 |
| 1376 | 3300035083 | Ga0373926_0002266 | Ga0373926_0002266_4365_5015 | 210 |
| 1377 | 3300035113 | Ga0373936_0244956 | Ga0373936_0244956_35_685 | 210 |
| 1378 | 3300035116 | Ga0373945_0042844 | Ga0373945_0042844_665_1315 | 210 |
| 1379 | 3300035120 | Ga0373957_0077988 | Ga0373957_0077988_554_1204 | 210 |
| 1380 | 3300035170 | Ga0373943_0000102 | Ga0373943_0000102_21785_22435 | 210 |
| 1381 | 3300035170 | Ga0373943_0027135 | Ga0373943_0027135_675_1325 | 210 |
| 1382 | 3300035171 | Ga0373946_0000763 | Ga0373946_0000763_2462_3112 | 210 |
| 1383 | 3300035171 | Ga0373946_0024658 | Ga0373946_0024658_464_1114 | 210 |
| 1384 | 3300035172 | Ga0373955_0010364 | Ga0373955_0010364_3734_4384 | 210 |
| 1385 | 3300035410 | Ga0373924_0239035 | Ga0373924_0239035_113_763 | 210 |
| 1386 | 3300035692 | Ga0373935_0005950 | Ga0373935_0005950_2117_2767 | 210 |
| 1387 | 3300035692 | Ga0373935_0014152 | Ga0373935_0014152_1395_2045 | 210 |
| 1388 | 3300035695 | Ga0373927_0003194 | Ga0373927_0003194_3117_3767 | 210 |
| 1389 | 3300035695 | Ga0373927_0013278 | Ga0373927_0013278_1359_2009 | 210 |
| 1390 | 3300035695 | Ga0373927_0109177 | Ga0373927_0109177_322_972 | 210 |
| 1391 | 3300035724 | Ga0373933_0005427 | Ga0373933_0005427_4552_5202 | 210 |
| 1392 | 3300035725 | Ga0373947_0002970 | Ga0373947_0002970_7797_8447 | 210 |
| 1393 | 3300035725 | Ga0373947_0008316 | Ga0373947_0008316_1325_1975 | 210 |
| 1394 | 3300037068 | Ga0373925_0001514 | Ga0373925_0001514_10038_10688 | 210 |
| 1395 | 3300037068 | Ga0373925_0033277 | Ga0373925_0033277_1070_1720 | 210 |
| 1396 | 3300037853 | Ga0436364_0543976 | Ga0436364_0543976_363_1013 | 210 |
| 1397 | 3300037853 | Ga0436364_1388333 | Ga0436364_1388333_1010_1660 | 210 |
| 1398 | 3300039437 | Ga0436365_1653741 | Ga0436365_1653741_2421_3071 | 210 |
| 1399 | 3300041460 | Ga0451802_0500530 | Ga0451802_0500530_1252_1905 | 210 |
| 1400 | 3300046454 | Ga0495592_0005124 | Ga0495592_0005124_2877_3527 | 210 |
| 1401 | 3300046459 | Ga0495629_0080113 | Ga0495629_0080113_1005_1655 | 210 |
| 1402 | 3300046462 | Ga0495651_0000976 | Ga0495651_0000976_11948_12598 | 210 |
| 1403 | 3300046463 | Ga0495653_0002352 | Ga0495653_0002352_3756_4406 | 210 |
| 1404 | 3300046475 | Ga0495639_0011256 | Ga0495639_0011256_1897_2547 | 210 |
| 1405 | 3300046476 | Ga0495662_0001205 | Ga0495662_0001205_2816_3466 | 210 |
| 1406 | 3300046477 | Ga0495664_0000600 | Ga0495664_0000600_13888_14538 | 210 |
| 1407 | 3300046477 | Ga0495664_0187161 | Ga0495664_0187161_17_667 | 210 |
| 1408 | 3300046511 | Ga0495608_0307865 | Ga0495608_0307865_201_851 | 210 |
| 1409 | 3300046514 | Ga0495618_0005805 | Ga0495618_0005805_3224_3874 | 210 |
| 1410 | 3300046514 | Ga0495618_0131487 | Ga0495618_0131487_794_1444 | 210 |
| 1411 | 3300046516 | Ga0495628_0483126 | Ga0495628_0483126_183_833 | 210 |
| 1412 | 3300046517 | Ga0495630_0005764 | Ga0495630_0005764_4818_5468 | 210 |
| 1413 | 3300046517 | Ga0495630_0031440 | Ga0495630_0031440_188_838 | 210 |
| 1414 | 3300046526 | Ga0495666_0030665 | Ga0495666_0030665_1925_2575 | 210 |
| 1415 | 3300046529 | Ga0495652_0092105 | Ga0495652_0092105_785_1435 | 210 |
| 1416 | 3300046533 | Ga0495640_0002848 | Ga0495640_0002848_8247_8897 | 210 |
| 1417 | 3300046533 | Ga0495640_0003109 | Ga0495640_0003109_9192_9842 | 210 |
| 1418 | 3300046533 | Ga0495640_0093329 | Ga0495640_0093329_1255_1905 | 210 |
| 1419 | 3300046535 | Ga0495586_0307160 | Ga0495586_0307160_200_850 | 210 |
| 1420 | 3300046642 | Ga0495634_0014172 | Ga0495634_0014172_1189_1839 | 210 |
| 1421 | 3300046642 | Ga0495634_0054769 | Ga0495634_0054769_1010_1660 | 210 |
| 1422 | 3300046663 | Ga0495635_0014561 | Ga0495635_0014561_3515_4165 | 210 |
| 1423 | 3300046663 | Ga0495635_0043108 | Ga0495635_0043108_2248_2898 | 210 |
| 1424 | 3300046679 | Ga0495623_0015491 | Ga0495623_0015491_1873_2523 | 210 |
| 1425 | 3300046680 | Ga0495646_0002551 | Ga0495646_0002551_5388_6038 | 210 |
| 1426 | 3300046680 | Ga0495646_0066311 | Ga0495646_0066311_605_1255 | 210 |
| 1427 | 3300046683 | Ga0495658_0228703 | Ga0495658_0228703_210_860 | 210 |
| 1428 | 3300046689 | Ga0495613_0023024 | Ga0495613_0023024_1539_2189 | 210 |
| 1429 | 3300046690 | Ga0495624_0005580 | Ga0495624_0005580_5302_5952 | 210 |
| 1430 | 3300047315 | Ga0495581_0087492 | Ga0495581_0087492_701_1351 | 210 |
| 1431 | 3300047319 | Ga0495674_0004086 | Ga0495674_0004086_10242_10892 | 210 |
| 1432 | 3300047321 | Ga0495676_0016920 | Ga0495676_0016920_751_1401 | 210 |
| 1433 | 3300047322 | Ga0495680_0003432 | Ga0495680_0003432_4379_5029 | 210 |
| 1434 | 3300047471 | Ga0495684_0013069 | Ga0495684_0013069_1350_2000 | 210 |
| 1435 | 3300047471 | Ga0495684_0021915 | Ga0495684_0021915_2905_3555 | 210 |
| 1436 | 3300047673 | Ga0495593_0090265 | Ga0495593_0090265_908_1558 | 210 |
| 1437 | 3300048088 | Ga0495602_0006678 | Ga0495602_0006678_804_1454 | 210 |
| 1438 | 3300053077 | Ga0495601_0001015 | Ga0495601_0001015_1934_2584 | 210 |
| 1439 | 3300053078 | Ga0495612_0000523 | Ga0495612_0000523_4039_4689 | 210 |
| 1440 | 3300053085 | Ga0495619_0001492 | Ga0495619_0001492_8617_9267 | 210 |
| 1441 | 3300002067 | JGI24735J21928_10018757 | JGI24735J21928_100187573 | 211 |
| 1442 | 3300002067 | JGI24735J21928_10052533 | JGI24735J21928_100525332 | 211 |
| 1443 | 3300002773 | JGI25152J39213_1015800 | JGI25152J39213_10158002 | 211 |
| 1444 | 3300002774 | JGI25150J39212_1000428 | JGI25150J39212_10004282 | 211 |
| 1445 | 3300002987 | JGI25159J45721_1000675 | JGI25159J45721_100067512 | 211 |
| 1446 | 3300003187 | JGI25151J46595_10010417 | JGI25151J46595_100104172 | 211 |
| 1447 | 3300003187 | JGI25151J46595_10023110 | JGI25151J46595_100231102 | 211 |
| 1448 | 3300003215 | JGI25153J46596_10000395 | JGI25153J46596_1000039524 | 211 |
| 1449 | 3300003354 | JGI25160J50197_1000962 | JGI25160J50197_10009626 | 211 |
| 1450 | 3300003374 | JGI25161J50226_1003326 | JGI25161J50226_10033262 | 211 |
| 1451 | 3300003771 | Ga0055526_1004461 | Ga0055526_10044617 | 211 |
| 1452 | 3300003781 | Ga0055536_1000715 | Ga0055536_10007156 | 211 |
| 1453 | 3300003781 | Ga0055536_1003152 | Ga0055536_10031525 | 211 |
| 1454 | 3300003794 | Ga0055531_10002978 | Ga0055531_100029783 | 211 |
| 1455 | 3300003794 | Ga0055531_10042077 | Ga0055531_100420772 | 211 |
| 1456 | 3300004625 | Ga0055543_1001474 | Ga0055543_10014744 | 211 |
| 1457 | 3300005262 | Ga0065165_1002550 | Ga0065165_100255012 | 211 |
| 1458 | 3300005327 | Ga0070658_10028610 | Ga0070658_100286103 | 211 |
| 1459 | 3300005344 | Ga0070661_100000006 | Ga0070661_100000006149 | 211 |
| 1460 | 3300005458 | Ga0070681_10011352 | Ga0070681_100113527 | 211 |
| 1461 | 3300005530 | Ga0070679_100000001 | Ga0070679_10000000128 | 211 |
| 1462 | 3300005563 | Ga0068855_100109993 | Ga0068855_1001099932 | 211 |
| 1463 | 3300005563 | Ga0068855_100191596 | Ga0068855_1001915962 | 211 |
| 1464 | 3300009093 | Ga0105240_10106546 | Ga0105240_101065463 | 211 |
| 1465 | 3300009093 | Ga0105240_10211667 | Ga0105240_102116673 | 211 |
| 1466 | 3300009093 | Ga0105240_11265032 | Ga0105240_112650322 | 211 |
| 1467 | 3300009545 | Ga0105237_10130578 | Ga0105237_101305783 | 211 |
| 1468 | 3300009551 | Ga0105238_10450889 | Ga0105238_104508891 | 211 |
| 1469 | 3300013100 | Ga0157373_10147263 | Ga0157373_101472632 | 211 |
| 1470 | 3300013250 | Ga0171462_1031 | Ga0171462_103146 | 211 |
| 1471 | 3300021384 | Ga0213876_10005332 | Ga0213876_100053325 | 211 |
| 1472 | 3300025208 | Ga0209436_100633 | Ga0209436_1006336 | 211 |
| 1473 | 3300025245 | Ga0207425_1000041 | Ga0207425_100004154 | 211 |
| 1474 | 3300025254 | Ga0209148_1002934 | Ga0209148_10029343 | 211 |
| 1475 | 3300025258 | Ga0209129_1004143 | Ga0209129_10041432 | 211 |
| 1476 | 3300025272 | Ga0209455_1001018 | Ga0209455_10010186 | 211 |
| 1477 | 3300025284 | Ga0209130_1001496 | Ga0209130_100149611 | 211 |
| 1478 | 3300025292 | Ga0209676_1000182 | Ga0209676_100018297 | 211 |
| 1479 | 3300025292 | Ga0209676_1001975 | Ga0209676_10019758 | 211 |
| 1480 | 3300025292 | Ga0209676_1003684 | Ga0209676_10036843 | 211 |
| 1481 | 3300025294 | Ga0209025_1000068 | Ga0209025_1000068223 | 211 |
| 1482 | 3300025294 | Ga0209025_1000301 | Ga0209025_100030170 | 211 |
| 1483 | 3300025295 | Ga0209564_1002177 | Ga0209564_10021778 | 211 |
| 1484 | 3300025297 | Ga0209758_1000004 | Ga0209758_1000004122 | 211 |
| 1485 | 3300025298 | Ga0209050_1000001 | Ga0209050_10000012051 | 211 |
| 1486 | 3300025298 | Ga0209050_1006167 | Ga0209050_10061674 | 211 |
| 1487 | 3300025299 | Ga0209256_1002806 | Ga0209256_10028066 | 211 |
| 1488 | 3300025302 | Ga0207426_1001904 | Ga0207426_100190411 | 211 |
| 1489 | 3300025303 | Ga0209051_1000191 | Ga0209051_100019118 | 211 |
| 1490 | 3300025303 | Ga0209051_1010665 | Ga0209051_10106655 | 211 |
| 1491 | 3300025304 | Ga0209257_1000234 | Ga0209257_100023440 | 211 |
| 1492 | 3300025304 | Ga0209257_1005496 | Ga0209257_100549610 | 211 |
| 1493 | 3300025909 | Ga0207705_10000022 | Ga0207705_10000022113 | 211 |
| 1494 | 3300025912 | Ga0207707_10020223 | Ga0207707_100202233 | 211 |
| 1495 | 3300025913 | Ga0207695_10075549 | Ga0207695_100755491 | 211 |
| 1496 | 3300025913 | Ga0207695_10662262 | Ga0207695_106622622 | 211 |
| 1497 | 3300025914 | Ga0207671_10030516 | Ga0207671_100305164 | 211 |
| 1498 | 3300025919 | Ga0207657_10009497 | Ga0207657_100094978 | 211 |
| 1499 | 3300025920 | Ga0207649_10000043 | Ga0207649_1000004382 | 211 |
| 1500 | 3300025921 | Ga0207652_10000001 | Ga0207652_10000001138 | 211 |
| 1501 | 3300025921 | Ga0207652_10000002 | Ga0207652_10000002589 | 211 |
| 1502 | 3300025949 | Ga0207667_10090353 | Ga0207667_100903535 | 211 |
| 1503 | 3300028800 | Ga0265338_10042032 | Ga0265338_100420323 | 211 |
| 1504 | 3300031240 | Ga0265320_10006647 | Ga0265320_100066473 | 211 |
| 1505 | 3300031249 | Ga0265339_10229013 | Ga0265339_102290132 | 211 |
| 1506 | 3300031251 | Ga0265327_10025911 | Ga0265327_100259115 | 211 |
| 1507 | 3300031456 | Ga0307513_10000433 | Ga0307513_1000043311 | 211 |
| 1508 | 3300031711 | Ga0265314_10014338 | Ga0265314_100143383 | 211 |
| 1509 | 3300031730 | Ga0307516_10005782 | Ga0307516_100057824 | 211 |
| 1510 | 3300032002 | Ga0307416_100481892 | Ga0307416_1004818922 | 211 |
| 1511 | 3300032004 | Ga0307414_10023710 | Ga0307414_100237105 | 211 |
| 1512 | 3300035114 | Ga0373939_0016008 | Ga0373939_0016008_197_835 | 211 |
| 1513 | 3300035115 | Ga0373941_0094452 | Ga0373941_0094452_62_700 | 211 |
| 1514 | 3300039437 | Ga0436365_0267961 | Ga0436365_0267961_3015_3671 | 211 |
| 1515 | 3300041494 | Ga0451837_0453168 | Ga0451837_0453168_10_651 | 211 |
| 1516 | 3300044683 | Ga0466965_0004319 | Ga0466965_0004319_3228_3863 | 211 |
| 1517 | 3300044901 | Ga0466960_0266513 | Ga0466960_0266513_158_820 | 211 |
| 1518 | 3300046455 | Ga0495603_0030464 | Ga0495603_0030464_1205_1843 | 211 |
| 1519 | 3300046473 | Ga0495582_0400906 | Ga0495582_0400906_74_712 | 211 |
| 1520 | 3300046557 | Ga0495622_0011733 | Ga0495622_0011733_2162_2800 | 211 |
| 1521 | 3300046558 | Ga0495633_0001747 | Ga0495633_0001747_3756_4412 | 211 |
| 1522 | 3300046648 | Ga0495611_0167124 | Ga0495611_0167124_355_1005 | 211 |
| 1523 | 3300046660 | Ga0495625_0112635 | Ga0495625_0112635_903_1553 | 211 |
| 1524 | 3300046683 | Ga0495658_0025453 | Ga0495658_0025453_2148_2786 | 211 |
| 1525 | 3300046684 | Ga0495669_0000164 | Ga0495669_0000164_20468_21103 | 211 |
| 1526 | 3300046694 | Ga0495649_0001564 | Ga0495649_0001564_11383_12033 | 211 |
| 1527 | 3300046694 | Ga0495649_0121797 | Ga0495649_0121797_534_1172 | 211 |
| 1528 | 3300047320 | Ga0495672_0021435 | Ga0495672_0021435_105_743 | 211 |
| 1529 | 3300047323 | Ga0495683_0139536 | Ga0495683_0139536_339_989 | 211 |
| 1530 | 3300048919 | Ga0496116_0036895 | Ga0496116_0036895_2653_3303 | 211 |
| 1531 | 3300048924 | Ga0496121_0000567 | Ga0496121_0000567_13511_14149 | 211 |
| 1532 | 3300048924 | Ga0496121_0028452 | Ga0496121_0028452_645_1301 | 211 |
| 1533 | 3300049592 | Ga0501076_0347967 | Ga0501076_0347967_69_728 | 211 |
| 1534 | 3300049686 | Ga0501257_003248 | Ga0501257_003248_2192_2842 | 211 |
| 1535 | 3300049758 | Ga0501241_004893 | Ga0501241_004893_1500_2144 | 211 |
| 1536 | 3300053087 | Ga0500643_002719 | Ga0500643_002719_2080_2715 | 211 |
| 1537 | 3300053088 | Ga0500644_0008465 | Ga0500644_0008465_467_1120 | 211 |
| 1538 | 3300053094 | Ga0500566_0090743 | Ga0500566_0090743_780_1430 | 211 |
| 1539 | 3300053094 | Ga0500566_0221184 | Ga0500566_0221184_294_929 | 211 |
| 1540 | 3300053121 | Ga0500607_000003 | Ga0500607_000003_127398_128033 | 211 |
| 1541 | 3300053136 | Ga0500559_0000400 | Ga0500559_0000400_17790_18425 | 211 |
| 1542 | 3300053139 | Ga0500568_0006369 | Ga0500568_0006369_4731_5387 | 211 |
| 1543 | 3300053140 | Ga0500573_0005745 | Ga0500573_0005745_5449_6102 | 211 |
| 1544 | 3300053151 | Ga0500604_0000025 | Ga0500604_0000025_23509_24144 | 211 |
| 1545 | 3300053153 | Ga0500616_0000254 | Ga0500616_0000254_60859_61494 | 211 |
| 1546 | 3300053730 | Ga0500645_002612 | Ga0500645_002612_5082_5717 | 211 |
| 1547 | 3300059604 | Ga0587098_014045 | Ga0587098_014045_91_741 | 211 |
| 1548 | 3300025981 | Ga0207640_10328359 | Ga0207640_103283592 | 212 |
| 1549 | 3300044712 | Ga0453684_0000126 | Ga0453684_0000126_140485_141141 | 214 |
| 1550 | 3300053078 | Ga0495612_0142801 | Ga0495612_0142801_71_739 | 214 |
| 1551 | 3300053085 | Ga0495619_0216970 | Ga0495619_0216970_287_955 | 214 |
| 1552 | 3300047320 | Ga0495672_0018332 | Ga0495672_0018332_3749_4465 | 215 |
| 1553 | iso_pu_bacteria | 2896253425 | 2896256048 | 217 |
| 1554 | 3300001976 | JGI24752J21851_1000255 | JGI24752J21851_10002557 | 218 |
| 1555 | 3300002074 | JGI24748J21848_1000053 | JGI24748J21848_100005347 | 218 |
| 1556 | 3300002076 | JGI24749J21850_1001230 | JGI24749J21850_10012303 | 218 |
| 1557 | 3300002239 | JGI24034J26672_10000036 | JGI24034J26672_1000003632 | 218 |
| 1558 | 3300002244 | JGI24742J22300_10002780 | JGI24742J22300_100027803 | 218 |
| 1559 | 3300005355 | Ga0070671_100125957 | Ga0070671_1001259573 | 218 |
| 1560 | 3300005355 | Ga0070671_100224309 | Ga0070671_1002243091 | 218 |
| 1561 | 3300005367 | Ga0070667_100865492 | Ga0070667_1008654921 | 218 |
| 1562 | 3300005455 | Ga0070663_100024503 | Ga0070663_1000245036 | 218 |
| 1563 | 3300005577 | Ga0068857_100405795 | Ga0068857_1004057952 | 218 |
| 1564 | 3300005578 | Ga0068854_100064887 | Ga0068854_1000648874 | 218 |
| 1565 | 3300005616 | Ga0068852_100018978 | Ga0068852_1000189782 | 218 |
| 1566 | 3300005618 | Ga0068864_100325041 | Ga0068864_1003250413 | 218 |
| 1567 | 3300005841 | Ga0068863_100000323 | Ga0068863_10000032311 | 218 |
| 1568 | 3300009174 | Ga0105241_10174653 | Ga0105241_101746533 | 218 |
| 1569 | 3300009177 | Ga0105248_10180654 | Ga0105248_101806543 | 218 |
| 1570 | 3300013297 | Ga0157378_10127308 | Ga0157378_101273084 | 218 |
| 1571 | 3300013306 | Ga0163162_10070533 | Ga0163162_100705332 | 218 |
| 1572 | 3300014325 | Ga0163163_10335608 | Ga0163163_103356082 | 218 |
| 1573 | 3300025223 | Ga0207672_1000282 | Ga0207672_10002827 | 218 |
| 1574 | 3300025900 | Ga0207710_10138408 | Ga0207710_101384082 | 218 |
| 1575 | 3300025907 | Ga0207645_10074675 | Ga0207645_100746753 | 218 |
| 1576 | 3300025919 | Ga0207657_10074311 | Ga0207657_100743111 | 218 |
| 1577 | 3300025924 | Ga0207694_10355031 | Ga0207694_103550312 | 218 |
| 1578 | 3300025925 | Ga0207650_10410813 | Ga0207650_104108132 | 218 |
| 1579 | 3300025925 | Ga0207650_10568842 | Ga0207650_105688422 | 218 |
| 1580 | 3300025931 | Ga0207644_10000004 | Ga0207644_10000004172 | 218 |
| 1581 | 3300025931 | Ga0207644_10037827 | Ga0207644_100378273 | 218 |
| 1582 | 3300025931 | Ga0207644_10106918 | Ga0207644_101069182 | 218 |
| 1583 | 3300025933 | Ga0207706_10388187 | Ga0207706_103881871 | 218 |
| 1584 | 3300025945 | Ga0207679_11066314 | Ga0207679_110663141 | 218 |
| 1585 | 3300025981 | Ga0207640_10002493 | Ga0207640_1000249313 | 218 |
| 1586 | 3300025986 | Ga0207658_10422575 | Ga0207658_104225751 | 218 |
| 1587 | 3300026067 | Ga0207678_10001628 | Ga0207678_100016283 | 218 |
| 1588 | 3300026088 | Ga0207641_10000216 | Ga0207641_1000021657 | 218 |
| 1589 | 3300026089 | Ga0207648_10035867 | Ga0207648_100358671 | 218 |
| 1590 | 3300026116 | Ga0207674_10184816 | Ga0207674_101848163 | 218 |
| 1591 | 3300026142 | Ga0207698_10002619 | Ga0207698_100026197 | 218 |
| 1592 | 3300037418 | Ga0395900_0449471 | Ga0395900_0449471_72_728 | 218 |
| 1593 | 3300037471 | Ga0395905_0090163 | Ga0395905_0090163_1192_1848 | 218 |
| 1594 | 3300048905 | Ga0496102_0946470 | Ga0496102_0946470_63_719 | 218 |
| 1595 | 3300048906 | Ga0496103_0170893 | Ga0496103_0170893_206_862 | 218 |
| 1596 | 3300048907 | Ga0496104_0157257 | Ga0496104_0157257_262_918 | 218 |
| 1597 | 3300048908 | Ga0496105_0025378 | Ga0496105_0025378_3558_4214 | 218 |
| 1598 | 3300048908 | Ga0496105_0072207 | Ga0496105_0072207_1980_2639 | 218 |
| 1599 | 3300048914 | Ga0496111_0044917 | Ga0496111_0044917_1444_2103 | 218 |
| 1600 | 3300048915 | Ga0496112_0150025 | Ga0496112_0150025_558_1217 | 218 |
| 1601 | 3300048915 | Ga0496112_0213950 | Ga0496112_0213950_1061_1717 | 218 |
| 1602 | 3300048916 | Ga0496113_0012960 | Ga0496113_0012960_2400_3059 | 218 |
| 1603 | 3300048922 | Ga0496119_0018999 | Ga0496119_0018999_3879_4535 | 218 |
| 1604 | 3300053122 | Ga0500608_000074 | Ga0500608_000074_28649_29308 | 218 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3k6m-assembly2.cif.gz_C | dynamic domains of succinyl-coa:3-ketoacid-coenzyme a transferase from pig heart. | 0.9195 | 12 | 217 |
| 3oxo-assembly3.cif.gz_E | succinyl-coa:3-ketoacid coa transferase from pig heart covalently bound to coa | 0.915 | 15 | 217 |
| 3oxo-assembly3.cif.gz_F | succinyl-coa:3-ketoacid coa transferase from pig heart covalently bound to coa | 0.9148 | 15 | 217 |
| 3oxo-assembly4.cif.gz_H | succinyl-coa:3-ketoacid coa transferase from pig heart covalently bound to coa | 0.9134 | 18 | 217 |
| 3oxo-assembly4.cif.gz_G | succinyl-coa:3-ketoacid coa transferase from pig heart covalently bound to coa | 0.9095 | 15 | 217 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5dbnD00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase | 0.8831 | 10 | 216 | 3.40.1080.10 |
| 2nrcB02 | Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase | 0.8684 | 12 | 217 | 3.40.1080.10 |
| 5dbnD00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase | 0.8407 | 10 | 216 | 3.40.1080.10 |
| 1o9lB02 | Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase | 0.8376 | 10 | 217 | 3.40.1080.10 |
| 2nrcB02 | Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase | 0.8279 | 12 | 217 | 3.40.1080.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N3DP54-F1-model_v4 | Succinyl-CoA--3-ketoacid-CoA transferase | 0.9986 | 138 | 218 |
GO:0008410
|
| AF-A0A2N3DP54-F1-model_v4 | Succinyl-CoA--3-ketoacid-CoA transferase | 0.9746 | 138 | 218 |
GO:0008410
|
| AF-A0A352H4X5-F1-model_v4 | deleted | 0.9648 | 98 | 217 |
|
| AF-A0A5A4WCF4-F1-model_v4 | deleted | 0.9418 | 98 | 217 |
|
| AF-A0A3D4T0Q5-F1-model_v4 | Succinyl-CoA--3-ketoacid-CoA transferase | 0.9404 | 102 | 217 |
GO:0008410
GO:0016787 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar