F494927

General Info

Members Datasets Scaffolds Average Seq Length
1589 902 1206 246

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2501025501|2501070266
Length 295
Sequence VPHLAARNTAFHHQSHEITTMSQQLQQIIDTAWENRADFSPKSAPNDVREAVAHVIAELDRGALRCAEKKDGDWVVNQWVKKAVLLSFRLEDNAPMPAGGYSQFYDKVPSKFASYTAEDFAAGGFRVVPPAIARRGSFIAKNVVLMPSYTNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPVIIEDNCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIYDRETGEVSYGRIPAGSVVVAGNLPSKDGSHSLYCAVIVKKVDAKTRAKVGLNELLRGD

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2506520008 Serratia plymuthica AS12 Isolate Unclassified
5 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
6 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
7 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
8 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
9 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
10 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
11 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
12 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
13 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
14 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
15 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
16 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
17 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
18 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
19 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
20 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
21 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
22 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
23 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
24 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
25 2519103095 Burkholderia sp. KJ006 Isolate Nodule
26 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
27 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
28 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
29 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
30 2547132181 Kosakonia sacchari SP1 Isolate Stem
31 2547132374 Acidovorax radicis N35 Isolate Unclassified
32 2547132512 Azospira oryzae 6a3 Isolate Unclassified
33 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
34 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
35 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
36 2561511199 Enterobacter sp. R4-368 Isolate Nodule
37 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
38 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
39 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
40 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
41 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
42 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
43 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
44 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
45 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
46 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
47 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
48 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
49 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
50 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
51 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
52 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
53 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
54 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
55 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
56 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
57 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
58 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
59 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
60 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
61 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
62 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
63 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
64 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
65 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
66 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
67 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
68 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
69 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
70 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
71 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
72 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
73 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
74 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
75 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
76 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
77 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
78 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
79 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
80 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
81 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
82 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
83 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
84 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
85 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
86 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
87 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
88 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
89 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
90 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
91 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
92 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
93 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
94 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
95 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
96 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
97 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
98 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
99 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
100 2636415599 Klebsiella variicola DX120E Isolate Unclassified
101 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
102 2643221556 Massilia sp. Root1485 Isolate Unclassified
103 2643221569 Achromobacter sp. Root565 Isolate Unclassified
104 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
105 2643221594 Achromobacter sp. Root170 Isolate Unclassified
106 2643221596 Acidovorax sp. Root70 Isolate Unclassified
107 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
108 2643221609 Acidovorax sp. Root217 Isolate Unclassified
109 2643221611 Acidovorax sp. Root219 Isolate Unclassified
110 2643221621 Achromobacter sp. Root83 Isolate Unclassified
111 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
112 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
113 2643221638 Duganella sp. Root336D2 Isolate Unclassified
114 2643221645 Massilia sp. Root351 Isolate Unclassified
115 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
116 2643221652 Acidovorax sp. Root402 Isolate Unclassified
117 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
118 2643221658 Variovorax sp. Root411 Isolate Unclassified
119 2643221660 Methylibium sp. Root1272 Isolate Unclassified
120 2643221664 Massilia sp. Root418 Isolate Unclassified
121 2643221665 Acinetobacter sp. Root1280 Isolate Unclassified
122 2643221672 Variovorax sp. Root434 Isolate Unclassified
123 2643221683 Variovorax sp. Root473 Isolate Unclassified
124 2643221684 Massilia sp. Root133 Isolate Unclassified
125 2643221717 Acidovorax sp. Root267 Isolate Unclassified
126 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
127 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
128 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
129 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
130 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
131 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
132 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
133 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
134 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
135 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
136 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
137 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
138 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
139 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
140 2738541277 Variovorax sp. GV051 Isolate Unclassified
141 2738541280 Massilia sp. GV090 Isolate Unclassified
142 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
143 2738541297 Duganella sp. GV083 Isolate Unclassified
144 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
145 2738541300 Massilia sp. GV016 Isolate Unclassified
146 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
147 2738541307 Variovorax sp. GV008 Isolate Unclassified
148 2738541357 Duganella sp. GV053 Isolate Unclassified
149 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
150 2738543003 Duganella sp. GV066 Isolate Unclassified
151 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
152 2738543012 Acidovorax sp. CF301 Isolate Unclassified
153 2738543013 Variovorax sp. BT01 Isolate Unclassified
154 2738543018 Massilia sp. GV045 Isolate Unclassified
155 2738543019 Variovorax sp. GV040 Isolate Unclassified
156 2738543026 Duganella sp. GV089 Isolate Unclassified
157 2738543029 Duganella sp. GV039 Isolate Unclassified
158 2738543030 Massilia sp. GV097 Isolate Unclassified
159 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
160 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
161 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
162 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
163 2751185917 Enterobacter sp. HK169 Isolate Unclassified
164 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
165 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
166 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
167 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
168 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
169 2775507074 Klebsiella sp. D5A Isolate Unclassified
170 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
171 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
172 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
173 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
174 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
175 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
176 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
177 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
178 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
179 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
180 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
181 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
182 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
183 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
184 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
185 2816332133 Acidovorax radicis 2721A Isolate Unclassified
186 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
187 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
188 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
189 2818991436 Collimonas arenae 515 Isolate Unclassified
190 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
191 2818991446 Variovorax sp. 1180 Isolate Unclassified
192 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
193 2818991450 Burkholderia sp. 604 Isolate Unclassified
194 2818991452 Burkholderia cepacia 561 Isolate Unclassified
195 2821118458 Enterobacter asburiae 609 Isolate Unclassified
196 2821131069 Duganella sp. 1224 Isolate Unclassified
197 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
198 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
199 2831864461 Roseateles noduli HZ7 Isolate Nodule
200 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
201 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
202 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
203 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
204 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
205 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
206 2842677519 Variovorax sp. R-72495 Isolate Unclassified
207 2842711865 Duganella sp. R-73148 Isolate Unclassified
208 2842733646 Variovorax sp. R-72446 Isolate Unclassified
209 2842747753 Variovorax sp. R-72060 Isolate Unclassified
210 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
211 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
212 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
213 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
214 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
215 2855730933 Achromobacter sp. HZ28 Isolate Nodule
216 2855767633 Achromobacter sp. HZ34 Isolate Nodule
217 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
218 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
219 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
220 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
221 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
222 2857553236 Duganella sp. R-74557 Isolate Unclassified
223 2857558681 Duganella sp. R-74565 Isolate Unclassified
224 2857564685 Duganella sp. R-74599 Isolate Unclassified
225 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
226 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
227 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
228 2858950400 Achromobacter sp. K91 Isolate Unclassified
229 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
230 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
231 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
232 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
233 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
234 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
235 2881714928 Pseudidiomarina mangrovi ZQ330 Isolate Rhizosphere
236 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
237 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
238 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
239 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
240 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
241 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
242 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
243 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
244 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
245 2885198086 Variovorax sp. 679 Isolate Unclassified
246 2885211737 Variovorax sp. 553 Isolate Unclassified
247 2885266251 Ralstonia sp. SET104 Isolate Nodule
248 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
249 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
250 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
251 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
252 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
253 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
254 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
255 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
256 2899924645 Variovorax sp. 369 Isolate Unclassified
257 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
258 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
259 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
260 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
261 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
262 2904424332 Duganella sp. 1411 Isolate Rhizosphere
263 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
264 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
265 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
266 2904456579 Variovorax sp. 2002 Isolate Unclassified
267 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
268 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
269 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
270 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
271 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
272 2904564687 Burkholderia sp. 571 Isolate Unclassified
273 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
274 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
275 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
276 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
277 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
278 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
279 2916178963 Pseudoalteromonas rhizosphaerae RA15 Isolate Rhizosphere
280 2916699645 Acinetobacter ursingii M3 Isolate Unclassified
281 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
282 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
283 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
284 2919476304 Duganella sp. 3397 Isolate Unclassified
285 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
286 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
287 2919506607 Acinetobacter sp. 3657 Isolate Unclassified
288 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
289 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
290 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
291 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
292 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
293 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
294 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
295 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
296 2928037797 Variovorax sp. 1126 Isolate Unclassified
297 2928044640 Variovorax sp. 1128 Isolate Unclassified
298 2928051484 Variovorax sp. 1133 Isolate Unclassified
299 2928058823 Ralstonia sp. 1138 Isolate Unclassified
300 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
301 2928070936 Variovorax gossypii 1167 Isolate Unclassified
302 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
303 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
304 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
305 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
306 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
307 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
308 2928163908 Burkholderia sp. 567 Isolate Unclassified
309 2928170801 Burkholderia sp. 572 Isolate Unclassified
310 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
311 2928515477 Acinetobacter bereziniae 1375 Isolate Rhizosphere
312 2928536128 Burkholderia sola 565 Isolate Unclassified
313 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
314 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
315 2929520902 Variovorax beijingensis 502 Isolate Unclassified
316 2932406140 Serratia sp. 2723 Isolate Rhizosphere
317 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
318 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
319 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
320 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
321 2937539931 Pantoea sp. LS15 Isolate Unclassified
322 2937967321 Serratia sp. YC16 Isolate Unclassified
323 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
324 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
325 2939577877 Serratia sp. 509 Isolate Rhizosphere
326 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
327 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
328 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
329 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
330 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
331 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
332 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
333 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
334 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
335 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
336 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
337 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
338 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
339 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
340 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
341 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
342 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
343 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
344 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
345 2984568884 Acinetobacter baylyi SORGH_AS893 Isolate Aerial Root
346 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
347 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
348 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
349 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
350 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
351 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
352 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
353 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
354 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
355 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
356 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
357 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
358 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
359 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
360 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
361 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
362 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
363 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
364 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
365 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
366 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
367 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
368 3300003479 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
369 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
370 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
371 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
372 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
373 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
374 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
375 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
376 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
377 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
378 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
379 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
380 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
381 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
382 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
383 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
384 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
385 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
386 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
387 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
388 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
389 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
390 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
391 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
392 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
393 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
394 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
395 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
396 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
397 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
398 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
399 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
400 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
401 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
402 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
403 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
404 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
405 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
406 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
407 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
408 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
409 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
410 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
411 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
412 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
413 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
414 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
415 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
416 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
417 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
418 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
419 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
420 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
421 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
422 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
423 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
424 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
425 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
426 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
427 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
428 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
429 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
430 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
431 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
432 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
433 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
434 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
435 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
436 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
437 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
438 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
439 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
440 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
441 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
442 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
443 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
444 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
445 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
446 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
447 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
448 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
449 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
450 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
451 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
452 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
453 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
454 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
455 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
456 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
457 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
458 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
459 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
460 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
461 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
462 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
463 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
464 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
465 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
466 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
467 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
468 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
469 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
470 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
471 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
472 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
473 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
474 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
475 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
476 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
477 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
478 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
479 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
480 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
481 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
482 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
483 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
484 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
485 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
486 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
487 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
488 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
489 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
490 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
491 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
492 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
493 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
494 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
495 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
496 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
497 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
498 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
499 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
500 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
501 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
502 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
503 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
504 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
505 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
506 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
507 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
508 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
509 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
510 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
511 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
512 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
513 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
514 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
515 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
516 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
517 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
518 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
519 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
520 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
521 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
522 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
523 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
524 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
525 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
526 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
527 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
528 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
529 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
530 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
531 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
532 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
533 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
534 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
535 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
536 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
537 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
538 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
539 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
540 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
541 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
542 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
543 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
544 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
545 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
546 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
547 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
548 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
549 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
550 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
551 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
552 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
553 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
554 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
555 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
556 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
557 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
558 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
559 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
560 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
561 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
562 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
563 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
564 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
565 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
566 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
567 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
568 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
569 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
570 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
571 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
572 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
573 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
574 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
575 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
576 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
577 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
578 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
579 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
580 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
581 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
582 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
583 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
584 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
585 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
586 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
587 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
588 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
589 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
590 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
591 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
592 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
593 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
594 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
595 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
596 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
597 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
598 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
599 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
600 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
601 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
602 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
603 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
604 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
605 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
606 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
607 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
608 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
609 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
610 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
611 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
612 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
613 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
614 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
615 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
616 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
617 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
618 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
619 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
620 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
621 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
622 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
623 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
624 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
625 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
626 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
627 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
628 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
629 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
630 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
631 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
632 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
633 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
634 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
635 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
636 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
637 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
638 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
639 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
640 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
641 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
642 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
643 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
644 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
645 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
646 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
647 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
648 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
649 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
650 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
651 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
652 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
653 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
654 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
655 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
656 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
657 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
658 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
659 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
660 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
661 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
662 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
663 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
664 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
665 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
666 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
667 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
668 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
669 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
670 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
671 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
672 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
673 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
674 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
675 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
676 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
677 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
678 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
679 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
680 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
681 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
682 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
683 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
684 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
685 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
686 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
687 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
688 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
689 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
690 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
691 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
692 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
693 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
694 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
695 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
696 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
697 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
698 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
699 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
700 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
701 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
702 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
703 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
704 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
705 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
706 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
707 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
708 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
709 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
710 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
711 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
712 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
713 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
714 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
715 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
716 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
717 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
718 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
719 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
720 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
721 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
722 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
723 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
724 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
725 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
726 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
727 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
728 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
729 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
730 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
731 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
732 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
733 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
734 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
735 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
736 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
737 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
738 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
739 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
740 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
741 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
742 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
743 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
744 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
745 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
746 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
747 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
748 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
749 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
750 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
751 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
752 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
753 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
754 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
755 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
756 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
757 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
758 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
759 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
760 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
761 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
762 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
763 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
764 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
765 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
766 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
767 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
768 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
769 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
770 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
771 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
772 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
773 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
774 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
775 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
776 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
777 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
778 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
779 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
780 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
781 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
782 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
783 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
784 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
785 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
786 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
787 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
788 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
789 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
790 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
791 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
792 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
793 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
794 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
795 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
796 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
797 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
798 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
799 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
800 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
801 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
802 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
803 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
804 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
805 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
806 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
807 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
808 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
809 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
810 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
811 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
812 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
813 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
814 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
815 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
816 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
817 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
818 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
819 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
820 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
821 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
822 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
823 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
824 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
825 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
826 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
827 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
828 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
829 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
830 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
831 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
832 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
833 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
834 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
835 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
836 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
837 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
838 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
839 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
840 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
841 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
842 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
843 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
844 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
845 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
846 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
847 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
848 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
849 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
850 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
851 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
852 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
853 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
854 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
855 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
856 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
857 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
858 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
859 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
860 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
861 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
862 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
863 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
864 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
865 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
866 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
867 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
868 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
869 639633007 Azoarcus olearius BH72 Isolate Unclassified
870 640753048 Serratia proteamaculans 568 Isolate Endosphere
871 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
872 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
873 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
874 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
875 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
876 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
877 8004592986 Serratia sp. S119 Isolate Unclassified
878 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
879 8018221730 Enterobacter sp. CM29 Isolate Unclassified
880 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
881 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
882 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
883 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
884 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
885 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
886 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
887 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
888 8033232454 Acinetobacter radioresistens SA188 Isolate Unclassified
889 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
890 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
891 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
892 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
893 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
894 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
895 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
896 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
897 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
898 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
899 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
900 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
901 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
902 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.52
Metatranscriptomes 0.38
Isolates 24.1

Biome Distribution

Category Percentage (%)
Aerial Root 0.19
Bulb 0
Endosphere 9
Nodule 2.39
Rhizoplane 6.48
Rhizosphere 66.08
Stem 0.06
Stem Tuber 0.31
Unclassified 15.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1004205 3300001976 Bacteria 1891
2 JGI24740J21852_10035369 3300001979 Bacteria 1562
3 JGI24739J22299_10000065 3300001989 Bacteria 29728
4 JGI24739J22299_10000141 3300001989 Bacteria 22875
5 JGI24739J22299_10007778 3300001989 Bacteria 4011
6 JGI24739J22299_10009567 3300001989 Bacteria 3607
7 JGI24739J22299_10015778 3300001989 Bacteria 2743
8 JGI24737J22298_10026242 3300001990 Bacteria 1840
9 JGI24743J22301_10010713 3300001991 Bacteria 1640
10 JGI24735J21928_10000304 3300002067 Bacteria 17151
11 JGI24735J21928_10000462 3300002067 Bacteria 14300
12 JGI24735J21928_10003854 3300002067 Bacteria 5076
13 JGI24738J21930_10001689 3300002075 Bacteria 6039
14 JGI24738J21930_10012456 3300002075 Bacteria 1858
15 JGI25155J39150_1000117 3300002704 Bacteria 39472
16 JGI25155J39150_1000303 3300002704 Bacteria 16743
17 JGI25156J39149_1000108 3300002705 Bacteria 59882
18 JGI25156J39149_1001040 3300002705 Bacteria 12889
19 JGI25156J39149_1001634 3300002705 Bacteria 9121
20 JGI25162J39368_1005095 3300002737 Bacteria 2728
21 JGI25154J39366_1000222 3300002738 Bacteria 38773
22 JGI25154J39366_1000463 3300002738 Bacteria 21207
23 JGI25157J39369_1000120 3300002741 Bacteria 67137
24 JGI25150J39212_1000667 3300002774 Bacteria 12602
25 JGI25151J46595_10000262 3300003187 Bacteria 61170
26 JGI25165J46597_1002348 3300003214 Bacteria 6356
27 JGI25153J46596_10003388 3300003215 Bacteria 8937
28 JGI25153J46596_10034800 3300003215 Bacteria 1640
29 rootL2_10007771 3300003322 Bacteria 8922
30 JGI25160J50197_1000102 3300003354 Bacteria 82464
31 Ga0006556J51387_1030668 3300003479 Bacteria 1310
32 Ga0006554J51385_1028769 3300003567 Bacteria 1216
33 Ga0055538_1000002 3300003751 Bacteria 999437
34 Ga0055539_1000002 3300003752 Bacteria 999437
35 Ga0055533_1000004 3300003756 Bacteria 999437
36 Ga0055533_1000235 3300003756 Bacteria 36089
37 Ga0055532_1000001 3300003758 Bacteria 1119836
38 Ga0055532_1000051 3300003758 Bacteria 165365
39 Ga0055525_1000002 3300003759 Bacteria 999437
40 Ga0055527_1000002 3300003760 Bacteria 830488
41 Ga0055535_1000001 3300003761 Bacteria 1119836
42 Ga0055542_1000001 3300003762 Bacteria 1119836
43 Ga0055529_1000026 3300003763 Bacteria 293254
44 Ga0055529_1000392 3300003763 Bacteria 46822
45 Ga0055529_1001316 3300003763 Bacteria 8427
46 Ga0055526_1000074 3300003771 Bacteria 92854
47 Ga0055526_1000086 3300003771 Bacteria 86198
48 Ga0055526_1014942 3300003771 Bacteria 3153
49 Ga0055537_1000012 3300003773 Bacteria 133761
50 Ga0055524_1000021 3300003775 Bacteria 227578
51 Ga0055524_1000099 3300003775 Bacteria 107171
52 Ga0055524_1009288 3300003775 Bacteria 4017
53 Ga0055534_1000399 3300003784 Bacteria 26784
54 Ga0055528_1000351 3300003790 Bacteria 37791
55 Ga0055528_1003000 3300003790 Bacteria 8724
56 Ga0055530_10010281 3300003791 Bacteria 3480
57 Ga0055531_10004883 3300003794 Bacteria 7989
58 Ga0055531_10043596 3300003794 Bacteria 1268
59 Ga0055541_1000002 3300003841 Bacteria 896405
60 Ga0065165_1000848 3300005262 Bacteria 40071
61 Ga0065165_1000995 3300005262 Bacteria 34985
62 Ga0065165_1001389 3300005262 Bacteria 26545
63 Ga0065165_1002021 3300005262 Bacteria 18891
64 Ga0065715_10009513 3300005293 Bacteria 2978
65 Ga0065707_10342981 3300005295 Bacteria 930
66 Ga0070658_10003785 3300005327 Bacteria 12392
67 Ga0070658_10013796 3300005327 Bacteria 6483
68 Ga0070658_10121400 3300005327 Bacteria 2171
69 Ga0070676_10073195 3300005328 Bacteria 2061
70 Ga0070676_10160615 3300005328 Bacteria 1446
71 Ga0070683_100017131 3300005329 Bacteria 6398
72 Ga0070690_100107845 3300005330 Bacteria 1854
73 Ga0070670_100048002 3300005331 Bacteria 3675
74 Ga0070670_100179598 3300005331 Bacteria 1837
75 Ga0070670_100217526 3300005331 Bacteria 1662
76 Ga0070670_100298112 3300005331 Bacteria 1410
77 Ga0070677_10003511 3300005333 Bacteria 5059
78 Ga0068869_100087182 3300005334 Bacteria 2341
79 Ga0068869_100101126 3300005334 Bacteria 2180
80 Ga0068869_100131549 3300005334 Bacteria 1924
81 Ga0070666_10026070 3300005335 Bacteria 3816
82 Ga0070680_100042649 3300005336 Bacteria 3682
83 Ga0070680_100225836 3300005336 Bacteria 1581
84 Ga0070682_100314188 3300005337 Bacteria 1154
85 Ga0070660_100000046 3300005339 Bacteria 70459
86 Ga0070660_100000646 3300005339 Bacteria 23099
87 Ga0070660_100000923 3300005339 Bacteria 19643
88 Ga0070660_100001084 3300005339 Bacteria 18307
89 Ga0070660_100041917 3300005339 Bacteria 3491
90 Ga0070660_100110067 3300005339 Bacteria 2191
91 Ga0070689_100011686 3300005340 Bacteria 6299
92 Ga0070689_100041672 3300005340 Bacteria 3525
93 Ga0070687_100004224 3300005343 Bacteria 5701
94 Ga0070687_100054985 3300005343 Bacteria 2076
95 Ga0070661_100003476 3300005344 Bacteria 10852
96 Ga0070661_100008601 3300005344 Bacteria 7059
97 Ga0070661_100167214 3300005344 Bacteria 1669
98 Ga0070668_100003227 3300005347 Bacteria 12020
99 Ga0070668_100170697 3300005347 Bacteria 1771
100 Ga0070668_100185688 3300005347 Bacteria 1700
101 Ga0070669_100007810 3300005353 Bacteria 7645
102 Ga0070669_100012088 3300005353 Bacteria 6127
103 Ga0070669_100105277 3300005353 Bacteria 2134
104 Ga0070675_100004454 3300005354 Bacteria 10683
105 Ga0070675_100028650 3300005354 Bacteria 4483
106 Ga0070675_100563773 3300005354 Bacteria 1031
107 Ga0070671_100002154 3300005355 Bacteria 15212
108 Ga0070671_100054603 3300005355 Bacteria 3322
109 Ga0070671_100115804 3300005355 Bacteria 2253
110 Ga0070671_100187887 3300005355 Bacteria 1751
111 Ga0070674_100024486 3300005356 Bacteria 3918
112 Ga0070674_100079070 3300005356 Bacteria 2345
113 Ga0070674_100094515 3300005356 Bacteria 2165
114 Ga0070674_100102615 3300005356 Bacteria 2086
115 Ga0070673_100006377 3300005364 Bacteria 7666
116 Ga0070673_100022059 3300005364 Bacteria 4629
117 Ga0070673_100188295 3300005364 Bacteria 1771
118 Ga0070688_100000242 3300005365 Bacteria 28832
119 Ga0070688_100023760 3300005365 Bacteria 3609
120 Ga0070659_100001931 3300005366 Bacteria 14814
121 Ga0070659_100083127 3300005366 Bacteria 2559
122 Ga0070659_100144393 3300005366 Bacteria 1938
123 Ga0070667_100000363 3300005367 Bacteria 49379
124 Ga0070667_100002252 3300005367 Bacteria 16981
125 Ga0070667_100025943 3300005367 Bacteria 4874
126 Ga0070667_100142704 3300005367 Bacteria 2099
127 Ga0070667_100616281 3300005367 Bacteria 1000
128 Ga0070714_100003461 3300005435 Bacteria 11767
129 Ga0070705_100038552 3300005440 Bacteria 2705
130 Ga0070700_100005082 3300005441 Bacteria 6940
131 Ga0070700_100012946 3300005441 Bacteria 4675
132 Ga0070663_100009438 3300005455 Bacteria 6041
133 Ga0070663_100018600 3300005455 Bacteria 4559
134 Ga0070663_100079453 3300005455 Bacteria 2407
135 Ga0070678_100025521 3300005456 Bacteria 3978
136 Ga0070678_100120149 3300005456 Bacteria 2071
137 Ga0070662_100000859 3300005457 Bacteria 18676
138 Ga0070662_100385305 3300005457 Bacteria 1154
139 Ga0070681_10003522 3300005458 Bacteria 14664
140 Ga0068867_100000006 3300005459 Bacteria 152530
141 Ga0068867_100079870 3300005459 Bacteria 2462
142 Ga0070685_10003093 3300005466 Bacteria 8463
143 Ga0070698_100275359 3300005471 Bacteria 1614
144 Ga0070679_100319142 3300005530 Bacteria 1503
145 Ga0070679_100458797 3300005530 Bacteria 1219
146 Ga0070684_100150710 3300005535 Bacteria 2107
147 Ga0068853_100008722 3300005539 Bacteria 8155
148 Ga0068853_100040591 3300005539 Bacteria 3971
149 Ga0068853_100116954 3300005539 Bacteria 2374
150 Ga0070672_100000208 3300005543 Bacteria 32511
151 Ga0070672_100030198 3300005543 Bacteria 4070
152 Ga0070672_100047622 3300005543 Bacteria 3328
153 Ga0070672_100102269 3300005543 Bacteria 2326
154 Ga0070672_100120364 3300005543 Bacteria 2148
155 Ga0070686_100035549 3300005544 Bacteria 3078
156 Ga0070686_100286387 3300005544 Bacteria 1217
157 Ga0070696_100009914 3300005546 Bacteria 6373
158 Ga0070696_100095869 3300005546 Bacteria 2119
159 Ga0070665_100006360 3300005548 Bacteria 12045
160 Ga0070665_100114056 3300005548 Bacteria 2705
161 Ga0070665_100197511 3300005548 Bacteria 2012
162 Ga0070665_100231318 3300005548 Bacteria 1848
163 Ga0070704_100032076 3300005549 Bacteria 3540
164 Ga0070704_100047674 3300005549 Bacteria 2996
165 Ga0068855_100001741 3300005563 Bacteria 27181
166 Ga0068855_100003042 3300005563 Bacteria 20540
167 Ga0068855_100009643 3300005563 Bacteria 11649
168 Ga0068855_100026769 3300005563 Bacteria 6900
169 Ga0068855_100039740 3300005563 Bacteria 5585
170 Ga0068855_100046760 3300005563 Bacteria 5114
171 Ga0070664_100009148 3300005564 Bacteria 8041
172 Ga0070664_100009861 3300005564 Bacteria 7740
173 Ga0070664_100013457 3300005564 Bacteria 6662
174 Ga0070664_100038486 3300005564 Bacteria 4026
175 Ga0070664_100072980 3300005564 Bacteria 2944
176 Ga0070664_100127051 3300005564 Bacteria 2237
177 Ga0068857_100003862 3300005577 Bacteria 12610
178 Ga0068857_100049862 3300005577 Bacteria 3714
179 Ga0068857_100466057 3300005577 Bacteria 1183
180 Ga0068854_100011136 3300005578 Bacteria 5840
181 Ga0068854_100025157 3300005578 Bacteria 4084
182 Ga0068854_100164637 3300005578 Bacteria 1721
183 Ga0068854_100177767 3300005578 Bacteria 1660
184 Ga0068856_100003022 3300005614 Bacteria 17234
185 Ga0068856_100100140 3300005614 Bacteria 2890
186 Ga0068856_100103691 3300005614 Bacteria 2838
187 Ga0068856_100396328 3300005614 Bacteria 1400
188 Ga0070702_100006282 3300005615 Bacteria 5612
189 Ga0068852_100052466 3300005616 Bacteria 3504
190 Ga0068852_100052664 3300005616 Bacteria 3499
191 Ga0068852_100114812 3300005616 Bacteria 2454
192 Ga0068852_100378390 3300005616 Bacteria 1388
193 Ga0068852_100659250 3300005616 Bacteria 1054
194 Ga0068859_100073513 3300005617 Bacteria 3457
195 Ga0068864_100016433 3300005618 Bacteria 6161
196 Ga0068864_100025688 3300005618 Bacteria 4963
197 Ga0068866_10001055 3300005718 Bacteria 12136
198 Ga0068861_100008415 3300005719 Bacteria 7104
199 Ga0068861_100018404 3300005719 Bacteria 4978
200 Ga0068861_100029827 3300005719 Bacteria 3993
201 Ga0068861_100124147 3300005719 Bacteria 2087
202 Ga0068851_10117239 3300005834 Bacteria 1427
203 Ga0068870_10004404 3300005840 Bacteria 6065
204 Ga0068870_10049308 3300005840 Bacteria 2221
205 Ga0068863_100082483 3300005841 Bacteria 3047
206 Ga0068863_100180440 3300005841 Bacteria 2026
207 Ga0068863_100184441 3300005841 Bacteria 2004
208 Ga0068863_100299206 3300005841 Bacteria 1561
209 Ga0068863_100361050 3300005841 Bacteria 1416
210 Ga0068858_100028665 3300005842 Bacteria 5170
211 Ga0068858_100266933 3300005842 Bacteria 1628
212 Ga0068860_100039561 3300005843 Bacteria 4510
213 Ga0068860_100072236 3300005843 Bacteria 3279
214 Ga0068860_100086668 3300005843 Bacteria 2980
215 Ga0068860_100118924 3300005843 Bacteria 2529
216 Ga0068860_100227804 3300005843 Bacteria 1811
217 Ga0068862_100009198 3300005844 Bacteria 8182
218 Ga0068862_100117675 3300005844 Bacteria 2339
219 Ga0068862_100142493 3300005844 Bacteria 2128
220 Ga0068862_100205428 3300005844 Bacteria 1778
221 Ga0081455_10004332 3300005937 Bacteria 15984
222 Ga0075368_10095893 3300006042 Bacteria 1216
223 Ga0075363_100083329 3300006048 Bacteria 1752
224 Ga0070716_100000075 3300006173 Bacteria 38157
225 Ga0070712_100089568 3300006175 Bacteria 2251
226 Ga0075362_10005262 3300006177 Bacteria 4722
227 Ga0075367_10007819 3300006178 Bacteria 5500
228 Ga0075366_10015633 3300006195 Bacteria 4354
229 Ga0075366_10020636 3300006195 Bacteria 3825
230 Ga0075366_10183616 3300006195 Bacteria 1271
231 Ga0075366_10251679 3300006195 Bacteria 1077
232 Ga0097621_100020799 3300006237 Bacteria 5063
233 Ga0097621_100327126 3300006237 Bacteria 1359
234 Ga0097621_100504237 3300006237 Bacteria 1096
235 Ga0075370_10008613 3300006353 Bacteria 5258
236 Ga0075370_10021076 3300006353 Bacteria 3569
237 Ga0075370_10105203 3300006353 Bacteria 1636
238 Ga0068871_100011150 3300006358 Bacteria 6590
239 Ga0068871_100185256 3300006358 Bacteria 1791
240 Ga0075428_100019639 3300006844 Bacteria 7477
241 Ga0075430_100061726 3300006846 Bacteria 3149
242 Ga0075430_100174741 3300006846 Bacteria 1787
243 Ga0075431_100014998 3300006847 Bacteria 7845
244 Ga0075434_100091112 3300006871 Bacteria 3051
245 Ga0075434_100305682 3300006871 Bacteria 1611
246 Ga0075434_100421173 3300006871 Bacteria 1356
247 Ga0075429_100269650 3300006880 Bacteria 1491
248 Ga0068865_100019463 3300006881 Bacteria 4393
249 Ga0068865_100041950 3300006881 Bacteria 3117
250 Ga0068865_100044895 3300006881 Bacteria 3027
251 Ga0097620_100073511 3300006931 Bacteria 3457
252 Ga0099823_1006273 3300006944 Bacteria 11985
253 Ga0079104_1004305 3300006946 Bacteria 6160
254 Ga0099826_10000002 3300006948 Bacteria 1125830
255 Ga0075435_100047799 3300007076 Bacteria 3437
256 Ga0099794_10013815 3300007265 Bacteria 3523
257 Ga0105244_10005473 3300009036 Bacteria 8438
258 Ga0105250_10029331 3300009092 Bacteria 2214
259 Ga0105240_10002341 3300009093 Bacteria 30608
260 Ga0105240_10008869 3300009093 Bacteria 14311
261 Ga0105240_10022945 3300009093 Bacteria 8267
262 Ga0105240_10025060 3300009093 Bacteria 7851
263 Ga0105240_10044913 3300009093 Bacteria 5608
264 Ga0105240_10065376 3300009093 Bacteria 4515
265 Ga0105240_10169689 3300009093 Bacteria 2585
266 Ga0111539_10008224 3300009094 Bacteria 13277
267 Ga0111539_10010207 3300009094 Bacteria 11836
268 Ga0111539_10017857 3300009094 Bacteria 8786
269 Ga0111539_10044187 3300009094 Bacteria 5338
270 Ga0111539_10481352 3300009094 Bacteria 1446
271 Ga0111539_10579902 3300009094 Bacteria 1306
272 Ga0111539_11099492 3300009094 Bacteria 924
273 Ga0105245_10096658 3300009098 Bacteria 2726
274 Ga0105245_10099033 3300009098 Bacteria 2694
275 Ga0105247_10149251 3300009101 Bacteria 1539
276 Ga0114129_10062288 3300009147 Bacteria 5212
277 Ga0114129_10267296 3300009147 Bacteria 2289
278 Ga0105243_10007446 3300009148 Bacteria 8412
279 Ga0105243_10038792 3300009148 Bacteria 3710
280 Ga0105243_10059329 3300009148 Bacteria 3053
281 Ga0105243_10100525 3300009148 Bacteria 2399
282 Ga0105242_10002939 3300009176 Bacteria 13325
283 Ga0105242_10020500 3300009176 Bacteria 5184
284 Ga0105242_10021310 3300009176 Bacteria 5085
285 Ga0105242_10038050 3300009176 Bacteria 3867
286 Ga0105242_10344902 3300009176 Bacteria 1374
287 Ga0105248_10003709 3300009177 Bacteria 16935
288 Ga0105237_10015121 3300009545 Bacteria 8041
289 Ga0105237_10121127 3300009545 Bacteria 2611
290 Ga0105237_10133693 3300009545 Bacteria 2475
291 Ga0105237_10165934 3300009545 Bacteria 2207
292 Ga0105238_10000977 3300009551 Bacteria 29236
293 Ga0105238_10059780 3300009551 Bacteria 3817
294 Ga0105238_10134544 3300009551 Bacteria 2450
295 Ga0105238_10285609 3300009551 Bacteria 1632
296 Ga0105249_10286980 3300009553 Bacteria 1646
297 Ga0105249_10450169 3300009553 Bacteria 1326
298 Ga0105239_10022568 3300010375 Bacteria 6939
299 Ga0105239_10032953 3300010375 Bacteria 5692
300 Ga0105239_10195897 3300010375 Bacteria 2263
301 Ga0105239_10291735 3300010375 Bacteria 1837
302 Ga0105239_10477400 3300010375 Bacteria 1416
303 Ga0105246_10194277 3300011119 Bacteria 1573
304 Ga0157319_1000006 3300012497 Bacteria 361506
305 Ga0157373_10003697 3300013100 Bacteria 11578
306 Ga0157373_10019329 3300013100 Bacteria 4961
307 Ga0157373_10027516 3300013100 Bacteria 4103
308 Ga0157371_10000422 3300013102 Bacteria 52177
309 Ga0157371_10006694 3300013102 Bacteria 9424
310 Ga0157370_10000850 3300013104 Bacteria 38703
311 Ga0157370_10001346 3300013104 Bacteria 30508
312 Ga0157370_10228352 3300013104 Bacteria 1723
313 Ga0157370_10258120 3300013104 Bacteria 1611
314 Ga0157369_10000947 3300013105 Bacteria 36855
315 Ga0157369_10000979 3300013105 Bacteria 36209
316 Ga0157369_10009691 3300013105 Bacteria 11016
317 Ga0157369_10047494 3300013105 Bacteria 4660
318 Ga0157374_10000107 3300013296 Bacteria 75925
319 Ga0157374_10623742 3300013296 Bacteria 1089
320 Ga0157378_10072572 3300013297 Bacteria 3093
321 Ga0163162_10008076 3300013306 Bacteria 10271
322 Ga0163162_10354848 3300013306 Bacteria 1599
323 Ga0157372_10004539 3300013307 Bacteria 14782
324 Ga0157372_10004653 3300013307 Bacteria 14585
325 Ga0157372_10006612 3300013307 Bacteria 12334
326 Ga0157372_10126293 3300013307 Bacteria 2941
327 Ga0157372_10207410 3300013307 Bacteria 2271
328 Ga0157375_10004499 3300013308 Bacteria 12119
329 Ga0157375_10125562 3300013308 Bacteria 2680
330 Ga0157375_10161243 3300013308 Bacteria 2384
331 Ga0157375_10374823 3300013308 Bacteria 1590
332 Ga0157375_10668214 3300013308 Bacteria 1194
333 Ga0163163_10020768 3300014325 Bacteria 6191
334 Ga0163163_10083221 3300014325 Bacteria 3205
335 Ga0163163_10084331 3300014325 Bacteria 3183
336 Ga0163163_10439880 3300014325 Bacteria 1364
337 Ga0157380_10001038 3300014326 Bacteria 17730
338 Ga0157380_10023317 3300014326 Bacteria 4668
339 Ga0157380_10074237 3300014326 Bacteria 2760
340 Ga0157380_10098497 3300014326 Bacteria 2429
341 Ga0182008_10014563 3300014497 Bacteria 4116
342 Ga0182008_10035124 3300014497 Bacteria 2512
343 Ga0157377_10000013 3300014745 Bacteria 267125
344 Ga0157379_10006759 3300014968 Bacteria 9912
345 Ga0157379_10293153 3300014968 Bacteria 1482
346 Ga0157376_10000565 3300014969 Bacteria 23889
347 Ga0157376_10043568 3300014969 Bacteria 3683
348 Ga0157376_10302009 3300014969 Bacteria 1516
349 Ga0182006_1000002 3300015261 Bacteria 887990
350 Ga0182006_1000026 3300015261 Bacteria 253543
351 Ga0182006_1031040 3300015261 Bacteria 2155
352 Ga0182006_1052716 3300015261 Bacteria 1562
353 Ga0182007_10000073 3300015262 Bacteria 80601
354 Ga0182007_10000581 3300015262 Bacteria 21489
355 Ga0182005_1000002 3300015265 Bacteria 908499
356 Ga0182005_1000007 3300015265 Bacteria 490994
357 Ga0182005_1000662 3300015265 Bacteria 16334
358 Ga0182005_1064419 3300015265 Bacteria 1002
359 Ga0183361_10006 3300016635 Bacteria 368532
360 Ga0163161_10009466 3300017792 Bacteria 6742
361 Ga0163161_10029871 3300017792 Bacteria 3874
362 Ga0163161_10167383 3300017792 Bacteria 1679
363 Ga0206355_1144450 3300020076 Bacteria 1483
364 Ga0213872_10000028 3300021361 Bacteria 148766
365 Ga0213872_10000046 3300021361 Bacteria 109934
366 Ga0213872_10000048 3300021361 Bacteria 109712
367 Ga0213872_10000086 3300021361 Bacteria 84955
368 Ga0213872_10016214 3300021361 Bacteria 3459
369 Ga0213872_10042905 3300021361 Bacteria 2062
370 Ga0209435_100028 3300025206 Bacteria 182520
371 Ga0209435_100139 3300025206 Bacteria 24429
372 Ga0209784_100002 3300025224 Bacteria 1753105
373 Ga0209566_100003 3300025225 Bacteria 1753105
374 Ga0209566_100504 3300025225 Bacteria 27098
375 Ga0209674_100004 3300025226 Bacteria 1753105
376 Ga0209674_100005 3300025226 Bacteria 1708125
377 Ga0209674_101381 3300025226 Bacteria 6524
378 Ga0209672_100001 3300025228 Bacteria 2828210
379 Ga0209672_100014 3300025228 Bacteria 546252
380 Ga0209672_100023 3300025228 Bacteria 371758
381 Ga0209672_100530 3300025228 Bacteria 20839
382 Ga0209147_100001 3300025229 Bacteria 2384371
383 Ga0209147_100004 3300025229 Bacteria 1371850
384 Ga0209147_100094 3300025229 Bacteria 167145
385 Ga0209147_100104 3300025229 Bacteria 158375
386 Ga0209563_100006 3300025230 Bacteria 1753105
387 Ga0209563_100468 3300025230 Bacteria 13843
388 Ga0207427_100592 3300025231 Bacteria 18165
389 Ga0209437_100053 3300025233 Bacteria 375580
390 Ga0209258_100001 3300025242 Bacteria 2384269
391 Ga0209258_100040 3300025242 Bacteria 385401
392 Ga0209258_100142 3300025242 Bacteria 165865
393 Ga0207425_1000192 3300025245 Bacteria 49765
394 Ga0209646_1000021 3300025246 Bacteria 461083
395 Ga0209646_1000095 3300025246 Bacteria 182520
396 Ga0209026_1000110 3300025250 Bacteria 141989
397 Ga0209677_100003 3300025253 Bacteria 1753105
398 Ga0209148_1000003 3300025254 Bacteria 2384288
399 Ga0209148_1000035 3300025254 Bacteria 548413
400 Ga0209148_1002027 3300025254 Bacteria 7906
401 Ga0209759_1000030 3300025256 Bacteria 285649
402 Ga0209759_1000080 3300025256 Bacteria 171186
403 Ga0209759_1000115 3300025256 Bacteria 141877
404 Ga0209759_1000155 3300025256 Bacteria 118819
405 Ga0209759_1000260 3300025256 Bacteria 76538
406 Ga0209759_1001844 3300025256 Bacteria 10606
407 Ga0209759_1012521 3300025256 Bacteria 2345
408 Ga0209233_1000016 3300025261 Bacteria 907830
409 Ga0209565_1000057 3300025263 Bacteria 196908
410 Ga0209565_1029489 3300025263 Bacteria 1077
411 Ga0207666_1002150 3300025271 Bacteria 2365
412 Ga0209455_1000001 3300025272 Bacteria 2384278
413 Ga0209455_1000037 3300025272 Bacteria 464097
414 Ga0209455_1000072 3300025272 Bacteria 293074
415 Ga0209455_1004470 3300025272 Bacteria 4563
416 Ga0209455_1009709 3300025272 Bacteria 2506
417 Ga0209673_1000051 3300025273 Bacteria 282161
418 Ga0209673_1000140 3300025273 Bacteria 157575
419 Ga0209673_1010871 3300025273 Bacteria 3802
420 Ga0209673_1014088 3300025273 Bacteria 3114
421 Ga0209673_1025996 3300025273 Bacteria 1934
422 Ga0209673_1028369 3300025273 Bacteria 1803
423 Ga0209675_1000027 3300025291 Bacteria 282175
424 Ga0209025_1000057 3300025294 Bacteria 314601
425 Ga0209025_1007891 3300025294 Bacteria 7806
426 Ga0209564_1000003 3300025295 Bacteria 1585848
427 Ga0209564_1000009 3300025295 Bacteria 950196
428 Ga0209564_1000094 3300025295 Bacteria 243176
429 Ga0209564_1022747 3300025295 Bacteria 2202
430 Ga0209758_1000096 3300025297 Bacteria 231496
431 Ga0209758_1000227 3300025297 Bacteria 120073
432 Ga0209050_1003867 3300025298 Bacteria 10643
433 Ga0209050_1006055 3300025298 Bacteria 7322
434 Ga0209256_1000044 3300025299 Bacteria 337264
435 Ga0209256_1000139 3300025299 Bacteria 155515
436 Ga0209256_1004237 3300025299 Bacteria 9194
437 Ga0209256_1024727 3300025299 Bacteria 1764
438 Ga0207426_1000125 3300025302 Bacteria 217504
439 Ga0209051_1000367 3300025303 Bacteria 65677
440 Ga0209051_1001570 3300025303 Bacteria 18860
441 Ga0209257_1000012 3300025304 Bacteria 1111138
442 Ga0209257_1033503 3300025304 Bacteria 1614
443 Ga0207697_10000129 3300025315 Bacteria 36355
444 Ga0207697_10021145 3300025315 Bacteria 2664
445 Ga0207656_10011124 3300025321 Bacteria 3391
446 Ga0207696_1021964 3300025711 Bacteria 2035
447 Ga0207655_1001746 3300025728 Bacteria 19071
448 Ga0207713_1000252 3300025735 Bacteria 67447
449 Ga0207713_1000864 3300025735 Bacteria 27722
450 Ga0207682_10000157 3300025893 Bacteria 30775
451 Ga0207642_10054369 3300025899 Bacteria 1826
452 Ga0207710_10011735 3300025900 Bacteria 3686
453 Ga0207688_10000508 3300025901 Bacteria 18745
454 Ga0207680_10030205 3300025903 Bacteria 3053
455 Ga0207680_10103558 3300025903 Bacteria 1833
456 Ga0207680_10146406 3300025903 Bacteria 1571
457 Ga0207647_10000498 3300025904 Bacteria 31401
458 Ga0207647_10000605 3300025904 Bacteria 27980
459 Ga0207685_10195559 3300025905 Bacteria 947
460 Ga0207645_10001209 3300025907 Bacteria 21313
461 Ga0207643_10000883 3300025908 Bacteria 18064
462 Ga0207643_10037238 3300025908 Bacteria 2729
463 Ga0207643_10069351 3300025908 Bacteria 2026
464 Ga0207654_10215135 3300025911 Bacteria 1272
465 Ga0207707_10034389 3300025912 Bacteria 4434
466 Ga0207707_10037528 3300025912 Bacteria 4235
467 Ga0207707_10384208 3300025912 Bacteria 1207
468 Ga0207695_10000926 3300025913 Bacteria 52365
469 Ga0207695_10002201 3300025913 Bacteria 29360
470 Ga0207695_10024266 3300025913 Bacteria 6828
471 Ga0207695_10081775 3300025913 Bacteria 3268
472 Ga0207695_10100163 3300025913 Bacteria 2894
473 Ga0207695_10173512 3300025913 Bacteria 2080
474 Ga0207695_10395223 3300025913 Bacteria 1267
475 Ga0207671_10026114 3300025914 Bacteria 4381
476 Ga0207671_10052850 3300025914 Bacteria 3011
477 Ga0207693_10097305 3300025915 Bacteria 2308
478 Ga0207693_10225050 3300025915 Bacteria 1473
479 Ga0207663_10209244 3300025916 Bacteria 1412
480 Ga0207663_10304763 3300025916 Bacteria 1191
481 Ga0207660_10081617 3300025917 Bacteria 2377
482 Ga0207660_10100383 3300025917 Bacteria 2161
483 Ga0207662_10002138 3300025918 Bacteria 9836
484 Ga0207662_10004730 3300025918 Bacteria 7189
485 Ga0207657_10000004 3300025919 Bacteria 247179
486 Ga0207657_10004856 3300025919 Bacteria 14157
487 Ga0207657_10007145 3300025919 Bacteria 11467
488 Ga0207657_10035316 3300025919 Bacteria 4484
489 Ga0207657_10111826 3300025919 Bacteria 2255
490 Ga0207681_10013238 3300025923 Bacteria 5101
491 Ga0207681_10027333 3300025923 Bacteria 3688
492 Ga0207681_10189141 3300025923 Bacteria 1574
493 Ga0207681_10229837 3300025923 Bacteria 1439
494 Ga0207681_10486921 3300025923 Bacteria 1008
495 Ga0207694_10008234 3300025924 Bacteria 7882
496 Ga0207694_10029080 3300025924 Bacteria 4214
497 Ga0207694_10098164 3300025924 Bacteria 2319
498 Ga0207694_10265458 3300025924 Bacteria 1407
499 Ga0207650_10012131 3300025925 Bacteria 5940
500 Ga0207650_10049298 3300025925 Bacteria 3109
501 Ga0207650_10197962 3300025925 Bacteria 1608
502 Ga0207659_10010632 3300025926 Bacteria 5787
503 Ga0207659_10416329 3300025926 Bacteria 1126
504 Ga0207664_10005455 3300025929 Bacteria 8697
505 Ga0207644_10019073 3300025931 Bacteria 4649
506 Ga0207644_10040966 3300025931 Bacteria 3275
507 Ga0207644_10056873 3300025931 Bacteria 2823
508 Ga0207644_10215812 3300025931 Bacteria 1518
509 Ga0207690_10001165 3300025932 Bacteria 16639
510 Ga0207690_10098960 3300025932 Bacteria 2079
511 Ga0207706_10000064 3300025933 Bacteria 109094
512 Ga0207706_10000928 3300025933 Bacteria 30049
513 Ga0207706_10013987 3300025933 Bacteria 7277
514 Ga0207706_10078212 3300025933 Bacteria 2909
515 Ga0207706_10287878 3300025933 Bacteria 1432
516 Ga0207686_10009771 3300025934 Bacteria 5215
517 Ga0207686_10389612 3300025934 Bacteria 1059
518 Ga0207709_10002748 3300025935 Bacteria 10847
519 Ga0207709_10004452 3300025935 Bacteria 8091
520 Ga0207709_10444253 3300025935 Bacteria 1001
521 Ga0207670_10249718 3300025936 Bacteria 1370
522 Ga0207669_10005626 3300025937 Bacteria 5644
523 Ga0207669_10056952 3300025937 Bacteria 2377
524 Ga0207669_10096727 3300025937 Bacteria 1939
525 Ga0207704_10094380 3300025938 Bacteria 1975
526 Ga0207691_10000087 3300025940 Bacteria 78167
527 Ga0207691_10038626 3300025940 Bacteria 4418
528 Ga0207691_10039177 3300025940 Bacteria 4384
529 Ga0207691_10053485 3300025940 Bacteria 3686
530 Ga0207691_10071826 3300025940 Bacteria 3122
531 Ga0207691_10133018 3300025940 Bacteria 2196
532 Ga0207691_10163814 3300025940 Bacteria 1949
533 Ga0207711_10024058 3300025941 Bacteria 5098
534 Ga0207711_10214096 3300025941 Bacteria 1760
535 Ga0207689_10003785 3300025942 Bacteria 13785
536 Ga0207689_10023736 3300025942 Bacteria 5145
537 Ga0207689_10044208 3300025942 Bacteria 3682
538 Ga0207689_10208111 3300025942 Bacteria 1616
539 Ga0207689_10250294 3300025942 Bacteria 1465
540 Ga0207689_10255085 3300025942 Bacteria 1451
541 Ga0207661_10073969 3300025944 Bacteria 2792
542 Ga0207679_10005057 3300025945 Bacteria 8245
543 Ga0207679_10009281 3300025945 Bacteria 6293
544 Ga0207679_10024676 3300025945 Bacteria 4125
545 Ga0207679_10086280 3300025945 Bacteria 2414
546 Ga0207679_10572556 3300025945 Bacteria 1015
547 Ga0207667_10000036 3300025949 Bacteria 297966
548 Ga0207667_10002775 3300025949 Bacteria 21673
549 Ga0207667_10003108 3300025949 Bacteria 20547
550 Ga0207667_10011537 3300025949 Bacteria 10264
551 Ga0207667_10029744 3300025949 Bacteria 5918
552 Ga0207667_10075369 3300025949 Bacteria 3503
553 Ga0207667_10090963 3300025949 Bacteria 3153
554 Ga0207651_10009113 3300025960 Bacteria 5405
555 Ga0207651_10041860 3300025960 Bacteria 3044
556 Ga0207651_10126061 3300025960 Bacteria 1951
557 Ga0207668_10001815 3300025972 Bacteria 12452
558 Ga0207668_10057056 3300025972 Bacteria 2723
559 Ga0207640_10010935 3300025981 Bacteria 5121
560 Ga0207640_10020459 3300025981 Bacteria 3930
561 Ga0207640_10110301 3300025981 Bacteria 1949
562 Ga0207658_10000322 3300025986 Bacteria 48194
563 Ga0207658_10017921 3300025986 Bacteria 4881
564 Ga0207658_10102594 3300025986 Bacteria 2244
565 Ga0207658_10217759 3300025986 Bacteria 1604
566 Ga0207658_10276004 3300025986 Bacteria 1439
567 Ga0207677_10423813 3300026023 Bacteria 1134
568 Ga0207639_10003441 3300026041 Bacteria 10648
569 Ga0207639_10036308 3300026041 Bacteria 3651
570 Ga0207678_10003926 3300026067 Bacteria 13374
571 Ga0207678_10006140 3300026067 Bacteria 10686
572 Ga0207678_10006659 3300026067 Bacteria 10241
573 Ga0207678_10173808 3300026067 Bacteria 1839
574 Ga0207678_10341463 3300026067 Bacteria 1290
575 Ga0207708_10002281 3300026075 Bacteria 14131
576 Ga0207708_10072561 3300026075 Bacteria 2637
577 Ga0207702_10010543 3300026078 Bacteria 7725
578 Ga0207702_10385526 3300026078 Bacteria 1348
579 Ga0207641_10189164 3300026088 Bacteria 1891
580 Ga0207648_10000006 3300026089 Bacteria 223855
581 Ga0207648_10004444 3300026089 Bacteria 14385
582 Ga0207676_10136478 3300026095 Bacteria 2093
583 Ga0207676_10165927 3300026095 Bacteria 1918
584 Ga0207674_10000437 3300026116 Bacteria 53986
585 Ga0207674_10002032 3300026116 Bacteria 25666
586 Ga0207674_10144921 3300026116 Bacteria 2334
587 Ga0207674_10241613 3300026116 Bacteria 1753
588 Ga0207674_10306920 3300026116 Bacteria 1536
589 Ga0207674_10329185 3300026116 Bacteria 1477
590 Ga0207674_10363838 3300026116 Bacteria 1398
591 Ga0207674_10511969 3300026116 Bacteria 1159
592 Ga0207675_100001840 3300026118 Bacteria 21287
593 Ga0207675_100012754 3300026118 Bacteria 7852
594 Ga0207675_100041887 3300026118 Bacteria 4276
595 Ga0207675_100072042 3300026118 Bacteria 3231
596 Ga0207675_100258482 3300026118 Bacteria 1687
597 Ga0207683_10000223 3300026121 Bacteria 49909
598 Ga0207683_10041600 3300026121 Bacteria 4013
599 Ga0207683_10053360 3300026121 Bacteria 3544
600 Ga0207698_10028347 3300026142 Bacteria 3992
601 Ga0207698_10036689 3300026142 Bacteria 3601
602 Ga0207698_10051736 3300026142 Bacteria 3142
603 Ga0207698_10127853 3300026142 Bacteria 2165
604 Ga0209389_1016619 3300027296 Bacteria 6661
605 Ga0209371_1000079 3300027312 Bacteria 187621
606 Ga0209282_1000001 3300027666 Bacteria 2450367
607 Ga0209971_1002887 3300027682 Bacteria 4104
608 Ga0209813_10031522 3300027866 Bacteria 1565
609 Ga0209974_10015038 3300027876 Bacteria 2570
610 Ga0207428_10007839 3300027907 Bacteria 9713
611 Ga0207428_10111489 3300027907 Bacteria 2105
612 Ga0207428_10287455 3300027907 Bacteria 1219
613 Ga0268266_10005164 3300028379 Bacteria 12303
614 Ga0268266_10022948 3300028379 Bacteria 5310
615 Ga0268266_10098585 3300028379 Bacteria 2571
616 Ga0268266_10157857 3300028379 Bacteria 2050
617 Ga0268265_10225041 3300028380 Bacteria 1644
618 Ga0268264_10062720 3300028381 Bacteria 3122
619 Ga0268264_10077361 3300028381 Bacteria 2834
620 Ga0268264_10292743 3300028381 Bacteria 1530
621 Ga0268264_10710253 3300028381 Bacteria 999
622 Ga0307517_10106490 3300028786 Bacteria 2168
623 Ga0307515_10002761 3300028794 Bacteria 37491
624 Ga0265338_10000028 3300028800 Bacteria 279132
625 Ga0265324_10019937 3300029957 Bacteria 2413
626 Ga0268256_1000090 3300030500 Bacteria 153976
627 Ga0265332_10000094 3300031238 Bacteria 77636
628 Ga0265332_10002144 3300031238 Bacteria 10194
629 Ga0265332_10007434 3300031238 Bacteria 4952
630 Ga0265328_10049342 3300031239 Bacteria 1546
631 Ga0265328_10095711 3300031239 Bacteria 1098
632 Ga0265325_10044008 3300031241 Bacteria 2327
633 Ga0265329_10001607 3300031242 Bacteria 10835
634 Ga0265331_10000303 3300031250 Bacteria 53811
635 Ga0265331_10000565 3300031250 Bacteria 33257
636 Ga0265327_10000007 3300031251 Bacteria 678515
637 Ga0265327_10000217 3300031251 Bacteria 117085
638 Ga0265327_10021683 3300031251 Bacteria 3869
639 Ga0307513_10378038 3300031456 Bacteria 1157
640 Ga0307509_10122075 3300031507 Bacteria 2581
641 Ga0307509_10125632 3300031507 Bacteria 2532
642 Ga0307509_10155234 3300031507 Bacteria 2196
643 Ga0307509_10175510 3300031507 Bacteria 2016
644 Ga0307509_10225497 3300031507 Bacteria 1682
645 Ga0307408_100005566 3300031548 Bacteria 8420
646 Ga0307408_100012826 3300031548 Bacteria 5558
647 Ga0307408_100105642 3300031548 Bacteria 2153
648 Ga0307408_100421549 3300031548 Bacteria 1151
649 Ga0307508_10007413 3300031616 Bacteria 10216
650 Ga0307514_10178034 3300031649 Bacteria 1376
651 Ga0316579_10080889 3300031691 Bacteria 1546
652 Ga0307516_10225042 3300031730 Bacteria 1583
653 Ga0307405_10001063 3300031731 Bacteria 11146
654 Ga0307405_10165804 3300031731 Bacteria 1570
655 Ga0316577_10014934 3300031733 Bacteria 4269
656 Ga0307518_10014580 3300031838 Bacteria 5615
657 Ga0307410_10177943 3300031852 Bacteria 1608
658 Ga0307406_10003525 3300031901 Bacteria 8529
659 Ga0307406_10012543 3300031901 Bacteria 4831
660 Ga0307406_10014170 3300031901 Bacteria 4582
661 Ga0307407_10004629 3300031903 Bacteria 5868
662 Ga0307412_10000021 3300031911 Bacteria 250629
663 Ga0307412_10005897 3300031911 Bacteria 6899
664 Ga0307412_10009253 3300031911 Bacteria 5647
665 Ga0307412_10419582 3300031911 Bacteria 1094
666 Ga0307409_100005917 3300031995 Bacteria 7111
667 Ga0307409_100045019 3300031995 Bacteria 3328
668 Ga0307416_100010456 3300032002 Bacteria 6129
669 Ga0307416_100039057 3300032002 Bacteria 3670
670 Ga0307414_10007717 3300032004 Bacteria 6061
671 Ga0307414_10043954 3300032004 Bacteria 3046
672 Ga0307411_10004935 3300032005 Bacteria 6487
673 Ga0307411_10020892 3300032005 Bacteria 3818
674 Ga0307411_10313913 3300032005 Bacteria 1263
675 Ga0307415_100053831 3300032126 Bacteria 2744
676 Ga0316583_10003221 3300032133 Bacteria 5743
677 Ga0316580_10018958 3300032139 Bacteria 2117
678 Ga0373934_0000479 3300035086 Bacteria 13995
679 Ga0373934_0020623 3300035086 Bacteria 2534
680 Ga0373951_0040641 3300035091 Bacteria 1121
681 Ga0373939_0026399 3300035114 Bacteria 1637
682 Ga0373954_0066196 3300035118 Bacteria 1711
683 Ga0373956_0000131 3300035119 Bacteria 26456
684 Ga0373943_0012155 3300035170 Bacteria 3878
685 Ga0373955_0073983 3300035172 Bacteria 1911
686 Ga0373955_0081153 3300035172 Bacteria 1833
687 Ga0316574_0030171 3300035398 Bacteria 3281
688 Ga0373931_0014996 3300035691 Bacteria 3798
689 Ga0373927_0006033 3300035695 Bacteria 8301
690 Ga0373933_0001235 3300035724 Bacteria 15111
691 Ga0373933_0084980 3300035724 Bacteria 1945
692 Ga0373937_0000096 3300036401 Bacteria 81963
693 Ga0316582_0024709 3300036647 Bacteria 3598
694 Ga0316584_0007474 3300036712 Bacteria 7477
695 Ga0373925_0163286 3300037068 Bacteria 1755
696 Ga0395899_0000082 3300037312 Bacteria 168513
697 Ga0395899_0003408 3300037312 Bacteria 12614
698 Ga0395899_0030796 3300037312 Bacteria 4034
699 Ga0395900_0120046 3300037418 Bacteria 2698
700 Ga0395900_0133493 3300037418 Unclassified 2543
701 Ga0395900_0231168 3300037418 Bacteria 1859
702 Ga0395900_0627722 3300037418 Bacteria 1013
703 Ga0395898_0031878 3300037466 Bacteria 5263
704 Ga0395898_0042130 3300037466 Bacteria 4506
705 Ga0395905_0000148 3300037471 Bacteria 116301
706 Ga0395905_0000459 3300037471 Bacteria 57003
707 Ga0395905_0014764 3300037471 Bacteria 7446
708 Ga0316581_0002029 3300037588 Bacteria 4753
709 Ga0395901_0000077 3300038443 Bacteria 135073
710 Ga0395901_0042064 3300038443 Bacteria 4736
711 Ga0395901_0353097 3300038443 Bacteria 1517
712 Ga0400490_40529 3300038726 Bacteria 4102
713 Ga0436365_0066966 3300039437 Bacteria 3639
714 Ga0436361_0091859 3300039447 Bacteria 14185
715 Ga0436361_0247137 3300039447 Bacteria 14220
716 Ga0436361_0299736 3300039447 Bacteria 5326
717 Ga0436361_0420505 3300039447 Bacteria 103715
718 Ga0436361_0624331 3300039447 Bacteria 6509
719 Ga0436361_0633280 3300039447 Bacteria 103480
720 Ga0436361_0943694 3300039447 Bacteria 119574
721 Ga0436361_1030340 3300039447 Bacteria 59405
722 Ga0451795_1374636 3300041456 Bacteria 1680
723 Ga0451798_0725560 3300041458 Bacteria 7655
724 Ga0451804_0286988 3300041463 Bacteria 1303
725 Ga0450890_007887 3300042127 Bacteria 1362
726 Ga0451577_0000114 3300042876 Bacteria 175957
727 Ga0451577_0002513 3300042876 Bacteria 21729
728 Ga0451577_0013618 3300042876 Bacteria 7605
729 Ga0466969_0004483 3300044656 Bacteria 7432
730 Ga0466969_0023385 3300044656 Bacteria 3185
731 Ga0466972_0000060 3300044658 Bacteria 109789
732 Ga0466977_0016580 3300044666 Bacteria 4435
733 Ga0453683_0015371 3300044673 Bacteria 4957
734 Ga0453683_0052988 3300044673 Bacteria 2539
735 Ga0466965_0001277 3300044683 Bacteria 10021
736 Ga0466966_0005728 3300044684 Bacteria 8177
737 Ga0466966_0291233 3300044684 Bacteria 981
738 Ga0466963_0005199 3300044694 Bacteria 7598
739 Ga0453684_0001710 3300044712 Bacteria 59044
740 Ga0453684_0033923 3300044712 Bacteria 7100
741 Ga0453684_0359327 3300044712 Bacteria 1640
742 Ga0453684_0779254 3300044712 Bacteria 1033
743 Ga0466968_0005441 3300044735 Bacteria 4765
744 Ga0466957_0212470 3300044842 Bacteria 1274
745 Ga0466957_0212841 3300044842 Bacteria 1273
746 Ga0451576_0000119 3300045051 Bacteria 200621
747 Ga0451576_0001379 3300045051 Bacteria 41763
748 Ga0451576_0004409 3300045051 Bacteria 18312
749 Ga0451576_0005551 3300045051 Bacteria 15758
750 Ga0451576_0008593 3300045051 Bacteria 11965
751 Ga0451576_0181381 3300045051 Bacteria 2198
752 Ga0451576_0271485 3300045051 Bacteria 1773
753 Ga0466958_0001681 3300045836 Bacteria 10674
754 Ga0466967_0225430 3300045976 Bacteria 1783
755 Ga0495617_000039 3300046452 Bacteria 128069
756 Ga0495627_000280 3300046453 Bacteria 51506
757 Ga0495592_0010535 3300046454 Bacteria 6972
758 Ga0495592_0021747 3300046454 Bacteria 4880
759 Ga0495592_0079197 3300046454 Bacteria 2378
760 Ga0495603_0007351 3300046455 Bacteria 6626
761 Ga0495603_0106439 3300046455 Bacteria 1636
762 Ga0495590_0000018 3300046457 Bacteria 216375
763 Ga0495590_0005435 3300046457 Bacteria 5056
764 Ga0495590_0016311 3300046457 Bacteria 2685
765 Ga0495591_000218 3300046458 Bacteria 57622
766 Ga0495591_029225 3300046458 Bacteria 1677
767 Ga0495629_0000172 3300046459 Bacteria 57319
768 Ga0495629_0000506 3300046459 Bacteria 32709
769 Ga0495629_0000725 3300046459 Bacteria 26753
770 Ga0495629_0002744 3300046459 Bacteria 13472
771 Ga0495629_0018715 3300046459 Bacteria 4949
772 Ga0495629_0183757 3300046459 Bacteria 1448
773 Ga0495629_0188774 3300046459 Bacteria 1427
774 Ga0495641_0009612 3300046461 Bacteria 5724
775 Ga0495651_0000085 3300046462 Bacteria 68214
776 Ga0495651_0017252 3300046462 Bacteria 5593
777 Ga0495651_0121874 3300046462 Bacteria 1914
778 Ga0495653_0012213 3300046463 Bacteria 7006
779 Ga0495653_0019400 3300046463 Bacteria 5514
780 Ga0495653_0030155 3300046463 Bacteria 4323
781 Ga0495653_0043631 3300046463 Bacteria 3485
782 Ga0495653_0053267 3300046463 Bacteria 3096
783 Ga0495650_0000166 3300046471 Bacteria 146047
784 Ga0495650_0000442 3300046471 Bacteria 66640
785 Ga0495650_0007870 3300046471 Bacteria 6330
786 Ga0495650_0078939 3300046471 Bacteria 1273
787 Ga0495580_0000812 3300046472 Bacteria 27065
788 Ga0495580_0002910 3300046472 Bacteria 14703
789 Ga0495580_0018014 3300046472 Bacteria 5265
790 Ga0495580_0059891 3300046472 Bacteria 2675
791 Ga0495582_0000614 3300046473 Bacteria 19582
792 Ga0495582_0189132 3300046473 Bacteria 1174
793 Ga0495605_0000059 3300046474 Bacteria 146371
794 Ga0495605_0000256 3300046474 Bacteria 62672
795 Ga0495605_0003771 3300046474 Bacteria 8993
796 Ga0495605_0024925 3300046474 Bacteria 3122
797 Ga0495605_0032897 3300046474 Bacteria 2637
798 Ga0495639_0000788 3300046475 Bacteria 14461
799 Ga0495662_0067007 3300046476 Bacteria 1737
800 Ga0495662_0095011 3300046476 Bacteria 1456
801 Ga0495664_0021769 3300046477 Bacteria 3704
802 Ga0495664_0073651 3300046477 Bacteria 2042
803 Ga0495584_0000006 3300046491 Bacteria 301775
804 Ga0495585_0000288 3300046492 Bacteria 50504
805 Ga0495585_0002218 3300046492 Bacteria 14068
806 Ga0495585_0010453 3300046492 Bacteria 5518
807 Ga0495594_0000364 3300046499 Bacteria 22686
808 Ga0495594_0057981 3300046499 Bacteria 2138
809 Ga0495594_0069218 3300046499 Bacteria 1960
810 Ga0495607_0002393 3300046501 Bacteria 15298
811 Ga0495607_0075043 3300046501 Bacteria 1875
812 Ga0495583_0000121 3300046506 Bacteria 132793
813 Ga0495583_0000809 3300046506 Bacteria 38609
814 Ga0495583_0001694 3300046506 Bacteria 21286
815 Ga0495583_0012014 3300046506 Bacteria 4932
816 Ga0495606_0000064 3300046507 Bacteria 183631
817 Ga0495606_0005502 3300046507 Bacteria 12113
818 Ga0495606_0025325 3300046507 Bacteria 4251
819 Ga0495608_0006938 3300046511 Bacteria 8021
820 Ga0495610_0001938 3300046512 Bacteria 17830
821 Ga0495610_0002499 3300046512 Bacteria 15367
822 Ga0495610_0006142 3300046512 Bacteria 8363
823 Ga0495610_0012787 3300046512 Bacteria 5023
824 Ga0495616_0001160 3300046513 Bacteria 18645
825 Ga0495616_0006600 3300046513 Bacteria 7010
826 Ga0495616_0028044 3300046513 Bacteria 2983
827 Ga0495618_0013302 3300046514 Bacteria 5008
828 Ga0495628_0003383 3300046516 Bacteria 14268
829 Ga0495628_0003726 3300046516 Bacteria 13565
830 Ga0495628_0012653 3300046516 Bacteria 7109
831 Ga0495628_0088195 3300046516 Bacteria 2404
832 Ga0495630_0047368 3300046517 Bacteria 3216
833 Ga0495630_0095077 3300046517 Bacteria 2252
834 Ga0495630_0165145 3300046517 Bacteria 1685
835 Ga0495630_0176096 3300046517 Bacteria 1630
836 Ga0495631_0001316 3300046518 Bacteria 15206
837 Ga0495631_0005164 3300046518 Bacteria 6877
838 Ga0495631_0013480 3300046518 Bacteria 3967
839 Ga0495632_0012093 3300046519 Bacteria 4994
840 Ga0495632_0063953 3300046519 Bacteria 1780
841 Ga0495637_0000004 3300046520 Bacteria 589740
842 Ga0495643_0136732 3300046522 Bacteria 1225
843 Ga0495644_0018028 3300046523 Bacteria 2695
844 Ga0495648_0000149 3300046524 Bacteria 83674
845 Ga0495648_0000908 3300046524 Bacteria 30919
846 Ga0495648_0051755 3300046524 Bacteria 2499
847 Ga0495648_0070358 3300046524 Bacteria 2033
848 Ga0495666_0000427 3300046526 Bacteria 18658
849 Ga0495666_0045536 3300046526 Bacteria 2116
850 Ga0495666_0050297 3300046526 Bacteria 2003
851 Ga0495666_0065467 3300046526 Bacteria 1733
852 Ga0495642_0001386 3300046528 Bacteria 10850
853 Ga0495642_0117975 3300046528 Bacteria 1137
854 Ga0495652_0005738 3300046529 Bacteria 11629
855 Ga0495652_0043262 3300046529 Bacteria 3880
856 Ga0495654_0037660 3300046530 Bacteria 2423
857 Ga0495665_0001409 3300046531 Bacteria 12877
858 Ga0495665_0017932 3300046531 Bacteria 3804
859 Ga0495665_0059385 3300046531 Bacteria 2018
860 Ga0495665_0065258 3300046531 Bacteria 1921
861 Ga0495665_0086174 3300046531 Bacteria 1650
862 Ga0495665_0142255 3300046531 Bacteria 1253
863 Ga0495640_0093109 3300046533 Bacteria 1986
864 Ga0495586_0004311 3300046535 Bacteria 7598
865 Ga0495586_0125013 3300046535 Bacteria 1438
866 Ga0495587_0010410 3300046536 Bacteria 5921
867 Ga0495598_0019217 3300046537 Bacteria 1788
868 Ga0495598_0022229 3300046537 Bacteria 1695
869 Ga0495609_0005541 3300046538 Bacteria 6594
870 Ga0495609_0011626 3300046538 Bacteria 4189
871 Ga0495621_0003440 3300046539 Bacteria 4372
872 Ga0495597_0003154 3300046542 Bacteria 9868
873 Ga0495597_0028713 3300046542 Bacteria 2544
874 Ga0495645_0000357 3300046543 Bacteria 31874
875 Ga0495645_0001492 3300046543 Bacteria 15847
876 Ga0495622_0000551 3300046557 Bacteria 22485
877 Ga0495622_0002768 3300046557 Bacteria 8383
878 Ga0495622_0009230 3300046557 Bacteria 4564
879 Ga0495622_0017647 3300046557 Bacteria 3322
880 Ga0495622_0073870 3300046557 Bacteria 1573
881 Ga0495633_0004666 3300046558 Bacteria 8625
882 Ga0495633_0021525 3300046558 Bacteria 3223
883 Ga0495633_0056826 3300046558 Bacteria 1839
884 Ga0495668_0000185 3300046616 Bacteria 92731
885 Ga0495668_0004037 3300046616 Bacteria 10678
886 Ga0495668_0015499 3300046616 Bacteria 4449
887 Ga0495668_0020606 3300046616 Bacteria 3791
888 Ga0495634_0001507 3300046642 Bacteria 20604
889 Ga0495634_0029934 3300046642 Bacteria 3764
890 Ga0495611_0001094 3300046648 Bacteria 14270
891 Ga0495611_0001338 3300046648 Bacteria 12509
892 Ga0495611_0001418 3300046648 Bacteria 11966
893 Ga0495611_0020618 3300046648 Bacteria 2838
894 Ga0495611_0034931 3300046648 Bacteria 2224
895 Ga0495611_0073261 3300046648 Bacteria 1567
896 Ga0495625_0000372 3300046660 Bacteria 68695
897 Ga0495625_0001737 3300046660 Bacteria 25184
898 Ga0495625_0063464 3300046660 Bacteria 2608
899 Ga0495635_0005954 3300046663 Bacteria 8507
900 Ga0495635_0010057 3300046663 Bacteria 6615
901 Ga0495635_0030228 3300046663 Bacteria 3764
902 Ga0495635_0135697 3300046663 Bacteria 1677
903 Ga0495659_0000065 3300046664 Bacteria 47327
904 Ga0495659_0006310 3300046664 Bacteria 3746
905 Ga0495661_0006787 3300046665 Bacteria 8025
906 Ga0495661_0135356 3300046665 Bacteria 1345
907 Ga0495588_0049916 3300046674 Bacteria 2152
908 Ga0495588_0112599 3300046674 Bacteria 1433
909 Ga0495588_0148341 3300046674 Bacteria 1239
910 Ga0495657_0115803 3300046675 Bacteria 1693
911 Ga0495599_0000788 3300046678 Bacteria 17818
912 Ga0495599_0000876 3300046678 Bacteria 16808
913 Ga0495599_0087493 3300046678 Bacteria 1945
914 Ga0495599_0095101 3300046678 Bacteria 1858
915 Ga0495623_0020310 3300046679 Bacteria 4293
916 Ga0495623_0068045 3300046679 Bacteria 2221
917 Ga0495623_0109472 3300046679 Bacteria 1675
918 Ga0495646_0009887 3300046680 Bacteria 6060
919 Ga0495647_0001075 3300046681 Bacteria 8331
920 Ga0495658_0001306 3300046683 Bacteria 13049
921 Ga0495658_0014681 3300046683 Bacteria 4005
922 Ga0495658_0140868 3300046683 Bacteria 1475
923 Ga0495669_0000870 3300046684 Bacteria 12768
924 Ga0495669_0001618 3300046684 Bacteria 9247
925 Ga0495669_0066699 3300046684 Bacteria 1635
926 Ga0495613_0001074 3300046689 Bacteria 20824
927 Ga0495613_0003580 3300046689 Bacteria 11638
928 Ga0495624_0004787 3300046690 Bacteria 9840
929 Ga0495624_0110253 3300046690 Bacteria 1692
930 Ga0495670_0059855 3300046691 Bacteria 1912
931 Ga0495670_0063406 3300046691 Bacteria 1860
932 Ga0495671_0000903 3300046692 Bacteria 21167
933 Ga0495649_0017065 3300046694 Bacteria 4105
934 Ga0495649_0055457 3300046694 Bacteria 2141
935 Ga0495649_0120694 3300046694 Bacteria 1386
936 Ga0495589_0012497 3300046794 Bacteria 4397
937 Ga0495589_0013954 3300046794 Bacteria 4142
938 Ga0495600_0000151 3300046809 Bacteria 39828
939 Ga0495600_0146905 3300046809 Bacteria 1528
940 Ga0495660_0013101 3300046810 Bacteria 4806
941 Ga0495581_0001952 3300047315 Bacteria 11545
942 Ga0495581_0003415 3300047315 Bacteria 9119
943 Ga0495581_0019225 3300047315 Bacteria 3964
944 Ga0495604_0016637 3300047317 Bacteria 5881
945 Ga0495604_0036410 3300047317 Bacteria 3879
946 Ga0495604_0038131 3300047317 Bacteria 3781
947 Ga0495604_0057846 3300047317 Bacteria 2979
948 Ga0495604_0072862 3300047317 Bacteria 2594
949 Ga0495636_0080117 3300047318 Bacteria 1405
950 Ga0495674_0003612 3300047319 Bacteria 15056
951 Ga0495674_0008069 3300047319 Bacteria 10052
952 Ga0495674_0048438 3300047319 Bacteria 3760
953 Ga0495674_0092897 3300047319 Bacteria 2575
954 Ga0495674_0188638 3300047319 Bacteria 1714
955 Ga0495674_0194483 3300047319 Bacteria 1684
956 Ga0495674_0321061 3300047319 Bacteria 1261
957 Ga0495672_0000477 3300047320 Bacteria 47447
958 Ga0495672_0000627 3300047320 Bacteria 39464
959 Ga0495672_0003268 3300047320 Bacteria 14029
960 Ga0495672_0037296 3300047320 Bacteria 2975
961 Ga0495672_0048418 3300047320 Bacteria 2520
962 Ga0495672_0131721 3300047320 Bacteria 1314
963 Ga0495676_0001397 3300047321 Bacteria 20781
964 Ga0495676_0028005 3300047321 Bacteria 4822
965 Ga0495676_0212855 3300047321 Bacteria 1336
966 Ga0495676_0266921 3300047321 Bacteria 1162
967 Ga0495676_0406120 3300047321 Bacteria 903
968 Ga0495680_0016593 3300047322 Bacteria 6321
969 Ga0495680_0018438 3300047322 Bacteria 5926
970 Ga0495680_0240217 3300047322 Bacteria 1287
971 Ga0495683_0000041 3300047323 Bacteria 137557
972 Ga0495683_0004175 3300047323 Bacteria 8255
973 Ga0495683_0019448 3300047323 Bacteria 3504
974 Ga0495683_0035521 3300047323 Bacteria 2533
975 Ga0495683_0068444 3300047323 Bacteria 1746
976 Ga0495683_0072097 3300047323 Bacteria 1694
977 Ga0495687_000437 3300047443 Bacteria 51548
978 Ga0495687_008170 3300047443 Bacteria 6034
979 Ga0495687_038829 3300047443 Bacteria 2110
980 Ga0495687_042191 3300047443 Bacteria 1995
981 Ga0495687_101599 3300047443 Bacteria 1077
982 Ga0495675_0019316 3300047444 Bacteria 4328
983 Ga0495675_0024438 3300047444 Bacteria 3851
984 Ga0495675_0045983 3300047444 Bacteria 2779
985 Ga0495675_0046686 3300047444 Bacteria 2757
986 Ga0495675_0108964 3300047444 Bacteria 1729
987 Ga0495677_0002560 3300047445 Bacteria 7115
988 Ga0495677_0002828 3300047445 Bacteria 6761
989 Ga0495677_0021867 3300047445 Bacteria 2318
990 Ga0495677_0030456 3300047445 Bacteria 1963
991 Ga0495679_000214 3300047446 Bacteria 49621
992 Ga0495679_009023 3300047446 Bacteria 4016
993 Ga0495673_0000003 3300047469 Bacteria 1491337
994 Ga0495673_0003810 3300047469 Bacteria 9741
995 Ga0495673_0061029 3300047469 Bacteria 1615
996 Ga0495681_0011038 3300047470 Bacteria 5416
997 Ga0495681_0081933 3300047470 Bacteria 1439
998 Ga0495686_0000002 3300047472 Bacteria 1050777
999 Ga0495686_0000350 3300047472 Bacteria 75596
1000 Ga0495686_0000675 3300047472 Bacteria 46177
1001 Ga0495593_0002755 3300047673 Bacteria 10582
1002 Ga0495593_0003119 3300047673 Bacteria 9964
1003 Ga0495593_0013716 3300047673 Bacteria 4615
1004 Ga0495602_0026848 3300048088 Bacteria 5545
1005 Ga0495602_0032598 3300048088 Bacteria 4903
1006 Ga0495602_0055501 3300048088 Bacteria 3488
1007 Ga0495602_0059754 3300048088 Bacteria 3325
1008 Ga0495602_0085305 3300048088 Bacteria 2639
1009 Ga0495602_0122900 3300048088 Bacteria 2085
1010 Ga0495602_0142272 3300048088 Bacteria 1897
1011 Ga0495614_0000266 3300048089 Bacteria 20351
1012 Ga0495614_0005291 3300048089 Bacteria 5821
1013 Ga0495614_0035946 3300048089 Bacteria 2127
1014 Ga0495614_0050574 3300048089 Bacteria 1780
1015 Ga0495626_0089260 3300048091 Bacteria 1357
1016 Ga0496100_0002406 3300048903 Bacteria 9478
1017 Ga0496100_0119378 3300048903 Bacteria 1842
1018 Ga0496100_0172254 3300048903 Bacteria 1560
1019 Ga0496101_0001779 3300048904 Bacteria 12954
1020 Ga0496101_0135646 3300048904 Bacteria 1872
1021 Ga0496101_0238945 3300048904 Bacteria 1413
1022 Ga0496102_0000123 3300048905 Bacteria 110781
1023 Ga0496102_0000351 3300048905 Bacteria 55799
1024 Ga0496102_0001049 3300048905 Bacteria 25567
1025 Ga0496102_0005053 3300048905 Bacteria 11168
1026 Ga0496102_0078328 3300048905 Bacteria 3042
1027 Ga0496102_0731416 3300048905 Bacteria 912
1028 Ga0496103_0002203 3300048906 Bacteria 12354
1029 Ga0496103_0003261 3300048906 Bacteria 9943
1030 Ga0496103_0053524 3300048906 Bacteria 2502
1031 Ga0496104_0022546 3300048907 Bacteria 5784
1032 Ga0496104_0045619 3300048907 Bacteria 4123
1033 Ga0496104_0134914 3300048907 Bacteria 2371
1034 Ga0496105_0013612 3300048908 Bacteria 6459
1035 Ga0496105_0167086 3300048908 Bacteria 1805
1036 Ga0496106_0003051 3300048909 Bacteria 12482
1037 Ga0496106_0005737 3300048909 Bacteria 9181
1038 Ga0496107_0029551 3300048910 Bacteria 3900
1039 Ga0496108_0186218 3300048911 Bacteria 1798
1040 Ga0496109_0006339 3300048912 Bacteria 9964
1041 Ga0496109_0605821 3300048912 Bacteria 1032
1042 Ga0496110_0003569 3300048913 Bacteria 11951
1043 Ga0496110_0016993 3300048913 Bacteria 6082
1044 Ga0496110_0453856 3300048913 Bacteria 1168
1045 Ga0496111_0036636 3300048914 Bacteria 3508
1046 Ga0496112_0013000 3300048915 Bacteria 7675
1047 Ga0496112_0016390 3300048915 Bacteria 6941
1048 Ga0496112_0271710 3300048915 Bacteria 1643
1049 Ga0496113_0002808 3300048916 Bacteria 10255
1050 Ga0496113_0026162 3300048916 Bacteria 4169
1051 Ga0496113_0190879 3300048916 Bacteria 1626
1052 Ga0496114_0025936 3300048917 Bacteria 4795
1053 Ga0496115_0035563 3300048918 Bacteria 3941
1054 Ga0496115_0159423 3300048918 Bacteria 1864
1055 Ga0496115_0171688 3300048918 Bacteria 1793
1056 Ga0496115_0212509 3300048918 Bacteria 1598
1057 Ga0496116_0004405 3300048919 Bacteria 13460
1058 Ga0496116_0067029 3300048919 Bacteria 2294
1059 Ga0496117_0000001 3300048920 Bacteria 2526244
1060 Ga0496117_0000589 3300048920 Bacteria 59852
1061 Ga0496117_0068787 3300048920 Bacteria 2388
1062 Ga0496117_0071738 3300048920 Bacteria 2319
1063 Ga0496117_0114786 3300048920 Bacteria 1668
1064 Ga0496117_0122632 3300048920 Bacteria 1593
1065 Ga0496118_0000002 3300048921 Bacteria 1690764
1066 Ga0496118_0000760 3300048921 Bacteria 52060
1067 Ga0496118_0002012 3300048921 Bacteria 28785
1068 Ga0496118_0026170 3300048921 Bacteria 4977
1069 Ga0496118_0051370 3300048921 Bacteria 3154
1070 Ga0496118_0062401 3300048921 Bacteria 2751
1071 Ga0496118_0103009 3300048921 Bacteria 1922
1072 Ga0496118_0121539 3300048921 Bacteria 1701
1073 Ga0496119_0129734 3300048922 Bacteria 1375
1074 Ga0496121_0002856 3300048924 Bacteria 25463
1075 Ga0496121_0006525 3300048924 Bacteria 14424
1076 Ga0496121_0013134 3300048924 Bacteria 8933
1077 Ga0496121_0036376 3300048924 Bacteria 4388
1078 Ga0496121_0087799 3300048924 Bacteria 2440
1079 Ga0496121_0096756 3300048924 Bacteria 2289
1080 Ga0496122_0001177 3300048925 Bacteria 44728
1081 Ga0496122_0002190 3300048925 Bacteria 28574
1082 Ga0496122_0003153 3300048925 Bacteria 22055
1083 Ga0496123_0000295 3300048926 Bacteria 97562
1084 Ga0496123_0000754 3300048926 Bacteria 52403
1085 Ga0496123_0008961 3300048926 Bacteria 9094
1086 Ga0496124_0015626 3300048927 Bacteria 7266
1087 Ga0496124_0018274 3300048927 Bacteria 6571
1088 Ga0496124_0146234 3300048927 Bacteria 1859
1089 Ga0496124_0156254 3300048927 Bacteria 1783
1090 Ga0496125_0001032 3300048928 Bacteria 43195
1091 Ga0496125_0010264 3300048928 Bacteria 9484
1092 Ga0496125_0078172 3300048928 Bacteria 2545
1093 Ga0496126_0005441 3300048929 Bacteria 14521
1094 Ga0496126_0005728 3300048929 Bacteria 14067
1095 Ga0495678_000121 3300049459 Bacteria 91388
1096 Ga0495682_0016024 3300049460 Bacteria 2836
1097 Ga0501031_0043440 3300049568 Bacteria 2933
1098 Ga0501033_0001193 3300049570 Bacteria 23470
1099 Ga0501033_0115086 3300049570 Bacteria 1954
1100 Ga0501036_0000543 3300049572 Bacteria 27032
1101 Ga0501038_0000909 3300049574 Bacteria 26221
1102 Ga0501039_0013843 3300049575 Bacteria 6171
1103 Ga0501040_0000101 3300049576 Bacteria 43457
1104 Ga0501041_0000405 3300049577 Bacteria 21753
1105 Ga0501042_0062265 3300049578 Bacteria 2666
1106 Ga0501043_0319819 3300049579 Bacteria 1183
1107 Ga0501046_0004138 3300049580 Bacteria 13220
1108 Ga0501046_0415155 3300049580 Bacteria 971
1109 Ga0501048_0188329 3300049582 Bacteria 1462
1110 Ga0501068_0057746 3300049584 Bacteria 2353
1111 Ga0501070_0022979 3300049586 Bacteria 5220
1112 Ga0501070_0106873 3300049586 Bacteria 2313
1113 Ga0501071_0000233 3300049587 Bacteria 25446
1114 Ga0501071_0047287 3300049587 Bacteria 3090
1115 Ga0501071_0079840 3300049587 Bacteria 2392
1116 Ga0501072_0000322 3300049588 Bacteria 34133
1117 Ga0501072_0035424 3300049588 Bacteria 3909
1118 Ga0501072_0297287 3300049588 Bacteria 1283
1119 Ga0501073_0000354 3300049589 Bacteria 30944
1120 Ga0501073_0099000 3300049589 Bacteria 2024
1121 Ga0501074_0000738 3300049590 Bacteria 20528
1122 Ga0501074_0025415 3300049590 Bacteria 4301
1123 Ga0501075_0001506 3300049591 Bacteria 15184
1124 Ga0501075_0114991 3300049591 Bacteria 2046
1125 Ga0501076_0000092 3300049592 Bacteria 47957
1126 Ga0501076_0056508 3300049592 Bacteria 3115
1127 Ga0501077_0000070 3300049593 Bacteria 51447
1128 Ga0501077_0012657 3300049593 Bacteria 5283
1129 Ga0501198_000003 3300049649 Bacteria 175301
1130 Ga0501198_000015 3300049649 Bacteria 102945
1131 Ga0501222_000014 3300049662 Bacteria 83609
1132 Ga0501222_000045 3300049662 Bacteria 46767
1133 Ga0501223_019752 3300049663 Bacteria 1323
1134 Ga0501257_013553 3300049686 Bacteria 1870
1135 Ga0501079_0000005 3300049741 Bacteria 85998
1136 Ga0501079_0002075 3300049741 Bacteria 14369
1137 Ga0501080_0004800 3300049742 Bacteria 12056
1138 Ga0501080_0070029 3300049742 Bacteria 3262
1139 Ga0501081_0001379 3300049743 Bacteria 14866
1140 Ga0501083_0051148 3300049744 Bacteria 2779
1141 Ga0501083_0067703 3300049744 Bacteria 2377
1142 Ga0501083_0181134 3300049744 Bacteria 1376
1143 Ga0501280_001851 3300049776 Bacteria 3716
1144 Ga0501035_0001495 3300049822 Bacteria 23928
1145 Ga0501044_0065993 3300049823 Bacteria 3691
1146 Ga0501044_0144303 3300049823 Bacteria 2367
1147 Ga0501045_0000596 3300049824 Bacteria 22747
1148 nmdc:mga0yw44_274305_c1 3300050492 Bacteria 1126
1149 nmdc:mga0k408_261606_c1 3300050493 Bacteria 1033
1150 nmdc:mga0k408_6321_c1 3300050493 Bacteria 6322
1151 nmdc:mga0k408_7248_c1 3300050493 Bacteria 5927
1152 nmdc:mga06z11_26874_c1 3300050494 Bacteria 2745
1153 nmdc:mga07m45_14547_c1 3300050496 Bacteria 4195
1154 nmdc:mga07m45_5726_c1 3300050496 Bacteria 6216
1155 nmdc:mga05p37_113514_c2 3300050507 Bacteria 2289
1156 nmdc:mga05p37_846524_c1 3300050507 Bacteria 994
1157 nmdc:mga09592_236985_c1 3300050508 Bacteria 1581
1158 nmdc:mga08y16_131209_c1 3300050511 Bacteria 2605
1159 nmdc:mga08y16_254065_c1 3300050511 Bacteria 1816
1160 nmdc:mga08y16_267174_c1 3300050511 Bacteria 1766
1161 nmdc:mga08y16_39060_c1 3300050511 Bacteria 4981
1162 nmdc:mga08y16_39966_c1 3300050511 Bacteria 4920
1163 nmdc:mga08y16_558217_c1 3300050511 Bacteria 1158
1164 nmdc:mga08y16_6905_c1 3300050511 Bacteria 11901
1165 nmdc:mga0n895_89883_c1 3300050512 Bacteria 3072
1166 nmdc:mga0rr50_44110_c1 3300050513 Bacteria 3268
1167 nmdc:mga08x19_78205_c1 3300050514 Bacteria 2167
1168 nmdc:mga0a205_366292_c1 3300050515 Bacteria 1307
1169 Ga0495601_0018962 3300053077 Bacteria 4192
1170 Ga0495619_0003111 3300053085 Bacteria 10766
1171 Ga0500578_0000115 3300053086 Bacteria 95966
1172 Ga0500643_000372 3300053087 Bacteria 35225
1173 Ga0500643_000839 3300053087 Bacteria 19704
1174 Ga0500583_0059991 3300053092 Bacteria 1792
1175 Ga0500651_0000063 3300053093 Bacteria 70772
1176 Ga0500651_0008220 3300053093 Bacteria 6126
1177 Ga0500555_050912 3300053103 Bacteria 1134
1178 Ga0500562_001011 3300053108 Bacteria 6870
1179 Ga0500571_000022 3300053110 Bacteria 56973
1180 Ga0500592_000173 3300053116 Bacteria 12743
1181 Ga0500594_0009994 3300053118 Bacteria 2194
1182 Ga0500642_0000832 3300053130 Bacteria 9002
1183 Ga0500658_0006845 3300053134 Bacteria 4218
1184 Ga0500658_0019208 3300053134 Bacteria 2570
1185 Ga0500564_047748 3300053138 Bacteria 1963
1186 Ga0500568_0003037 3300053139 Bacteria 9595
1187 Ga0500568_0020192 3300053139 Bacteria 2885
1188 Ga0500568_0033686 3300053139 Bacteria 2100
1189 Ga0500574_000554 3300053141 Bacteria 4836
1190 Ga0500622_0000205 3300053156 Bacteria 62937
1191 Ga0500622_0001272 3300053156 Bacteria 20575
1192 Ga0500622_0109934 3300053156 Bacteria 1348
1193 Ga0500627_0001084 3300053158 Bacteria 7425
1194 Ga0500638_033403 3300053162 Bacteria 2487
1195 Ga0501084_0001577 3300054114 Bacteria 18055
1196 Ga0501084_0004840 3300054114 Bacteria 11005
1197 Ga0501084_0159229 3300054114 Bacteria 1905
1198 Ga0501084_0343427 3300054114 Bacteria 1261
1199 Ga0587083_0042145 3300059505 Bacteria 961
1200 Ga0587090_001158 3300059510 Bacteria 2585
1201 Ga0587072_042043 3300059643 Bacteria 891
1202 Ga0501082_0000755 3300060353 Bacteria 28412
1203 Ga0501082_0012597 3300060353 Bacteria 7268
1204 Ga0501082_0019287 3300060353 Bacteria 5879
1205 Ga0501082_0116368 3300060353 Bacteria 2315
1206 Ga0530510_0000240 3300061734 Bacteria 34436

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300001989 JGI24739J22299_10000065 JGI24739J22299_1000006515 190
2 3300044712 Ga0453684_0001710 Ga0453684_0001710_58276_59025 196
3 3300006881 Ga0068865_100041950 Ga0068865_1000419502 209
4 3300054114 Ga0501084_0343427 Ga0501084_0343427_227_1069 210
5 3300047444 Ga0495675_0045983 Ga0495675_0045983_1134_1970 213
6 3300046513 Ga0495616_0001160 Ga0495616_0001160_13532_14302 215
7 3300010375 Ga0105239_10477400 Ga0105239_104774001 216
8 3300002067 JGI24735J21928_10003854 JGI24735J21928_100038545 218
9 3300005563 Ga0068855_100003042 Ga0068855_1000030427 218
10 3300009093 Ga0105240_10002341 Ga0105240_1000234128 218
11 3300010375 Ga0105239_10032953 Ga0105239_100329533 218
12 3300013100 Ga0157373_10019329 Ga0157373_100193292 218
13 3300013104 Ga0157370_10001346 Ga0157370_1000134611 218
14 3300013105 Ga0157369_10000979 Ga0157369_100009794 218
15 3300013296 Ga0157374_10000107 Ga0157374_100001077 218
16 3300013307 Ga0157372_10004539 Ga0157372_100045399 218
17 3300025228 Ga0209672_100530 Ga0209672_1005308 218
18 3300025256 Ga0209759_1012521 Ga0209759_10125212 218
19 3300025904 Ga0207647_10000605 Ga0207647_100006057 218
20 3300025913 Ga0207695_10024266 Ga0207695_100242663 218
21 3300025919 Ga0207657_10004856 Ga0207657_100048564 218
22 3300025949 Ga0207667_10002775 Ga0207667_1000277510 218
23 3300031250 Ga0265331_10000303 Ga0265331_1000030312 218
24 3300031251 Ga0265327_10000007 Ga0265327_10000007427 218
25 3300037418 Ga0395900_0120046 Ga0395900_0120046_1224_2051 218
26 3300037466 Ga0395898_0042130 Ga0395898_0042130_1107_1934 218
27 3300038443 Ga0395901_0000077 Ga0395901_0000077_84590_85417 218
28 3300044656 Ga0466969_0023385 Ga0466969_0023385_1523_2398 218
29 3300044684 Ga0466966_0005728 Ga0466966_0005728_1279_2106 218
30 3300044694 Ga0466963_0005199 Ga0466963_0005199_2751_3761 218
31 3300044842 Ga0466957_0212470 Ga0466957_0212470_138_1169 218
32 3300045836 Ga0466958_0001681 Ga0466958_0001681_7018_8028 218
33 3300046459 Ga0495629_0188774 Ga0495629_0188774_540_1391 218
34 3300042876 Ga0451577_0013618 Ga0451577_0013618_1840_2706 219
35 3300045051 Ga0451576_0001379 Ga0451576_0001379_18659_19525 219
36 3300009176 Ga0105242_10344902 Ga0105242_103449021 221
37 3300049568 Ga0501031_0043440 Ga0501031_0043440_1075_1869 221
38 3300049570 Ga0501033_0001193 Ga0501033_0001193_17411_18205 221
39 3300049572 Ga0501036_0000543 Ga0501036_0000543_8474_9268 221
40 3300049574 Ga0501038_0000909 Ga0501038_0000909_15581_16375 221
41 3300049575 Ga0501039_0013843 Ga0501039_0013843_3329_4123 221
42 3300049576 Ga0501040_0000101 Ga0501040_0000101_38405_39199 221
43 3300049577 Ga0501041_0000405 Ga0501041_0000405_9729_10523 221
44 3300049580 Ga0501046_0004138 Ga0501046_0004138_1798_2592 221
45 3300049587 Ga0501071_0000233 Ga0501071_0000233_15128_15922 221
46 3300049588 Ga0501072_0000322 Ga0501072_0000322_23511_24305 221
47 3300049590 Ga0501074_0025415 Ga0501074_0025415_1372_2166 221
48 3300049591 Ga0501075_0001506 Ga0501075_0001506_5197_5991 221
49 3300049592 Ga0501076_0000092 Ga0501076_0000092_37668_38462 221
50 3300049593 Ga0501077_0000070 Ga0501077_0000070_7339_8133 221
51 3300049741 Ga0501079_0000005 Ga0501079_0000005_53636_54430 221
52 3300049742 Ga0501080_0070029 Ga0501080_0070029_2227_3021 221
53 3300049743 Ga0501081_0001379 Ga0501081_0001379_4132_4926 221
54 3300049744 Ga0501083_0051148 Ga0501083_0051148_783_1577 221
55 3300049822 Ga0501035_0001495 Ga0501035_0001495_11248_12042 221
56 3300049823 Ga0501044_0065993 Ga0501044_0065993_625_1419 221
57 3300049824 Ga0501045_0000596 Ga0501045_0000596_10228_11022 221
58 3300054114 Ga0501084_0001577 Ga0501084_0001577_13009_13803 221
59 3300060353 Ga0501082_0000755 Ga0501082_0000755_6500_7294 221
60 3300061734 Ga0530510_0000240 Ga0530510_0000240_23419_24213 221
61 3300005336 Ga0070680_100042649 Ga0070680_1000426493 222
62 3300005549 Ga0070704_100032076 Ga0070704_1000320763 222
63 3300005719 Ga0068861_100008415 Ga0068861_1000084152 222
64 3300009553 Ga0105249_10450169 Ga0105249_104501691 222
65 3300025917 Ga0207660_10100383 Ga0207660_101003832 222
66 3300025942 Ga0207689_10255085 Ga0207689_102550851 222
67 3300026118 Ga0207675_100001840 Ga0207675_1000018405 222
68 3300003794 Ga0055531_10004883 Ga0055531_100048833 223
69 3300005295 Ga0065707_10342981 Ga0065707_103429811 223
70 3300006846 Ga0075430_100061726 Ga0075430_1000617262 223
71 3300006847 Ga0075431_100014998 Ga0075431_1000149982 223
72 3300006871 Ga0075434_100091112 Ga0075434_1000911122 223
73 3300006871 Ga0075434_100421173 Ga0075434_1004211732 223
74 3300009147 Ga0114129_10062288 Ga0114129_100622885 223
75 3300009147 Ga0114129_10267296 Ga0114129_102672962 223
76 3300009176 Ga0105242_10021310 Ga0105242_100213104 223
77 3300025303 Ga0209051_1000367 Ga0209051_100036746 223
78 3300025304 Ga0209257_1000012 Ga0209257_1000012568 223
79 3300025934 Ga0207686_10009771 Ga0207686_100097713 223
80 3300037471 Ga0395905_0000148 Ga0395905_0000148_38625_39497 223
81 3300042876 Ga0451577_0000114 Ga0451577_0000114_58211_59044 223
82 3300044673 Ga0453683_0015371 Ga0453683_0015371_15_839 223
83 3300044735 Ga0466968_0005441 Ga0466968_0005441_983_1843 223
84 3300045051 Ga0451576_0004409 Ga0451576_0004409_2004_2837 223
85 3300050507 nmdc:mga05p37_113514_c2 nmdc:mga05p37_113514_c2_1379_2203 223
86 3300050512 nmdc:mga0n895_89883_c1 nmdc:mga0n895_89883_c1_307_1131 223
87 3300053092 Ga0500583_0059991 Ga0500583_0059991_518_1351 223
88 3300001989 JGI24739J22299_10015778 JGI24739J22299_100157783 224
89 3300002075 JGI24738J21930_10001689 JGI24738J21930_100016892 224
90 3300005327 Ga0070658_10121400 Ga0070658_101214001 224
91 3300005334 Ga0068869_100131549 Ga0068869_1001315491 224
92 3300005336 Ga0070680_100225836 Ga0070680_1002258362 224
93 3300005339 Ga0070660_100001084 Ga0070660_10000108411 224
94 3300005339 Ga0070660_100110067 Ga0070660_1001100672 224
95 3300005343 Ga0070687_100054985 Ga0070687_1000549853 224
96 3300005344 Ga0070661_100167214 Ga0070661_1001672142 224
97 3300005365 Ga0070688_100000242 Ga0070688_10000024218 224
98 3300005367 Ga0070667_100002252 Ga0070667_1000022528 224
99 3300005539 Ga0068853_100116954 Ga0068853_1001169541 224
100 3300005546 Ga0070696_100009914 Ga0070696_1000099147 224
101 3300005563 Ga0068855_100046760 Ga0068855_1000467604 224
102 3300005564 Ga0070664_100009148 Ga0070664_1000091485 224
103 3300005564 Ga0070664_100009861 Ga0070664_1000098612 224
104 3300005577 Ga0068857_100003862 Ga0068857_10000386213 224
105 3300005577 Ga0068857_100466057 Ga0068857_1004660571 224
106 3300005578 Ga0068854_100164637 Ga0068854_1001646372 224
107 3300005841 Ga0068863_100082483 Ga0068863_1000824833 224
108 3300006173 Ga0070716_100000075 Ga0070716_10000007512 224
109 3300009093 Ga0105240_10044913 Ga0105240_100449133 224
110 3300009148 Ga0105243_10038792 Ga0105243_100387922 224
111 3300009176 Ga0105242_10002939 Ga0105242_100029393 224
112 3300009545 Ga0105237_10133693 Ga0105237_101336932 224
113 3300009545 Ga0105237_10165934 Ga0105237_101659342 224
114 3300009551 Ga0105238_10059780 Ga0105238_100597803 224
115 3300009551 Ga0105238_10285609 Ga0105238_102856092 224
116 3300013100 Ga0157373_10027516 Ga0157373_100275163 224
117 3300013102 Ga0157371_10006694 Ga0157371_100066948 224
118 3300013105 Ga0157369_10000947 Ga0157369_1000094729 224
119 3300014326 Ga0157380_10001038 Ga0157380_1000103815 224
120 3300014969 Ga0157376_10000565 Ga0157376_100005658 224
121 3300014969 Ga0157376_10043568 Ga0157376_100435683 224
122 3300025273 Ga0209673_1028369 Ga0209673_10283692 224
123 3300025728 Ga0207655_1001746 Ga0207655_10017466 224
124 3300025900 Ga0207710_10011735 Ga0207710_100117353 224
125 3300025903 Ga0207680_10103558 Ga0207680_101035582 224
126 3300025912 Ga0207707_10384208 Ga0207707_103842082 224
127 3300025918 Ga0207662_10004730 Ga0207662_100047304 224
128 3300025919 Ga0207657_10111826 Ga0207657_101118262 224
129 3300025923 Ga0207681_10027333 Ga0207681_100273333 224
130 3300025924 Ga0207694_10098164 Ga0207694_100981642 224
131 3300025924 Ga0207694_10265458 Ga0207694_102654582 224
132 3300025933 Ga0207706_10078212 Ga0207706_100782123 224
133 3300025934 Ga0207686_10389612 Ga0207686_103896122 224
134 3300025935 Ga0207709_10002748 Ga0207709_100027485 224
135 3300025942 Ga0207689_10044208 Ga0207689_100442083 224
136 3300025942 Ga0207689_10208111 Ga0207689_102081111 224
137 3300025945 Ga0207679_10009281 Ga0207679_100092814 224
138 3300025949 Ga0207667_10075369 Ga0207667_100753693 224
139 3300026116 Ga0207674_10000437 Ga0207674_100004372 224
140 3300026116 Ga0207674_10363838 Ga0207674_103638382 224
141 3300026121 Ga0207683_10000223 Ga0207683_1000022314 224
142 3300038443 Ga0395901_0353097 Ga0395901_0353097_200_1024 224
143 3300046512 Ga0495610_0012787 Ga0495610_0012787_2395_3219 224
144 3300046518 Ga0495631_0013480 Ga0495631_0013480_2550_3374 224
145 3300046537 Ga0495598_0019217 Ga0495598_0019217_500_1303 224
146 3300046539 Ga0495621_0003440 Ga0495621_0003440_235_1059 224
147 3300046683 Ga0495658_0014681 Ga0495658_0014681_2216_3040 224
148 3300047318 Ga0495636_0080117 Ga0495636_0080117_100_942 224
149 3300047321 Ga0495676_0001397 Ga0495676_0001397_15092_15916 224
150 3300047673 Ga0495593_0013716 Ga0495593_0013716_1059_1982 224
151 3300048089 Ga0495614_0000266 Ga0495614_0000266_5915_6838 224
152 3300048919 Ga0496116_0004405 Ga0496116_0004405_8467_9291 224
153 3300048920 Ga0496117_0068787 Ga0496117_0068787_819_1643 224
154 3300048921 Ga0496118_0051370 Ga0496118_0051370_1782_2606 224
155 3300048924 Ga0496121_0096756 Ga0496121_0096756_500_1324 224
156 3300050496 nmdc:mga07m45_5726_c1 nmdc:mga07m45_5726_c1_844_1668 224
157 3300053093 Ga0500651_0000063 Ga0500651_0000063_14777_15601 224
158 3300053110 Ga0500571_000022 Ga0500571_000022_23931_24755 224
159 3300053118 Ga0500594_0009994 Ga0500594_0009994_1200_2024 224
160 3300053134 Ga0500658_0006845 Ga0500658_0006845_2549_3373 224
161 3300053138 Ga0500564_047748 Ga0500564_047748_639_1463 224
162 3300053139 Ga0500568_0003037 Ga0500568_0003037_2029_2853 224
163 3300053141 Ga0500574_000554 Ga0500574_000554_2532_3455 224
164 3300053162 Ga0500638_033403 Ga0500638_033403_1183_2007 224
165 3300025915 Ga0207693_10225050 Ga0207693_102250502 225
166 3300025916 Ga0207663_10304763 Ga0207663_103047632 225
167 3300035170 Ga0373943_0012155 Ga0373943_0012155_711_1553 225
168 3300035172 Ga0373955_0073983 Ga0373955_0073983_693_1535 225
169 3300035695 Ga0373927_0006033 Ga0373927_0006033_1275_2117 225
170 3300037068 Ga0373925_0163286 Ga0373925_0163286_712_1554 225
171 3300046459 Ga0495629_0000725 Ga0495629_0000725_19591_20433 225
172 3300046461 Ga0495641_0009612 Ga0495641_0009612_4200_5042 225
173 3300046472 Ga0495580_0000812 Ga0495580_0000812_18874_19716 225
174 3300046473 Ga0495582_0000614 Ga0495582_0000614_5897_6739 225
175 3300046475 Ga0495639_0000788 Ga0495639_0000788_8383_9225 225
176 3300046476 Ga0495662_0095011 Ga0495662_0095011_282_1124 225
177 3300046499 Ga0495594_0000364 Ga0495594_0000364_6182_7024 225
178 3300046526 Ga0495666_0065467 Ga0495666_0065467_331_1173 225
179 3300046557 Ga0495622_0002768 Ga0495622_0002768_30_872 225
180 3300046642 Ga0495634_0001507 Ga0495634_0001507_15875_16717 225
181 3300046663 Ga0495635_0135697 Ga0495635_0135697_606_1448 225
182 3300046681 Ga0495647_0001075 Ga0495647_0001075_6397_7239 225
183 3300046683 Ga0495658_0001306 Ga0495658_0001306_7604_8446 225
184 3300046689 Ga0495613_0001074 Ga0495613_0001074_17453_18295 225
185 3300047315 Ga0495581_0003415 Ga0495581_0003415_3231_4073 225
186 3300047321 Ga0495676_0028005 Ga0495676_0028005_966_1808 225
187 3300047673 Ga0495593_0003119 Ga0495593_0003119_2188_3030 225
188 3300048089 Ga0495614_0050574 Ga0495614_0050574_376_1218 225
189 3300048907 Ga0496104_0134914 Ga0496104_0134914_1128_1970 225
190 3300048915 Ga0496112_0271710 Ga0496112_0271710_631_1473 225
191 3300048916 Ga0496113_0190879 Ga0496113_0190879_422_1264 225
192 3300048918 Ga0496115_0212509 Ga0496115_0212509_440_1282 225
193 3300048921 Ga0496118_0103009 Ga0496118_0103009_81_941 225
194 3300053085 Ga0495619_0003111 Ga0495619_0003111_4726_5568 225
195 3300005367 Ga0070667_100000363 Ga0070667_1000003634 226
196 3300006844 Ga0075428_100019639 Ga0075428_1000196396 226
197 3300006880 Ga0075429_100269650 Ga0075429_1002696502 226
198 3300009094 Ga0111539_10044187 Ga0111539_100441877 226
199 3300009094 Ga0111539_10481352 Ga0111539_104813522 226
200 3300009101 Ga0105247_10149251 Ga0105247_101492512 226
201 3300014968 Ga0157379_10293153 Ga0157379_102931532 226
202 3300020076 Ga0206355_1144450 Ga0206355_11444502 226
203 3300025986 Ga0207658_10000322 Ga0207658_1000032249 226
204 3300027907 Ga0207428_10111489 Ga0207428_101114892 226
205 3300031507 Ga0307509_10155234 Ga0307509_101552342 226
206 3300031691 Ga0316579_10080889 Ga0316579_100808892 226
207 3300031733 Ga0316577_10014934 Ga0316577_100149343 226
208 3300032133 Ga0316583_10003221 Ga0316583_100032215 226
209 3300032139 Ga0316580_10018958 Ga0316580_100189582 226
210 3300035086 Ga0373934_0020623 Ga0373934_0020623_1149_1991 226
211 3300035398 Ga0316574_0030171 Ga0316574_0030171_1910_2752 226
212 3300036647 Ga0316582_0024709 Ga0316582_0024709_1296_2138 226
213 3300036712 Ga0316584_0007474 Ga0316584_0007474_2165_3007 226
214 3300037588 Ga0316581_0002029 Ga0316581_0002029_2617_3459 226
215 3300046542 Ga0495597_0028713 Ga0495597_0028713_1498_2325 226
216 3300047321 Ga0495676_0406120 Ga0495676_0406120_42_884 226
217 3300050508 nmdc:mga09592_236985_c1 nmdc:mga09592_236985_c1_160_984 226
218 3300050511 nmdc:mga08y16_131209_c1 nmdc:mga08y16_131209_c1_1113_1937 226
219 3300050511 nmdc:mga08y16_39060_c1 nmdc:mga08y16_39060_c1_1540_2364 226
220 3300005459 Ga0068867_100000006 Ga0068867_10000000610 227
221 3300005471 Ga0070698_100275359 Ga0070698_1002753592 227
222 3300005544 Ga0070686_100286387 Ga0070686_1002863871 227
223 3300005616 Ga0068852_100114812 Ga0068852_1001148123 227
224 3300009148 Ga0105243_10007446 Ga0105243_100074461 227
225 3300009176 Ga0105242_10020500 Ga0105242_100205004 227
226 3300014745 Ga0157377_10000013 Ga0157377_1000001372 227
227 3300025905 Ga0207685_10195559 Ga0207685_101955591 227
228 3300025935 Ga0207709_10004452 Ga0207709_100044528 227
229 3300026089 Ga0207648_10000006 Ga0207648_10000006180 227
230 3300026142 Ga0207698_10051736 Ga0207698_100517363 227
231 3300044712 Ga0453684_0359327 Ga0453684_0359327_133_945 227
232 3300045051 Ga0451576_0005551 Ga0451576_0005551_5929_6741 227
233 3300045051 Ga0451576_0271485 Ga0451576_0271485_193_1005 227
234 3300005334 Ga0068869_100101126 Ga0068869_1001011262 228
235 3300005340 Ga0070689_100041672 Ga0070689_1000416723 228
236 3300005356 Ga0070674_100079070 Ga0070674_1000790702 228
237 3300005440 Ga0070705_100038552 Ga0070705_1000385521 228
238 3300005441 Ga0070700_100012946 Ga0070700_1000129463 228
239 3300005456 Ga0070678_100025521 Ga0070678_1000255212 228
240 3300005457 Ga0070662_100385305 Ga0070662_1003853052 228
241 3300005543 Ga0070672_100030198 Ga0070672_1000301982 228
242 3300005543 Ga0070672_100102269 Ga0070672_1001022692 228
243 3300005543 Ga0070672_100120364 Ga0070672_1001203642 228
244 3300005546 Ga0070696_100095869 Ga0070696_1000958692 228
245 3300005548 Ga0070665_100006360 Ga0070665_1000063602 228
246 3300005549 Ga0070704_100047674 Ga0070704_1000476742 228
247 3300005615 Ga0070702_100006282 Ga0070702_1000062822 228
248 3300005719 Ga0068861_100018404 Ga0068861_1000184042 228
249 3300005719 Ga0068861_100029827 Ga0068861_1000298273 228
250 3300005719 Ga0068861_100124147 Ga0068861_1001241472 228
251 3300005840 Ga0068870_10049308 Ga0068870_100493082 228
252 3300005841 Ga0068863_100184441 Ga0068863_1001844412 228
253 3300005841 Ga0068863_100361050 Ga0068863_1003610501 228
254 3300005843 Ga0068860_100118924 Ga0068860_1001189243 228
255 3300005844 Ga0068862_100009198 Ga0068862_1000091986 228
256 3300005844 Ga0068862_100117675 Ga0068862_1001176752 228
257 3300005844 Ga0068862_100205428 Ga0068862_1002054282 228
258 3300006237 Ga0097621_100020799 Ga0097621_1000207993 228
259 3300006358 Ga0068871_100011150 Ga0068871_1000111503 228
260 3300006881 Ga0068865_100044895 Ga0068865_1000448953 228
261 3300009094 Ga0111539_10579902 Ga0111539_105799022 228
262 3300013104 Ga0157370_10228352 Ga0157370_102283522 228
263 3300013308 Ga0157375_10668214 Ga0157375_106682141 228
264 3300014325 Ga0163163_10020768 Ga0163163_100207684 228
265 3300014326 Ga0157380_10023317 Ga0157380_100233173 228
266 3300025908 Ga0207643_10037238 Ga0207643_100372382 228
267 3300025908 Ga0207643_10069351 Ga0207643_100693512 228
268 3300025923 Ga0207681_10229837 Ga0207681_102298372 228
269 3300025933 Ga0207706_10287878 Ga0207706_102878782 228
270 3300025937 Ga0207669_10056952 Ga0207669_100569522 228
271 3300025940 Ga0207691_10133018 Ga0207691_101330182 228
272 3300025940 Ga0207691_10163814 Ga0207691_101638142 228
273 3300025942 Ga0207689_10023736 Ga0207689_100237362 228
274 3300025945 Ga0207679_10086280 Ga0207679_100862802 228
275 3300026075 Ga0207708_10072561 Ga0207708_100725612 228
276 3300026088 Ga0207641_10189164 Ga0207641_101891642 228
277 3300026118 Ga0207675_100041887 Ga0207675_1000418873 228
278 3300026118 Ga0207675_100072042 Ga0207675_1000720423 228
279 3300026118 Ga0207675_100258482 Ga0207675_1002584822 228
280 3300026121 Ga0207683_10041600 Ga0207683_100416003 228
281 3300028379 Ga0268266_10005164 Ga0268266_1000516411 228
282 3300028380 Ga0268265_10225041 Ga0268265_102250412 228
283 3300028794 Ga0307515_10002761 Ga0307515_1000276116 228
284 3300031507 Ga0307509_10125632 Ga0307509_101256323 228
285 3300031548 Ga0307408_100105642 Ga0307408_1001056422 228
286 3300031901 Ga0307406_10014170 Ga0307406_100141702 228
287 3300031995 Ga0307409_100005917 Ga0307409_1000059177 228
288 3300032005 Ga0307411_10004935 Ga0307411_100049354 228
289 3300032005 Ga0307411_10313913 Ga0307411_103139131 228
290 3300037312 Ga0395899_0030796 Ga0395899_0030796_589_1416 228
291 3300037418 Ga0395900_0231168 Ga0395900_0231168_970_1797 228
292 3300037466 Ga0395898_0031878 Ga0395898_0031878_921_1748 228
293 3300038443 Ga0395901_0042064 Ga0395901_0042064_394_1221 228
294 3300039437 Ga0436365_0066966 Ga0436365_0066966_1895_2707 228
295 3300046519 Ga0495632_0063953 Ga0495632_0063953_176_1018 228
296 3300046616 Ga0495668_0015499 Ga0495668_0015499_2853_3695 228
297 3300048925 Ga0496122_0001177 Ga0496122_0001177_39278_40120 228
298 3300048926 Ga0496123_0000754 Ga0496123_0000754_46905_47747 228
299 3300049578 Ga0501042_0062265 Ga0501042_0062265_484_1326 228
300 3300049584 Ga0501068_0057746 Ga0501068_0057746_595_1437 228
301 3300049586 Ga0501070_0022979 Ga0501070_0022979_3402_4244 228
302 3300049587 Ga0501071_0047287 Ga0501071_0047287_2019_2861 228
303 3300049588 Ga0501072_0035424 Ga0501072_0035424_2447_3289 228
304 3300049589 Ga0501073_0000354 Ga0501073_0000354_27695_28537 228
305 3300049590 Ga0501074_0000738 Ga0501074_0000738_7264_8106 228
306 3300049591 Ga0501075_0114991 Ga0501075_0114991_213_1055 228
307 3300049593 Ga0501077_0012657 Ga0501077_0012657_3276_4118 228
308 3300049741 Ga0501079_0002075 Ga0501079_0002075_2275_3117 228
309 3300049742 Ga0501080_0004800 Ga0501080_0004800_10099_10941 228
310 3300049744 Ga0501083_0067703 Ga0501083_0067703_930_1772 228
311 3300050511 nmdc:mga08y16_267174_c1 nmdc:mga08y16_267174_c1_322_1164 228
312 3300050511 nmdc:mga08y16_39966_c1 nmdc:mga08y16_39966_c1_2053_2880 228
313 3300050511 nmdc:mga08y16_558217_c1 nmdc:mga08y16_558217_c1_150_992 228
314 3300054114 Ga0501084_0004840 Ga0501084_0004840_9167_10009 228
315 3300060353 Ga0501082_0019287 Ga0501082_0019287_842_1684 228
316 3300003794 Ga0055531_10043596 Ga0055531_100435961 229
317 3300005353 Ga0070669_100012088 Ga0070669_1000120884 229
318 3300006944 Ga0099823_1006273 Ga0099823_10062739 229
319 3300025273 Ga0209673_1014088 Ga0209673_10140883 229
320 3300025298 Ga0209050_1006055 Ga0209050_10060555 229
321 3300025303 Ga0209051_1001570 Ga0209051_10015705 229
322 3300025304 Ga0209257_1033503 Ga0209257_10335032 229
323 3300027296 Ga0209389_1016619 Ga0209389_10166194 229
324 3300048927 Ga0496124_0015626 Ga0496124_0015626_2624_3442 229
325 3300003322 rootL2_10007771 rootL2_100077715 230
326 3300003771 Ga0055526_1014942 Ga0055526_10149422 230
327 3300005331 Ga0070670_100217526 Ga0070670_1002175262 230
328 3300005355 Ga0070671_100054603 Ga0070671_1000546032 230
329 3300005456 Ga0070678_100120149 Ga0070678_1001201492 230
330 3300005530 Ga0070679_100458797 Ga0070679_1004587972 230
331 3300005548 Ga0070665_100231318 Ga0070665_1002313182 230
332 3300005617 Ga0068859_100073513 Ga0068859_1000735133 230
333 3300005843 Ga0068860_100086668 Ga0068860_1000866683 230
334 3300006195 Ga0075366_10183616 Ga0075366_101836162 230
335 3300006931 Ga0097620_100073511 Ga0097620_1000735113 230
336 3300007265 Ga0099794_10013815 Ga0099794_100138152 230
337 3300009098 Ga0105245_10099033 Ga0105245_100990332 230
338 3300012497 Ga0157319_1000006 Ga0157319_1000006122 230
339 3300013308 Ga0157375_10374823 Ga0157375_103748231 230
340 3300025273 Ga0209673_1010871 Ga0209673_10108712 230
341 3300025295 Ga0209564_1000003 Ga0209564_10000031375 230
342 3300025299 Ga0209256_1004237 Ga0209256_10042377 230
343 3300025911 Ga0207654_10215135 Ga0207654_102151352 230
344 3300025912 Ga0207707_10037528 Ga0207707_100375282 230
345 3300025916 Ga0207663_10209244 Ga0207663_102092442 230
346 3300025931 Ga0207644_10040966 Ga0207644_100409662 230
347 3300025942 Ga0207689_10250294 Ga0207689_102502942 230
348 3300025986 Ga0207658_10217759 Ga0207658_102177592 230
349 3300026023 Ga0207677_10423813 Ga0207677_104238132 230
350 3300028379 Ga0268266_10157857 Ga0268266_101578572 230
351 3300028381 Ga0268264_10077361 Ga0268264_100773612 230
352 3300031239 Ga0265328_10095711 Ga0265328_100957111 230
353 3300031507 Ga0307509_10122075 Ga0307509_101220753 230
354 3300035086 Ga0373934_0000479 Ga0373934_0000479_8894_9715 230
355 3300035091 Ga0373951_0040641 Ga0373951_0040641_36_857 230
356 3300035119 Ga0373956_0000131 Ga0373956_0000131_10520_11341 230
357 3300035724 Ga0373933_0001235 Ga0373933_0001235_842_1663 230
358 3300036401 Ga0373937_0000096 Ga0373937_0000096_12989_13810 230
359 3300037418 Ga0395900_0133493 Ga0395900_0133493_1069_1929 230
360 3300042127 Ga0450890_007887 Ga0450890_007887_270_1088 230
361 3300046454 Ga0495592_0079197 Ga0495592_0079197_681_1502 230
362 3300046462 Ga0495651_0000085 Ga0495651_0000085_36918_37739 230
363 3300046516 Ga0495628_0003726 Ga0495628_0003726_4149_4970 230
364 3300046517 Ga0495630_0047368 Ga0495630_0047368_541_1362 230
365 3300046529 Ga0495652_0005738 Ga0495652_0005738_2928_3749 230
366 3300046543 Ga0495645_0001492 Ga0495645_0001492_5424_6245 230
367 3300046557 Ga0495622_0073870 Ga0495622_0073870_605_1501 230
368 3300046616 Ga0495668_0020606 Ga0495668_0020606_2543_3376 230
369 3300046678 Ga0495599_0000876 Ga0495599_0000876_11846_12667 230
370 3300046683 Ga0495658_0140868 Ga0495658_0140868_326_1159 230
371 3300047322 Ga0495680_0240217 Ga0495680_0240217_192_1013 230
372 3300047444 Ga0495675_0046686 Ga0495675_0046686_66_887 230
373 3300049570 Ga0501033_0115086 Ga0501033_0115086_768_1592 230
374 3300049579 Ga0501043_0319819 Ga0501043_0319819_119_943 230
375 3300049823 Ga0501044_0144303 Ga0501044_0144303_448_1272 230
376 3300050493 nmdc:mga0k408_261606_c1 nmdc:mga0k408_261606_c1_151_969 230
377 3300050514 nmdc:mga08x19_78205_c1 nmdc:mga08x19_78205_c1_779_1615 230
378 3300053077 Ga0495601_0018962 Ga0495601_0018962_722_1543 230
379 3300053156 Ga0500622_0001272 Ga0500622_0001272_15812_16630 230
380 3300001989 JGI24739J22299_10000141 JGI24739J22299_100001415 231
381 3300003187 JGI25151J46595_10000262 JGI25151J46595_100002624 231
382 3300003215 JGI25153J46596_10003388 JGI25153J46596_100033883 231
383 3300003791 Ga0055530_10010281 Ga0055530_100102812 231
384 3300005262 Ga0065165_1000995 Ga0065165_10009956 231
385 3300005262 Ga0065165_1001389 Ga0065165_100138918 231
386 3300005262 Ga0065165_1002021 Ga0065165_10020218 231
387 3300005458 Ga0070681_10003522 Ga0070681_100035225 231
388 3300005614 Ga0068856_100396328 Ga0068856_1003963282 231
389 3300006195 Ga0075366_10251679 Ga0075366_102516791 231
390 3300017792 Ga0163161_10167383 Ga0163161_101673831 231
391 3300025273 Ga0209673_1025996 Ga0209673_10259962 231
392 3300025294 Ga0209025_1000057 Ga0209025_1000057210 231
393 3300025297 Ga0209758_1000096 Ga0209758_1000096143 231
394 3300025298 Ga0209050_1003867 Ga0209050_10038679 231
395 3300025299 Ga0209256_1024727 Ga0209256_10247272 231
396 3300025912 Ga0207707_10034389 Ga0207707_100343895 231
397 3300028786 Ga0307517_10106490 Ga0307517_101064902 231
398 3300031616 Ga0307508_10007413 Ga0307508_100074135 231
399 3300031649 Ga0307514_10178034 Ga0307514_101780342 231
400 3300032004 Ga0307414_10007717 Ga0307414_100077172 231
401 3300041456 Ga0451795_1374636 Ga0451795_1374636_800_1624 231
402 3300041458 Ga0451798_0725560 Ga0451798_0725560_6348_7172 231
403 3300041463 Ga0451804_0286988 Ga0451804_0286988_436_1260 231
404 3300044656 Ga0466969_0004483 Ga0466969_0004483_2793_3668 231
405 3300046506 Ga0495583_0000809 Ga0495583_0000809_9342_10169 231
406 3300046522 Ga0495643_0136732 Ga0495643_0136732_144_971 231
407 3300046664 Ga0495659_0006310 Ga0495659_0006310_1302_2129 231
408 3300047445 Ga0495677_0021867 Ga0495677_0021867_448_1275 231
409 3300048905 Ga0496102_0000123 Ga0496102_0000123_106100_106927 231
410 3300048918 Ga0496115_0035563 Ga0496115_0035563_1613_2437 231
411 3300048929 Ga0496126_0005728 Ga0496126_0005728_488_1315 231
412 3300053086 Ga0500578_0000115 Ga0500578_0000115_26170_26994 231
413 3300053093 Ga0500651_0008220 Ga0500651_0008220_3054_3878 231
414 3300053130 Ga0500642_0000832 Ga0500642_0000832_1984_2808 231
415 3300053139 Ga0500568_0033686 Ga0500568_0033686_168_992 231
416 3300053156 Ga0500622_0000205 Ga0500622_0000205_12966_13790 231
417 3300003771 Ga0055526_1000086 Ga0055526_10000865 232
418 3300003773 Ga0055537_1000012 Ga0055537_100001284 232
419 3300003775 Ga0055524_1009288 Ga0055524_10092883 232
420 3300003784 Ga0055534_1000399 Ga0055534_100039923 232
421 3300003790 Ga0055528_1000351 Ga0055528_100035130 232
422 3300005331 Ga0070670_100048002 Ga0070670_1000480022 232
423 3300005331 Ga0070670_100298112 Ga0070670_1002981122 232
424 3300005339 Ga0070660_100000923 Ga0070660_1000009232 232
425 3300005344 Ga0070661_100008601 Ga0070661_1000086013 232
426 3300005347 Ga0070668_100003227 Ga0070668_1000032273 232
427 3300005353 Ga0070669_100007810 Ga0070669_1000078105 232
428 3300005354 Ga0070675_100004454 Ga0070675_1000044543 232
429 3300005354 Ga0070675_100028650 Ga0070675_1000286503 232
430 3300005354 Ga0070675_100563773 Ga0070675_1005637731 232
431 3300005355 Ga0070671_100002154 Ga0070671_1000021545 232
432 3300005355 Ga0070671_100115804 Ga0070671_1001158042 232
433 3300005364 Ga0070673_100006377 Ga0070673_1000063773 232
434 3300005364 Ga0070673_100022059 Ga0070673_1000220593 232
435 3300005366 Ga0070659_100001931 Ga0070659_1000019314 232
436 3300005367 Ga0070667_100025943 Ga0070667_1000259435 232
437 3300005367 Ga0070667_100142704 Ga0070667_1001427042 232
438 3300005457 Ga0070662_100000859 Ga0070662_1000008598 232
439 3300005539 Ga0068853_100008722 Ga0068853_1000087224 232
440 3300005543 Ga0070672_100000208 Ga0070672_1000002084 232
441 3300005564 Ga0070664_100013457 Ga0070664_1000134573 232
442 3300005564 Ga0070664_100127051 Ga0070664_1001270512 232
443 3300005614 Ga0068856_100003022 Ga0068856_10000302210 232
444 3300005616 Ga0068852_100052664 Ga0068852_1000526642 232
445 3300005618 Ga0068864_100016433 Ga0068864_1000164333 232
446 3300005841 Ga0068863_100299206 Ga0068863_1002992061 232
447 3300005843 Ga0068860_100072236 Ga0068860_1000722363 232
448 3300006237 Ga0097621_100327126 Ga0097621_1003271262 232
449 3300013100 Ga0157373_10003697 Ga0157373_100036979 232
450 3300013102 Ga0157371_10000422 Ga0157371_1000042222 232
451 3300013306 Ga0163162_10354848 Ga0163162_103548482 232
452 3300013307 Ga0157372_10006612 Ga0157372_100066124 232
453 3300013308 Ga0157375_10004499 Ga0157375_100044993 232
454 3300014325 Ga0163163_10084331 Ga0163163_100843312 232
455 3300014325 Ga0163163_10439880 Ga0163163_104398802 232
456 3300014326 Ga0157380_10074237 Ga0157380_100742373 232
457 3300017792 Ga0163161_10029871 Ga0163161_100298713 232
458 3300021361 Ga0213872_10000046 Ga0213872_1000004689 232
459 3300021361 Ga0213872_10000048 Ga0213872_1000004855 232
460 3300021361 Ga0213872_10000086 Ga0213872_1000008618 232
461 3300025263 Ga0209565_1000057 Ga0209565_100005787 232
462 3300025273 Ga0209673_1000051 Ga0209673_1000051201 232
463 3300025291 Ga0209675_1000027 Ga0209675_1000027201 232
464 3300025295 Ga0209564_1000094 Ga0209564_100009486 232
465 3300025299 Ga0209256_1000139 Ga0209256_100013986 232
466 3300025315 Ga0207697_10021145 Ga0207697_100211452 232
467 3300025923 Ga0207681_10013238 Ga0207681_100132383 232
468 3300025925 Ga0207650_10049298 Ga0207650_100492982 232
469 3300025925 Ga0207650_10197962 Ga0207650_101979622 232
470 3300025926 Ga0207659_10010632 Ga0207659_100106323 232
471 3300025931 Ga0207644_10056873 Ga0207644_100568732 232
472 3300025932 Ga0207690_10001165 Ga0207690_1000116512 232
473 3300025933 Ga0207706_10000064 Ga0207706_1000006488 232
474 3300025933 Ga0207706_10013987 Ga0207706_100139872 232
475 3300025940 Ga0207691_10000087 Ga0207691_1000008721 232
476 3300025945 Ga0207679_10005057 Ga0207679_100050577 232
477 3300025945 Ga0207679_10024676 Ga0207679_100246763 232
478 3300025949 Ga0207667_10003108 Ga0207667_100031088 232
479 3300025960 Ga0207651_10009113 Ga0207651_100091133 232
480 3300025960 Ga0207651_10041860 Ga0207651_100418604 232
481 3300025972 Ga0207668_10001815 Ga0207668_100018156 232
482 3300025986 Ga0207658_10017921 Ga0207658_100179215 232
483 3300025986 Ga0207658_10102594 Ga0207658_101025943 232
484 3300026041 Ga0207639_10003441 Ga0207639_100034418 232
485 3300026067 Ga0207678_10006140 Ga0207678_100061408 232
486 3300026078 Ga0207702_10010543 Ga0207702_100105435 232
487 3300026095 Ga0207676_10165927 Ga0207676_101659272 232
488 3300026142 Ga0207698_10036689 Ga0207698_100366892 232
489 3300028381 Ga0268264_10062720 Ga0268264_100627203 232
490 3300031548 Ga0307408_100421549 Ga0307408_1004215492 232
491 3300031731 Ga0307405_10001063 Ga0307405_100010633 232
492 3300031852 Ga0307410_10177943 Ga0307410_101779432 232
493 3300031901 Ga0307406_10003525 Ga0307406_100035252 232
494 3300031903 Ga0307407_10004629 Ga0307407_100046293 232
495 3300031911 Ga0307412_10009253 Ga0307412_100092534 232
496 3300031995 Ga0307409_100045019 Ga0307409_1000450193 232
497 3300032002 Ga0307416_100039057 Ga0307416_1000390573 232
498 3300032005 Ga0307411_10020892 Ga0307411_100208923 232
499 3300032126 Ga0307415_100053831 Ga0307415_1000538313 232
500 3300039447 Ga0436361_0633280 Ga0436361_0633280_18146_18967 232
501 3300039447 Ga0436361_0943694 Ga0436361_0943694_30791_31609 232
502 3300039447 Ga0436361_1030340 Ga0436361_1030340_40213_41037 232
503 3300042876 Ga0451577_0002513 Ga0451577_0002513_13354_14193 232
504 3300048903 Ga0496100_0172254 Ga0496100_0172254_604_1434 232
505 3300048905 Ga0496102_0078328 Ga0496102_0078328_84_914 232
506 3300048909 Ga0496106_0005737 Ga0496106_0005737_4793_5623 232
507 3300049649 Ga0501198_000003 Ga0501198_000003_45722_46603 232
508 3300049662 Ga0501222_000014 Ga0501222_000014_45722_46603 232
509 3300053139 Ga0500568_0020192 Ga0500568_0020192_693_1523 232
510 iso_pu_bacteria 2883577096 2883578324 232
511 3300002774 JGI25150J39212_1000667 JGI25150J39212_100066711 233
512 3300003215 JGI25153J46596_10034800 JGI25153J46596_100348001 233
513 3300003771 Ga0055526_1000074 Ga0055526_100007418 233
514 3300005328 Ga0070676_10160615 Ga0070676_101606152 233
515 3300005347 Ga0070668_100170697 Ga0070668_1001706972 233
516 3300005367 Ga0070667_100616281 Ga0070667_1006162811 233
517 3300005455 Ga0070663_100079453 Ga0070663_1000794532 233
518 3300005543 Ga0070672_100047622 Ga0070672_1000476222 233
519 3300005563 Ga0068855_100009643 Ga0068855_10000964313 233
520 3300005578 Ga0068854_100177767 Ga0068854_1001777672 233
521 3300005843 Ga0068860_100227804 Ga0068860_1002278042 233
522 3300006042 Ga0075368_10095893 Ga0075368_100958932 233
523 3300006048 Ga0075363_100083329 Ga0075363_1000833292 233
524 3300006177 Ga0075362_10005262 Ga0075362_100052624 233
525 3300006178 Ga0075367_10007819 Ga0075367_100078194 233
526 3300006353 Ga0075370_10008613 Ga0075370_100086133 233
527 3300006353 Ga0075370_10021076 Ga0075370_100210762 233
528 3300006353 Ga0075370_10105203 Ga0075370_101052032 233
529 3300006358 Ga0068871_100185256 Ga0068871_1001852561 233
530 3300006946 Ga0079104_1004305 Ga0079104_10043052 233
531 3300009036 Ga0105244_10005473 Ga0105244_100054734 233
532 3300009094 Ga0111539_11099492 Ga0111539_110994921 233
533 3300009098 Ga0105245_10096658 Ga0105245_100966583 233
534 3300009148 Ga0105243_10059329 Ga0105243_100593292 233
535 3300009148 Ga0105243_10100525 Ga0105243_101005252 233
536 3300009177 Ga0105248_10003709 Ga0105248_1000370916 233
537 3300009553 Ga0105249_10286980 Ga0105249_102869802 233
538 3300013308 Ga0157375_10125562 Ga0157375_101255623 233
539 3300014326 Ga0157380_10098497 Ga0157380_100984971 233
540 3300014497 Ga0182008_10014563 Ga0182008_100145632 233
541 3300015261 Ga0182006_1000002 Ga0182006_1000002505 233
542 3300015261 Ga0182006_1000026 Ga0182006_1000026149 233
543 3300015262 Ga0182007_10000073 Ga0182007_1000007323 233
544 3300015265 Ga0182005_1000002 Ga0182005_1000002587 233
545 3300015265 Ga0182005_1000007 Ga0182005_1000007230 233
546 3300021361 Ga0213872_10000028 Ga0213872_1000002884 233
547 3300025245 Ga0207425_1000192 Ga0207425_100019236 233
548 3300025294 Ga0209025_1007891 Ga0209025_10078917 233
549 3300025295 Ga0209564_1000009 Ga0209564_1000009281 233
550 3300025297 Ga0209758_1000227 Ga0209758_100022748 233
551 3300025917 Ga0207660_10081617 Ga0207660_100816173 233
552 3300025923 Ga0207681_10189141 Ga0207681_101891412 233
553 3300025931 Ga0207644_10019073 Ga0207644_100190731 233
554 3300025940 Ga0207691_10038626 Ga0207691_100386264 233
555 3300025940 Ga0207691_10053485 Ga0207691_100534853 233
556 3300025941 Ga0207711_10214096 Ga0207711_102140962 233
557 3300025981 Ga0207640_10020459 Ga0207640_100204594 233
558 3300025986 Ga0207658_10276004 Ga0207658_102760042 233
559 3300026116 Ga0207674_10306920 Ga0207674_103069202 233
560 3300026116 Ga0207674_10329185 Ga0207674_103291851 233
561 3300026142 Ga0207698_10127853 Ga0207698_101278532 233
562 3300027866 Ga0209813_10031522 Ga0209813_100315222 233
563 3300027907 Ga0207428_10287455 Ga0207428_102874552 233
564 3300028381 Ga0268264_10292743 Ga0268264_102927432 233
565 3300029957 Ga0265324_10019937 Ga0265324_100199372 233
566 3300031251 Ga0265327_10000217 Ga0265327_1000021781 233
567 3300031251 Ga0265327_10021683 Ga0265327_100216832 233
568 3300031507 Ga0307509_10175510 Ga0307509_101755102 233
569 3300031730 Ga0307516_10225042 Ga0307516_102250422 233
570 3300032004 Ga0307414_10043954 Ga0307414_100439541 233
571 3300035114 Ga0373939_0026399 Ga0373939_0026399_10_834 233
572 3300038726 Ga0400490_40529 Ga0400490_40529_866_1693 233
573 3300039447 Ga0436361_0420505 Ga0436361_0420505_81117_81944 233
574 3300044673 Ga0453683_0052988 Ga0453683_0052988_1209_2027 233
575 3300044712 Ga0453684_0033923 Ga0453684_0033923_5585_6403 233
576 3300044712 Ga0453684_0779254 Ga0453684_0779254_43_870 233
577 3300045051 Ga0451576_0008593 Ga0451576_0008593_7099_7917 233
578 3300046452 Ga0495617_000039 Ga0495617_000039_116026_116850 233
579 3300046453 Ga0495627_000280 Ga0495627_000280_39395_40219 233
580 3300046457 Ga0495590_0000018 Ga0495590_0000018_106406_107230 233
581 3300046457 Ga0495590_0016311 Ga0495590_0016311_436_1260 233
582 3300046458 Ga0495591_000218 Ga0495591_000218_14688_15512 233
583 3300046459 Ga0495629_0183757 Ga0495629_0183757_418_1248 233
584 3300046463 Ga0495653_0053267 Ga0495653_0053267_1546_2376 233
585 3300046471 Ga0495650_0000166 Ga0495650_0000166_71464_72291 233
586 3300046471 Ga0495650_0000442 Ga0495650_0000442_40344_41171 233
587 3300046474 Ga0495605_0000059 Ga0495605_0000059_78305_79132 233
588 3300046474 Ga0495605_0000256 Ga0495605_0000256_492_1316 233
589 3300046474 Ga0495605_0024925 Ga0495605_0024925_2288_3112 233
590 3300046492 Ga0495585_0000288 Ga0495585_0000288_29262_30086 233
591 3300046492 Ga0495585_0010453 Ga0495585_0010453_2914_3738 233
592 3300046499 Ga0495594_0057981 Ga0495594_0057981_906_1736 233
593 3300046501 Ga0495607_0002393 Ga0495607_0002393_4616_5440 233
594 3300046506 Ga0495583_0000121 Ga0495583_0000121_28416_29240 233
595 3300046507 Ga0495606_0000064 Ga0495606_0000064_102873_103700 233
596 3300046512 Ga0495610_0002499 Ga0495610_0002499_4685_5509 233
597 3300046512 Ga0495610_0006142 Ga0495610_0006142_7430_8257 233
598 3300046513 Ga0495616_0006600 Ga0495616_0006600_5165_5989 233
599 3300046513 Ga0495616_0028044 Ga0495616_0028044_796_1626 233
600 3300046518 Ga0495631_0001316 Ga0495631_0001316_548_1372 233
601 3300046518 Ga0495631_0005164 Ga0495631_0005164_3678_4502 233
602 3300046519 Ga0495632_0012093 Ga0495632_0012093_2431_3258 233
603 3300046520 Ga0495637_0000004 Ga0495637_0000004_500781_501605 233
604 3300046523 Ga0495644_0018028 Ga0495644_0018028_796_1626 233
605 3300046524 Ga0495648_0000149 Ga0495648_0000149_9533_10357 233
606 3300046524 Ga0495648_0000908 Ga0495648_0000908_20419_21243 233
607 3300046526 Ga0495666_0050297 Ga0495666_0050297_181_1014 233
608 3300046528 Ga0495642_0001386 Ga0495642_0001386_9125_9949 233
609 3300046531 Ga0495665_0017932 Ga0495665_0017932_2017_2847 233
610 3300046531 Ga0495665_0142255 Ga0495665_0142255_347_1180 233
611 3300046536 Ga0495587_0010410 Ga0495587_0010410_4741_5574 233
612 3300046537 Ga0495598_0022229 Ga0495598_0022229_385_1215 233
613 3300046538 Ga0495609_0005541 Ga0495609_0005541_880_1704 233
614 3300046538 Ga0495609_0011626 Ga0495609_0011626_1015_1839 233
615 3300046557 Ga0495622_0009230 Ga0495622_0009230_187_1020 233
616 3300046557 Ga0495622_0017647 Ga0495622_0017647_1424_2254 233
617 3300046558 Ga0495633_0004666 Ga0495633_0004666_5878_6702 233
618 3300046558 Ga0495633_0021525 Ga0495633_0021525_1991_2821 233
619 3300046616 Ga0495668_0000185 Ga0495668_0000185_35393_36220 233
620 3300046616 Ga0495668_0004037 Ga0495668_0004037_218_1048 233
621 3300046648 Ga0495611_0001338 Ga0495611_0001338_7011_7835 233
622 3300046648 Ga0495611_0001418 Ga0495611_0001418_2207_3031 233
623 3300046648 Ga0495611_0020618 Ga0495611_0020618_1681_2505 233
624 3300046648 Ga0495611_0034931 Ga0495611_0034931_379_1203 233
625 3300046648 Ga0495611_0073261 Ga0495611_0073261_244_1068 233
626 3300046660 Ga0495625_0000372 Ga0495625_0000372_32108_32935 233
627 3300046660 Ga0495625_0063464 Ga0495625_0063464_86_913 233
628 3300046663 Ga0495635_0010057 Ga0495635_0010057_1777_2607 233
629 3300046664 Ga0495659_0000065 Ga0495659_0000065_7790_8617 233
630 3300046665 Ga0495661_0006787 Ga0495661_0006787_1310_2134 233
631 3300046665 Ga0495661_0135356 Ga0495661_0135356_493_1317 233
632 3300046674 Ga0495588_0112599 Ga0495588_0112599_201_1031 233
633 3300046674 Ga0495588_0148341 Ga0495588_0148341_249_1082 233
634 3300046679 Ga0495623_0068045 Ga0495623_0068045_928_1761 233
635 3300046684 Ga0495669_0000870 Ga0495669_0000870_3862_4686 233
636 3300046691 Ga0495670_0059855 Ga0495670_0059855_1022_1846 233
637 3300046692 Ga0495671_0000903 Ga0495671_0000903_11501_12325 233
638 3300046694 Ga0495649_0017065 Ga0495649_0017065_114_941 233
639 3300046810 Ga0495660_0013101 Ga0495660_0013101_3788_4612 233
640 3300047315 Ga0495581_0001952 Ga0495581_0001952_7425_8255 233
641 3300047315 Ga0495581_0019225 Ga0495581_0019225_2262_3095 233
642 3300047320 Ga0495672_0000477 Ga0495672_0000477_39056_39880 233
643 3300047320 Ga0495672_0000627 Ga0495672_0000627_33120_33947 233
644 3300047320 Ga0495672_0131721 Ga0495672_0131721_27_851 233
645 3300047322 Ga0495680_0016593 Ga0495680_0016593_1713_2543 233
646 3300047323 Ga0495683_0000041 Ga0495683_0000041_123156_123980 233
647 3300047323 Ga0495683_0004175 Ga0495683_0004175_7310_8134 233
648 3300047323 Ga0495683_0019448 Ga0495683_0019448_1927_2751 233
649 3300047323 Ga0495683_0068444 Ga0495683_0068444_723_1547 233
650 3300047443 Ga0495687_042191 Ga0495687_042191_408_1235 233
651 3300047444 Ga0495675_0024438 Ga0495675_0024438_1419_2249 233
652 3300047444 Ga0495675_0108964 Ga0495675_0108964_23_856 233
653 3300047445 Ga0495677_0002560 Ga0495677_0002560_5501_6325 233
654 3300047445 Ga0495677_0002828 Ga0495677_0002828_4663_5493 233
655 3300047445 Ga0495677_0030456 Ga0495677_0030456_219_1043 233
656 3300047446 Ga0495679_009023 Ga0495679_009023_1560_2384 233
657 3300047469 Ga0495673_0000003 Ga0495673_0000003_1408317_1409144 233
658 3300047469 Ga0495673_0003810 Ga0495673_0003810_7622_8446 233
659 3300047470 Ga0495681_0011038 Ga0495681_0011038_355_1179 233
660 3300047470 Ga0495681_0081933 Ga0495681_0081933_57_884 233
661 3300047472 Ga0495686_0000350 Ga0495686_0000350_74011_74835 233
662 3300047472 Ga0495686_0000675 Ga0495686_0000675_2217_3041 233
663 3300047673 Ga0495593_0002755 Ga0495593_0002755_8965_9795 233
664 3300048088 Ga0495602_0055501 Ga0495602_0055501_76_909 233
665 3300048089 Ga0495614_0005291 Ga0495614_0005291_1252_2082 233
666 3300048091 Ga0495626_0089260 Ga0495626_0089260_420_1244 233
667 3300048905 Ga0496102_0000351 Ga0496102_0000351_45562_46386 233
668 3300048918 Ga0496115_0159423 Ga0496115_0159423_481_1305 233
669 3300048918 Ga0496115_0171688 Ga0496115_0171688_473_1297 233
670 3300048920 Ga0496117_0000001 Ga0496117_0000001_1522185_1523012 233
671 3300048921 Ga0496118_0000002 Ga0496118_0000002_1522185_1523012 233
672 3300048927 Ga0496124_0146234 Ga0496124_0146234_632_1456 233
673 3300048927 Ga0496124_0156254 Ga0496124_0156254_464_1288 233
674 3300048929 Ga0496126_0005441 Ga0496126_0005441_5554_6381 233
675 3300049459 Ga0495678_000121 Ga0495678_000121_10650_11474 233
676 3300050492 nmdc:mga0yw44_274305_c1 nmdc:mga0yw44_274305_c1_29_856 233
677 3300050493 nmdc:mga0k408_6321_c1 nmdc:mga0k408_6321_c1_5066_5893 233
678 3300050494 nmdc:mga06z11_26874_c1 nmdc:mga06z11_26874_c1_36_863 233
679 3300050496 nmdc:mga07m45_14547_c1 nmdc:mga07m45_14547_c1_2703_3530 233
680 3300050507 nmdc:mga05p37_846524_c1 nmdc:mga05p37_846524_c1_80_904 233
681 3300003763 Ga0055529_1000392 Ga0055529_100039228 234
682 3300003775 Ga0055524_1000021 Ga0055524_100002160 234
683 3300003775 Ga0055524_1000099 Ga0055524_100009931 234
684 3300005327 Ga0070658_10013796 Ga0070658_100137965 234
685 3300005337 Ga0070682_100314188 Ga0070682_1003141881 234
686 3300005339 Ga0070660_100000646 Ga0070660_1000006466 234
687 3300005366 Ga0070659_100144393 Ga0070659_1001443932 234
688 3300005539 Ga0068853_100040591 Ga0068853_1000405912 234
689 3300005614 Ga0068856_100100140 Ga0068856_1001001401 234
690 3300005616 Ga0068852_100659250 Ga0068852_1006592501 234
691 3300005937 Ga0081455_10004332 Ga0081455_100043326 234
692 3300006195 Ga0075366_10015633 Ga0075366_100156333 234
693 3300006846 Ga0075430_100174741 Ga0075430_1001747413 234
694 3300006871 Ga0075434_100305682 Ga0075434_1003056822 234
695 3300006948 Ga0099826_10000002 Ga0099826_10000002984 234
696 3300007076 Ga0075435_100047799 Ga0075435_1000477993 234
697 3300009093 Ga0105240_10008869 Ga0105240_1000886911 234
698 3300009093 Ga0105240_10025060 Ga0105240_1002506010 234
699 3300009094 Ga0111539_10010207 Ga0111539_100102075 234
700 3300009551 Ga0105238_10134544 Ga0105238_101345442 234
701 3300013307 Ga0157372_10207410 Ga0157372_102074103 234
702 3300015261 Ga0182006_1052716 Ga0182006_10527162 234
703 3300015265 Ga0182005_1000662 Ga0182005_10006625 234
704 3300025231 Ga0207427_100592 Ga0207427_10059217 234
705 3300025263 Ga0209565_1029489 Ga0209565_10294892 234
706 3300025272 Ga0209455_1000037 Ga0209455_1000037181 234
707 3300025299 Ga0209256_1000044 Ga0209256_1000044144 234
708 3300025913 Ga0207695_10100163 Ga0207695_101001633 234
709 3300025913 Ga0207695_10173512 Ga0207695_101735121 234
710 3300025935 Ga0207709_10444253 Ga0207709_104442532 234
711 3300025949 Ga0207667_10090963 Ga0207667_100909632 234
712 3300026041 Ga0207639_10036308 Ga0207639_100363082 234
713 3300026078 Ga0207702_10385526 Ga0207702_103855262 234
714 3300027666 Ga0209282_1000001 Ga0209282_1000001177 234
715 3300027907 Ga0207428_10007839 Ga0207428_100078394 234
716 3300031238 Ga0265332_10002144 Ga0265332_100021441 234
717 3300031239 Ga0265328_10049342 Ga0265328_100493422 234
718 3300031241 Ga0265325_10044008 Ga0265325_100440082 234
719 3300031242 Ga0265329_10001607 Ga0265329_100016076 234
720 3300031250 Ga0265331_10000565 Ga0265331_1000056526 234
721 3300031838 Ga0307518_10014580 Ga0307518_100145806 234
722 3300037312 Ga0395899_0003408 Ga0395899_0003408_90_917 234
723 3300037418 Ga0395900_0627722 Ga0395900_0627722_133_960 234
724 3300039447 Ga0436361_0299736 Ga0436361_0299736_1409_2233 234
725 3300044658 Ga0466972_0000060 Ga0466972_0000060_55175_56002 234
726 3300044683 Ga0466965_0001277 Ga0466965_0001277_1080_1907 234
727 3300044842 Ga0466957_0212841 Ga0466957_0212841_177_1001 234
728 3300045051 Ga0451576_0000119 Ga0451576_0000119_141376_142194 234
729 3300045051 Ga0451576_0181381 Ga0451576_0181381_184_1017 234
730 3300045976 Ga0466967_0225430 Ga0466967_0225430_418_1245 234
731 3300046462 Ga0495651_0121874 Ga0495651_0121874_911_1738 234
732 3300046463 Ga0495653_0012213 Ga0495653_0012213_2692_3519 234
733 3300046492 Ga0495585_0002218 Ga0495585_0002218_13072_13911 234
734 3300046501 Ga0495607_0075043 Ga0495607_0075043_388_1215 234
735 3300046506 Ga0495583_0001694 Ga0495583_0001694_14844_15671 234
736 3300046514 Ga0495618_0013302 Ga0495618_0013302_1939_2766 234
737 3300046516 Ga0495628_0003383 Ga0495628_0003383_9078_9905 234
738 3300046558 Ga0495633_0056826 Ga0495633_0056826_204_1028 234
739 3300046648 Ga0495611_0001094 Ga0495611_0001094_136_975 234
740 3300046678 Ga0495599_0000788 Ga0495599_0000788_2560_3387 234
741 3300046684 Ga0495669_0001618 Ga0495669_0001618_3249_4088 234
742 3300046809 Ga0495600_0000151 Ga0495600_0000151_13779_14606 234
743 3300047317 Ga0495604_0016637 Ga0495604_0016637_1961_2788 234
744 3300047443 Ga0495687_000437 Ga0495687_000437_40630_41469 234
745 3300048088 Ga0495602_0026848 Ga0495602_0026848_177_1004 234
746 3300048913 Ga0496110_0453856 Ga0496110_0453856_254_1084 234
747 3300048915 Ga0496112_0013000 Ga0496112_0013000_4257_5087 234
748 3300048916 Ga0496113_0026162 Ga0496113_0026162_1016_1846 234
749 3300048921 Ga0496118_0121539 Ga0496118_0121539_211_1038 234
750 3300048928 Ga0496125_0001032 Ga0496125_0001032_4764_5588 234
751 3300049580 Ga0501046_0415155 Ga0501046_0415155_32_874 234
752 3300049582 Ga0501048_0188329 Ga0501048_0188329_489_1331 234
753 3300049587 Ga0501071_0079840 Ga0501071_0079840_1260_2102 234
754 3300049588 Ga0501072_0297287 Ga0501072_0297287_145_987 234
755 3300049592 Ga0501076_0056508 Ga0501076_0056508_503_1345 234
756 3300049744 Ga0501083_0181134 Ga0501083_0181134_355_1197 234
757 3300050511 nmdc:mga08y16_6905_c1 nmdc:mga08y16_6905_c1_4364_5209 234
758 3300050513 nmdc:mga0rr50_44110_c1 nmdc:mga0rr50_44110_c1_997_1827 234
759 3300054114 Ga0501084_0159229 Ga0501084_0159229_602_1444 234
760 3300059505 Ga0587083_0042145 Ga0587083_0042145_56_883 234
761 3300059510 Ga0587090_001158 Ga0587090_001158_153_980 234
762 3300060353 Ga0501082_0116368 Ga0501082_0116368_652_1494 234
763 iso_pu_bacteria 2831864461 2831869908 234
764 3300002704 JGI25155J39150_1000117 JGI25155J39150_100011717 235
765 3300002704 JGI25155J39150_1000303 JGI25155J39150_10003033 235
766 3300002705 JGI25156J39149_1000108 JGI25156J39149_100010840 235
767 3300002737 JGI25162J39368_1005095 JGI25162J39368_10050953 235
768 3300002738 JGI25154J39366_1000222 JGI25154J39366_100022217 235
769 3300002738 JGI25154J39366_1000463 JGI25154J39366_100046313 235
770 3300002741 JGI25157J39369_1000120 JGI25157J39369_100012036 235
771 3300003758 Ga0055532_1000051 Ga0055532_1000051114 235
772 3300005344 Ga0070661_100003476 Ga0070661_1000034768 235
773 3300005356 Ga0070674_100102615 Ga0070674_1001026152 235
774 3300006195 Ga0075366_10020636 Ga0075366_100206365 235
775 3300009093 Ga0105240_10022945 Ga0105240_100229453 235
776 3300013307 Ga0157372_10004653 Ga0157372_1000465310 235
777 3300014497 Ga0182008_10035124 Ga0182008_100351242 235
778 3300015261 Ga0182006_1031040 Ga0182006_10310402 235
779 3300025206 Ga0209435_100028 Ga0209435_10002823 235
780 3300025206 Ga0209435_100139 Ga0209435_1001394 235
781 3300025229 Ga0209147_100004 Ga0209147_100004370 235
782 3300025233 Ga0209437_100053 Ga0209437_100053281 235
783 3300025246 Ga0209646_1000021 Ga0209646_1000021151 235
784 3300025246 Ga0209646_1000095 Ga0209646_100009523 235
785 3300025250 Ga0209026_1000110 Ga0209026_100011023 235
786 3300025256 Ga0209759_1000080 Ga0209759_1000080109 235
787 3300025256 Ga0209759_1000115 Ga0209759_100011523 235
788 3300025256 Ga0209759_1000155 Ga0209759_100015586 235
789 3300025272 Ga0209455_1004470 Ga0209455_10044703 235
790 3300025913 Ga0207695_10002201 Ga0207695_1000220126 235
791 3300025913 Ga0207695_10395223 Ga0207695_103952231 235
792 3300026116 Ga0207674_10511969 Ga0207674_105119692 235
793 3300031238 Ga0265332_10000094 Ga0265332_1000009413 235
794 3300037312 Ga0395899_0000082 Ga0395899_0000082_59904_60731 235
795 3300046459 Ga0495629_0018715 Ga0495629_0018715_2047_2883 235
796 3300046491 Ga0495584_0000006 Ga0495584_0000006_113145_113981 235
797 3300046499 Ga0495594_0069218 Ga0495594_0069218_298_1134 235
798 3300046526 Ga0495666_0045536 Ga0495666_0045536_582_1418 235
799 3300046531 Ga0495665_0001409 Ga0495665_0001409_6060_6902 235
800 3300046660 Ga0495625_0001737 Ga0495625_0001737_19437_20273 235
801 3300046674 Ga0495588_0049916 Ga0495588_0049916_735_1571 235
802 3300046691 Ga0495670_0063406 Ga0495670_0063406_972_1811 235
803 3300047319 Ga0495674_0003612 Ga0495674_0003612_7991_8827 235
804 3300047321 Ga0495676_0212855 Ga0495676_0212855_206_1039 235
805 3300048925 Ga0496122_0003153 Ga0496122_0003153_1030_1866 235
806 3300048926 Ga0496123_0000295 Ga0496123_0000295_27900_28736 235
807 3300048928 Ga0496125_0010264 Ga0496125_0010264_274_1110 235
808 3300050493 nmdc:mga0k408_7248_c1 nmdc:mga0k408_7248_c1_3200_4039 235
809 3300053156 Ga0500622_0109934 Ga0500622_0109934_39_869 235
810 iso_pu_bacteria 2506520008 2506585213 235
811 iso_pu_bacteria 2508501071 2508853880 235
812 iso_pu_bacteria 2547132181 2547696688 235
813 iso_pu_bacteria 2547132512 2548848177 235
814 iso_pu_bacteria 2554235234 2555261927 235
815 iso_pu_bacteria 2561511199 2562466047 235
816 iso_pu_bacteria 2574179768 2574432208 235
817 iso_pu_bacteria 2599185169 2599412288 235
818 iso_pu_bacteria 2600255254 2601525478 235
819 iso_pu_bacteria 2600255255 2601530549 235
820 iso_pu_bacteria 2600255256 2601534098 235
821 iso_pu_bacteria 2600255257 2601540266 235
822 iso_pu_bacteria 2600255280 2601617599 235
823 iso_pu_bacteria 2600255281 2601622633 235
824 iso_pu_bacteria 2600255287 2601644459 235
825 iso_pu_bacteria 2600255288 2601650907 235
826 iso_pu_bacteria 2600255289 2601655957 235
827 iso_pu_bacteria 2600255290 2601660763 235
828 iso_pu_bacteria 2600255291 2601664624 235
829 iso_pu_bacteria 2600255298 2601697508 235
830 iso_pu_bacteria 2600255299 2601702896 235
831 iso_pu_bacteria 2600255300 2601708723 235
832 iso_pu_bacteria 2600255301 2601713581 235
833 iso_pu_bacteria 2600255302 2601718806 235
834 iso_pu_bacteria 2600255303 2601722445 235
835 iso_pu_bacteria 2600255304 2601728713 235
836 iso_pu_bacteria 2600255305 2601733636 235
837 iso_pu_bacteria 2600255306 2601738611 235
838 iso_pu_bacteria 2600255307 2601743057 235
839 iso_pu_bacteria 2600255309 2601753851 235
840 iso_pu_bacteria 2600255310 2601758751 235
841 iso_pu_bacteria 2600255311 2601762898 235
842 iso_pu_bacteria 2600255392 2602020619 235
843 iso_pu_bacteria 2602042046 2603640751 235
844 iso_pu_bacteria 2602042047 2603644456 235
845 iso_pu_bacteria 2602042052 2603663059 235
846 iso_pu_bacteria 2602042053 2603667957 235
847 iso_pu_bacteria 2602042066 2603700315 235
848 iso_pu_bacteria 2602042067 2603706071 235
849 iso_pu_bacteria 2602042103 2603841276 235
850 iso_pu_bacteria 2602042104 2603846348 235
851 iso_pu_bacteria 2602042105 2603851423 235
852 iso_pu_bacteria 2602042106 2603856490 235
853 iso_pu_bacteria 2602042109 2603868701 235
854 iso_pu_bacteria 2602042110 2603874070 235
855 iso_pu_bacteria 2602042111 2603878765 235
856 iso_pu_bacteria 2603880178 2606051250 235
857 iso_pu_bacteria 2603880184 2606072113 235
858 iso_pu_bacteria 2603880202 2606148819 235
859 iso_pu_bacteria 2603880211 2606179141 235
860 iso_pu_bacteria 2609459761 2609911817 235
861 iso_pu_bacteria 2636415599 2637226992 235
862 iso_pu_bacteria 2643221554 2643787073 235
863 iso_pu_bacteria 2643221638 2644215836 235
864 iso_pu_bacteria 2643221665 2644365316 235
865 iso_pu_bacteria 2667528172 2671103570 235
866 iso_pu_bacteria 2671180115 2671587865 235
867 iso_pu_bacteria 2675903046 2676409520 235
868 iso_pu_bacteria 2681812866 2681996980 235
869 iso_pu_bacteria 2681812869 2682008766 235
870 iso_pu_bacteria 2687453601 2689446617 235
871 iso_pu_bacteria 2690315857 2691330939 235
872 iso_pu_bacteria 2706794495 2707100125 235
873 iso_pu_bacteria 2711768156 2712470777 235
874 iso_pu_bacteria 2751185917 2753854698 235
875 iso_pu_bacteria 2765235842 2765587564 235
876 iso_pu_bacteria 2772190666 2772440529 235
877 iso_pu_bacteria 2773857761 2774389846 235
878 iso_pu_bacteria 2775506706 2775540958 235
879 iso_pu_bacteria 2775507074 2777021390 235
880 iso_pu_bacteria 2791354903 2791924374 235
881 iso_pu_bacteria 2791355010 2792313463 235
882 iso_pu_bacteria 2791355275 2793406764 235
883 iso_pu_bacteria 2806310673 2807178447 235
884 iso_pu_bacteria 2811995292 2813730487 235
885 iso_pu_bacteria 2814123068 2814698095 235
886 iso_pu_bacteria 2821118458 2821121562 235
887 iso_pu_bacteria 2823373977 2823377315 235
888 iso_pu_bacteria 2844425489 2844426260 235
889 iso_pu_bacteria 2881101125 2881101867 235
890 iso_pu_bacteria 2881714928 2881715394 235
891 iso_pu_bacteria 2884086401 2884090337 235
892 iso_pu_bacteria 2888366609 2888370608 235
893 iso_pu_bacteria 2888373701 2888376924 235
894 iso_pu_bacteria 2891633521 2891637574 235
895 iso_pu_bacteria 2891670763 2891671942 235
896 iso_pu_bacteria 2904479285 2904483008 235
897 iso_pu_bacteria 2904513164 2904516288 235
898 iso_pu_bacteria 2908669403 2908673289 235
899 iso_pu_bacteria 2916178963 2916183028 235
900 iso_pu_bacteria 2916699645 2916701988 235
901 iso_pu_bacteria 2919108558 2919112505 235
902 iso_pu_bacteria 2919493220 2919496680 235
903 iso_pu_bacteria 2919497567 2919498947 235
904 iso_pu_bacteria 2919506607 2919508203 235
905 iso_pu_bacteria 2919543075 2919546839 235
906 iso_pu_bacteria 2919688452 2919692219 235
907 iso_pu_bacteria 2919704043 2919705361 235
908 iso_pu_bacteria 2923634449 2923638112 235
909 iso_pu_bacteria 2927833300 2927835468 235
910 iso_pu_bacteria 2928515477 2928515851 235
911 iso_pu_bacteria 2929199973 2929205218 235
912 iso_pu_bacteria 2932406140 2932410421 235
913 iso_pu_bacteria 2935625433 2935628055 235
914 iso_pu_bacteria 2937539931 2937544567 235
915 iso_pu_bacteria 2937967321 2937971833 235
916 iso_pu_bacteria 2939568625 2939571449 235
917 iso_pu_bacteria 2939573065 2939576186 235
918 iso_pu_bacteria 2939577877 2939581525 235
919 iso_pu_bacteria 2939602548 2939605286 235
920 iso_pu_bacteria 2939607340 2939609340 235
921 iso_pu_bacteria 2939617950 2939619526 235
922 iso_pu_bacteria 2939642701 2939646142 235
923 iso_pu_bacteria 2945874760 2945879640 235
924 iso_pu_bacteria 2969079654 2969084003 235
925 iso_pu_bacteria 2971820967 2971825479 235
926 iso_pu_bacteria 2974310843 2974313500 235
927 iso_pu_bacteria 2974435778 2974437081 235
928 iso_pu_bacteria 2984559226 2984561080 235
929 iso_pu_bacteria 2984568884 2984570373 235
930 iso_pu_bacteria 2984595703 2984599153 235
931 iso_pu_bacteria 3000376612 3000380389 235
932 iso_pu_bacteria 639633007 639787153 235
933 iso_pu_bacteria 640753048 640939350 235
934 iso_pu_bacteria 8004592986 8004593170 235
935 iso_pu_bacteria 8015394850 8015396916 235
936 iso_pu_bacteria 8018221730 8018225262 235
937 iso_pu_bacteria 8018405270 8018410155 235
938 iso_pu_bacteria 8019504834 8019506953 235
939 iso_pu_bacteria 8033232454 8033233950 235
940 iso_pu_bacteria 8048746797 8048748404 235
941 iso_pu_bacteria 8055087960 8055092471 235
942 iso_pu_bacteria 8055092621 8055093670 235
943 iso_pu_bacteria 8055097453 8055100542 235
944 iso_pu_bacteria 8055693939 8055697405 235
945 iso_pu_bacteria 8055909800 8055913397 235
946 iso_pu_bacteria 8057304971 8057307211 235
947 3300001979 JGI24740J21852_10035369 JGI24740J21852_100353692 236
948 3300001989 JGI24739J22299_10007778 JGI24739J22299_100077782 236
949 3300001989 JGI24739J22299_10009567 JGI24739J22299_100095674 236
950 3300001990 JGI24737J22298_10026242 JGI24737J22298_100262423 236
951 3300002067 JGI24735J21928_10000304 JGI24735J21928_100003046 236
952 3300002067 JGI24735J21928_10000462 JGI24735J21928_1000046212 236
953 3300002075 JGI24738J21930_10012456 JGI24738J21930_100124562 236
954 3300002705 JGI25156J39149_1001040 JGI25156J39149_10010404 236
955 3300002705 JGI25156J39149_1001634 JGI25156J39149_10016342 236
956 3300003214 JGI25165J46597_1002348 JGI25165J46597_10023482 236
957 3300003354 JGI25160J50197_1000102 JGI25160J50197_100010211 236
958 3300003479 Ga0006556J51387_1030668 Ga0006556J51387_10306681 236
959 3300003567 Ga0006554J51385_1028769 Ga0006554J51385_10287692 236
960 3300003751 Ga0055538_1000002 Ga0055538_1000002534 236
961 3300003752 Ga0055539_1000002 Ga0055539_1000002534 236
962 3300003756 Ga0055533_1000004 Ga0055533_1000004534 236
963 3300003756 Ga0055533_1000235 Ga0055533_10002354 236
964 3300003758 Ga0055532_1000001 Ga0055532_1000001233 236
965 3300003759 Ga0055525_1000002 Ga0055525_1000002534 236
966 3300003760 Ga0055527_1000002 Ga0055527_1000002526 236
967 3300003761 Ga0055535_1000001 Ga0055535_1000001771 236
968 3300003762 Ga0055542_1000001 Ga0055542_1000001233 236
969 3300003763 Ga0055529_1000026 Ga0055529_100002651 236
970 3300003763 Ga0055529_1001316 Ga0055529_10013167 236
971 3300003790 Ga0055528_1003000 Ga0055528_10030003 236
972 3300003841 Ga0055541_1000002 Ga0055541_1000002309 236
973 3300005262 Ga0065165_1000848 Ga0065165_100084825 236
974 3300005293 Ga0065715_10009513 Ga0065715_100095132 236
975 3300005327 Ga0070658_10003785 Ga0070658_100037852 236
976 3300005335 Ga0070666_10026070 Ga0070666_100260702 236
977 3300005339 Ga0070660_100000046 Ga0070660_10000004670 236
978 3300005356 Ga0070674_100094515 Ga0070674_1000945152 236
979 3300005364 Ga0070673_100188295 Ga0070673_1001882953 236
980 3300005455 Ga0070663_100018600 Ga0070663_1000186003 236
981 3300005548 Ga0070665_100197511 Ga0070665_1001975112 236
982 3300005563 Ga0068855_100001741 Ga0068855_10000174116 236
983 3300005563 Ga0068855_100039740 Ga0068855_1000397406 236
984 3300005564 Ga0070664_100072980 Ga0070664_1000729801 236
985 3300005578 Ga0068854_100011136 Ga0068854_1000111364 236
986 3300005616 Ga0068852_100052466 Ga0068852_1000524663 236
987 3300005842 Ga0068858_100266933 Ga0068858_1002669332 236
988 3300006175 Ga0070712_100089568 Ga0070712_1000895682 236
989 3300009092 Ga0105250_10029331 Ga0105250_100293312 236
990 3300009093 Ga0105240_10065376 Ga0105240_100653763 236
991 3300009093 Ga0105240_10169689 Ga0105240_101696892 236
992 3300009545 Ga0105237_10015121 Ga0105237_100151214 236
993 3300009545 Ga0105237_10121127 Ga0105237_101211272 236
994 3300009551 Ga0105238_10000977 Ga0105238_1000097715 236
995 3300010375 Ga0105239_10022568 Ga0105239_100225682 236
996 3300010375 Ga0105239_10195897 Ga0105239_101958972 236
997 3300013105 Ga0157369_10009691 Ga0157369_100096915 236
998 3300013105 Ga0157369_10047494 Ga0157369_100474942 236
999 3300013306 Ga0163162_10008076 Ga0163162_100080763 236
1000 3300013307 Ga0157372_10126293 Ga0157372_101262931 236
1001 3300015262 Ga0182007_10000581 Ga0182007_100005815 236
1002 3300015265 Ga0182005_1064419 Ga0182005_10644192 236
1003 3300016635 Ga0183361_10006 Ga0183361_10006177 236
1004 3300021361 Ga0213872_10042905 Ga0213872_100429052 236
1005 3300025224 Ga0209784_100002 Ga0209784_100002760 236
1006 3300025225 Ga0209566_100003 Ga0209566_100003760 236
1007 3300025225 Ga0209566_100504 Ga0209566_1005046 236
1008 3300025226 Ga0209674_100004 Ga0209674_100004760 236
1009 3300025226 Ga0209674_100005 Ga0209674_100005603 236
1010 3300025226 Ga0209674_101381 Ga0209674_1013813 236
1011 3300025228 Ga0209672_100001 Ga0209672_1000011065 236
1012 3300025228 Ga0209672_100014 Ga0209672_100014168 236
1013 3300025228 Ga0209672_100023 Ga0209672_100023204 236
1014 3300025229 Ga0209147_100001 Ga0209147_1000011065 236
1015 3300025229 Ga0209147_100094 Ga0209147_100094138 236
1016 3300025229 Ga0209147_100104 Ga0209147_100104113 236
1017 3300025230 Ga0209563_100006 Ga0209563_100006760 236
1018 3300025230 Ga0209563_100468 Ga0209563_1004684 236
1019 3300025242 Ga0209258_100001 Ga0209258_1000011065 236
1020 3300025242 Ga0209258_100040 Ga0209258_100040337 236
1021 3300025242 Ga0209258_100142 Ga0209258_100142127 236
1022 3300025253 Ga0209677_100003 Ga0209677_100003760 236
1023 3300025254 Ga0209148_1000003 Ga0209148_10000031065 236
1024 3300025254 Ga0209148_1000035 Ga0209148_1000035337 236
1025 3300025254 Ga0209148_1002027 Ga0209148_10020273 236
1026 3300025256 Ga0209759_1000030 Ga0209759_100003072 236
1027 3300025256 Ga0209759_1000260 Ga0209759_100026051 236
1028 3300025256 Ga0209759_1001844 Ga0209759_10018449 236
1029 3300025261 Ga0209233_1000016 Ga0209233_100001625 236
1030 3300025272 Ga0209455_1000001 Ga0209455_10000011065 236
1031 3300025272 Ga0209455_1000072 Ga0209455_1000072115 236
1032 3300025272 Ga0209455_1009709 Ga0209455_10097092 236
1033 3300025273 Ga0209673_1000140 Ga0209673_10001403 236
1034 3300025295 Ga0209564_1022747 Ga0209564_10227472 236
1035 3300025302 Ga0207426_1000125 Ga0207426_1000125136 236
1036 3300025711 Ga0207696_1021964 Ga0207696_10219642 236
1037 3300025735 Ga0207713_1000252 Ga0207713_10002523 236
1038 3300025735 Ga0207713_1000864 Ga0207713_10008644 236
1039 3300025903 Ga0207680_10146406 Ga0207680_101464062 236
1040 3300025904 Ga0207647_10000498 Ga0207647_100004984 236
1041 3300025913 Ga0207695_10000926 Ga0207695_1000092647 236
1042 3300025913 Ga0207695_10081775 Ga0207695_100817752 236
1043 3300025914 Ga0207671_10026114 Ga0207671_100261142 236
1044 3300025914 Ga0207671_10052850 Ga0207671_100528502 236
1045 3300025915 Ga0207693_10097305 Ga0207693_100973052 236
1046 3300025919 Ga0207657_10000004 Ga0207657_1000000455 236
1047 3300025924 Ga0207694_10008234 Ga0207694_100082343 236
1048 3300025924 Ga0207694_10029080 Ga0207694_100290802 236
1049 3300025937 Ga0207669_10096727 Ga0207669_100967272 236
1050 3300025940 Ga0207691_10071826 Ga0207691_100718262 236
1051 3300025949 Ga0207667_10000036 Ga0207667_1000003633 236
1052 3300025949 Ga0207667_10011537 Ga0207667_100115379 236
1053 3300025960 Ga0207651_10126061 Ga0207651_101260614 236
1054 3300025981 Ga0207640_10010935 Ga0207640_100109354 236
1055 3300026067 Ga0207678_10003926 Ga0207678_100039263 236
1056 3300026067 Ga0207678_10173808 Ga0207678_101738082 236
1057 3300026067 Ga0207678_10341463 Ga0207678_103414632 236
1058 3300026116 Ga0207674_10144921 Ga0207674_101449213 236
1059 3300026142 Ga0207698_10028347 Ga0207698_100283475 236
1060 3300027312 Ga0209371_1000079 Ga0209371_100007985 236
1061 3300028379 Ga0268266_10098585 Ga0268266_100985852 236
1062 3300028800 Ga0265338_10000028 Ga0265338_10000028127 236
1063 3300030500 Ga0268256_1000090 Ga0268256_100009088 236
1064 3300031238 Ga0265332_10007434 Ga0265332_100074345 236
1065 3300031507 Ga0307509_10225497 Ga0307509_102254972 236
1066 3300031548 Ga0307408_100005566 Ga0307408_1000055664 236
1067 3300031911 Ga0307412_10000021 Ga0307412_10000021174 236
1068 3300031911 Ga0307412_10419582 Ga0307412_104195822 236
1069 3300035724 Ga0373933_0084980 Ga0373933_0084980_826_1665 236
1070 3300037471 Ga0395905_0000459 Ga0395905_0000459_11733_12560 236
1071 3300039447 Ga0436361_0091859 Ga0436361_0091859_2138_2971 236
1072 3300039447 Ga0436361_0624331 Ga0436361_0624331_1652_2479 236
1073 3300044666 Ga0466977_0016580 Ga0466977_0016580_766_1593 236
1074 3300044684 Ga0466966_0291233 Ga0466966_0291233_123_950 236
1075 3300046454 Ga0495592_0010535 Ga0495592_0010535_5648_6475 236
1076 3300046454 Ga0495592_0021747 Ga0495592_0021747_2517_3344 236
1077 3300046455 Ga0495603_0007351 Ga0495603_0007351_625_1452 236
1078 3300046455 Ga0495603_0106439 Ga0495603_0106439_348_1175 236
1079 3300046457 Ga0495590_0005435 Ga0495590_0005435_2545_3372 236
1080 3300046458 Ga0495591_029225 Ga0495591_029225_812_1639 236
1081 3300046459 Ga0495629_0000172 Ga0495629_0000172_13176_14003 236
1082 3300046459 Ga0495629_0000506 Ga0495629_0000506_18778_19605 236
1083 3300046459 Ga0495629_0002744 Ga0495629_0002744_12017_12844 236
1084 3300046462 Ga0495651_0017252 Ga0495651_0017252_339_1166 236
1085 3300046463 Ga0495653_0019400 Ga0495653_0019400_4427_5335 236
1086 3300046463 Ga0495653_0030155 Ga0495653_0030155_606_1433 236
1087 3300046463 Ga0495653_0043631 Ga0495653_0043631_743_1570 236
1088 3300046471 Ga0495650_0007870 Ga0495650_0007870_413_1240 236
1089 3300046471 Ga0495650_0078939 Ga0495650_0078939_361_1188 236
1090 3300046472 Ga0495580_0002910 Ga0495580_0002910_3346_4173 236
1091 3300046472 Ga0495580_0018014 Ga0495580_0018014_3973_4800 236
1092 3300046472 Ga0495580_0059891 Ga0495580_0059891_14_841 236
1093 3300046473 Ga0495582_0189132 Ga0495582_0189132_227_1054 236
1094 3300046474 Ga0495605_0003771 Ga0495605_0003771_183_1010 236
1095 3300046474 Ga0495605_0032897 Ga0495605_0032897_511_1338 236
1096 3300046476 Ga0495662_0067007 Ga0495662_0067007_256_1083 236
1097 3300046477 Ga0495664_0021769 Ga0495664_0021769_424_1251 236
1098 3300046477 Ga0495664_0073651 Ga0495664_0073651_306_1133 236
1099 3300046506 Ga0495583_0012014 Ga0495583_0012014_1030_1857 236
1100 3300046507 Ga0495606_0005502 Ga0495606_0005502_259_1086 236
1101 3300046507 Ga0495606_0025325 Ga0495606_0025325_2575_3402 236
1102 3300046511 Ga0495608_0006938 Ga0495608_0006938_5355_6263 236
1103 3300046512 Ga0495610_0001938 Ga0495610_0001938_9383_10210 236
1104 3300046516 Ga0495628_0012653 Ga0495628_0012653_1798_2625 236
1105 3300046516 Ga0495628_0088195 Ga0495628_0088195_828_1655 236
1106 3300046517 Ga0495630_0095077 Ga0495630_0095077_383_1210 236
1107 3300046517 Ga0495630_0165145 Ga0495630_0165145_679_1506 236
1108 3300046517 Ga0495630_0176096 Ga0495630_0176096_575_1402 236
1109 3300046524 Ga0495648_0051755 Ga0495648_0051755_643_1470 236
1110 3300046524 Ga0495648_0070358 Ga0495648_0070358_461_1288 236
1111 3300046526 Ga0495666_0000427 Ga0495666_0000427_17124_17951 236
1112 3300046528 Ga0495642_0117975 Ga0495642_0117975_15_842 236
1113 3300046529 Ga0495652_0043262 Ga0495652_0043262_2903_3811 236
1114 3300046531 Ga0495665_0059385 Ga0495665_0059385_134_961 236
1115 3300046531 Ga0495665_0065258 Ga0495665_0065258_99_1007 236
1116 3300046531 Ga0495665_0086174 Ga0495665_0086174_187_1014 236
1117 3300046533 Ga0495640_0093109 Ga0495640_0093109_650_1477 236
1118 3300046535 Ga0495586_0004311 Ga0495586_0004311_3609_4436 236
1119 3300046535 Ga0495586_0125013 Ga0495586_0125013_488_1315 236
1120 3300046542 Ga0495597_0003154 Ga0495597_0003154_5966_6793 236
1121 3300046543 Ga0495645_0000357 Ga0495645_0000357_25270_26097 236
1122 3300046557 Ga0495622_0000551 Ga0495622_0000551_480_1307 236
1123 3300046642 Ga0495634_0029934 Ga0495634_0029934_2376_3203 236
1124 3300046663 Ga0495635_0005954 Ga0495635_0005954_583_1410 236
1125 3300046663 Ga0495635_0030228 Ga0495635_0030228_2788_3696 236
1126 3300046675 Ga0495657_0115803 Ga0495657_0115803_581_1408 236
1127 3300046678 Ga0495599_0087493 Ga0495599_0087493_246_1073 236
1128 3300046678 Ga0495599_0095101 Ga0495599_0095101_963_1790 236
1129 3300046679 Ga0495623_0020310 Ga0495623_0020310_736_1563 236
1130 3300046679 Ga0495623_0109472 Ga0495623_0109472_70_978 236
1131 3300046680 Ga0495646_0009887 Ga0495646_0009887_791_1699 236
1132 3300046684 Ga0495669_0066699 Ga0495669_0066699_18_845 236
1133 3300046689 Ga0495613_0003580 Ga0495613_0003580_7923_8750 236
1134 3300046690 Ga0495624_0004787 Ga0495624_0004787_7337_8164 236
1135 3300046690 Ga0495624_0110253 Ga0495624_0110253_215_1123 236
1136 3300046694 Ga0495649_0055457 Ga0495649_0055457_580_1407 236
1137 3300046694 Ga0495649_0120694 Ga0495649_0120694_296_1123 236
1138 3300046794 Ga0495589_0012497 Ga0495589_0012497_2352_3179 236
1139 3300046794 Ga0495589_0013954 Ga0495589_0013954_2010_2837 236
1140 3300046809 Ga0495600_0146905 Ga0495600_0146905_174_1001 236
1141 3300047317 Ga0495604_0036410 Ga0495604_0036410_2309_3217 236
1142 3300047317 Ga0495604_0038131 Ga0495604_0038131_2461_3288 236
1143 3300047317 Ga0495604_0057846 Ga0495604_0057846_555_1382 236
1144 3300047319 Ga0495674_0008069 Ga0495674_0008069_8420_9247 236
1145 3300047319 Ga0495674_0048438 Ga0495674_0048438_1745_2572 236
1146 3300047319 Ga0495674_0092897 Ga0495674_0092897_51_878 236
1147 3300047319 Ga0495674_0188638 Ga0495674_0188638_552_1379 236
1148 3300047319 Ga0495674_0194483 Ga0495674_0194483_292_1200 236
1149 3300047319 Ga0495674_0321061 Ga0495674_0321061_59_886 236
1150 3300047320 Ga0495672_0003268 Ga0495672_0003268_474_1301 236
1151 3300047320 Ga0495672_0037296 Ga0495672_0037296_348_1175 236
1152 3300047320 Ga0495672_0048418 Ga0495672_0048418_225_1052 236
1153 3300047321 Ga0495676_0266921 Ga0495676_0266921_242_1069 236
1154 3300047322 Ga0495680_0018438 Ga0495680_0018438_2582_3490 236
1155 3300047323 Ga0495683_0035521 Ga0495683_0035521_1260_2168 236
1156 3300047323 Ga0495683_0072097 Ga0495683_0072097_178_1005 236
1157 3300047443 Ga0495687_008170 Ga0495687_008170_4114_4941 236
1158 3300047443 Ga0495687_038829 Ga0495687_038829_843_1751 236
1159 3300047443 Ga0495687_101599 Ga0495687_101599_189_1016 236
1160 3300047444 Ga0495675_0019316 Ga0495675_0019316_2989_3816 236
1161 3300047446 Ga0495679_000214 Ga0495679_000214_17076_17903 236
1162 3300047469 Ga0495673_0061029 Ga0495673_0061029_532_1359 236
1163 3300047472 Ga0495686_0000002 Ga0495686_0000002_761101_761928 236
1164 3300048088 Ga0495602_0032598 Ga0495602_0032598_59_886 236
1165 3300048088 Ga0495602_0059754 Ga0495602_0059754_1981_2808 236
1166 3300048088 Ga0495602_0085305 Ga0495602_0085305_1538_2446 236
1167 3300048088 Ga0495602_0122900 Ga0495602_0122900_643_1470 236
1168 3300048088 Ga0495602_0142272 Ga0495602_0142272_20_847 236
1169 3300048089 Ga0495614_0035946 Ga0495614_0035946_59_886 236
1170 3300048903 Ga0496100_0002406 Ga0496100_0002406_5651_6478 236
1171 3300048903 Ga0496100_0119378 Ga0496100_0119378_294_1121 236
1172 3300048904 Ga0496101_0001779 Ga0496101_0001779_758_1585 236
1173 3300048904 Ga0496101_0238945 Ga0496101_0238945_309_1136 236
1174 3300048905 Ga0496102_0001049 Ga0496102_0001049_12354_13181 236
1175 3300048905 Ga0496102_0005053 Ga0496102_0005053_5857_6684 236
1176 3300048906 Ga0496103_0002203 Ga0496103_0002203_5766_6593 236
1177 3300048906 Ga0496103_0003261 Ga0496103_0003261_221_1048 236
1178 3300048906 Ga0496103_0053524 Ga0496103_0053524_1657_2484 236
1179 3300048907 Ga0496104_0045619 Ga0496104_0045619_769_1596 236
1180 3300048908 Ga0496105_0167086 Ga0496105_0167086_751_1578 236
1181 3300048909 Ga0496106_0003051 Ga0496106_0003051_5395_6222 236
1182 3300048910 Ga0496107_0029551 Ga0496107_0029551_292_1119 236
1183 3300048912 Ga0496109_0605821 Ga0496109_0605821_71_898 236
1184 3300048913 Ga0496110_0003569 Ga0496110_0003569_10043_10870 236
1185 3300048914 Ga0496111_0036636 Ga0496111_0036636_1302_2129 236
1186 3300048915 Ga0496112_0016390 Ga0496112_0016390_5459_6286 236
1187 3300048916 Ga0496113_0002808 Ga0496113_0002808_7043_7870 236
1188 3300048919 Ga0496116_0067029 Ga0496116_0067029_594_1421 236
1189 3300048920 Ga0496117_0000589 Ga0496117_0000589_23262_24089 236
1190 3300048920 Ga0496117_0071738 Ga0496117_0071738_974_1801 236
1191 3300048920 Ga0496117_0114786 Ga0496117_0114786_393_1220 236
1192 3300048920 Ga0496117_0122632 Ga0496117_0122632_684_1511 236
1193 3300048921 Ga0496118_0000760 Ga0496118_0000760_29955_30782 236
1194 3300048921 Ga0496118_0002012 Ga0496118_0002012_14766_15593 236
1195 3300048921 Ga0496118_0026170 Ga0496118_0026170_3716_4543 236
1196 3300048921 Ga0496118_0062401 Ga0496118_0062401_1743_2570 236
1197 3300048922 Ga0496119_0129734 Ga0496119_0129734_475_1302 236
1198 3300048924 Ga0496121_0002856 Ga0496121_0002856_11806_12633 236
1199 3300048924 Ga0496121_0006525 Ga0496121_0006525_6604_7431 236
1200 3300048924 Ga0496121_0013134 Ga0496121_0013134_5106_5933 236
1201 3300048925 Ga0496122_0002190 Ga0496122_0002190_7853_8680 236
1202 3300048926 Ga0496123_0008961 Ga0496123_0008961_557_1384 236
1203 3300048927 Ga0496124_0018274 Ga0496124_0018274_685_1512 236
1204 3300048928 Ga0496125_0078172 Ga0496125_0078172_503_1330 236
1205 3300049460 Ga0495682_0016024 Ga0495682_0016024_136_963 236
1206 3300050515 nmdc:mga0a205_366292_c1 nmdc:mga0a205_366292_c1_203_1033 236
1207 3300053103 Ga0500555_050912 Ga0500555_050912_177_1022 236
1208 3300059643 Ga0587072_042043 Ga0587072_042043_50_877 236
1209 iso_pu_bacteria 2513020051 2513228729 236
1210 iso_pu_bacteria 2547132374 2548497500 236
1211 iso_pu_bacteria 2585428057 2587729188 236
1212 iso_pu_bacteria 2585428058 2587734739 236
1213 iso_pu_bacteria 2588253510 2588293527 236
1214 iso_pu_bacteria 2599185214 2599623704 236
1215 iso_pu_bacteria 2599185226 2599671677 236
1216 iso_pu_bacteria 2599185227 2599681310 236
1217 iso_pu_bacteria 2599185229 2599693287 236
1218 iso_pu_bacteria 2599185292 2599904965 236
1219 iso_pu_bacteria 2643221556 2643802275 236
1220 iso_pu_bacteria 2643221569 2643860398 236
1221 iso_pu_bacteria 2643221592 2643971624 236
1222 iso_pu_bacteria 2643221594 2643981746 236
1223 iso_pu_bacteria 2643221596 2643993191 236
1224 iso_pu_bacteria 2643221609 2644061856 236
1225 iso_pu_bacteria 2643221611 2644073561 236
1226 iso_pu_bacteria 2643221621 2644119866 236
1227 iso_pu_bacteria 2643221625 2644141867 236
1228 iso_pu_bacteria 2643221628 2644159622 236
1229 iso_pu_bacteria 2643221648 2644275801 236
1230 iso_pu_bacteria 2643221652 2644294218 236
1231 iso_pu_bacteria 2643221658 2644327647 236
1232 iso_pu_bacteria 2643221660 2644337903 236
1233 iso_pu_bacteria 2643221672 2644401449 236
1234 iso_pu_bacteria 2643221683 2644468192 236
1235 iso_pu_bacteria 2643221684 2644475783 236
1236 iso_pu_bacteria 2643221717 2644647379 236
1237 iso_pu_bacteria 2734482258 2735817300 236
1238 iso_pu_bacteria 2738541277 2738717765 236
1239 iso_pu_bacteria 2738541307 2738879376 236
1240 iso_pu_bacteria 2738543012 2739243004 236
1241 iso_pu_bacteria 2738543013 2739250649 236
1242 iso_pu_bacteria 2738543019 2739278451 236
1243 iso_pu_bacteria 2739367655 2739612898 236
1244 iso_pu_bacteria 2808606395 2809035650 236
1245 iso_pu_bacteria 2808606418 2809145326 236
1246 iso_pu_bacteria 2816332133 2816473305 236
1247 iso_pu_bacteria 2818991446 2819597248 236
1248 iso_pu_bacteria 2831265667 2831266374 236
1249 iso_pu_bacteria 2838054893 2838057505 236
1250 iso_pu_bacteria 2842677519 2842679944 236
1251 iso_pu_bacteria 2842733646 2842736747 236
1252 iso_pu_bacteria 2842747753 2842747834 236
1253 iso_pu_bacteria 2855195626 2855197869 236
1254 iso_pu_bacteria 2855730933 2855732524 236
1255 iso_pu_bacteria 2855767633 2855769232 236
1256 iso_pu_bacteria 2857537821 2857539078 236
1257 iso_pu_bacteria 2857542790 2857546943 236
1258 iso_pu_bacteria 2858466076 2858469798 236
1259 iso_pu_bacteria 2858950400 2858956101 236
1260 iso_pu_bacteria 2871272651 2871276870 236
1261 iso_pu_bacteria 2871282230 2871284048 236
1262 iso_pu_bacteria 2881412998 2881414876 236
1263 iso_pu_bacteria 2881927736 2881928133 236
1264 iso_pu_bacteria 2885192300 2885192670 236
1265 iso_pu_bacteria 2885198086 2885204508 236
1266 iso_pu_bacteria 2885211737 2885218161 236
1267 iso_pu_bacteria 2887375801 2887379252 236
1268 iso_pu_bacteria 2894023352 2894025649 236
1269 iso_pu_bacteria 2899924645 2899924755 236
1270 iso_pu_bacteria 2900051742 2900054399 236
1271 iso_pu_bacteria 2904449895 2904454405 236
1272 iso_pu_bacteria 2904456579 2904461152 236
1273 iso_pu_bacteria 2904541872 2904548265 236
1274 iso_pu_bacteria 2928037797 2928039119 236
1275 iso_pu_bacteria 2928044640 2928045276 236
1276 iso_pu_bacteria 2928051484 2928053081 236
1277 iso_pu_bacteria 2928064002 2928064248 236
1278 iso_pu_bacteria 2928070936 2928071677 236
1279 iso_pu_bacteria 2928084124 2928084373 236
1280 iso_pu_bacteria 2928115317 2928121284 236
1281 iso_pu_bacteria 2929160207 2929163255 236
1282 iso_pu_bacteria 2929520902 2929527034 236
1283 iso_pu_bacteria 2932422444 2932423456 236
1284 iso_pu_bacteria 2939631187 2939631511 236
1285 iso_pu_bacteria 2945909444 2945911686 236
1286 iso_pu_bacteria 2945945610 2945948112 236
1287 iso_pu_bacteria 2945972063 2945977194 236
1288 iso_pu_bacteria 2945984333 2945986018 236
1289 iso_pu_bacteria 2954767861 2954772279 236
1290 iso_pu_bacteria 2974320154 2974323566 236
1291 iso_pu_bacteria 2990710928 2990712372 236
1292 iso_pu_bacteria 8047673197 8047673867 236
1293 iso_pu_bacteria 8055225921 8055228253 236
1294 3300021361 Ga0213872_10016214 Ga0213872_100162144 237
1295 3300028381 Ga0268264_10710253 Ga0268264_107102531 237
1296 3300037471 Ga0395905_0014764 Ga0395905_0014764_183_1022 237
1297 3300039447 Ga0436361_0247137 Ga0436361_0247137_1588_2427 237
1298 3300047317 Ga0495604_0072862 Ga0495604_0072862_1305_2132 237
1299 3300048924 Ga0496121_0036376 Ga0496121_0036376_2761_3615 237
1300 3300049589 Ga0501073_0099000 Ga0501073_0099000_10_831 237
1301 3300049649 Ga0501198_000015 Ga0501198_000015_56734_57555 237
1302 3300049662 Ga0501222_000045 Ga0501222_000045_1007_1828 237
1303 3300053108 Ga0500562_001011 Ga0500562_001011_4126_4977 237
1304 3300060353 Ga0501082_0012597 Ga0501082_0012597_1032_1853 237
1305 iso_pu_bacteria 2501025502 2501080633 237
1306 iso_pu_bacteria 2501025504 2501410656 237
1307 iso_pu_bacteria 2508501125 2509131232 237
1308 iso_pu_bacteria 2510065045 2510251395 237
1309 iso_pu_bacteria 2510917013 2511086914 237
1310 iso_pu_bacteria 2510917014 2511096882 237
1311 iso_pu_bacteria 2510917015 2511103691 237
1312 iso_pu_bacteria 2511231002 2511245906 237
1313 iso_pu_bacteria 2512047030 2512345668 237
1314 iso_pu_bacteria 2513237082 2513553847 237
1315 iso_pu_bacteria 2513237083 2513564790 237
1316 iso_pu_bacteria 2513237150 2513955186 237
1317 iso_pu_bacteria 2513237151 2513961950 237
1318 iso_pu_bacteria 2513237165 2514043672 237
1319 iso_pu_bacteria 2513237166 2514051837 237
1320 iso_pu_bacteria 2515154122 2515680936 237
1321 iso_pu_bacteria 2515154123 2515689926 237
1322 iso_pu_bacteria 2515154189 2516019359 237
1323 iso_pu_bacteria 2519103095 2519459075 237
1324 iso_pu_bacteria 2522572158 2523104322 237
1325 iso_pu_bacteria 2526164713 2527075360 237
1326 iso_pu_bacteria 2562617112 2563058721 237
1327 iso_pu_bacteria 2582581311 2585291408 237
1328 iso_pu_bacteria 2596583598 2597028529 237
1329 iso_pu_bacteria 2597490356 2599105222 237
1330 iso_pu_bacteria 2599185178 2599444548 237
1331 iso_pu_bacteria 2599185239 2599736677 237
1332 iso_pu_bacteria 2599185240 2599744732 237
1333 iso_pu_bacteria 2599185355 2600205907 237
1334 iso_pu_bacteria 2600255067 2600809443 237
1335 iso_pu_bacteria 2600255292 2601667599 237
1336 iso_pu_bacteria 2643221603 2644027287 237
1337 iso_pu_bacteria 2643221645 2644254323 237
1338 iso_pu_bacteria 2643221664 2644358009 237
1339 iso_pu_bacteria 2675903129 2676742858 237
1340 iso_pu_bacteria 2711768613 2713476630 237
1341 iso_pu_bacteria 2718217991 2719640510 237
1342 iso_pu_bacteria 2721755763 2723877450 237
1343 iso_pu_bacteria 2738541280 2738741141 237
1344 iso_pu_bacteria 2738541296 2738818425 237
1345 iso_pu_bacteria 2738541297 2738829324 237
1346 iso_pu_bacteria 2738541298 2738831418 237
1347 iso_pu_bacteria 2738541300 2738845607 237
1348 iso_pu_bacteria 2738541306 2738872946 237
1349 iso_pu_bacteria 2738541357 2739153120 237
1350 iso_pu_bacteria 2738543002 2739184576 237
1351 iso_pu_bacteria 2738543003 2739195040 237
1352 iso_pu_bacteria 2738543008 2739219545 237
1353 iso_pu_bacteria 2738543018 2739276664 237
1354 iso_pu_bacteria 2738543026 2739321516 237
1355 iso_pu_bacteria 2738543029 2739339928 237
1356 iso_pu_bacteria 2738543030 2739345708 237
1357 iso_pu_bacteria 2744054900 2746085785 237
1358 iso_pu_bacteria 2744054901 2746096223 237
1359 iso_pu_bacteria 2791355137 2792835963 237
1360 iso_pu_bacteria 2808606384 2808972415 237
1361 iso_pu_bacteria 2808606390 2809007244 237
1362 iso_pu_bacteria 2808606391 2809014382 237
1363 iso_pu_bacteria 2816332253 2817261363 237
1364 iso_pu_bacteria 2816332256 2817279040 237
1365 iso_pu_bacteria 2816332286 2817451236 237
1366 iso_pu_bacteria 2818991436 2819542811 237
1367 iso_pu_bacteria 2818991450 2819622795 237
1368 iso_pu_bacteria 2818991452 2819631161 237
1369 iso_pu_bacteria 2821131069 2821131494 237
1370 iso_pu_bacteria 2834641062 2834642749 237
1371 iso_pu_bacteria 2842324504 2842327929 237
1372 iso_pu_bacteria 2842348783 2842352246 237
1373 iso_pu_bacteria 2842454564 2842458599 237
1374 iso_pu_bacteria 2842711865 2842714151 237
1375 iso_pu_bacteria 2846952575 2846955099 237
1376 iso_pu_bacteria 2848858292 2848858608 237
1377 iso_pu_bacteria 2856287931 2856294322 237
1378 iso_pu_bacteria 2857357740 2857367579 237
1379 iso_pu_bacteria 2857547612 2857551680 237
1380 iso_pu_bacteria 2857553236 2857554384 237
1381 iso_pu_bacteria 2857558681 2857559985 237
1382 iso_pu_bacteria 2857564685 2857564847 237
1383 iso_pu_bacteria 2858688981 2858699869 237
1384 iso_pu_bacteria 2863421361 2863424737 237
1385 iso_pu_bacteria 2870068957 2870070973 237
1386 iso_pu_bacteria 2883087390 2883092953 237
1387 iso_pu_bacteria 2885080285 2885086361 237
1388 iso_pu_bacteria 2885266251 2885267125 237
1389 iso_pu_bacteria 2885270888 2885275450 237
1390 iso_pu_bacteria 2900577576 2900578695 237
1391 iso_pu_bacteria 2900634093 2900634371 237
1392 iso_pu_bacteria 2901300506 2901301120 237
1393 iso_pu_bacteria 2902682994 2902683608 237
1394 iso_pu_bacteria 2904424332 2904426128 237
1395 iso_pu_bacteria 2904483920 2904484682 237
1396 iso_pu_bacteria 2904564687 2904571545 237
1397 iso_pu_bacteria 2904571731 2904575984 237
1398 iso_pu_bacteria 2904615490 2904624096 237
1399 iso_pu_bacteria 2919476304 2919478512 237
1400 iso_pu_bacteria 2919527303 2919531356 237
1401 iso_pu_bacteria 2921643360 2921649577 237
1402 iso_pu_bacteria 2928058823 2928062545 237
1403 iso_pu_bacteria 2928108538 2928113321 237
1404 iso_pu_bacteria 2928135762 2928140480 237
1405 iso_pu_bacteria 2928157003 2928162997 237
1406 iso_pu_bacteria 2928163908 2928169659 237
1407 iso_pu_bacteria 2928170801 2928171721 237
1408 iso_pu_bacteria 2928503688 2928507437 237
1409 iso_pu_bacteria 2928536128 2928539877 237
1410 iso_pu_bacteria 2932410948 2932411202 237
1411 iso_pu_bacteria 2932416698 2932419231 237
1412 iso_pu_bacteria 2945934425 2945937136 237
1413 iso_pu_bacteria 2981990288 2981994808 237
1414 iso_pu_bacteria 2990703756 2990706129 237
1415 iso_pu_bacteria 641736154 642420217 237
1416 iso_pu_bacteria 642555112 642593126 237
1417 iso_pu_bacteria 642555113 642622021 237
1418 iso_pu_bacteria 644736347 644748008 237
1419 iso_pu_bacteria 8003400568 8003401527 237
1420 iso_pu_bacteria 8003955200 8003961196 237
1421 iso_pu_bacteria 8018845410 8018851361 237
1422 iso_pu_bacteria 8020807995 8020810207 237
1423 iso_pu_bacteria 8020938398 8020945015 237
1424 iso_pu_bacteria 8020945358 8020951409 237
1425 iso_pu_bacteria 8020953355 8020956948 237
1426 iso_pu_bacteria 8021120328 8021122198 237
1427 iso_pu_bacteria 8039098773 8039102557 237
1428 iso_pu_bacteria 8040167225 8040168788 237
1429 iso_pu_bacteria 8040173305 8040174714 237
1430 iso_pu_bacteria 8055266321 8055267638 237
1431 iso_pu_bacteria 8055301274 8055302205 237
1432 3300005435 Ga0070714_100003461 Ga0070714_1000034614 238
1433 3300025929 Ga0207664_10005455 Ga0207664_100054559 238
1434 iso_pu_bacteria 2511231003 2511247732 238
1435 iso_pu_bacteria 2511231026 2511388090 238
1436 iso_pu_bacteria 2521172590 2521558119 238
1437 iso_pu_bacteria 2526164512 2526213499 238
1438 iso_pu_bacteria 2548876994 2550692910 238
1439 iso_pu_bacteria 2551306416 2553003246 238
1440 iso_pu_bacteria 2643221654 2644305184 238
1441 iso_pu_bacteria 2765235838 2765569252 238
1442 iso_pu_bacteria 2808606386 2808983882 238
1443 iso_pu_bacteria 2808606415 2809130942 238
1444 iso_pu_bacteria 2808606419 2809150723 238
1445 iso_pu_bacteria 2818991445 2819593239 238
1446 iso_pu_bacteria 2818991449 2819614736 238
1447 iso_pu_bacteria 2839094727 2839095862 238
1448 iso_pu_bacteria 2852618963 2852622240 238
1449 iso_pu_bacteria 2884811622 2884812508 238
1450 iso_pu_bacteria 2884836552 2884838139 238
1451 iso_pu_bacteria 2884852848 2884854432 238
1452 iso_pu_bacteria 2896154374 2896154452 238
1453 iso_pu_bacteria 2904439833 2904441105 238
1454 iso_pu_bacteria 2904530477 2904531952 238
1455 iso_pu_bacteria 2904584206 2904587822 238
1456 iso_pu_bacteria 2904589729 2904590018 238
1457 iso_pu_bacteria 2904601388 2904602594 238
1458 iso_pu_bacteria 2919046199 2919046584 238
1459 iso_pu_bacteria 2919079590 2919079900 238
1460 iso_pu_bacteria 2923510766 2923511368 238
1461 iso_pu_bacteria 2928130867 2928131300 238
1462 3300005355 Ga0070671_100187887 Ga0070671_1001878872 239
1463 3300005366 Ga0070659_100083127 Ga0070659_1000831272 239
1464 3300005563 Ga0068855_100026769 Ga0068855_1000267696 239
1465 3300009094 Ga0111539_10017857 Ga0111539_100178575 239
1466 3300025932 Ga0207690_10098960 Ga0207690_100989602 239
1467 3300025949 Ga0207667_10029744 Ga0207667_100297441 239
1468 3300026116 Ga0207674_10241613 Ga0207674_102416132 239
1469 3300031456 Ga0307513_10378038 Ga0307513_103780382 239
1470 3300031548 Ga0307408_100012826 Ga0307408_1000128265 239
1471 3300031731 Ga0307405_10165804 Ga0307405_101658042 239
1472 3300031901 Ga0307406_10012543 Ga0307406_100125435 239
1473 3300031911 Ga0307412_10005897 Ga0307412_100058973 239
1474 3300032002 Ga0307416_100010456 Ga0307416_1000104568 239
1475 3300035691 Ga0373931_0014996 Ga0373931_0014996_1285_2109 239
1476 3300046530 Ga0495654_0037660 Ga0495654_0037660_122_958 239
1477 3300048924 Ga0496121_0087799 Ga0496121_0087799_1324_2145 239
1478 3300049586 Ga0501070_0106873 Ga0501070_0106873_186_1028 239
1479 3300049663 Ga0501223_019752 Ga0501223_019752_159_995 239
1480 3300049686 Ga0501257_013553 Ga0501257_013553_939_1775 239
1481 3300049776 Ga0501280_001851 Ga0501280_001851_694_1530 239
1482 3300053087 Ga0500643_000372 Ga0500643_000372_6670_7512 239
1483 3300053087 Ga0500643_000839 Ga0500643_000839_13542_14378 239
1484 3300053116 Ga0500592_000173 Ga0500592_000173_7397_8233 239
1485 3300053134 Ga0500658_0019208 Ga0500658_0019208_1608_2444 239
1486 3300053158 Ga0500627_0001084 Ga0500627_0001084_2625_3461 239
1487 iso_pu_bacteria 2857576091 2857579465 239
1488 3300005530 Ga0070679_100319142 Ga0070679_1003191422 240
1489 3300013104 Ga0157370_10258120 Ga0157370_102581202 240
1490 3300025919 Ga0207657_10035316 Ga0207657_100353163 240
1491 3300027682 Ga0209971_1002887 Ga0209971_10028871 240
1492 3300027876 Ga0209974_10015038 Ga0209974_100150382 240
1493 iso_pu_bacteria 2501025501 2501070266 240
1494 iso_pu_bacteria 2751185846 2753566562 240
1495 iso_pu_bacteria 2904434214 2904438584 240
1496 3300001976 JGI24752J21851_1004205 JGI24752J21851_10042052 243
1497 3300001991 JGI24743J22301_10010713 JGI24743J22301_100107132 243
1498 3300005328 Ga0070676_10073195 Ga0070676_100731952 243
1499 3300005329 Ga0070683_100017131 Ga0070683_1000171314 243
1500 3300005330 Ga0070690_100107845 Ga0070690_1001078452 243
1501 3300005331 Ga0070670_100179598 Ga0070670_1001795981 243
1502 3300005333 Ga0070677_10003511 Ga0070677_100035114 243
1503 3300005334 Ga0068869_100087182 Ga0068869_1000871821 243
1504 3300005339 Ga0070660_100041917 Ga0070660_1000419173 243
1505 3300005340 Ga0070689_100011686 Ga0070689_1000116864 243
1506 3300005343 Ga0070687_100004224 Ga0070687_1000042242 243
1507 3300005347 Ga0070668_100185688 Ga0070668_1001856881 243
1508 3300005353 Ga0070669_100105277 Ga0070669_1001052772 243
1509 3300005356 Ga0070674_100024486 Ga0070674_1000244863 243
1510 3300005365 Ga0070688_100023760 Ga0070688_1000237601 243
1511 3300005441 Ga0070700_100005082 Ga0070700_1000050824 243
1512 3300005455 Ga0070663_100009438 Ga0070663_1000094386 243
1513 3300005459 Ga0068867_100079870 Ga0068867_1000798703 243
1514 3300005466 Ga0070685_10003093 Ga0070685_100030934 243
1515 3300005535 Ga0070684_100150710 Ga0070684_1001507103 243
1516 3300005544 Ga0070686_100035549 Ga0070686_1000355493 243
1517 3300005548 Ga0070665_100114056 Ga0070665_1001140562 243
1518 3300005564 Ga0070664_100038486 Ga0070664_1000384861 243
1519 3300005577 Ga0068857_100049862 Ga0068857_1000498623 243
1520 3300005578 Ga0068854_100025157 Ga0068854_1000251572 243
1521 3300005614 Ga0068856_100103691 Ga0068856_1001036913 243
1522 3300005616 Ga0068852_100378390 Ga0068852_1003783901 243
1523 3300005618 Ga0068864_100025688 Ga0068864_1000256883 243
1524 3300005718 Ga0068866_10001055 Ga0068866_100010556 243
1525 3300005834 Ga0068851_10117239 Ga0068851_101172392 243
1526 3300005840 Ga0068870_10004404 Ga0068870_100044043 243
1527 3300005841 Ga0068863_100180440 Ga0068863_1001804403 243
1528 3300005842 Ga0068858_100028665 Ga0068858_1000286654 243
1529 3300005843 Ga0068860_100039561 Ga0068860_1000395613 243
1530 3300005844 Ga0068862_100142493 Ga0068862_1001424931 243
1531 3300006237 Ga0097621_100504237 Ga0097621_1005042372 243
1532 3300006881 Ga0068865_100019463 Ga0068865_1000194633 243
1533 3300009094 Ga0111539_10008224 Ga0111539_100082242 243
1534 3300009176 Ga0105242_10038050 Ga0105242_100380504 243
1535 3300010375 Ga0105239_10291735 Ga0105239_102917351 243
1536 3300011119 Ga0105246_10194277 Ga0105246_101942772 243
1537 3300013104 Ga0157370_10000850 Ga0157370_1000085020 243
1538 3300013296 Ga0157374_10623742 Ga0157374_106237422 243
1539 3300013297 Ga0157378_10072572 Ga0157378_100725722 243
1540 3300013308 Ga0157375_10161243 Ga0157375_101612433 243
1541 3300014325 Ga0163163_10083221 Ga0163163_100832213 243
1542 3300014968 Ga0157379_10006759 Ga0157379_1000675910 243
1543 3300014969 Ga0157376_10302009 Ga0157376_103020092 243
1544 3300017792 Ga0163161_10009466 Ga0163161_100094663 243
1545 3300025271 Ga0207666_1002150 Ga0207666_10021502 243
1546 3300025315 Ga0207697_10000129 Ga0207697_100001293 243
1547 3300025321 Ga0207656_10011124 Ga0207656_100111242 243
1548 3300025893 Ga0207682_10000157 Ga0207682_1000015724 243
1549 3300025899 Ga0207642_10054369 Ga0207642_100543692 243
1550 3300025901 Ga0207688_10000508 Ga0207688_1000050815 243
1551 3300025903 Ga0207680_10030205 Ga0207680_100302052 243
1552 3300025907 Ga0207645_10001209 Ga0207645_1000120911 243
1553 3300025908 Ga0207643_10000883 Ga0207643_100008836 243
1554 3300025918 Ga0207662_10002138 Ga0207662_100021388 243
1555 3300025919 Ga0207657_10007145 Ga0207657_100071455 243
1556 3300025923 Ga0207681_10486921 Ga0207681_104869211 243
1557 3300025925 Ga0207650_10012131 Ga0207650_100121315 243
1558 3300025926 Ga0207659_10416329 Ga0207659_104163292 243
1559 3300025931 Ga0207644_10215812 Ga0207644_102158122 243
1560 3300025933 Ga0207706_10000928 Ga0207706_1000092811 243
1561 3300025936 Ga0207670_10249718 Ga0207670_102497181 243
1562 3300025937 Ga0207669_10005626 Ga0207669_100056264 243
1563 3300025938 Ga0207704_10094380 Ga0207704_100943802 243
1564 3300025940 Ga0207691_10039177 Ga0207691_100391772 243
1565 3300025941 Ga0207711_10024058 Ga0207711_100240583 243
1566 3300025942 Ga0207689_10003785 Ga0207689_100037853 243
1567 3300025944 Ga0207661_10073969 Ga0207661_100739692 243
1568 3300025945 Ga0207679_10572556 Ga0207679_105725562 243
1569 3300025972 Ga0207668_10057056 Ga0207668_100570562 243
1570 3300025981 Ga0207640_10110301 Ga0207640_101103012 243
1571 3300026067 Ga0207678_10006659 Ga0207678_100066593 243
1572 3300026075 Ga0207708_10002281 Ga0207708_1000228110 243
1573 3300026089 Ga0207648_10004444 Ga0207648_100044448 243
1574 3300026095 Ga0207676_10136478 Ga0207676_101364781 243
1575 3300026116 Ga0207674_10002032 Ga0207674_1000203217 243
1576 3300026118 Ga0207675_100012754 Ga0207675_1000127541 243
1577 3300026121 Ga0207683_10053360 Ga0207683_100533603 243
1578 3300028379 Ga0268266_10022948 Ga0268266_100229482 243
1579 3300035118 Ga0373954_0066196 Ga0373954_0066196_703_1533 243
1580 3300035172 Ga0373955_0081153 Ga0373955_0081153_149_979 243
1581 3300048904 Ga0496101_0135646 Ga0496101_0135646_905_1735 243
1582 3300048905 Ga0496102_0731416 Ga0496102_0731416_58_888 243
1583 3300048907 Ga0496104_0022546 Ga0496104_0022546_3731_4561 243
1584 3300048908 Ga0496105_0013612 Ga0496105_0013612_4239_5069 243
1585 3300048911 Ga0496108_0186218 Ga0496108_0186218_555_1385 243
1586 3300048912 Ga0496109_0006339 Ga0496109_0006339_5747_6577 243
1587 3300048913 Ga0496110_0016993 Ga0496110_0016993_2327_3157 243
1588 3300048917 Ga0496114_0025936 Ga0496114_0025936_2737_3567 243
1589 3300050511 nmdc:mga08y16_254065_c1 nmdc:mga08y16_254065_c1_491_1321 243

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14805

THDPS_N_2

Tetrahydrodipicolinate N-succinyltransferase N-terminal

24

90

0.99

PF00132

Hexapep

Bacterial transferase hexapeptide (six repeats)

197

232

0.95

PF14602

Hexapep_2

Hexapeptide repeat of succinyl-transferase

197

232

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6x3c-assembly2.cif.gz_B crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) 0.9414 147 204
3tk8-assembly1.cif.gz_B structure of a 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate n-succinyltransferase from burkholderia pseudomallei 0.9354 1 227
6ckt-assembly1.cif.gz_A crystal structure of 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate n-succinyltransferase from legionella pneumophila philadelphia 1 0.9346 1 242
1tdt-assembly1.cif.gz_C three-dimensional structure of tetrahydrodipicolinate-n-succinyltransferase 0.9336 5 227
4e6u-assembly1.cif.gz_A structure of lpxa from acinetobacter baumannii at 1.4a resolution (p63 form) 0.9328 147 205
ID Description Score Start End Superfamily
3tk8C01 Mainly Alpha;Orthogonal Bundle;Tetrahydrodipicolinate-N-succinyltransferase; Chain A, domain 1;Tetrahydrodipicolinate-N-succinyltransferase, N-terminal domain 0.9831 1 69 1.10.166.10
3tk8A01 Mainly Alpha;Orthogonal Bundle;Tetrahydrodipicolinate-N-succinyltransferase; Chain A, domain 1;Tetrahydrodipicolinate-N-succinyltransferase, N-terminal domain 0.9796 2 69 1.10.166.10
6amyA01 Mainly Alpha;Orthogonal Bundle;Tetrahydrodipicolinate-N-succinyltransferase; Chain A, domain 1;Tetrahydrodipicolinate-N-succinyltransferase, N-terminal domain 0.9753 3 69 1.10.166.10
3tk8C01 Mainly Alpha;Orthogonal Bundle;Tetrahydrodipicolinate-N-succinyltransferase; Chain A, domain 1;Tetrahydrodipicolinate-N-succinyltransferase, N-terminal domain 0.9558 1 69 1.10.166.10
af_A0A0P0WBK1_1725_1883_2.160.10.10 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.9479 147 205 2.160.10.10
ID Description Score Start End GO Terms
AF-A0A4Y9Q6J3-F1-model_v4 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase 1.007 1 56 GO:0016740
AF-A0A354Z193-F1-model_v4 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase 1.002 186 242 GO:0016740
AF-A0A4U6LD75-F1-model_v4 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (EC 2.3.1.117) 1.002 1 55 GO:0008666
AF-K2A529-F1-model_v4 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase (EC 2.3.1.117) 0.9987 175 243 GO:0008666
AF-A0A3C2E297-F1-model_v4 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase 0.9966 164 243 GO:0016740

Feature Viewer

pLDDT pTM Quality
90.93 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map