F494927
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1589 | 902 | 1206 | 246 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2501025501|2501070266 |
| Length | 295 |
| Sequence | VPHLAARNTAFHHQSHEITTMSQQLQQIIDTAWENRADFSPKSAPNDVREAVAHVIAELDRGALRCAEKKDGDWVVNQWVKKAVLLSFRLEDNAPMPAGGYSQFYDKVPSKFASYTAEDFAAGGFRVVPPAIARRGSFIAKNVVLMPSYTNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPVIIEDNCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIYDRETGEVSYGRIPAGSVVVAGNLPSKDGSHSLYCAVIVKKVDAKTRAKVGLNELLRGD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 2 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 3 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 4 | 2506520008 | Serratia plymuthica AS12 | Isolate | Unclassified |
| 5 | 2508501071 | Serratia proteamaculans S4 | Isolate | Rhizosphere |
| 6 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 7 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 8 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 9 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 10 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 11 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 12 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 13 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 14 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 15 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 16 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 17 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 18 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 19 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 20 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 21 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 22 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 23 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 24 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 25 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 26 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 27 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 28 | 2526164512 | Azovibrio restrictus DSM 23866 | Isolate | Unclassified |
| 29 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 30 | 2547132181 | Kosakonia sacchari SP1 | Isolate | Stem |
| 31 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 32 | 2547132512 | Azospira oryzae 6a3 | Isolate | Unclassified |
| 33 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 34 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 35 | 2554235234 | Klebsiella michiganensis SA2 | Isolate | Unclassified |
| 36 | 2561511199 | Enterobacter sp. R4-368 | Isolate | Nodule |
| 37 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 38 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 39 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 40 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 41 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 42 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 43 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 44 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 45 | 2599185169 | Klebsiella quasipneumoniae NFPP35 | Isolate | Rhizoplane |
| 46 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 47 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 48 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 49 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 50 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 51 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 52 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 53 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 54 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 55 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 56 | 2600255254 | Klebsiella quasipneumoniae NFIX15 | Isolate | Rhizoplane |
| 57 | 2600255255 | Klebsiella quasipneumoniae NFIX23 | Isolate | Rhizoplane |
| 58 | 2600255256 | Enterobacter sp. NFIX08 | Isolate | Rhizoplane |
| 59 | 2600255257 | Enterobacter sp. NFIX03 | Isolate | Rhizoplane |
| 60 | 2600255280 | Klebsiella quasipneumoniae NFIX42 | Isolate | Rhizoplane |
| 61 | 2600255281 | Klebsiella quasipneumoniae NFIX43 | Isolate | Rhizoplane |
| 62 | 2600255287 | Klebsiella quasipneumoniae NFIX11 | Isolate | Rhizoplane |
| 63 | 2600255288 | Klebsiella quasipneumoniae NFIX14 | Isolate | Rhizoplane |
| 64 | 2600255289 | Klebsiella quasipneumoniae NFIX16 | Isolate | Rhizoplane |
| 65 | 2600255290 | Klebsiella quasipneumoniae NFIX17 | Isolate | Rhizoplane |
| 66 | 2600255291 | Klebsiella quasipneumoniae NFIX19 | Isolate | Rhizoplane |
| 67 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 68 | 2600255298 | Klebsiella quasipneumoniae NFIX21 | Isolate | Rhizoplane |
| 69 | 2600255299 | Klebsiella quasipneumoniae NFIX22 | Isolate | Rhizoplane |
| 70 | 2600255300 | Klebsiella quasipneumoniae NFIX30 | Isolate | Rhizoplane |
| 71 | 2600255301 | Klebsiella quasipneumoniae NFIX33 | Isolate | Rhizoplane |
| 72 | 2600255302 | Klebsiella quasipneumoniae NFIX35 | Isolate | Rhizoplane |
| 73 | 2600255303 | Klebsiella quasipneumoniae NFIX36 | Isolate | Rhizoplane |
| 74 | 2600255304 | Klebsiella quasipneumoniae NFIX37 | Isolate | Rhizoplane |
| 75 | 2600255305 | Klebsiella quasipneumoniae NFIX41 | Isolate | Rhizoplane |
| 76 | 2600255306 | Klebsiella quasipneumoniae NFIX44 | Isolate | Rhizoplane |
| 77 | 2600255307 | Klebsiella quasipneumoniae NFIX56 | Isolate | Rhizoplane |
| 78 | 2600255309 | Klebsiella sp. NFIX53 | Isolate | Rhizoplane |
| 79 | 2600255310 | Enterobacter sp. NFIX06 | Isolate | Rhizoplane |
| 80 | 2600255311 | Enterobacter sp. NFIX04 | Isolate | Rhizoplane |
| 81 | 2600255392 | Klebsiella quasipneumoniae NFIX54 | Isolate | Rhizoplane |
| 82 | 2602042046 | Enterobacter sp. NFIX09 | Isolate | Rhizoplane |
| 83 | 2602042047 | Enterobacter sp. NFIX59 | Isolate | Rhizoplane |
| 84 | 2602042052 | Klebsiella quasipneumoniae NFIX18 | Isolate | Rhizoplane |
| 85 | 2602042053 | Klebsiella quasipneumoniae NFIX12 | Isolate | Rhizoplane |
| 86 | 2602042066 | Enterobacter sp. NFIX45 | Isolate | Rhizoplane |
| 87 | 2602042067 | Enterobacter sp. NFIX58 | Isolate | Rhizoplane |
| 88 | 2602042103 | Klebsiella quasipneumoniae NFIX29 | Isolate | Rhizoplane |
| 89 | 2602042104 | Klebsiella quasipneumoniae NFIX26 | Isolate | Rhizoplane |
| 90 | 2602042105 | Klebsiella quasipneumoniae NFIX25 | Isolate | Rhizoplane |
| 91 | 2602042106 | Klebsiella quasipneumoniae NFIX13 | Isolate | Rhizoplane |
| 92 | 2602042109 | Klebsiella aerogenes NFIX39 | Isolate | Rhizoplane |
| 93 | 2602042110 | Klebsiella quasipneumoniae NFIX40 | Isolate | Rhizoplane |
| 94 | 2602042111 | Klebsiella quasipneumoniae NFIX20 | Isolate | Rhizoplane |
| 95 | 2603880178 | Klebsiella quasipneumoniae NFIX34 | Isolate | Rhizoplane |
| 96 | 2603880184 | Klebsiella quasipneumoniae NFIX27 | Isolate | Rhizoplane |
| 97 | 2603880202 | Klebsiella quasipneumoniae NFIX38 | Isolate | Rhizoplane |
| 98 | 2603880211 | Klebsiella quasipneumoniae NFIX24 | Isolate | Rhizoplane |
| 99 | 2609459761 | Enterobacter sp. NFR05 | Isolate | Rhizoplane |
| 100 | 2636415599 | Klebsiella variicola DX120E | Isolate | Unclassified |
| 101 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 102 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 103 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 104 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 105 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 106 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 107 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 108 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 109 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 110 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 111 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 112 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 113 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 114 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 115 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 116 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 117 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 118 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 119 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 120 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 121 | 2643221665 | Acinetobacter sp. Root1280 | Isolate | Unclassified |
| 122 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 123 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 124 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 125 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 126 | 2667528172 | Enterobacteriaceae bacterium NFIX31 | Isolate | Rhizoplane |
| 127 | 2671180115 | Cedecea sp. NFIX57 | Isolate | Rhizoplane |
| 128 | 2675903046 | Klebsiella quasipneumoniae NFIX52 | Isolate | Rhizoplane |
| 129 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 130 | 2681812866 | Enterobacter asburiae NFIX55 | Isolate | Rhizoplane |
| 131 | 2681812869 | Enterobacter ludwigii NFPP41 | Isolate | Rhizoplane |
| 132 | 2687453601 | Serratia plymuthica 3Rp8 | Isolate | Unclassified |
| 133 | 2690315857 | Rheinheimera sp. EpRS3 | Isolate | Unclassified |
| 134 | 2706794495 | Dickeya zeae ZJU1202 | Isolate | Unclassified |
| 135 | 2711768156 | Atlantibacter hermannii DDE1 | Isolate | Unclassified |
| 136 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 137 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 138 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 139 | 2734482258 | Glomeribacter sp. phylotype 3 | Isolate | Unclassified |
| 140 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 141 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 142 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 143 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 144 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 145 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 146 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 147 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 148 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 149 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 150 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 151 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 152 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 153 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 154 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 155 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 156 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 157 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 158 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 159 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 160 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 161 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 162 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 163 | 2751185917 | Enterobacter sp. HK169 | Isolate | Unclassified |
| 164 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 165 | 2765235842 | Enterobacter ludwigii AA4 | Isolate | Unclassified |
| 166 | 2772190666 | Serratia surfactantfaciens YD25 | Isolate | Unclassified |
| 167 | 2773857761 | Acinetobacter sp. 3664 | Isolate | Unclassified |
| 168 | 2775506706 | Enterobacter asburiae 1216 | Isolate | Unclassified |
| 169 | 2775507074 | Klebsiella sp. D5A | Isolate | Unclassified |
| 170 | 2791354903 | Mangrovibacter phragmitis MP23 | Isolate | Unclassified |
| 171 | 2791355010 | Kosakonia pseudosacchari NN143 | Isolate | Unclassified |
| 172 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 173 | 2791355275 | Enterobacter sp. Sa187 | Isolate | Unclassified |
| 174 | 2806310673 | Serratia quinivorans NCTC 13189 | Isolate | Rhizosphere |
| 175 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 176 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 177 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 178 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 179 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 180 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 181 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 182 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 183 | 2811995292 | Kosakonia oryzae Ola 51 | Isolate | Unclassified |
| 184 | 2814123068 | Kosakonia radicincitans GXGL-4A | Isolate | Rhizosphere |
| 185 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 186 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 187 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 188 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 189 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 190 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 191 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 192 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 193 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 194 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 195 | 2821118458 | Enterobacter asburiae 609 | Isolate | Unclassified |
| 196 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 197 | 2823373977 | Enterobacter ludwigii NCR3 | Isolate | Rhizosphere |
| 198 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 199 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 200 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 201 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 202 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 203 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 204 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 205 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 206 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 207 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 208 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 209 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 210 | 2844425489 | Enterobacter cloacae SBP-8 | Isolate | Rhizosphere |
| 211 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 212 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 213 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 214 | 2855195626 | Pectobacterium atrosepticum SS26 | Isolate | Stem Tuber |
| 215 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 216 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 217 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 218 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 219 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 220 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 221 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 222 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 223 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 224 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 225 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 226 | 2858466076 | Pectobacterium polaris SS28 | Isolate | Stem Tuber |
| 227 | 2858688981 | Cupriavidus sp. UYMMa02A | Isolate | Unclassified |
| 228 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 229 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 230 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 231 | 2871272651 | Pectobacterium carotovorum SS96 | Isolate | Stem Tuber |
| 232 | 2871282230 | Pectobacterium parmentieri SS90 | Isolate | Stem Tuber |
| 233 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 234 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 235 | 2881714928 | Pseudidiomarina mangrovi ZQ330 | Isolate | Rhizosphere |
| 236 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 237 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 238 | 2883577096 | Roseococcus sp. SYP-B2431 | Isolate | Rhizosphere |
| 239 | 2884086401 | Kluyvera sp. PO2S7 | Isolate | Rhizosphere |
| 240 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 241 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 242 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 243 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 244 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 245 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 246 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 247 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 248 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 249 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 250 | 2888366609 | Serratia sp. NGAS9 | Isolate | Rhizosphere |
| 251 | 2888373701 | Serratia rhizosphaerae KUDC3025 | Isolate | Rhizosphere |
| 252 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 253 | 2891670763 | Buttiauxella sp. B2 | Isolate | Rhizosphere |
| 254 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 255 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 256 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 257 | 2900051742 | Pectobacterium zantedeschiae 2M | Isolate | Stem Tuber |
| 258 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 259 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 260 | 2901300506 | Cupriavidus sp. UYMSc13B | Isolate | Unclassified |
| 261 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 262 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 263 | 2904434214 | Robbsia andropogonis 1567 | Isolate | Rhizosphere |
| 264 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 265 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 266 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 267 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 268 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 269 | 2904513164 | Klebsiella variicola 1431 | Isolate | Rhizosphere |
| 270 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 271 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 272 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 273 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 274 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 275 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 276 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 277 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 278 | 2908669403 | Pantoea coffeiphila 1480 | Isolate | Rhizosphere |
| 279 | 2916178963 | Pseudoalteromonas rhizosphaerae RA15 | Isolate | Rhizosphere |
| 280 | 2916699645 | Acinetobacter ursingii M3 | Isolate | Unclassified |
| 281 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 282 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 283 | 2919108558 | Klebsiella sp. 1400 | Isolate | Rhizosphere |
| 284 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 285 | 2919493220 | Aeromonas salmonicida salmonicida 3466 | Isolate | Unclassified |
| 286 | 2919497567 | Shewanella putrefaciens 3469 | Isolate | Unclassified |
| 287 | 2919506607 | Acinetobacter sp. 3657 | Isolate | Unclassified |
| 288 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 289 | 2919543075 | Aeromonas salmonicida masoucida 4076 | Isolate | Unclassified |
| 290 | 2919688452 | Pararheinheimera soli 4138 | Isolate | Unclassified |
| 291 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 292 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 293 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 294 | 2923634449 | Enterobacter kobei SLBN-76 | Isolate | Rhizosphere |
| 295 | 2927833300 | Enterobacter sp. SLBN-59 | Isolate | Rhizosphere |
| 296 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 297 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 298 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 299 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 300 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 301 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 302 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 303 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 304 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 305 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 306 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 307 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 308 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 309 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 310 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 311 | 2928515477 | Acinetobacter bereziniae 1375 | Isolate | Rhizosphere |
| 312 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 313 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 314 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 315 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 316 | 2932406140 | Serratia sp. 2723 | Isolate | Rhizosphere |
| 317 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 318 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 319 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 320 | 2935625433 | Kosakonia sp. 1610 | Isolate | Rhizosphere |
| 321 | 2937539931 | Pantoea sp. LS15 | Isolate | Unclassified |
| 322 | 2937967321 | Serratia sp. YC16 | Isolate | Unclassified |
| 323 | 2939568625 | Lelliottia sp. 489 | Isolate | Rhizosphere |
| 324 | 2939573065 | Citrobacter sp. 506 | Isolate | Rhizosphere |
| 325 | 2939577877 | Serratia sp. 509 | Isolate | Rhizosphere |
| 326 | 2939602548 | Pantoea dispersa 1175 | Isolate | Rhizosphere |
| 327 | 2939607340 | Leclercia sp. 1548 | Isolate | Rhizosphere |
| 328 | 2939617950 | Kosakonia cowanii 2056 | Isolate | Rhizosphere |
| 329 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 330 | 2939642701 | Lelliottia nimipressuralis 2756 | Isolate | Rhizosphere |
| 331 | 2945874760 | Phytobacter diazotrophicus UAEU22 | Isolate | Rhizosphere |
| 332 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 333 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 334 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 335 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 336 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 337 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 338 | 2969079654 | Klebsiella variicola E57-7 | Isolate | Unclassified |
| 339 | 2971820967 | Klebsiella sp. MPUS7 | Isolate | Rhizosphere |
| 340 | 2974310843 | Enterobacter sp. SORGH_AS 287 | Isolate | Unclassified |
| 341 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 342 | 2974435778 | Kosakonia cowanii SORGH_AS 304 | Isolate | Unclassified |
| 343 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 344 | 2984559226 | Klebsiella variicola SORGH_AS834 | Isolate | Aerial Root |
| 345 | 2984568884 | Acinetobacter baylyi SORGH_AS893 | Isolate | Aerial Root |
| 346 | 2984595703 | Klebsiella variicola SORGH_AS1070 | Isolate | Aerial Root |
| 347 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 348 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 349 | 3000376612 | Enterobacteriaceae bacterium 4M9 | Isolate | Rhizosphere |
| 350 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 351 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 352 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 353 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 354 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 355 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 356 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 357 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 358 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 359 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 360 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 361 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 362 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 363 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 364 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 365 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 366 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 367 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 368 | 3300003479 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 369 | 3300003567 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 370 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 371 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 372 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 373 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 374 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 375 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 376 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 377 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 378 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 379 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 380 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 381 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 382 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 383 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 384 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 385 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 386 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 387 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 388 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 389 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 390 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 391 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 392 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 393 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 394 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 395 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 396 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 397 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 398 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 399 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 400 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 401 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 402 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 403 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 404 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 405 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 406 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 407 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 408 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 409 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 410 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 411 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 412 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 413 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 414 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 415 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 416 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 417 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 418 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 419 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 420 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 421 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 422 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 423 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 424 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 425 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 426 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 427 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 428 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 429 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 430 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 431 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 432 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 433 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 434 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 435 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 436 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 437 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 438 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 439 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 440 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 441 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 442 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 443 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 444 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 445 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 446 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 447 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 448 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 449 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 450 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 451 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 452 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 453 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 454 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 455 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 456 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 457 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 458 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 459 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 460 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 461 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 462 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 463 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 464 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 465 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 466 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 467 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 468 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 469 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 470 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 471 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 472 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 473 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 474 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 475 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 476 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 477 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 478 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 479 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 480 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 481 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 482 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 483 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 484 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 485 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 486 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 487 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 488 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 489 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 490 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 491 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 492 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 493 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 494 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 495 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 496 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 497 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 498 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 499 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 500 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 501 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 502 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 503 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 504 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 505 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 506 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 507 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 508 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 509 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 510 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 511 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 512 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 513 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 514 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 515 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 516 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 517 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 518 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 519 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 520 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 521 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 522 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 523 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 524 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 525 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 526 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 527 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 528 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 529 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 530 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 531 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 532 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 533 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 534 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 535 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 536 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 537 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 538 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 539 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 540 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 541 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 542 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 543 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 544 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 545 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 546 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 547 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 548 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 549 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 550 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 551 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 552 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 553 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 554 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 555 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 556 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 557 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 558 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 559 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 560 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 561 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 562 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 563 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 564 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 565 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 566 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 567 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 568 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 569 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 570 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 571 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 572 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 573 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 574 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 575 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 576 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 577 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 578 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 579 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 580 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 581 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 582 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 583 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 584 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 585 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 586 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 587 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 588 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 589 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 590 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 591 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 592 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 593 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 594 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 595 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 596 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 597 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 598 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 599 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 600 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 601 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 602 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 603 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 604 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 605 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 606 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 607 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 608 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 609 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 610 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 611 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 612 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 613 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 614 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 615 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 616 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 617 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 618 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 619 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 620 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 621 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 622 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 623 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 624 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 625 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 626 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 627 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 628 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 629 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 630 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 631 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 632 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 633 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 634 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 635 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 636 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 637 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 638 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 639 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 640 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 641 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 642 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 643 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 644 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 645 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 646 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 647 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 648 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 649 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 650 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 651 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 652 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 653 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 654 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 655 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 656 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 657 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 658 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 659 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 660 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 661 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 662 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 663 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 664 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 665 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 666 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 667 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 668 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 669 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 670 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 671 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 672 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 673 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 674 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 675 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 676 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 677 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 678 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 679 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 680 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 681 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 682 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 683 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 684 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 685 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 686 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 687 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 688 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 689 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 690 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 691 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 692 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 693 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 694 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 695 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 696 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 697 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 698 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 699 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 700 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 701 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 702 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 703 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 704 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 705 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 706 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 707 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 708 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 709 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 710 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 711 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 712 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 713 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 714 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 715 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 716 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 717 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 718 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 719 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 720 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 721 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 722 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 723 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 724 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 725 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 726 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 727 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 728 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 729 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 730 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 731 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 732 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 733 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 734 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 735 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 736 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 737 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 738 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 739 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 740 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 741 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 742 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 743 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 744 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 745 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 746 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 747 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 748 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 749 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 750 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 751 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 752 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 753 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 754 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 755 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 756 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 757 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 758 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 759 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 760 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 761 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 762 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 763 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 764 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 765 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 766 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 767 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 768 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 769 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 770 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 771 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 772 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 773 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 774 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 775 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 776 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 777 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 778 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 779 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 780 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 781 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 782 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 783 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 784 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 785 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 786 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 787 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 788 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 789 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 790 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 791 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 792 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 793 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 794 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 795 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 796 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 797 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 798 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 799 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 800 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 801 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 802 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 803 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 804 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 805 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 806 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 807 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 808 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 809 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 810 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 811 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 812 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 813 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 814 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 815 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 816 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 817 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 818 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 819 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 820 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 821 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 822 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 823 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 824 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 825 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 826 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 827 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 828 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 829 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 830 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 831 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 832 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 833 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 834 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 835 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 836 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 837 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 838 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 839 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 840 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 841 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 842 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 843 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 844 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 845 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 846 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 847 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 848 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 849 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 850 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 851 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 852 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 853 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 854 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 855 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 856 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 857 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 858 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 859 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 860 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 861 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 862 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 863 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 864 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 865 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 866 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 867 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 868 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 869 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
| 870 | 640753048 | Serratia proteamaculans 568 | Isolate | Endosphere |
| 871 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 872 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 873 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 874 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 875 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
| 876 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 877 | 8004592986 | Serratia sp. S119 | Isolate | Unclassified |
| 878 | 8015394850 | Serratia sp. PGPR-27 | Isolate | Rhizosphere |
| 879 | 8018221730 | Enterobacter sp. CM29 | Isolate | Unclassified |
| 880 | 8018405270 | Enterobacter sp. 198 | Isolate | Rhizosphere |
| 881 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 882 | 8019504834 | Atlantibacter hermannii 1903 | Isolate | Rhizosphere |
| 883 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 884 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 885 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 886 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 887 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 888 | 8033232454 | Acinetobacter radioresistens SA188 | Isolate | Unclassified |
| 889 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 890 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 891 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 892 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
| 893 | 8048746797 | Alcaligenes endophyticus DSM 100498 | Isolate | Unclassified |
| 894 | 8055087960 | Silvania hatchlandensis H19S6 | Isolate | Rhizosphere |
| 895 | 8055092621 | Silvania confinis H4N4 | Isolate | Rhizosphere |
| 896 | 8055097453 | Leclercia tamurae H6W5 | Isolate | Rhizosphere |
| 897 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
| 898 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 899 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
| 900 | 8055693939 | Hafnia alvei A23BA | Isolate | Rhizosphere |
| 901 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
| 902 | 8057304971 | Scandinavium manionii H17S15 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 75.52 |
| Metatranscriptomes | 0.38 |
| Isolates | 24.1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.19 |
| Bulb | 0 |
| Endosphere | 9 |
| Nodule | 2.39 |
| Rhizoplane | 6.48 |
| Rhizosphere | 66.08 |
| Stem | 0.06 |
| Stem Tuber | 0.31 |
| Unclassified | 15.48 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1004205 | 3300001976 | Bacteria | 1891 |
| 2 | JGI24740J21852_10035369 | 3300001979 | Bacteria | 1562 |
| 3 | JGI24739J22299_10000065 | 3300001989 | Bacteria | 29728 |
| 4 | JGI24739J22299_10000141 | 3300001989 | Bacteria | 22875 |
| 5 | JGI24739J22299_10007778 | 3300001989 | Bacteria | 4011 |
| 6 | JGI24739J22299_10009567 | 3300001989 | Bacteria | 3607 |
| 7 | JGI24739J22299_10015778 | 3300001989 | Bacteria | 2743 |
| 8 | JGI24737J22298_10026242 | 3300001990 | Bacteria | 1840 |
| 9 | JGI24743J22301_10010713 | 3300001991 | Bacteria | 1640 |
| 10 | JGI24735J21928_10000304 | 3300002067 | Bacteria | 17151 |
| 11 | JGI24735J21928_10000462 | 3300002067 | Bacteria | 14300 |
| 12 | JGI24735J21928_10003854 | 3300002067 | Bacteria | 5076 |
| 13 | JGI24738J21930_10001689 | 3300002075 | Bacteria | 6039 |
| 14 | JGI24738J21930_10012456 | 3300002075 | Bacteria | 1858 |
| 15 | JGI25155J39150_1000117 | 3300002704 | Bacteria | 39472 |
| 16 | JGI25155J39150_1000303 | 3300002704 | Bacteria | 16743 |
| 17 | JGI25156J39149_1000108 | 3300002705 | Bacteria | 59882 |
| 18 | JGI25156J39149_1001040 | 3300002705 | Bacteria | 12889 |
| 19 | JGI25156J39149_1001634 | 3300002705 | Bacteria | 9121 |
| 20 | JGI25162J39368_1005095 | 3300002737 | Bacteria | 2728 |
| 21 | JGI25154J39366_1000222 | 3300002738 | Bacteria | 38773 |
| 22 | JGI25154J39366_1000463 | 3300002738 | Bacteria | 21207 |
| 23 | JGI25157J39369_1000120 | 3300002741 | Bacteria | 67137 |
| 24 | JGI25150J39212_1000667 | 3300002774 | Bacteria | 12602 |
| 25 | JGI25151J46595_10000262 | 3300003187 | Bacteria | 61170 |
| 26 | JGI25165J46597_1002348 | 3300003214 | Bacteria | 6356 |
| 27 | JGI25153J46596_10003388 | 3300003215 | Bacteria | 8937 |
| 28 | JGI25153J46596_10034800 | 3300003215 | Bacteria | 1640 |
| 29 | rootL2_10007771 | 3300003322 | Bacteria | 8922 |
| 30 | JGI25160J50197_1000102 | 3300003354 | Bacteria | 82464 |
| 31 | Ga0006556J51387_1030668 | 3300003479 | Bacteria | 1310 |
| 32 | Ga0006554J51385_1028769 | 3300003567 | Bacteria | 1216 |
| 33 | Ga0055538_1000002 | 3300003751 | Bacteria | 999437 |
| 34 | Ga0055539_1000002 | 3300003752 | Bacteria | 999437 |
| 35 | Ga0055533_1000004 | 3300003756 | Bacteria | 999437 |
| 36 | Ga0055533_1000235 | 3300003756 | Bacteria | 36089 |
| 37 | Ga0055532_1000001 | 3300003758 | Bacteria | 1119836 |
| 38 | Ga0055532_1000051 | 3300003758 | Bacteria | 165365 |
| 39 | Ga0055525_1000002 | 3300003759 | Bacteria | 999437 |
| 40 | Ga0055527_1000002 | 3300003760 | Bacteria | 830488 |
| 41 | Ga0055535_1000001 | 3300003761 | Bacteria | 1119836 |
| 42 | Ga0055542_1000001 | 3300003762 | Bacteria | 1119836 |
| 43 | Ga0055529_1000026 | 3300003763 | Bacteria | 293254 |
| 44 | Ga0055529_1000392 | 3300003763 | Bacteria | 46822 |
| 45 | Ga0055529_1001316 | 3300003763 | Bacteria | 8427 |
| 46 | Ga0055526_1000074 | 3300003771 | Bacteria | 92854 |
| 47 | Ga0055526_1000086 | 3300003771 | Bacteria | 86198 |
| 48 | Ga0055526_1014942 | 3300003771 | Bacteria | 3153 |
| 49 | Ga0055537_1000012 | 3300003773 | Bacteria | 133761 |
| 50 | Ga0055524_1000021 | 3300003775 | Bacteria | 227578 |
| 51 | Ga0055524_1000099 | 3300003775 | Bacteria | 107171 |
| 52 | Ga0055524_1009288 | 3300003775 | Bacteria | 4017 |
| 53 | Ga0055534_1000399 | 3300003784 | Bacteria | 26784 |
| 54 | Ga0055528_1000351 | 3300003790 | Bacteria | 37791 |
| 55 | Ga0055528_1003000 | 3300003790 | Bacteria | 8724 |
| 56 | Ga0055530_10010281 | 3300003791 | Bacteria | 3480 |
| 57 | Ga0055531_10004883 | 3300003794 | Bacteria | 7989 |
| 58 | Ga0055531_10043596 | 3300003794 | Bacteria | 1268 |
| 59 | Ga0055541_1000002 | 3300003841 | Bacteria | 896405 |
| 60 | Ga0065165_1000848 | 3300005262 | Bacteria | 40071 |
| 61 | Ga0065165_1000995 | 3300005262 | Bacteria | 34985 |
| 62 | Ga0065165_1001389 | 3300005262 | Bacteria | 26545 |
| 63 | Ga0065165_1002021 | 3300005262 | Bacteria | 18891 |
| 64 | Ga0065715_10009513 | 3300005293 | Bacteria | 2978 |
| 65 | Ga0065707_10342981 | 3300005295 | Bacteria | 930 |
| 66 | Ga0070658_10003785 | 3300005327 | Bacteria | 12392 |
| 67 | Ga0070658_10013796 | 3300005327 | Bacteria | 6483 |
| 68 | Ga0070658_10121400 | 3300005327 | Bacteria | 2171 |
| 69 | Ga0070676_10073195 | 3300005328 | Bacteria | 2061 |
| 70 | Ga0070676_10160615 | 3300005328 | Bacteria | 1446 |
| 71 | Ga0070683_100017131 | 3300005329 | Bacteria | 6398 |
| 72 | Ga0070690_100107845 | 3300005330 | Bacteria | 1854 |
| 73 | Ga0070670_100048002 | 3300005331 | Bacteria | 3675 |
| 74 | Ga0070670_100179598 | 3300005331 | Bacteria | 1837 |
| 75 | Ga0070670_100217526 | 3300005331 | Bacteria | 1662 |
| 76 | Ga0070670_100298112 | 3300005331 | Bacteria | 1410 |
| 77 | Ga0070677_10003511 | 3300005333 | Bacteria | 5059 |
| 78 | Ga0068869_100087182 | 3300005334 | Bacteria | 2341 |
| 79 | Ga0068869_100101126 | 3300005334 | Bacteria | 2180 |
| 80 | Ga0068869_100131549 | 3300005334 | Bacteria | 1924 |
| 81 | Ga0070666_10026070 | 3300005335 | Bacteria | 3816 |
| 82 | Ga0070680_100042649 | 3300005336 | Bacteria | 3682 |
| 83 | Ga0070680_100225836 | 3300005336 | Bacteria | 1581 |
| 84 | Ga0070682_100314188 | 3300005337 | Bacteria | 1154 |
| 85 | Ga0070660_100000046 | 3300005339 | Bacteria | 70459 |
| 86 | Ga0070660_100000646 | 3300005339 | Bacteria | 23099 |
| 87 | Ga0070660_100000923 | 3300005339 | Bacteria | 19643 |
| 88 | Ga0070660_100001084 | 3300005339 | Bacteria | 18307 |
| 89 | Ga0070660_100041917 | 3300005339 | Bacteria | 3491 |
| 90 | Ga0070660_100110067 | 3300005339 | Bacteria | 2191 |
| 91 | Ga0070689_100011686 | 3300005340 | Bacteria | 6299 |
| 92 | Ga0070689_100041672 | 3300005340 | Bacteria | 3525 |
| 93 | Ga0070687_100004224 | 3300005343 | Bacteria | 5701 |
| 94 | Ga0070687_100054985 | 3300005343 | Bacteria | 2076 |
| 95 | Ga0070661_100003476 | 3300005344 | Bacteria | 10852 |
| 96 | Ga0070661_100008601 | 3300005344 | Bacteria | 7059 |
| 97 | Ga0070661_100167214 | 3300005344 | Bacteria | 1669 |
| 98 | Ga0070668_100003227 | 3300005347 | Bacteria | 12020 |
| 99 | Ga0070668_100170697 | 3300005347 | Bacteria | 1771 |
| 100 | Ga0070668_100185688 | 3300005347 | Bacteria | 1700 |
| 101 | Ga0070669_100007810 | 3300005353 | Bacteria | 7645 |
| 102 | Ga0070669_100012088 | 3300005353 | Bacteria | 6127 |
| 103 | Ga0070669_100105277 | 3300005353 | Bacteria | 2134 |
| 104 | Ga0070675_100004454 | 3300005354 | Bacteria | 10683 |
| 105 | Ga0070675_100028650 | 3300005354 | Bacteria | 4483 |
| 106 | Ga0070675_100563773 | 3300005354 | Bacteria | 1031 |
| 107 | Ga0070671_100002154 | 3300005355 | Bacteria | 15212 |
| 108 | Ga0070671_100054603 | 3300005355 | Bacteria | 3322 |
| 109 | Ga0070671_100115804 | 3300005355 | Bacteria | 2253 |
| 110 | Ga0070671_100187887 | 3300005355 | Bacteria | 1751 |
| 111 | Ga0070674_100024486 | 3300005356 | Bacteria | 3918 |
| 112 | Ga0070674_100079070 | 3300005356 | Bacteria | 2345 |
| 113 | Ga0070674_100094515 | 3300005356 | Bacteria | 2165 |
| 114 | Ga0070674_100102615 | 3300005356 | Bacteria | 2086 |
| 115 | Ga0070673_100006377 | 3300005364 | Bacteria | 7666 |
| 116 | Ga0070673_100022059 | 3300005364 | Bacteria | 4629 |
| 117 | Ga0070673_100188295 | 3300005364 | Bacteria | 1771 |
| 118 | Ga0070688_100000242 | 3300005365 | Bacteria | 28832 |
| 119 | Ga0070688_100023760 | 3300005365 | Bacteria | 3609 |
| 120 | Ga0070659_100001931 | 3300005366 | Bacteria | 14814 |
| 121 | Ga0070659_100083127 | 3300005366 | Bacteria | 2559 |
| 122 | Ga0070659_100144393 | 3300005366 | Bacteria | 1938 |
| 123 | Ga0070667_100000363 | 3300005367 | Bacteria | 49379 |
| 124 | Ga0070667_100002252 | 3300005367 | Bacteria | 16981 |
| 125 | Ga0070667_100025943 | 3300005367 | Bacteria | 4874 |
| 126 | Ga0070667_100142704 | 3300005367 | Bacteria | 2099 |
| 127 | Ga0070667_100616281 | 3300005367 | Bacteria | 1000 |
| 128 | Ga0070714_100003461 | 3300005435 | Bacteria | 11767 |
| 129 | Ga0070705_100038552 | 3300005440 | Bacteria | 2705 |
| 130 | Ga0070700_100005082 | 3300005441 | Bacteria | 6940 |
| 131 | Ga0070700_100012946 | 3300005441 | Bacteria | 4675 |
| 132 | Ga0070663_100009438 | 3300005455 | Bacteria | 6041 |
| 133 | Ga0070663_100018600 | 3300005455 | Bacteria | 4559 |
| 134 | Ga0070663_100079453 | 3300005455 | Bacteria | 2407 |
| 135 | Ga0070678_100025521 | 3300005456 | Bacteria | 3978 |
| 136 | Ga0070678_100120149 | 3300005456 | Bacteria | 2071 |
| 137 | Ga0070662_100000859 | 3300005457 | Bacteria | 18676 |
| 138 | Ga0070662_100385305 | 3300005457 | Bacteria | 1154 |
| 139 | Ga0070681_10003522 | 3300005458 | Bacteria | 14664 |
| 140 | Ga0068867_100000006 | 3300005459 | Bacteria | 152530 |
| 141 | Ga0068867_100079870 | 3300005459 | Bacteria | 2462 |
| 142 | Ga0070685_10003093 | 3300005466 | Bacteria | 8463 |
| 143 | Ga0070698_100275359 | 3300005471 | Bacteria | 1614 |
| 144 | Ga0070679_100319142 | 3300005530 | Bacteria | 1503 |
| 145 | Ga0070679_100458797 | 3300005530 | Bacteria | 1219 |
| 146 | Ga0070684_100150710 | 3300005535 | Bacteria | 2107 |
| 147 | Ga0068853_100008722 | 3300005539 | Bacteria | 8155 |
| 148 | Ga0068853_100040591 | 3300005539 | Bacteria | 3971 |
| 149 | Ga0068853_100116954 | 3300005539 | Bacteria | 2374 |
| 150 | Ga0070672_100000208 | 3300005543 | Bacteria | 32511 |
| 151 | Ga0070672_100030198 | 3300005543 | Bacteria | 4070 |
| 152 | Ga0070672_100047622 | 3300005543 | Bacteria | 3328 |
| 153 | Ga0070672_100102269 | 3300005543 | Bacteria | 2326 |
| 154 | Ga0070672_100120364 | 3300005543 | Bacteria | 2148 |
| 155 | Ga0070686_100035549 | 3300005544 | Bacteria | 3078 |
| 156 | Ga0070686_100286387 | 3300005544 | Bacteria | 1217 |
| 157 | Ga0070696_100009914 | 3300005546 | Bacteria | 6373 |
| 158 | Ga0070696_100095869 | 3300005546 | Bacteria | 2119 |
| 159 | Ga0070665_100006360 | 3300005548 | Bacteria | 12045 |
| 160 | Ga0070665_100114056 | 3300005548 | Bacteria | 2705 |
| 161 | Ga0070665_100197511 | 3300005548 | Bacteria | 2012 |
| 162 | Ga0070665_100231318 | 3300005548 | Bacteria | 1848 |
| 163 | Ga0070704_100032076 | 3300005549 | Bacteria | 3540 |
| 164 | Ga0070704_100047674 | 3300005549 | Bacteria | 2996 |
| 165 | Ga0068855_100001741 | 3300005563 | Bacteria | 27181 |
| 166 | Ga0068855_100003042 | 3300005563 | Bacteria | 20540 |
| 167 | Ga0068855_100009643 | 3300005563 | Bacteria | 11649 |
| 168 | Ga0068855_100026769 | 3300005563 | Bacteria | 6900 |
| 169 | Ga0068855_100039740 | 3300005563 | Bacteria | 5585 |
| 170 | Ga0068855_100046760 | 3300005563 | Bacteria | 5114 |
| 171 | Ga0070664_100009148 | 3300005564 | Bacteria | 8041 |
| 172 | Ga0070664_100009861 | 3300005564 | Bacteria | 7740 |
| 173 | Ga0070664_100013457 | 3300005564 | Bacteria | 6662 |
| 174 | Ga0070664_100038486 | 3300005564 | Bacteria | 4026 |
| 175 | Ga0070664_100072980 | 3300005564 | Bacteria | 2944 |
| 176 | Ga0070664_100127051 | 3300005564 | Bacteria | 2237 |
| 177 | Ga0068857_100003862 | 3300005577 | Bacteria | 12610 |
| 178 | Ga0068857_100049862 | 3300005577 | Bacteria | 3714 |
| 179 | Ga0068857_100466057 | 3300005577 | Bacteria | 1183 |
| 180 | Ga0068854_100011136 | 3300005578 | Bacteria | 5840 |
| 181 | Ga0068854_100025157 | 3300005578 | Bacteria | 4084 |
| 182 | Ga0068854_100164637 | 3300005578 | Bacteria | 1721 |
| 183 | Ga0068854_100177767 | 3300005578 | Bacteria | 1660 |
| 184 | Ga0068856_100003022 | 3300005614 | Bacteria | 17234 |
| 185 | Ga0068856_100100140 | 3300005614 | Bacteria | 2890 |
| 186 | Ga0068856_100103691 | 3300005614 | Bacteria | 2838 |
| 187 | Ga0068856_100396328 | 3300005614 | Bacteria | 1400 |
| 188 | Ga0070702_100006282 | 3300005615 | Bacteria | 5612 |
| 189 | Ga0068852_100052466 | 3300005616 | Bacteria | 3504 |
| 190 | Ga0068852_100052664 | 3300005616 | Bacteria | 3499 |
| 191 | Ga0068852_100114812 | 3300005616 | Bacteria | 2454 |
| 192 | Ga0068852_100378390 | 3300005616 | Bacteria | 1388 |
| 193 | Ga0068852_100659250 | 3300005616 | Bacteria | 1054 |
| 194 | Ga0068859_100073513 | 3300005617 | Bacteria | 3457 |
| 195 | Ga0068864_100016433 | 3300005618 | Bacteria | 6161 |
| 196 | Ga0068864_100025688 | 3300005618 | Bacteria | 4963 |
| 197 | Ga0068866_10001055 | 3300005718 | Bacteria | 12136 |
| 198 | Ga0068861_100008415 | 3300005719 | Bacteria | 7104 |
| 199 | Ga0068861_100018404 | 3300005719 | Bacteria | 4978 |
| 200 | Ga0068861_100029827 | 3300005719 | Bacteria | 3993 |
| 201 | Ga0068861_100124147 | 3300005719 | Bacteria | 2087 |
| 202 | Ga0068851_10117239 | 3300005834 | Bacteria | 1427 |
| 203 | Ga0068870_10004404 | 3300005840 | Bacteria | 6065 |
| 204 | Ga0068870_10049308 | 3300005840 | Bacteria | 2221 |
| 205 | Ga0068863_100082483 | 3300005841 | Bacteria | 3047 |
| 206 | Ga0068863_100180440 | 3300005841 | Bacteria | 2026 |
| 207 | Ga0068863_100184441 | 3300005841 | Bacteria | 2004 |
| 208 | Ga0068863_100299206 | 3300005841 | Bacteria | 1561 |
| 209 | Ga0068863_100361050 | 3300005841 | Bacteria | 1416 |
| 210 | Ga0068858_100028665 | 3300005842 | Bacteria | 5170 |
| 211 | Ga0068858_100266933 | 3300005842 | Bacteria | 1628 |
| 212 | Ga0068860_100039561 | 3300005843 | Bacteria | 4510 |
| 213 | Ga0068860_100072236 | 3300005843 | Bacteria | 3279 |
| 214 | Ga0068860_100086668 | 3300005843 | Bacteria | 2980 |
| 215 | Ga0068860_100118924 | 3300005843 | Bacteria | 2529 |
| 216 | Ga0068860_100227804 | 3300005843 | Bacteria | 1811 |
| 217 | Ga0068862_100009198 | 3300005844 | Bacteria | 8182 |
| 218 | Ga0068862_100117675 | 3300005844 | Bacteria | 2339 |
| 219 | Ga0068862_100142493 | 3300005844 | Bacteria | 2128 |
| 220 | Ga0068862_100205428 | 3300005844 | Bacteria | 1778 |
| 221 | Ga0081455_10004332 | 3300005937 | Bacteria | 15984 |
| 222 | Ga0075368_10095893 | 3300006042 | Bacteria | 1216 |
| 223 | Ga0075363_100083329 | 3300006048 | Bacteria | 1752 |
| 224 | Ga0070716_100000075 | 3300006173 | Bacteria | 38157 |
| 225 | Ga0070712_100089568 | 3300006175 | Bacteria | 2251 |
| 226 | Ga0075362_10005262 | 3300006177 | Bacteria | 4722 |
| 227 | Ga0075367_10007819 | 3300006178 | Bacteria | 5500 |
| 228 | Ga0075366_10015633 | 3300006195 | Bacteria | 4354 |
| 229 | Ga0075366_10020636 | 3300006195 | Bacteria | 3825 |
| 230 | Ga0075366_10183616 | 3300006195 | Bacteria | 1271 |
| 231 | Ga0075366_10251679 | 3300006195 | Bacteria | 1077 |
| 232 | Ga0097621_100020799 | 3300006237 | Bacteria | 5063 |
| 233 | Ga0097621_100327126 | 3300006237 | Bacteria | 1359 |
| 234 | Ga0097621_100504237 | 3300006237 | Bacteria | 1096 |
| 235 | Ga0075370_10008613 | 3300006353 | Bacteria | 5258 |
| 236 | Ga0075370_10021076 | 3300006353 | Bacteria | 3569 |
| 237 | Ga0075370_10105203 | 3300006353 | Bacteria | 1636 |
| 238 | Ga0068871_100011150 | 3300006358 | Bacteria | 6590 |
| 239 | Ga0068871_100185256 | 3300006358 | Bacteria | 1791 |
| 240 | Ga0075428_100019639 | 3300006844 | Bacteria | 7477 |
| 241 | Ga0075430_100061726 | 3300006846 | Bacteria | 3149 |
| 242 | Ga0075430_100174741 | 3300006846 | Bacteria | 1787 |
| 243 | Ga0075431_100014998 | 3300006847 | Bacteria | 7845 |
| 244 | Ga0075434_100091112 | 3300006871 | Bacteria | 3051 |
| 245 | Ga0075434_100305682 | 3300006871 | Bacteria | 1611 |
| 246 | Ga0075434_100421173 | 3300006871 | Bacteria | 1356 |
| 247 | Ga0075429_100269650 | 3300006880 | Bacteria | 1491 |
| 248 | Ga0068865_100019463 | 3300006881 | Bacteria | 4393 |
| 249 | Ga0068865_100041950 | 3300006881 | Bacteria | 3117 |
| 250 | Ga0068865_100044895 | 3300006881 | Bacteria | 3027 |
| 251 | Ga0097620_100073511 | 3300006931 | Bacteria | 3457 |
| 252 | Ga0099823_1006273 | 3300006944 | Bacteria | 11985 |
| 253 | Ga0079104_1004305 | 3300006946 | Bacteria | 6160 |
| 254 | Ga0099826_10000002 | 3300006948 | Bacteria | 1125830 |
| 255 | Ga0075435_100047799 | 3300007076 | Bacteria | 3437 |
| 256 | Ga0099794_10013815 | 3300007265 | Bacteria | 3523 |
| 257 | Ga0105244_10005473 | 3300009036 | Bacteria | 8438 |
| 258 | Ga0105250_10029331 | 3300009092 | Bacteria | 2214 |
| 259 | Ga0105240_10002341 | 3300009093 | Bacteria | 30608 |
| 260 | Ga0105240_10008869 | 3300009093 | Bacteria | 14311 |
| 261 | Ga0105240_10022945 | 3300009093 | Bacteria | 8267 |
| 262 | Ga0105240_10025060 | 3300009093 | Bacteria | 7851 |
| 263 | Ga0105240_10044913 | 3300009093 | Bacteria | 5608 |
| 264 | Ga0105240_10065376 | 3300009093 | Bacteria | 4515 |
| 265 | Ga0105240_10169689 | 3300009093 | Bacteria | 2585 |
| 266 | Ga0111539_10008224 | 3300009094 | Bacteria | 13277 |
| 267 | Ga0111539_10010207 | 3300009094 | Bacteria | 11836 |
| 268 | Ga0111539_10017857 | 3300009094 | Bacteria | 8786 |
| 269 | Ga0111539_10044187 | 3300009094 | Bacteria | 5338 |
| 270 | Ga0111539_10481352 | 3300009094 | Bacteria | 1446 |
| 271 | Ga0111539_10579902 | 3300009094 | Bacteria | 1306 |
| 272 | Ga0111539_11099492 | 3300009094 | Bacteria | 924 |
| 273 | Ga0105245_10096658 | 3300009098 | Bacteria | 2726 |
| 274 | Ga0105245_10099033 | 3300009098 | Bacteria | 2694 |
| 275 | Ga0105247_10149251 | 3300009101 | Bacteria | 1539 |
| 276 | Ga0114129_10062288 | 3300009147 | Bacteria | 5212 |
| 277 | Ga0114129_10267296 | 3300009147 | Bacteria | 2289 |
| 278 | Ga0105243_10007446 | 3300009148 | Bacteria | 8412 |
| 279 | Ga0105243_10038792 | 3300009148 | Bacteria | 3710 |
| 280 | Ga0105243_10059329 | 3300009148 | Bacteria | 3053 |
| 281 | Ga0105243_10100525 | 3300009148 | Bacteria | 2399 |
| 282 | Ga0105242_10002939 | 3300009176 | Bacteria | 13325 |
| 283 | Ga0105242_10020500 | 3300009176 | Bacteria | 5184 |
| 284 | Ga0105242_10021310 | 3300009176 | Bacteria | 5085 |
| 285 | Ga0105242_10038050 | 3300009176 | Bacteria | 3867 |
| 286 | Ga0105242_10344902 | 3300009176 | Bacteria | 1374 |
| 287 | Ga0105248_10003709 | 3300009177 | Bacteria | 16935 |
| 288 | Ga0105237_10015121 | 3300009545 | Bacteria | 8041 |
| 289 | Ga0105237_10121127 | 3300009545 | Bacteria | 2611 |
| 290 | Ga0105237_10133693 | 3300009545 | Bacteria | 2475 |
| 291 | Ga0105237_10165934 | 3300009545 | Bacteria | 2207 |
| 292 | Ga0105238_10000977 | 3300009551 | Bacteria | 29236 |
| 293 | Ga0105238_10059780 | 3300009551 | Bacteria | 3817 |
| 294 | Ga0105238_10134544 | 3300009551 | Bacteria | 2450 |
| 295 | Ga0105238_10285609 | 3300009551 | Bacteria | 1632 |
| 296 | Ga0105249_10286980 | 3300009553 | Bacteria | 1646 |
| 297 | Ga0105249_10450169 | 3300009553 | Bacteria | 1326 |
| 298 | Ga0105239_10022568 | 3300010375 | Bacteria | 6939 |
| 299 | Ga0105239_10032953 | 3300010375 | Bacteria | 5692 |
| 300 | Ga0105239_10195897 | 3300010375 | Bacteria | 2263 |
| 301 | Ga0105239_10291735 | 3300010375 | Bacteria | 1837 |
| 302 | Ga0105239_10477400 | 3300010375 | Bacteria | 1416 |
| 303 | Ga0105246_10194277 | 3300011119 | Bacteria | 1573 |
| 304 | Ga0157319_1000006 | 3300012497 | Bacteria | 361506 |
| 305 | Ga0157373_10003697 | 3300013100 | Bacteria | 11578 |
| 306 | Ga0157373_10019329 | 3300013100 | Bacteria | 4961 |
| 307 | Ga0157373_10027516 | 3300013100 | Bacteria | 4103 |
| 308 | Ga0157371_10000422 | 3300013102 | Bacteria | 52177 |
| 309 | Ga0157371_10006694 | 3300013102 | Bacteria | 9424 |
| 310 | Ga0157370_10000850 | 3300013104 | Bacteria | 38703 |
| 311 | Ga0157370_10001346 | 3300013104 | Bacteria | 30508 |
| 312 | Ga0157370_10228352 | 3300013104 | Bacteria | 1723 |
| 313 | Ga0157370_10258120 | 3300013104 | Bacteria | 1611 |
| 314 | Ga0157369_10000947 | 3300013105 | Bacteria | 36855 |
| 315 | Ga0157369_10000979 | 3300013105 | Bacteria | 36209 |
| 316 | Ga0157369_10009691 | 3300013105 | Bacteria | 11016 |
| 317 | Ga0157369_10047494 | 3300013105 | Bacteria | 4660 |
| 318 | Ga0157374_10000107 | 3300013296 | Bacteria | 75925 |
| 319 | Ga0157374_10623742 | 3300013296 | Bacteria | 1089 |
| 320 | Ga0157378_10072572 | 3300013297 | Bacteria | 3093 |
| 321 | Ga0163162_10008076 | 3300013306 | Bacteria | 10271 |
| 322 | Ga0163162_10354848 | 3300013306 | Bacteria | 1599 |
| 323 | Ga0157372_10004539 | 3300013307 | Bacteria | 14782 |
| 324 | Ga0157372_10004653 | 3300013307 | Bacteria | 14585 |
| 325 | Ga0157372_10006612 | 3300013307 | Bacteria | 12334 |
| 326 | Ga0157372_10126293 | 3300013307 | Bacteria | 2941 |
| 327 | Ga0157372_10207410 | 3300013307 | Bacteria | 2271 |
| 328 | Ga0157375_10004499 | 3300013308 | Bacteria | 12119 |
| 329 | Ga0157375_10125562 | 3300013308 | Bacteria | 2680 |
| 330 | Ga0157375_10161243 | 3300013308 | Bacteria | 2384 |
| 331 | Ga0157375_10374823 | 3300013308 | Bacteria | 1590 |
| 332 | Ga0157375_10668214 | 3300013308 | Bacteria | 1194 |
| 333 | Ga0163163_10020768 | 3300014325 | Bacteria | 6191 |
| 334 | Ga0163163_10083221 | 3300014325 | Bacteria | 3205 |
| 335 | Ga0163163_10084331 | 3300014325 | Bacteria | 3183 |
| 336 | Ga0163163_10439880 | 3300014325 | Bacteria | 1364 |
| 337 | Ga0157380_10001038 | 3300014326 | Bacteria | 17730 |
| 338 | Ga0157380_10023317 | 3300014326 | Bacteria | 4668 |
| 339 | Ga0157380_10074237 | 3300014326 | Bacteria | 2760 |
| 340 | Ga0157380_10098497 | 3300014326 | Bacteria | 2429 |
| 341 | Ga0182008_10014563 | 3300014497 | Bacteria | 4116 |
| 342 | Ga0182008_10035124 | 3300014497 | Bacteria | 2512 |
| 343 | Ga0157377_10000013 | 3300014745 | Bacteria | 267125 |
| 344 | Ga0157379_10006759 | 3300014968 | Bacteria | 9912 |
| 345 | Ga0157379_10293153 | 3300014968 | Bacteria | 1482 |
| 346 | Ga0157376_10000565 | 3300014969 | Bacteria | 23889 |
| 347 | Ga0157376_10043568 | 3300014969 | Bacteria | 3683 |
| 348 | Ga0157376_10302009 | 3300014969 | Bacteria | 1516 |
| 349 | Ga0182006_1000002 | 3300015261 | Bacteria | 887990 |
| 350 | Ga0182006_1000026 | 3300015261 | Bacteria | 253543 |
| 351 | Ga0182006_1031040 | 3300015261 | Bacteria | 2155 |
| 352 | Ga0182006_1052716 | 3300015261 | Bacteria | 1562 |
| 353 | Ga0182007_10000073 | 3300015262 | Bacteria | 80601 |
| 354 | Ga0182007_10000581 | 3300015262 | Bacteria | 21489 |
| 355 | Ga0182005_1000002 | 3300015265 | Bacteria | 908499 |
| 356 | Ga0182005_1000007 | 3300015265 | Bacteria | 490994 |
| 357 | Ga0182005_1000662 | 3300015265 | Bacteria | 16334 |
| 358 | Ga0182005_1064419 | 3300015265 | Bacteria | 1002 |
| 359 | Ga0183361_10006 | 3300016635 | Bacteria | 368532 |
| 360 | Ga0163161_10009466 | 3300017792 | Bacteria | 6742 |
| 361 | Ga0163161_10029871 | 3300017792 | Bacteria | 3874 |
| 362 | Ga0163161_10167383 | 3300017792 | Bacteria | 1679 |
| 363 | Ga0206355_1144450 | 3300020076 | Bacteria | 1483 |
| 364 | Ga0213872_10000028 | 3300021361 | Bacteria | 148766 |
| 365 | Ga0213872_10000046 | 3300021361 | Bacteria | 109934 |
| 366 | Ga0213872_10000048 | 3300021361 | Bacteria | 109712 |
| 367 | Ga0213872_10000086 | 3300021361 | Bacteria | 84955 |
| 368 | Ga0213872_10016214 | 3300021361 | Bacteria | 3459 |
| 369 | Ga0213872_10042905 | 3300021361 | Bacteria | 2062 |
| 370 | Ga0209435_100028 | 3300025206 | Bacteria | 182520 |
| 371 | Ga0209435_100139 | 3300025206 | Bacteria | 24429 |
| 372 | Ga0209784_100002 | 3300025224 | Bacteria | 1753105 |
| 373 | Ga0209566_100003 | 3300025225 | Bacteria | 1753105 |
| 374 | Ga0209566_100504 | 3300025225 | Bacteria | 27098 |
| 375 | Ga0209674_100004 | 3300025226 | Bacteria | 1753105 |
| 376 | Ga0209674_100005 | 3300025226 | Bacteria | 1708125 |
| 377 | Ga0209674_101381 | 3300025226 | Bacteria | 6524 |
| 378 | Ga0209672_100001 | 3300025228 | Bacteria | 2828210 |
| 379 | Ga0209672_100014 | 3300025228 | Bacteria | 546252 |
| 380 | Ga0209672_100023 | 3300025228 | Bacteria | 371758 |
| 381 | Ga0209672_100530 | 3300025228 | Bacteria | 20839 |
| 382 | Ga0209147_100001 | 3300025229 | Bacteria | 2384371 |
| 383 | Ga0209147_100004 | 3300025229 | Bacteria | 1371850 |
| 384 | Ga0209147_100094 | 3300025229 | Bacteria | 167145 |
| 385 | Ga0209147_100104 | 3300025229 | Bacteria | 158375 |
| 386 | Ga0209563_100006 | 3300025230 | Bacteria | 1753105 |
| 387 | Ga0209563_100468 | 3300025230 | Bacteria | 13843 |
| 388 | Ga0207427_100592 | 3300025231 | Bacteria | 18165 |
| 389 | Ga0209437_100053 | 3300025233 | Bacteria | 375580 |
| 390 | Ga0209258_100001 | 3300025242 | Bacteria | 2384269 |
| 391 | Ga0209258_100040 | 3300025242 | Bacteria | 385401 |
| 392 | Ga0209258_100142 | 3300025242 | Bacteria | 165865 |
| 393 | Ga0207425_1000192 | 3300025245 | Bacteria | 49765 |
| 394 | Ga0209646_1000021 | 3300025246 | Bacteria | 461083 |
| 395 | Ga0209646_1000095 | 3300025246 | Bacteria | 182520 |
| 396 | Ga0209026_1000110 | 3300025250 | Bacteria | 141989 |
| 397 | Ga0209677_100003 | 3300025253 | Bacteria | 1753105 |
| 398 | Ga0209148_1000003 | 3300025254 | Bacteria | 2384288 |
| 399 | Ga0209148_1000035 | 3300025254 | Bacteria | 548413 |
| 400 | Ga0209148_1002027 | 3300025254 | Bacteria | 7906 |
| 401 | Ga0209759_1000030 | 3300025256 | Bacteria | 285649 |
| 402 | Ga0209759_1000080 | 3300025256 | Bacteria | 171186 |
| 403 | Ga0209759_1000115 | 3300025256 | Bacteria | 141877 |
| 404 | Ga0209759_1000155 | 3300025256 | Bacteria | 118819 |
| 405 | Ga0209759_1000260 | 3300025256 | Bacteria | 76538 |
| 406 | Ga0209759_1001844 | 3300025256 | Bacteria | 10606 |
| 407 | Ga0209759_1012521 | 3300025256 | Bacteria | 2345 |
| 408 | Ga0209233_1000016 | 3300025261 | Bacteria | 907830 |
| 409 | Ga0209565_1000057 | 3300025263 | Bacteria | 196908 |
| 410 | Ga0209565_1029489 | 3300025263 | Bacteria | 1077 |
| 411 | Ga0207666_1002150 | 3300025271 | Bacteria | 2365 |
| 412 | Ga0209455_1000001 | 3300025272 | Bacteria | 2384278 |
| 413 | Ga0209455_1000037 | 3300025272 | Bacteria | 464097 |
| 414 | Ga0209455_1000072 | 3300025272 | Bacteria | 293074 |
| 415 | Ga0209455_1004470 | 3300025272 | Bacteria | 4563 |
| 416 | Ga0209455_1009709 | 3300025272 | Bacteria | 2506 |
| 417 | Ga0209673_1000051 | 3300025273 | Bacteria | 282161 |
| 418 | Ga0209673_1000140 | 3300025273 | Bacteria | 157575 |
| 419 | Ga0209673_1010871 | 3300025273 | Bacteria | 3802 |
| 420 | Ga0209673_1014088 | 3300025273 | Bacteria | 3114 |
| 421 | Ga0209673_1025996 | 3300025273 | Bacteria | 1934 |
| 422 | Ga0209673_1028369 | 3300025273 | Bacteria | 1803 |
| 423 | Ga0209675_1000027 | 3300025291 | Bacteria | 282175 |
| 424 | Ga0209025_1000057 | 3300025294 | Bacteria | 314601 |
| 425 | Ga0209025_1007891 | 3300025294 | Bacteria | 7806 |
| 426 | Ga0209564_1000003 | 3300025295 | Bacteria | 1585848 |
| 427 | Ga0209564_1000009 | 3300025295 | Bacteria | 950196 |
| 428 | Ga0209564_1000094 | 3300025295 | Bacteria | 243176 |
| 429 | Ga0209564_1022747 | 3300025295 | Bacteria | 2202 |
| 430 | Ga0209758_1000096 | 3300025297 | Bacteria | 231496 |
| 431 | Ga0209758_1000227 | 3300025297 | Bacteria | 120073 |
| 432 | Ga0209050_1003867 | 3300025298 | Bacteria | 10643 |
| 433 | Ga0209050_1006055 | 3300025298 | Bacteria | 7322 |
| 434 | Ga0209256_1000044 | 3300025299 | Bacteria | 337264 |
| 435 | Ga0209256_1000139 | 3300025299 | Bacteria | 155515 |
| 436 | Ga0209256_1004237 | 3300025299 | Bacteria | 9194 |
| 437 | Ga0209256_1024727 | 3300025299 | Bacteria | 1764 |
| 438 | Ga0207426_1000125 | 3300025302 | Bacteria | 217504 |
| 439 | Ga0209051_1000367 | 3300025303 | Bacteria | 65677 |
| 440 | Ga0209051_1001570 | 3300025303 | Bacteria | 18860 |
| 441 | Ga0209257_1000012 | 3300025304 | Bacteria | 1111138 |
| 442 | Ga0209257_1033503 | 3300025304 | Bacteria | 1614 |
| 443 | Ga0207697_10000129 | 3300025315 | Bacteria | 36355 |
| 444 | Ga0207697_10021145 | 3300025315 | Bacteria | 2664 |
| 445 | Ga0207656_10011124 | 3300025321 | Bacteria | 3391 |
| 446 | Ga0207696_1021964 | 3300025711 | Bacteria | 2035 |
| 447 | Ga0207655_1001746 | 3300025728 | Bacteria | 19071 |
| 448 | Ga0207713_1000252 | 3300025735 | Bacteria | 67447 |
| 449 | Ga0207713_1000864 | 3300025735 | Bacteria | 27722 |
| 450 | Ga0207682_10000157 | 3300025893 | Bacteria | 30775 |
| 451 | Ga0207642_10054369 | 3300025899 | Bacteria | 1826 |
| 452 | Ga0207710_10011735 | 3300025900 | Bacteria | 3686 |
| 453 | Ga0207688_10000508 | 3300025901 | Bacteria | 18745 |
| 454 | Ga0207680_10030205 | 3300025903 | Bacteria | 3053 |
| 455 | Ga0207680_10103558 | 3300025903 | Bacteria | 1833 |
| 456 | Ga0207680_10146406 | 3300025903 | Bacteria | 1571 |
| 457 | Ga0207647_10000498 | 3300025904 | Bacteria | 31401 |
| 458 | Ga0207647_10000605 | 3300025904 | Bacteria | 27980 |
| 459 | Ga0207685_10195559 | 3300025905 | Bacteria | 947 |
| 460 | Ga0207645_10001209 | 3300025907 | Bacteria | 21313 |
| 461 | Ga0207643_10000883 | 3300025908 | Bacteria | 18064 |
| 462 | Ga0207643_10037238 | 3300025908 | Bacteria | 2729 |
| 463 | Ga0207643_10069351 | 3300025908 | Bacteria | 2026 |
| 464 | Ga0207654_10215135 | 3300025911 | Bacteria | 1272 |
| 465 | Ga0207707_10034389 | 3300025912 | Bacteria | 4434 |
| 466 | Ga0207707_10037528 | 3300025912 | Bacteria | 4235 |
| 467 | Ga0207707_10384208 | 3300025912 | Bacteria | 1207 |
| 468 | Ga0207695_10000926 | 3300025913 | Bacteria | 52365 |
| 469 | Ga0207695_10002201 | 3300025913 | Bacteria | 29360 |
| 470 | Ga0207695_10024266 | 3300025913 | Bacteria | 6828 |
| 471 | Ga0207695_10081775 | 3300025913 | Bacteria | 3268 |
| 472 | Ga0207695_10100163 | 3300025913 | Bacteria | 2894 |
| 473 | Ga0207695_10173512 | 3300025913 | Bacteria | 2080 |
| 474 | Ga0207695_10395223 | 3300025913 | Bacteria | 1267 |
| 475 | Ga0207671_10026114 | 3300025914 | Bacteria | 4381 |
| 476 | Ga0207671_10052850 | 3300025914 | Bacteria | 3011 |
| 477 | Ga0207693_10097305 | 3300025915 | Bacteria | 2308 |
| 478 | Ga0207693_10225050 | 3300025915 | Bacteria | 1473 |
| 479 | Ga0207663_10209244 | 3300025916 | Bacteria | 1412 |
| 480 | Ga0207663_10304763 | 3300025916 | Bacteria | 1191 |
| 481 | Ga0207660_10081617 | 3300025917 | Bacteria | 2377 |
| 482 | Ga0207660_10100383 | 3300025917 | Bacteria | 2161 |
| 483 | Ga0207662_10002138 | 3300025918 | Bacteria | 9836 |
| 484 | Ga0207662_10004730 | 3300025918 | Bacteria | 7189 |
| 485 | Ga0207657_10000004 | 3300025919 | Bacteria | 247179 |
| 486 | Ga0207657_10004856 | 3300025919 | Bacteria | 14157 |
| 487 | Ga0207657_10007145 | 3300025919 | Bacteria | 11467 |
| 488 | Ga0207657_10035316 | 3300025919 | Bacteria | 4484 |
| 489 | Ga0207657_10111826 | 3300025919 | Bacteria | 2255 |
| 490 | Ga0207681_10013238 | 3300025923 | Bacteria | 5101 |
| 491 | Ga0207681_10027333 | 3300025923 | Bacteria | 3688 |
| 492 | Ga0207681_10189141 | 3300025923 | Bacteria | 1574 |
| 493 | Ga0207681_10229837 | 3300025923 | Bacteria | 1439 |
| 494 | Ga0207681_10486921 | 3300025923 | Bacteria | 1008 |
| 495 | Ga0207694_10008234 | 3300025924 | Bacteria | 7882 |
| 496 | Ga0207694_10029080 | 3300025924 | Bacteria | 4214 |
| 497 | Ga0207694_10098164 | 3300025924 | Bacteria | 2319 |
| 498 | Ga0207694_10265458 | 3300025924 | Bacteria | 1407 |
| 499 | Ga0207650_10012131 | 3300025925 | Bacteria | 5940 |
| 500 | Ga0207650_10049298 | 3300025925 | Bacteria | 3109 |
| 501 | Ga0207650_10197962 | 3300025925 | Bacteria | 1608 |
| 502 | Ga0207659_10010632 | 3300025926 | Bacteria | 5787 |
| 503 | Ga0207659_10416329 | 3300025926 | Bacteria | 1126 |
| 504 | Ga0207664_10005455 | 3300025929 | Bacteria | 8697 |
| 505 | Ga0207644_10019073 | 3300025931 | Bacteria | 4649 |
| 506 | Ga0207644_10040966 | 3300025931 | Bacteria | 3275 |
| 507 | Ga0207644_10056873 | 3300025931 | Bacteria | 2823 |
| 508 | Ga0207644_10215812 | 3300025931 | Bacteria | 1518 |
| 509 | Ga0207690_10001165 | 3300025932 | Bacteria | 16639 |
| 510 | Ga0207690_10098960 | 3300025932 | Bacteria | 2079 |
| 511 | Ga0207706_10000064 | 3300025933 | Bacteria | 109094 |
| 512 | Ga0207706_10000928 | 3300025933 | Bacteria | 30049 |
| 513 | Ga0207706_10013987 | 3300025933 | Bacteria | 7277 |
| 514 | Ga0207706_10078212 | 3300025933 | Bacteria | 2909 |
| 515 | Ga0207706_10287878 | 3300025933 | Bacteria | 1432 |
| 516 | Ga0207686_10009771 | 3300025934 | Bacteria | 5215 |
| 517 | Ga0207686_10389612 | 3300025934 | Bacteria | 1059 |
| 518 | Ga0207709_10002748 | 3300025935 | Bacteria | 10847 |
| 519 | Ga0207709_10004452 | 3300025935 | Bacteria | 8091 |
| 520 | Ga0207709_10444253 | 3300025935 | Bacteria | 1001 |
| 521 | Ga0207670_10249718 | 3300025936 | Bacteria | 1370 |
| 522 | Ga0207669_10005626 | 3300025937 | Bacteria | 5644 |
| 523 | Ga0207669_10056952 | 3300025937 | Bacteria | 2377 |
| 524 | Ga0207669_10096727 | 3300025937 | Bacteria | 1939 |
| 525 | Ga0207704_10094380 | 3300025938 | Bacteria | 1975 |
| 526 | Ga0207691_10000087 | 3300025940 | Bacteria | 78167 |
| 527 | Ga0207691_10038626 | 3300025940 | Bacteria | 4418 |
| 528 | Ga0207691_10039177 | 3300025940 | Bacteria | 4384 |
| 529 | Ga0207691_10053485 | 3300025940 | Bacteria | 3686 |
| 530 | Ga0207691_10071826 | 3300025940 | Bacteria | 3122 |
| 531 | Ga0207691_10133018 | 3300025940 | Bacteria | 2196 |
| 532 | Ga0207691_10163814 | 3300025940 | Bacteria | 1949 |
| 533 | Ga0207711_10024058 | 3300025941 | Bacteria | 5098 |
| 534 | Ga0207711_10214096 | 3300025941 | Bacteria | 1760 |
| 535 | Ga0207689_10003785 | 3300025942 | Bacteria | 13785 |
| 536 | Ga0207689_10023736 | 3300025942 | Bacteria | 5145 |
| 537 | Ga0207689_10044208 | 3300025942 | Bacteria | 3682 |
| 538 | Ga0207689_10208111 | 3300025942 | Bacteria | 1616 |
| 539 | Ga0207689_10250294 | 3300025942 | Bacteria | 1465 |
| 540 | Ga0207689_10255085 | 3300025942 | Bacteria | 1451 |
| 541 | Ga0207661_10073969 | 3300025944 | Bacteria | 2792 |
| 542 | Ga0207679_10005057 | 3300025945 | Bacteria | 8245 |
| 543 | Ga0207679_10009281 | 3300025945 | Bacteria | 6293 |
| 544 | Ga0207679_10024676 | 3300025945 | Bacteria | 4125 |
| 545 | Ga0207679_10086280 | 3300025945 | Bacteria | 2414 |
| 546 | Ga0207679_10572556 | 3300025945 | Bacteria | 1015 |
| 547 | Ga0207667_10000036 | 3300025949 | Bacteria | 297966 |
| 548 | Ga0207667_10002775 | 3300025949 | Bacteria | 21673 |
| 549 | Ga0207667_10003108 | 3300025949 | Bacteria | 20547 |
| 550 | Ga0207667_10011537 | 3300025949 | Bacteria | 10264 |
| 551 | Ga0207667_10029744 | 3300025949 | Bacteria | 5918 |
| 552 | Ga0207667_10075369 | 3300025949 | Bacteria | 3503 |
| 553 | Ga0207667_10090963 | 3300025949 | Bacteria | 3153 |
| 554 | Ga0207651_10009113 | 3300025960 | Bacteria | 5405 |
| 555 | Ga0207651_10041860 | 3300025960 | Bacteria | 3044 |
| 556 | Ga0207651_10126061 | 3300025960 | Bacteria | 1951 |
| 557 | Ga0207668_10001815 | 3300025972 | Bacteria | 12452 |
| 558 | Ga0207668_10057056 | 3300025972 | Bacteria | 2723 |
| 559 | Ga0207640_10010935 | 3300025981 | Bacteria | 5121 |
| 560 | Ga0207640_10020459 | 3300025981 | Bacteria | 3930 |
| 561 | Ga0207640_10110301 | 3300025981 | Bacteria | 1949 |
| 562 | Ga0207658_10000322 | 3300025986 | Bacteria | 48194 |
| 563 | Ga0207658_10017921 | 3300025986 | Bacteria | 4881 |
| 564 | Ga0207658_10102594 | 3300025986 | Bacteria | 2244 |
| 565 | Ga0207658_10217759 | 3300025986 | Bacteria | 1604 |
| 566 | Ga0207658_10276004 | 3300025986 | Bacteria | 1439 |
| 567 | Ga0207677_10423813 | 3300026023 | Bacteria | 1134 |
| 568 | Ga0207639_10003441 | 3300026041 | Bacteria | 10648 |
| 569 | Ga0207639_10036308 | 3300026041 | Bacteria | 3651 |
| 570 | Ga0207678_10003926 | 3300026067 | Bacteria | 13374 |
| 571 | Ga0207678_10006140 | 3300026067 | Bacteria | 10686 |
| 572 | Ga0207678_10006659 | 3300026067 | Bacteria | 10241 |
| 573 | Ga0207678_10173808 | 3300026067 | Bacteria | 1839 |
| 574 | Ga0207678_10341463 | 3300026067 | Bacteria | 1290 |
| 575 | Ga0207708_10002281 | 3300026075 | Bacteria | 14131 |
| 576 | Ga0207708_10072561 | 3300026075 | Bacteria | 2637 |
| 577 | Ga0207702_10010543 | 3300026078 | Bacteria | 7725 |
| 578 | Ga0207702_10385526 | 3300026078 | Bacteria | 1348 |
| 579 | Ga0207641_10189164 | 3300026088 | Bacteria | 1891 |
| 580 | Ga0207648_10000006 | 3300026089 | Bacteria | 223855 |
| 581 | Ga0207648_10004444 | 3300026089 | Bacteria | 14385 |
| 582 | Ga0207676_10136478 | 3300026095 | Bacteria | 2093 |
| 583 | Ga0207676_10165927 | 3300026095 | Bacteria | 1918 |
| 584 | Ga0207674_10000437 | 3300026116 | Bacteria | 53986 |
| 585 | Ga0207674_10002032 | 3300026116 | Bacteria | 25666 |
| 586 | Ga0207674_10144921 | 3300026116 | Bacteria | 2334 |
| 587 | Ga0207674_10241613 | 3300026116 | Bacteria | 1753 |
| 588 | Ga0207674_10306920 | 3300026116 | Bacteria | 1536 |
| 589 | Ga0207674_10329185 | 3300026116 | Bacteria | 1477 |
| 590 | Ga0207674_10363838 | 3300026116 | Bacteria | 1398 |
| 591 | Ga0207674_10511969 | 3300026116 | Bacteria | 1159 |
| 592 | Ga0207675_100001840 | 3300026118 | Bacteria | 21287 |
| 593 | Ga0207675_100012754 | 3300026118 | Bacteria | 7852 |
| 594 | Ga0207675_100041887 | 3300026118 | Bacteria | 4276 |
| 595 | Ga0207675_100072042 | 3300026118 | Bacteria | 3231 |
| 596 | Ga0207675_100258482 | 3300026118 | Bacteria | 1687 |
| 597 | Ga0207683_10000223 | 3300026121 | Bacteria | 49909 |
| 598 | Ga0207683_10041600 | 3300026121 | Bacteria | 4013 |
| 599 | Ga0207683_10053360 | 3300026121 | Bacteria | 3544 |
| 600 | Ga0207698_10028347 | 3300026142 | Bacteria | 3992 |
| 601 | Ga0207698_10036689 | 3300026142 | Bacteria | 3601 |
| 602 | Ga0207698_10051736 | 3300026142 | Bacteria | 3142 |
| 603 | Ga0207698_10127853 | 3300026142 | Bacteria | 2165 |
| 604 | Ga0209389_1016619 | 3300027296 | Bacteria | 6661 |
| 605 | Ga0209371_1000079 | 3300027312 | Bacteria | 187621 |
| 606 | Ga0209282_1000001 | 3300027666 | Bacteria | 2450367 |
| 607 | Ga0209971_1002887 | 3300027682 | Bacteria | 4104 |
| 608 | Ga0209813_10031522 | 3300027866 | Bacteria | 1565 |
| 609 | Ga0209974_10015038 | 3300027876 | Bacteria | 2570 |
| 610 | Ga0207428_10007839 | 3300027907 | Bacteria | 9713 |
| 611 | Ga0207428_10111489 | 3300027907 | Bacteria | 2105 |
| 612 | Ga0207428_10287455 | 3300027907 | Bacteria | 1219 |
| 613 | Ga0268266_10005164 | 3300028379 | Bacteria | 12303 |
| 614 | Ga0268266_10022948 | 3300028379 | Bacteria | 5310 |
| 615 | Ga0268266_10098585 | 3300028379 | Bacteria | 2571 |
| 616 | Ga0268266_10157857 | 3300028379 | Bacteria | 2050 |
| 617 | Ga0268265_10225041 | 3300028380 | Bacteria | 1644 |
| 618 | Ga0268264_10062720 | 3300028381 | Bacteria | 3122 |
| 619 | Ga0268264_10077361 | 3300028381 | Bacteria | 2834 |
| 620 | Ga0268264_10292743 | 3300028381 | Bacteria | 1530 |
| 621 | Ga0268264_10710253 | 3300028381 | Bacteria | 999 |
| 622 | Ga0307517_10106490 | 3300028786 | Bacteria | 2168 |
| 623 | Ga0307515_10002761 | 3300028794 | Bacteria | 37491 |
| 624 | Ga0265338_10000028 | 3300028800 | Bacteria | 279132 |
| 625 | Ga0265324_10019937 | 3300029957 | Bacteria | 2413 |
| 626 | Ga0268256_1000090 | 3300030500 | Bacteria | 153976 |
| 627 | Ga0265332_10000094 | 3300031238 | Bacteria | 77636 |
| 628 | Ga0265332_10002144 | 3300031238 | Bacteria | 10194 |
| 629 | Ga0265332_10007434 | 3300031238 | Bacteria | 4952 |
| 630 | Ga0265328_10049342 | 3300031239 | Bacteria | 1546 |
| 631 | Ga0265328_10095711 | 3300031239 | Bacteria | 1098 |
| 632 | Ga0265325_10044008 | 3300031241 | Bacteria | 2327 |
| 633 | Ga0265329_10001607 | 3300031242 | Bacteria | 10835 |
| 634 | Ga0265331_10000303 | 3300031250 | Bacteria | 53811 |
| 635 | Ga0265331_10000565 | 3300031250 | Bacteria | 33257 |
| 636 | Ga0265327_10000007 | 3300031251 | Bacteria | 678515 |
| 637 | Ga0265327_10000217 | 3300031251 | Bacteria | 117085 |
| 638 | Ga0265327_10021683 | 3300031251 | Bacteria | 3869 |
| 639 | Ga0307513_10378038 | 3300031456 | Bacteria | 1157 |
| 640 | Ga0307509_10122075 | 3300031507 | Bacteria | 2581 |
| 641 | Ga0307509_10125632 | 3300031507 | Bacteria | 2532 |
| 642 | Ga0307509_10155234 | 3300031507 | Bacteria | 2196 |
| 643 | Ga0307509_10175510 | 3300031507 | Bacteria | 2016 |
| 644 | Ga0307509_10225497 | 3300031507 | Bacteria | 1682 |
| 645 | Ga0307408_100005566 | 3300031548 | Bacteria | 8420 |
| 646 | Ga0307408_100012826 | 3300031548 | Bacteria | 5558 |
| 647 | Ga0307408_100105642 | 3300031548 | Bacteria | 2153 |
| 648 | Ga0307408_100421549 | 3300031548 | Bacteria | 1151 |
| 649 | Ga0307508_10007413 | 3300031616 | Bacteria | 10216 |
| 650 | Ga0307514_10178034 | 3300031649 | Bacteria | 1376 |
| 651 | Ga0316579_10080889 | 3300031691 | Bacteria | 1546 |
| 652 | Ga0307516_10225042 | 3300031730 | Bacteria | 1583 |
| 653 | Ga0307405_10001063 | 3300031731 | Bacteria | 11146 |
| 654 | Ga0307405_10165804 | 3300031731 | Bacteria | 1570 |
| 655 | Ga0316577_10014934 | 3300031733 | Bacteria | 4269 |
| 656 | Ga0307518_10014580 | 3300031838 | Bacteria | 5615 |
| 657 | Ga0307410_10177943 | 3300031852 | Bacteria | 1608 |
| 658 | Ga0307406_10003525 | 3300031901 | Bacteria | 8529 |
| 659 | Ga0307406_10012543 | 3300031901 | Bacteria | 4831 |
| 660 | Ga0307406_10014170 | 3300031901 | Bacteria | 4582 |
| 661 | Ga0307407_10004629 | 3300031903 | Bacteria | 5868 |
| 662 | Ga0307412_10000021 | 3300031911 | Bacteria | 250629 |
| 663 | Ga0307412_10005897 | 3300031911 | Bacteria | 6899 |
| 664 | Ga0307412_10009253 | 3300031911 | Bacteria | 5647 |
| 665 | Ga0307412_10419582 | 3300031911 | Bacteria | 1094 |
| 666 | Ga0307409_100005917 | 3300031995 | Bacteria | 7111 |
| 667 | Ga0307409_100045019 | 3300031995 | Bacteria | 3328 |
| 668 | Ga0307416_100010456 | 3300032002 | Bacteria | 6129 |
| 669 | Ga0307416_100039057 | 3300032002 | Bacteria | 3670 |
| 670 | Ga0307414_10007717 | 3300032004 | Bacteria | 6061 |
| 671 | Ga0307414_10043954 | 3300032004 | Bacteria | 3046 |
| 672 | Ga0307411_10004935 | 3300032005 | Bacteria | 6487 |
| 673 | Ga0307411_10020892 | 3300032005 | Bacteria | 3818 |
| 674 | Ga0307411_10313913 | 3300032005 | Bacteria | 1263 |
| 675 | Ga0307415_100053831 | 3300032126 | Bacteria | 2744 |
| 676 | Ga0316583_10003221 | 3300032133 | Bacteria | 5743 |
| 677 | Ga0316580_10018958 | 3300032139 | Bacteria | 2117 |
| 678 | Ga0373934_0000479 | 3300035086 | Bacteria | 13995 |
| 679 | Ga0373934_0020623 | 3300035086 | Bacteria | 2534 |
| 680 | Ga0373951_0040641 | 3300035091 | Bacteria | 1121 |
| 681 | Ga0373939_0026399 | 3300035114 | Bacteria | 1637 |
| 682 | Ga0373954_0066196 | 3300035118 | Bacteria | 1711 |
| 683 | Ga0373956_0000131 | 3300035119 | Bacteria | 26456 |
| 684 | Ga0373943_0012155 | 3300035170 | Bacteria | 3878 |
| 685 | Ga0373955_0073983 | 3300035172 | Bacteria | 1911 |
| 686 | Ga0373955_0081153 | 3300035172 | Bacteria | 1833 |
| 687 | Ga0316574_0030171 | 3300035398 | Bacteria | 3281 |
| 688 | Ga0373931_0014996 | 3300035691 | Bacteria | 3798 |
| 689 | Ga0373927_0006033 | 3300035695 | Bacteria | 8301 |
| 690 | Ga0373933_0001235 | 3300035724 | Bacteria | 15111 |
| 691 | Ga0373933_0084980 | 3300035724 | Bacteria | 1945 |
| 692 | Ga0373937_0000096 | 3300036401 | Bacteria | 81963 |
| 693 | Ga0316582_0024709 | 3300036647 | Bacteria | 3598 |
| 694 | Ga0316584_0007474 | 3300036712 | Bacteria | 7477 |
| 695 | Ga0373925_0163286 | 3300037068 | Bacteria | 1755 |
| 696 | Ga0395899_0000082 | 3300037312 | Bacteria | 168513 |
| 697 | Ga0395899_0003408 | 3300037312 | Bacteria | 12614 |
| 698 | Ga0395899_0030796 | 3300037312 | Bacteria | 4034 |
| 699 | Ga0395900_0120046 | 3300037418 | Bacteria | 2698 |
| 700 | Ga0395900_0133493 | 3300037418 | Unclassified | 2543 |
| 701 | Ga0395900_0231168 | 3300037418 | Bacteria | 1859 |
| 702 | Ga0395900_0627722 | 3300037418 | Bacteria | 1013 |
| 703 | Ga0395898_0031878 | 3300037466 | Bacteria | 5263 |
| 704 | Ga0395898_0042130 | 3300037466 | Bacteria | 4506 |
| 705 | Ga0395905_0000148 | 3300037471 | Bacteria | 116301 |
| 706 | Ga0395905_0000459 | 3300037471 | Bacteria | 57003 |
| 707 | Ga0395905_0014764 | 3300037471 | Bacteria | 7446 |
| 708 | Ga0316581_0002029 | 3300037588 | Bacteria | 4753 |
| 709 | Ga0395901_0000077 | 3300038443 | Bacteria | 135073 |
| 710 | Ga0395901_0042064 | 3300038443 | Bacteria | 4736 |
| 711 | Ga0395901_0353097 | 3300038443 | Bacteria | 1517 |
| 712 | Ga0400490_40529 | 3300038726 | Bacteria | 4102 |
| 713 | Ga0436365_0066966 | 3300039437 | Bacteria | 3639 |
| 714 | Ga0436361_0091859 | 3300039447 | Bacteria | 14185 |
| 715 | Ga0436361_0247137 | 3300039447 | Bacteria | 14220 |
| 716 | Ga0436361_0299736 | 3300039447 | Bacteria | 5326 |
| 717 | Ga0436361_0420505 | 3300039447 | Bacteria | 103715 |
| 718 | Ga0436361_0624331 | 3300039447 | Bacteria | 6509 |
| 719 | Ga0436361_0633280 | 3300039447 | Bacteria | 103480 |
| 720 | Ga0436361_0943694 | 3300039447 | Bacteria | 119574 |
| 721 | Ga0436361_1030340 | 3300039447 | Bacteria | 59405 |
| 722 | Ga0451795_1374636 | 3300041456 | Bacteria | 1680 |
| 723 | Ga0451798_0725560 | 3300041458 | Bacteria | 7655 |
| 724 | Ga0451804_0286988 | 3300041463 | Bacteria | 1303 |
| 725 | Ga0450890_007887 | 3300042127 | Bacteria | 1362 |
| 726 | Ga0451577_0000114 | 3300042876 | Bacteria | 175957 |
| 727 | Ga0451577_0002513 | 3300042876 | Bacteria | 21729 |
| 728 | Ga0451577_0013618 | 3300042876 | Bacteria | 7605 |
| 729 | Ga0466969_0004483 | 3300044656 | Bacteria | 7432 |
| 730 | Ga0466969_0023385 | 3300044656 | Bacteria | 3185 |
| 731 | Ga0466972_0000060 | 3300044658 | Bacteria | 109789 |
| 732 | Ga0466977_0016580 | 3300044666 | Bacteria | 4435 |
| 733 | Ga0453683_0015371 | 3300044673 | Bacteria | 4957 |
| 734 | Ga0453683_0052988 | 3300044673 | Bacteria | 2539 |
| 735 | Ga0466965_0001277 | 3300044683 | Bacteria | 10021 |
| 736 | Ga0466966_0005728 | 3300044684 | Bacteria | 8177 |
| 737 | Ga0466966_0291233 | 3300044684 | Bacteria | 981 |
| 738 | Ga0466963_0005199 | 3300044694 | Bacteria | 7598 |
| 739 | Ga0453684_0001710 | 3300044712 | Bacteria | 59044 |
| 740 | Ga0453684_0033923 | 3300044712 | Bacteria | 7100 |
| 741 | Ga0453684_0359327 | 3300044712 | Bacteria | 1640 |
| 742 | Ga0453684_0779254 | 3300044712 | Bacteria | 1033 |
| 743 | Ga0466968_0005441 | 3300044735 | Bacteria | 4765 |
| 744 | Ga0466957_0212470 | 3300044842 | Bacteria | 1274 |
| 745 | Ga0466957_0212841 | 3300044842 | Bacteria | 1273 |
| 746 | Ga0451576_0000119 | 3300045051 | Bacteria | 200621 |
| 747 | Ga0451576_0001379 | 3300045051 | Bacteria | 41763 |
| 748 | Ga0451576_0004409 | 3300045051 | Bacteria | 18312 |
| 749 | Ga0451576_0005551 | 3300045051 | Bacteria | 15758 |
| 750 | Ga0451576_0008593 | 3300045051 | Bacteria | 11965 |
| 751 | Ga0451576_0181381 | 3300045051 | Bacteria | 2198 |
| 752 | Ga0451576_0271485 | 3300045051 | Bacteria | 1773 |
| 753 | Ga0466958_0001681 | 3300045836 | Bacteria | 10674 |
| 754 | Ga0466967_0225430 | 3300045976 | Bacteria | 1783 |
| 755 | Ga0495617_000039 | 3300046452 | Bacteria | 128069 |
| 756 | Ga0495627_000280 | 3300046453 | Bacteria | 51506 |
| 757 | Ga0495592_0010535 | 3300046454 | Bacteria | 6972 |
| 758 | Ga0495592_0021747 | 3300046454 | Bacteria | 4880 |
| 759 | Ga0495592_0079197 | 3300046454 | Bacteria | 2378 |
| 760 | Ga0495603_0007351 | 3300046455 | Bacteria | 6626 |
| 761 | Ga0495603_0106439 | 3300046455 | Bacteria | 1636 |
| 762 | Ga0495590_0000018 | 3300046457 | Bacteria | 216375 |
| 763 | Ga0495590_0005435 | 3300046457 | Bacteria | 5056 |
| 764 | Ga0495590_0016311 | 3300046457 | Bacteria | 2685 |
| 765 | Ga0495591_000218 | 3300046458 | Bacteria | 57622 |
| 766 | Ga0495591_029225 | 3300046458 | Bacteria | 1677 |
| 767 | Ga0495629_0000172 | 3300046459 | Bacteria | 57319 |
| 768 | Ga0495629_0000506 | 3300046459 | Bacteria | 32709 |
| 769 | Ga0495629_0000725 | 3300046459 | Bacteria | 26753 |
| 770 | Ga0495629_0002744 | 3300046459 | Bacteria | 13472 |
| 771 | Ga0495629_0018715 | 3300046459 | Bacteria | 4949 |
| 772 | Ga0495629_0183757 | 3300046459 | Bacteria | 1448 |
| 773 | Ga0495629_0188774 | 3300046459 | Bacteria | 1427 |
| 774 | Ga0495641_0009612 | 3300046461 | Bacteria | 5724 |
| 775 | Ga0495651_0000085 | 3300046462 | Bacteria | 68214 |
| 776 | Ga0495651_0017252 | 3300046462 | Bacteria | 5593 |
| 777 | Ga0495651_0121874 | 3300046462 | Bacteria | 1914 |
| 778 | Ga0495653_0012213 | 3300046463 | Bacteria | 7006 |
| 779 | Ga0495653_0019400 | 3300046463 | Bacteria | 5514 |
| 780 | Ga0495653_0030155 | 3300046463 | Bacteria | 4323 |
| 781 | Ga0495653_0043631 | 3300046463 | Bacteria | 3485 |
| 782 | Ga0495653_0053267 | 3300046463 | Bacteria | 3096 |
| 783 | Ga0495650_0000166 | 3300046471 | Bacteria | 146047 |
| 784 | Ga0495650_0000442 | 3300046471 | Bacteria | 66640 |
| 785 | Ga0495650_0007870 | 3300046471 | Bacteria | 6330 |
| 786 | Ga0495650_0078939 | 3300046471 | Bacteria | 1273 |
| 787 | Ga0495580_0000812 | 3300046472 | Bacteria | 27065 |
| 788 | Ga0495580_0002910 | 3300046472 | Bacteria | 14703 |
| 789 | Ga0495580_0018014 | 3300046472 | Bacteria | 5265 |
| 790 | Ga0495580_0059891 | 3300046472 | Bacteria | 2675 |
| 791 | Ga0495582_0000614 | 3300046473 | Bacteria | 19582 |
| 792 | Ga0495582_0189132 | 3300046473 | Bacteria | 1174 |
| 793 | Ga0495605_0000059 | 3300046474 | Bacteria | 146371 |
| 794 | Ga0495605_0000256 | 3300046474 | Bacteria | 62672 |
| 795 | Ga0495605_0003771 | 3300046474 | Bacteria | 8993 |
| 796 | Ga0495605_0024925 | 3300046474 | Bacteria | 3122 |
| 797 | Ga0495605_0032897 | 3300046474 | Bacteria | 2637 |
| 798 | Ga0495639_0000788 | 3300046475 | Bacteria | 14461 |
| 799 | Ga0495662_0067007 | 3300046476 | Bacteria | 1737 |
| 800 | Ga0495662_0095011 | 3300046476 | Bacteria | 1456 |
| 801 | Ga0495664_0021769 | 3300046477 | Bacteria | 3704 |
| 802 | Ga0495664_0073651 | 3300046477 | Bacteria | 2042 |
| 803 | Ga0495584_0000006 | 3300046491 | Bacteria | 301775 |
| 804 | Ga0495585_0000288 | 3300046492 | Bacteria | 50504 |
| 805 | Ga0495585_0002218 | 3300046492 | Bacteria | 14068 |
| 806 | Ga0495585_0010453 | 3300046492 | Bacteria | 5518 |
| 807 | Ga0495594_0000364 | 3300046499 | Bacteria | 22686 |
| 808 | Ga0495594_0057981 | 3300046499 | Bacteria | 2138 |
| 809 | Ga0495594_0069218 | 3300046499 | Bacteria | 1960 |
| 810 | Ga0495607_0002393 | 3300046501 | Bacteria | 15298 |
| 811 | Ga0495607_0075043 | 3300046501 | Bacteria | 1875 |
| 812 | Ga0495583_0000121 | 3300046506 | Bacteria | 132793 |
| 813 | Ga0495583_0000809 | 3300046506 | Bacteria | 38609 |
| 814 | Ga0495583_0001694 | 3300046506 | Bacteria | 21286 |
| 815 | Ga0495583_0012014 | 3300046506 | Bacteria | 4932 |
| 816 | Ga0495606_0000064 | 3300046507 | Bacteria | 183631 |
| 817 | Ga0495606_0005502 | 3300046507 | Bacteria | 12113 |
| 818 | Ga0495606_0025325 | 3300046507 | Bacteria | 4251 |
| 819 | Ga0495608_0006938 | 3300046511 | Bacteria | 8021 |
| 820 | Ga0495610_0001938 | 3300046512 | Bacteria | 17830 |
| 821 | Ga0495610_0002499 | 3300046512 | Bacteria | 15367 |
| 822 | Ga0495610_0006142 | 3300046512 | Bacteria | 8363 |
| 823 | Ga0495610_0012787 | 3300046512 | Bacteria | 5023 |
| 824 | Ga0495616_0001160 | 3300046513 | Bacteria | 18645 |
| 825 | Ga0495616_0006600 | 3300046513 | Bacteria | 7010 |
| 826 | Ga0495616_0028044 | 3300046513 | Bacteria | 2983 |
| 827 | Ga0495618_0013302 | 3300046514 | Bacteria | 5008 |
| 828 | Ga0495628_0003383 | 3300046516 | Bacteria | 14268 |
| 829 | Ga0495628_0003726 | 3300046516 | Bacteria | 13565 |
| 830 | Ga0495628_0012653 | 3300046516 | Bacteria | 7109 |
| 831 | Ga0495628_0088195 | 3300046516 | Bacteria | 2404 |
| 832 | Ga0495630_0047368 | 3300046517 | Bacteria | 3216 |
| 833 | Ga0495630_0095077 | 3300046517 | Bacteria | 2252 |
| 834 | Ga0495630_0165145 | 3300046517 | Bacteria | 1685 |
| 835 | Ga0495630_0176096 | 3300046517 | Bacteria | 1630 |
| 836 | Ga0495631_0001316 | 3300046518 | Bacteria | 15206 |
| 837 | Ga0495631_0005164 | 3300046518 | Bacteria | 6877 |
| 838 | Ga0495631_0013480 | 3300046518 | Bacteria | 3967 |
| 839 | Ga0495632_0012093 | 3300046519 | Bacteria | 4994 |
| 840 | Ga0495632_0063953 | 3300046519 | Bacteria | 1780 |
| 841 | Ga0495637_0000004 | 3300046520 | Bacteria | 589740 |
| 842 | Ga0495643_0136732 | 3300046522 | Bacteria | 1225 |
| 843 | Ga0495644_0018028 | 3300046523 | Bacteria | 2695 |
| 844 | Ga0495648_0000149 | 3300046524 | Bacteria | 83674 |
| 845 | Ga0495648_0000908 | 3300046524 | Bacteria | 30919 |
| 846 | Ga0495648_0051755 | 3300046524 | Bacteria | 2499 |
| 847 | Ga0495648_0070358 | 3300046524 | Bacteria | 2033 |
| 848 | Ga0495666_0000427 | 3300046526 | Bacteria | 18658 |
| 849 | Ga0495666_0045536 | 3300046526 | Bacteria | 2116 |
| 850 | Ga0495666_0050297 | 3300046526 | Bacteria | 2003 |
| 851 | Ga0495666_0065467 | 3300046526 | Bacteria | 1733 |
| 852 | Ga0495642_0001386 | 3300046528 | Bacteria | 10850 |
| 853 | Ga0495642_0117975 | 3300046528 | Bacteria | 1137 |
| 854 | Ga0495652_0005738 | 3300046529 | Bacteria | 11629 |
| 855 | Ga0495652_0043262 | 3300046529 | Bacteria | 3880 |
| 856 | Ga0495654_0037660 | 3300046530 | Bacteria | 2423 |
| 857 | Ga0495665_0001409 | 3300046531 | Bacteria | 12877 |
| 858 | Ga0495665_0017932 | 3300046531 | Bacteria | 3804 |
| 859 | Ga0495665_0059385 | 3300046531 | Bacteria | 2018 |
| 860 | Ga0495665_0065258 | 3300046531 | Bacteria | 1921 |
| 861 | Ga0495665_0086174 | 3300046531 | Bacteria | 1650 |
| 862 | Ga0495665_0142255 | 3300046531 | Bacteria | 1253 |
| 863 | Ga0495640_0093109 | 3300046533 | Bacteria | 1986 |
| 864 | Ga0495586_0004311 | 3300046535 | Bacteria | 7598 |
| 865 | Ga0495586_0125013 | 3300046535 | Bacteria | 1438 |
| 866 | Ga0495587_0010410 | 3300046536 | Bacteria | 5921 |
| 867 | Ga0495598_0019217 | 3300046537 | Bacteria | 1788 |
| 868 | Ga0495598_0022229 | 3300046537 | Bacteria | 1695 |
| 869 | Ga0495609_0005541 | 3300046538 | Bacteria | 6594 |
| 870 | Ga0495609_0011626 | 3300046538 | Bacteria | 4189 |
| 871 | Ga0495621_0003440 | 3300046539 | Bacteria | 4372 |
| 872 | Ga0495597_0003154 | 3300046542 | Bacteria | 9868 |
| 873 | Ga0495597_0028713 | 3300046542 | Bacteria | 2544 |
| 874 | Ga0495645_0000357 | 3300046543 | Bacteria | 31874 |
| 875 | Ga0495645_0001492 | 3300046543 | Bacteria | 15847 |
| 876 | Ga0495622_0000551 | 3300046557 | Bacteria | 22485 |
| 877 | Ga0495622_0002768 | 3300046557 | Bacteria | 8383 |
| 878 | Ga0495622_0009230 | 3300046557 | Bacteria | 4564 |
| 879 | Ga0495622_0017647 | 3300046557 | Bacteria | 3322 |
| 880 | Ga0495622_0073870 | 3300046557 | Bacteria | 1573 |
| 881 | Ga0495633_0004666 | 3300046558 | Bacteria | 8625 |
| 882 | Ga0495633_0021525 | 3300046558 | Bacteria | 3223 |
| 883 | Ga0495633_0056826 | 3300046558 | Bacteria | 1839 |
| 884 | Ga0495668_0000185 | 3300046616 | Bacteria | 92731 |
| 885 | Ga0495668_0004037 | 3300046616 | Bacteria | 10678 |
| 886 | Ga0495668_0015499 | 3300046616 | Bacteria | 4449 |
| 887 | Ga0495668_0020606 | 3300046616 | Bacteria | 3791 |
| 888 | Ga0495634_0001507 | 3300046642 | Bacteria | 20604 |
| 889 | Ga0495634_0029934 | 3300046642 | Bacteria | 3764 |
| 890 | Ga0495611_0001094 | 3300046648 | Bacteria | 14270 |
| 891 | Ga0495611_0001338 | 3300046648 | Bacteria | 12509 |
| 892 | Ga0495611_0001418 | 3300046648 | Bacteria | 11966 |
| 893 | Ga0495611_0020618 | 3300046648 | Bacteria | 2838 |
| 894 | Ga0495611_0034931 | 3300046648 | Bacteria | 2224 |
| 895 | Ga0495611_0073261 | 3300046648 | Bacteria | 1567 |
| 896 | Ga0495625_0000372 | 3300046660 | Bacteria | 68695 |
| 897 | Ga0495625_0001737 | 3300046660 | Bacteria | 25184 |
| 898 | Ga0495625_0063464 | 3300046660 | Bacteria | 2608 |
| 899 | Ga0495635_0005954 | 3300046663 | Bacteria | 8507 |
| 900 | Ga0495635_0010057 | 3300046663 | Bacteria | 6615 |
| 901 | Ga0495635_0030228 | 3300046663 | Bacteria | 3764 |
| 902 | Ga0495635_0135697 | 3300046663 | Bacteria | 1677 |
| 903 | Ga0495659_0000065 | 3300046664 | Bacteria | 47327 |
| 904 | Ga0495659_0006310 | 3300046664 | Bacteria | 3746 |
| 905 | Ga0495661_0006787 | 3300046665 | Bacteria | 8025 |
| 906 | Ga0495661_0135356 | 3300046665 | Bacteria | 1345 |
| 907 | Ga0495588_0049916 | 3300046674 | Bacteria | 2152 |
| 908 | Ga0495588_0112599 | 3300046674 | Bacteria | 1433 |
| 909 | Ga0495588_0148341 | 3300046674 | Bacteria | 1239 |
| 910 | Ga0495657_0115803 | 3300046675 | Bacteria | 1693 |
| 911 | Ga0495599_0000788 | 3300046678 | Bacteria | 17818 |
| 912 | Ga0495599_0000876 | 3300046678 | Bacteria | 16808 |
| 913 | Ga0495599_0087493 | 3300046678 | Bacteria | 1945 |
| 914 | Ga0495599_0095101 | 3300046678 | Bacteria | 1858 |
| 915 | Ga0495623_0020310 | 3300046679 | Bacteria | 4293 |
| 916 | Ga0495623_0068045 | 3300046679 | Bacteria | 2221 |
| 917 | Ga0495623_0109472 | 3300046679 | Bacteria | 1675 |
| 918 | Ga0495646_0009887 | 3300046680 | Bacteria | 6060 |
| 919 | Ga0495647_0001075 | 3300046681 | Bacteria | 8331 |
| 920 | Ga0495658_0001306 | 3300046683 | Bacteria | 13049 |
| 921 | Ga0495658_0014681 | 3300046683 | Bacteria | 4005 |
| 922 | Ga0495658_0140868 | 3300046683 | Bacteria | 1475 |
| 923 | Ga0495669_0000870 | 3300046684 | Bacteria | 12768 |
| 924 | Ga0495669_0001618 | 3300046684 | Bacteria | 9247 |
| 925 | Ga0495669_0066699 | 3300046684 | Bacteria | 1635 |
| 926 | Ga0495613_0001074 | 3300046689 | Bacteria | 20824 |
| 927 | Ga0495613_0003580 | 3300046689 | Bacteria | 11638 |
| 928 | Ga0495624_0004787 | 3300046690 | Bacteria | 9840 |
| 929 | Ga0495624_0110253 | 3300046690 | Bacteria | 1692 |
| 930 | Ga0495670_0059855 | 3300046691 | Bacteria | 1912 |
| 931 | Ga0495670_0063406 | 3300046691 | Bacteria | 1860 |
| 932 | Ga0495671_0000903 | 3300046692 | Bacteria | 21167 |
| 933 | Ga0495649_0017065 | 3300046694 | Bacteria | 4105 |
| 934 | Ga0495649_0055457 | 3300046694 | Bacteria | 2141 |
| 935 | Ga0495649_0120694 | 3300046694 | Bacteria | 1386 |
| 936 | Ga0495589_0012497 | 3300046794 | Bacteria | 4397 |
| 937 | Ga0495589_0013954 | 3300046794 | Bacteria | 4142 |
| 938 | Ga0495600_0000151 | 3300046809 | Bacteria | 39828 |
| 939 | Ga0495600_0146905 | 3300046809 | Bacteria | 1528 |
| 940 | Ga0495660_0013101 | 3300046810 | Bacteria | 4806 |
| 941 | Ga0495581_0001952 | 3300047315 | Bacteria | 11545 |
| 942 | Ga0495581_0003415 | 3300047315 | Bacteria | 9119 |
| 943 | Ga0495581_0019225 | 3300047315 | Bacteria | 3964 |
| 944 | Ga0495604_0016637 | 3300047317 | Bacteria | 5881 |
| 945 | Ga0495604_0036410 | 3300047317 | Bacteria | 3879 |
| 946 | Ga0495604_0038131 | 3300047317 | Bacteria | 3781 |
| 947 | Ga0495604_0057846 | 3300047317 | Bacteria | 2979 |
| 948 | Ga0495604_0072862 | 3300047317 | Bacteria | 2594 |
| 949 | Ga0495636_0080117 | 3300047318 | Bacteria | 1405 |
| 950 | Ga0495674_0003612 | 3300047319 | Bacteria | 15056 |
| 951 | Ga0495674_0008069 | 3300047319 | Bacteria | 10052 |
| 952 | Ga0495674_0048438 | 3300047319 | Bacteria | 3760 |
| 953 | Ga0495674_0092897 | 3300047319 | Bacteria | 2575 |
| 954 | Ga0495674_0188638 | 3300047319 | Bacteria | 1714 |
| 955 | Ga0495674_0194483 | 3300047319 | Bacteria | 1684 |
| 956 | Ga0495674_0321061 | 3300047319 | Bacteria | 1261 |
| 957 | Ga0495672_0000477 | 3300047320 | Bacteria | 47447 |
| 958 | Ga0495672_0000627 | 3300047320 | Bacteria | 39464 |
| 959 | Ga0495672_0003268 | 3300047320 | Bacteria | 14029 |
| 960 | Ga0495672_0037296 | 3300047320 | Bacteria | 2975 |
| 961 | Ga0495672_0048418 | 3300047320 | Bacteria | 2520 |
| 962 | Ga0495672_0131721 | 3300047320 | Bacteria | 1314 |
| 963 | Ga0495676_0001397 | 3300047321 | Bacteria | 20781 |
| 964 | Ga0495676_0028005 | 3300047321 | Bacteria | 4822 |
| 965 | Ga0495676_0212855 | 3300047321 | Bacteria | 1336 |
| 966 | Ga0495676_0266921 | 3300047321 | Bacteria | 1162 |
| 967 | Ga0495676_0406120 | 3300047321 | Bacteria | 903 |
| 968 | Ga0495680_0016593 | 3300047322 | Bacteria | 6321 |
| 969 | Ga0495680_0018438 | 3300047322 | Bacteria | 5926 |
| 970 | Ga0495680_0240217 | 3300047322 | Bacteria | 1287 |
| 971 | Ga0495683_0000041 | 3300047323 | Bacteria | 137557 |
| 972 | Ga0495683_0004175 | 3300047323 | Bacteria | 8255 |
| 973 | Ga0495683_0019448 | 3300047323 | Bacteria | 3504 |
| 974 | Ga0495683_0035521 | 3300047323 | Bacteria | 2533 |
| 975 | Ga0495683_0068444 | 3300047323 | Bacteria | 1746 |
| 976 | Ga0495683_0072097 | 3300047323 | Bacteria | 1694 |
| 977 | Ga0495687_000437 | 3300047443 | Bacteria | 51548 |
| 978 | Ga0495687_008170 | 3300047443 | Bacteria | 6034 |
| 979 | Ga0495687_038829 | 3300047443 | Bacteria | 2110 |
| 980 | Ga0495687_042191 | 3300047443 | Bacteria | 1995 |
| 981 | Ga0495687_101599 | 3300047443 | Bacteria | 1077 |
| 982 | Ga0495675_0019316 | 3300047444 | Bacteria | 4328 |
| 983 | Ga0495675_0024438 | 3300047444 | Bacteria | 3851 |
| 984 | Ga0495675_0045983 | 3300047444 | Bacteria | 2779 |
| 985 | Ga0495675_0046686 | 3300047444 | Bacteria | 2757 |
| 986 | Ga0495675_0108964 | 3300047444 | Bacteria | 1729 |
| 987 | Ga0495677_0002560 | 3300047445 | Bacteria | 7115 |
| 988 | Ga0495677_0002828 | 3300047445 | Bacteria | 6761 |
| 989 | Ga0495677_0021867 | 3300047445 | Bacteria | 2318 |
| 990 | Ga0495677_0030456 | 3300047445 | Bacteria | 1963 |
| 991 | Ga0495679_000214 | 3300047446 | Bacteria | 49621 |
| 992 | Ga0495679_009023 | 3300047446 | Bacteria | 4016 |
| 993 | Ga0495673_0000003 | 3300047469 | Bacteria | 1491337 |
| 994 | Ga0495673_0003810 | 3300047469 | Bacteria | 9741 |
| 995 | Ga0495673_0061029 | 3300047469 | Bacteria | 1615 |
| 996 | Ga0495681_0011038 | 3300047470 | Bacteria | 5416 |
| 997 | Ga0495681_0081933 | 3300047470 | Bacteria | 1439 |
| 998 | Ga0495686_0000002 | 3300047472 | Bacteria | 1050777 |
| 999 | Ga0495686_0000350 | 3300047472 | Bacteria | 75596 |
| 1000 | Ga0495686_0000675 | 3300047472 | Bacteria | 46177 |
| 1001 | Ga0495593_0002755 | 3300047673 | Bacteria | 10582 |
| 1002 | Ga0495593_0003119 | 3300047673 | Bacteria | 9964 |
| 1003 | Ga0495593_0013716 | 3300047673 | Bacteria | 4615 |
| 1004 | Ga0495602_0026848 | 3300048088 | Bacteria | 5545 |
| 1005 | Ga0495602_0032598 | 3300048088 | Bacteria | 4903 |
| 1006 | Ga0495602_0055501 | 3300048088 | Bacteria | 3488 |
| 1007 | Ga0495602_0059754 | 3300048088 | Bacteria | 3325 |
| 1008 | Ga0495602_0085305 | 3300048088 | Bacteria | 2639 |
| 1009 | Ga0495602_0122900 | 3300048088 | Bacteria | 2085 |
| 1010 | Ga0495602_0142272 | 3300048088 | Bacteria | 1897 |
| 1011 | Ga0495614_0000266 | 3300048089 | Bacteria | 20351 |
| 1012 | Ga0495614_0005291 | 3300048089 | Bacteria | 5821 |
| 1013 | Ga0495614_0035946 | 3300048089 | Bacteria | 2127 |
| 1014 | Ga0495614_0050574 | 3300048089 | Bacteria | 1780 |
| 1015 | Ga0495626_0089260 | 3300048091 | Bacteria | 1357 |
| 1016 | Ga0496100_0002406 | 3300048903 | Bacteria | 9478 |
| 1017 | Ga0496100_0119378 | 3300048903 | Bacteria | 1842 |
| 1018 | Ga0496100_0172254 | 3300048903 | Bacteria | 1560 |
| 1019 | Ga0496101_0001779 | 3300048904 | Bacteria | 12954 |
| 1020 | Ga0496101_0135646 | 3300048904 | Bacteria | 1872 |
| 1021 | Ga0496101_0238945 | 3300048904 | Bacteria | 1413 |
| 1022 | Ga0496102_0000123 | 3300048905 | Bacteria | 110781 |
| 1023 | Ga0496102_0000351 | 3300048905 | Bacteria | 55799 |
| 1024 | Ga0496102_0001049 | 3300048905 | Bacteria | 25567 |
| 1025 | Ga0496102_0005053 | 3300048905 | Bacteria | 11168 |
| 1026 | Ga0496102_0078328 | 3300048905 | Bacteria | 3042 |
| 1027 | Ga0496102_0731416 | 3300048905 | Bacteria | 912 |
| 1028 | Ga0496103_0002203 | 3300048906 | Bacteria | 12354 |
| 1029 | Ga0496103_0003261 | 3300048906 | Bacteria | 9943 |
| 1030 | Ga0496103_0053524 | 3300048906 | Bacteria | 2502 |
| 1031 | Ga0496104_0022546 | 3300048907 | Bacteria | 5784 |
| 1032 | Ga0496104_0045619 | 3300048907 | Bacteria | 4123 |
| 1033 | Ga0496104_0134914 | 3300048907 | Bacteria | 2371 |
| 1034 | Ga0496105_0013612 | 3300048908 | Bacteria | 6459 |
| 1035 | Ga0496105_0167086 | 3300048908 | Bacteria | 1805 |
| 1036 | Ga0496106_0003051 | 3300048909 | Bacteria | 12482 |
| 1037 | Ga0496106_0005737 | 3300048909 | Bacteria | 9181 |
| 1038 | Ga0496107_0029551 | 3300048910 | Bacteria | 3900 |
| 1039 | Ga0496108_0186218 | 3300048911 | Bacteria | 1798 |
| 1040 | Ga0496109_0006339 | 3300048912 | Bacteria | 9964 |
| 1041 | Ga0496109_0605821 | 3300048912 | Bacteria | 1032 |
| 1042 | Ga0496110_0003569 | 3300048913 | Bacteria | 11951 |
| 1043 | Ga0496110_0016993 | 3300048913 | Bacteria | 6082 |
| 1044 | Ga0496110_0453856 | 3300048913 | Bacteria | 1168 |
| 1045 | Ga0496111_0036636 | 3300048914 | Bacteria | 3508 |
| 1046 | Ga0496112_0013000 | 3300048915 | Bacteria | 7675 |
| 1047 | Ga0496112_0016390 | 3300048915 | Bacteria | 6941 |
| 1048 | Ga0496112_0271710 | 3300048915 | Bacteria | 1643 |
| 1049 | Ga0496113_0002808 | 3300048916 | Bacteria | 10255 |
| 1050 | Ga0496113_0026162 | 3300048916 | Bacteria | 4169 |
| 1051 | Ga0496113_0190879 | 3300048916 | Bacteria | 1626 |
| 1052 | Ga0496114_0025936 | 3300048917 | Bacteria | 4795 |
| 1053 | Ga0496115_0035563 | 3300048918 | Bacteria | 3941 |
| 1054 | Ga0496115_0159423 | 3300048918 | Bacteria | 1864 |
| 1055 | Ga0496115_0171688 | 3300048918 | Bacteria | 1793 |
| 1056 | Ga0496115_0212509 | 3300048918 | Bacteria | 1598 |
| 1057 | Ga0496116_0004405 | 3300048919 | Bacteria | 13460 |
| 1058 | Ga0496116_0067029 | 3300048919 | Bacteria | 2294 |
| 1059 | Ga0496117_0000001 | 3300048920 | Bacteria | 2526244 |
| 1060 | Ga0496117_0000589 | 3300048920 | Bacteria | 59852 |
| 1061 | Ga0496117_0068787 | 3300048920 | Bacteria | 2388 |
| 1062 | Ga0496117_0071738 | 3300048920 | Bacteria | 2319 |
| 1063 | Ga0496117_0114786 | 3300048920 | Bacteria | 1668 |
| 1064 | Ga0496117_0122632 | 3300048920 | Bacteria | 1593 |
| 1065 | Ga0496118_0000002 | 3300048921 | Bacteria | 1690764 |
| 1066 | Ga0496118_0000760 | 3300048921 | Bacteria | 52060 |
| 1067 | Ga0496118_0002012 | 3300048921 | Bacteria | 28785 |
| 1068 | Ga0496118_0026170 | 3300048921 | Bacteria | 4977 |
| 1069 | Ga0496118_0051370 | 3300048921 | Bacteria | 3154 |
| 1070 | Ga0496118_0062401 | 3300048921 | Bacteria | 2751 |
| 1071 | Ga0496118_0103009 | 3300048921 | Bacteria | 1922 |
| 1072 | Ga0496118_0121539 | 3300048921 | Bacteria | 1701 |
| 1073 | Ga0496119_0129734 | 3300048922 | Bacteria | 1375 |
| 1074 | Ga0496121_0002856 | 3300048924 | Bacteria | 25463 |
| 1075 | Ga0496121_0006525 | 3300048924 | Bacteria | 14424 |
| 1076 | Ga0496121_0013134 | 3300048924 | Bacteria | 8933 |
| 1077 | Ga0496121_0036376 | 3300048924 | Bacteria | 4388 |
| 1078 | Ga0496121_0087799 | 3300048924 | Bacteria | 2440 |
| 1079 | Ga0496121_0096756 | 3300048924 | Bacteria | 2289 |
| 1080 | Ga0496122_0001177 | 3300048925 | Bacteria | 44728 |
| 1081 | Ga0496122_0002190 | 3300048925 | Bacteria | 28574 |
| 1082 | Ga0496122_0003153 | 3300048925 | Bacteria | 22055 |
| 1083 | Ga0496123_0000295 | 3300048926 | Bacteria | 97562 |
| 1084 | Ga0496123_0000754 | 3300048926 | Bacteria | 52403 |
| 1085 | Ga0496123_0008961 | 3300048926 | Bacteria | 9094 |
| 1086 | Ga0496124_0015626 | 3300048927 | Bacteria | 7266 |
| 1087 | Ga0496124_0018274 | 3300048927 | Bacteria | 6571 |
| 1088 | Ga0496124_0146234 | 3300048927 | Bacteria | 1859 |
| 1089 | Ga0496124_0156254 | 3300048927 | Bacteria | 1783 |
| 1090 | Ga0496125_0001032 | 3300048928 | Bacteria | 43195 |
| 1091 | Ga0496125_0010264 | 3300048928 | Bacteria | 9484 |
| 1092 | Ga0496125_0078172 | 3300048928 | Bacteria | 2545 |
| 1093 | Ga0496126_0005441 | 3300048929 | Bacteria | 14521 |
| 1094 | Ga0496126_0005728 | 3300048929 | Bacteria | 14067 |
| 1095 | Ga0495678_000121 | 3300049459 | Bacteria | 91388 |
| 1096 | Ga0495682_0016024 | 3300049460 | Bacteria | 2836 |
| 1097 | Ga0501031_0043440 | 3300049568 | Bacteria | 2933 |
| 1098 | Ga0501033_0001193 | 3300049570 | Bacteria | 23470 |
| 1099 | Ga0501033_0115086 | 3300049570 | Bacteria | 1954 |
| 1100 | Ga0501036_0000543 | 3300049572 | Bacteria | 27032 |
| 1101 | Ga0501038_0000909 | 3300049574 | Bacteria | 26221 |
| 1102 | Ga0501039_0013843 | 3300049575 | Bacteria | 6171 |
| 1103 | Ga0501040_0000101 | 3300049576 | Bacteria | 43457 |
| 1104 | Ga0501041_0000405 | 3300049577 | Bacteria | 21753 |
| 1105 | Ga0501042_0062265 | 3300049578 | Bacteria | 2666 |
| 1106 | Ga0501043_0319819 | 3300049579 | Bacteria | 1183 |
| 1107 | Ga0501046_0004138 | 3300049580 | Bacteria | 13220 |
| 1108 | Ga0501046_0415155 | 3300049580 | Bacteria | 971 |
| 1109 | Ga0501048_0188329 | 3300049582 | Bacteria | 1462 |
| 1110 | Ga0501068_0057746 | 3300049584 | Bacteria | 2353 |
| 1111 | Ga0501070_0022979 | 3300049586 | Bacteria | 5220 |
| 1112 | Ga0501070_0106873 | 3300049586 | Bacteria | 2313 |
| 1113 | Ga0501071_0000233 | 3300049587 | Bacteria | 25446 |
| 1114 | Ga0501071_0047287 | 3300049587 | Bacteria | 3090 |
| 1115 | Ga0501071_0079840 | 3300049587 | Bacteria | 2392 |
| 1116 | Ga0501072_0000322 | 3300049588 | Bacteria | 34133 |
| 1117 | Ga0501072_0035424 | 3300049588 | Bacteria | 3909 |
| 1118 | Ga0501072_0297287 | 3300049588 | Bacteria | 1283 |
| 1119 | Ga0501073_0000354 | 3300049589 | Bacteria | 30944 |
| 1120 | Ga0501073_0099000 | 3300049589 | Bacteria | 2024 |
| 1121 | Ga0501074_0000738 | 3300049590 | Bacteria | 20528 |
| 1122 | Ga0501074_0025415 | 3300049590 | Bacteria | 4301 |
| 1123 | Ga0501075_0001506 | 3300049591 | Bacteria | 15184 |
| 1124 | Ga0501075_0114991 | 3300049591 | Bacteria | 2046 |
| 1125 | Ga0501076_0000092 | 3300049592 | Bacteria | 47957 |
| 1126 | Ga0501076_0056508 | 3300049592 | Bacteria | 3115 |
| 1127 | Ga0501077_0000070 | 3300049593 | Bacteria | 51447 |
| 1128 | Ga0501077_0012657 | 3300049593 | Bacteria | 5283 |
| 1129 | Ga0501198_000003 | 3300049649 | Bacteria | 175301 |
| 1130 | Ga0501198_000015 | 3300049649 | Bacteria | 102945 |
| 1131 | Ga0501222_000014 | 3300049662 | Bacteria | 83609 |
| 1132 | Ga0501222_000045 | 3300049662 | Bacteria | 46767 |
| 1133 | Ga0501223_019752 | 3300049663 | Bacteria | 1323 |
| 1134 | Ga0501257_013553 | 3300049686 | Bacteria | 1870 |
| 1135 | Ga0501079_0000005 | 3300049741 | Bacteria | 85998 |
| 1136 | Ga0501079_0002075 | 3300049741 | Bacteria | 14369 |
| 1137 | Ga0501080_0004800 | 3300049742 | Bacteria | 12056 |
| 1138 | Ga0501080_0070029 | 3300049742 | Bacteria | 3262 |
| 1139 | Ga0501081_0001379 | 3300049743 | Bacteria | 14866 |
| 1140 | Ga0501083_0051148 | 3300049744 | Bacteria | 2779 |
| 1141 | Ga0501083_0067703 | 3300049744 | Bacteria | 2377 |
| 1142 | Ga0501083_0181134 | 3300049744 | Bacteria | 1376 |
| 1143 | Ga0501280_001851 | 3300049776 | Bacteria | 3716 |
| 1144 | Ga0501035_0001495 | 3300049822 | Bacteria | 23928 |
| 1145 | Ga0501044_0065993 | 3300049823 | Bacteria | 3691 |
| 1146 | Ga0501044_0144303 | 3300049823 | Bacteria | 2367 |
| 1147 | Ga0501045_0000596 | 3300049824 | Bacteria | 22747 |
| 1148 | nmdc:mga0yw44_274305_c1 | 3300050492 | Bacteria | 1126 |
| 1149 | nmdc:mga0k408_261606_c1 | 3300050493 | Bacteria | 1033 |
| 1150 | nmdc:mga0k408_6321_c1 | 3300050493 | Bacteria | 6322 |
| 1151 | nmdc:mga0k408_7248_c1 | 3300050493 | Bacteria | 5927 |
| 1152 | nmdc:mga06z11_26874_c1 | 3300050494 | Bacteria | 2745 |
| 1153 | nmdc:mga07m45_14547_c1 | 3300050496 | Bacteria | 4195 |
| 1154 | nmdc:mga07m45_5726_c1 | 3300050496 | Bacteria | 6216 |
| 1155 | nmdc:mga05p37_113514_c2 | 3300050507 | Bacteria | 2289 |
| 1156 | nmdc:mga05p37_846524_c1 | 3300050507 | Bacteria | 994 |
| 1157 | nmdc:mga09592_236985_c1 | 3300050508 | Bacteria | 1581 |
| 1158 | nmdc:mga08y16_131209_c1 | 3300050511 | Bacteria | 2605 |
| 1159 | nmdc:mga08y16_254065_c1 | 3300050511 | Bacteria | 1816 |
| 1160 | nmdc:mga08y16_267174_c1 | 3300050511 | Bacteria | 1766 |
| 1161 | nmdc:mga08y16_39060_c1 | 3300050511 | Bacteria | 4981 |
| 1162 | nmdc:mga08y16_39966_c1 | 3300050511 | Bacteria | 4920 |
| 1163 | nmdc:mga08y16_558217_c1 | 3300050511 | Bacteria | 1158 |
| 1164 | nmdc:mga08y16_6905_c1 | 3300050511 | Bacteria | 11901 |
| 1165 | nmdc:mga0n895_89883_c1 | 3300050512 | Bacteria | 3072 |
| 1166 | nmdc:mga0rr50_44110_c1 | 3300050513 | Bacteria | 3268 |
| 1167 | nmdc:mga08x19_78205_c1 | 3300050514 | Bacteria | 2167 |
| 1168 | nmdc:mga0a205_366292_c1 | 3300050515 | Bacteria | 1307 |
| 1169 | Ga0495601_0018962 | 3300053077 | Bacteria | 4192 |
| 1170 | Ga0495619_0003111 | 3300053085 | Bacteria | 10766 |
| 1171 | Ga0500578_0000115 | 3300053086 | Bacteria | 95966 |
| 1172 | Ga0500643_000372 | 3300053087 | Bacteria | 35225 |
| 1173 | Ga0500643_000839 | 3300053087 | Bacteria | 19704 |
| 1174 | Ga0500583_0059991 | 3300053092 | Bacteria | 1792 |
| 1175 | Ga0500651_0000063 | 3300053093 | Bacteria | 70772 |
| 1176 | Ga0500651_0008220 | 3300053093 | Bacteria | 6126 |
| 1177 | Ga0500555_050912 | 3300053103 | Bacteria | 1134 |
| 1178 | Ga0500562_001011 | 3300053108 | Bacteria | 6870 |
| 1179 | Ga0500571_000022 | 3300053110 | Bacteria | 56973 |
| 1180 | Ga0500592_000173 | 3300053116 | Bacteria | 12743 |
| 1181 | Ga0500594_0009994 | 3300053118 | Bacteria | 2194 |
| 1182 | Ga0500642_0000832 | 3300053130 | Bacteria | 9002 |
| 1183 | Ga0500658_0006845 | 3300053134 | Bacteria | 4218 |
| 1184 | Ga0500658_0019208 | 3300053134 | Bacteria | 2570 |
| 1185 | Ga0500564_047748 | 3300053138 | Bacteria | 1963 |
| 1186 | Ga0500568_0003037 | 3300053139 | Bacteria | 9595 |
| 1187 | Ga0500568_0020192 | 3300053139 | Bacteria | 2885 |
| 1188 | Ga0500568_0033686 | 3300053139 | Bacteria | 2100 |
| 1189 | Ga0500574_000554 | 3300053141 | Bacteria | 4836 |
| 1190 | Ga0500622_0000205 | 3300053156 | Bacteria | 62937 |
| 1191 | Ga0500622_0001272 | 3300053156 | Bacteria | 20575 |
| 1192 | Ga0500622_0109934 | 3300053156 | Bacteria | 1348 |
| 1193 | Ga0500627_0001084 | 3300053158 | Bacteria | 7425 |
| 1194 | Ga0500638_033403 | 3300053162 | Bacteria | 2487 |
| 1195 | Ga0501084_0001577 | 3300054114 | Bacteria | 18055 |
| 1196 | Ga0501084_0004840 | 3300054114 | Bacteria | 11005 |
| 1197 | Ga0501084_0159229 | 3300054114 | Bacteria | 1905 |
| 1198 | Ga0501084_0343427 | 3300054114 | Bacteria | 1261 |
| 1199 | Ga0587083_0042145 | 3300059505 | Bacteria | 961 |
| 1200 | Ga0587090_001158 | 3300059510 | Bacteria | 2585 |
| 1201 | Ga0587072_042043 | 3300059643 | Bacteria | 891 |
| 1202 | Ga0501082_0000755 | 3300060353 | Bacteria | 28412 |
| 1203 | Ga0501082_0012597 | 3300060353 | Bacteria | 7268 |
| 1204 | Ga0501082_0019287 | 3300060353 | Bacteria | 5879 |
| 1205 | Ga0501082_0116368 | 3300060353 | Bacteria | 2315 |
| 1206 | Ga0530510_0000240 | 3300061734 | Bacteria | 34436 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300001989 | JGI24739J22299_10000065 | JGI24739J22299_1000006515 | 190 |
| 2 | 3300044712 | Ga0453684_0001710 | Ga0453684_0001710_58276_59025 | 196 |
| 3 | 3300006881 | Ga0068865_100041950 | Ga0068865_1000419502 | 209 |
| 4 | 3300054114 | Ga0501084_0343427 | Ga0501084_0343427_227_1069 | 210 |
| 5 | 3300047444 | Ga0495675_0045983 | Ga0495675_0045983_1134_1970 | 213 |
| 6 | 3300046513 | Ga0495616_0001160 | Ga0495616_0001160_13532_14302 | 215 |
| 7 | 3300010375 | Ga0105239_10477400 | Ga0105239_104774001 | 216 |
| 8 | 3300002067 | JGI24735J21928_10003854 | JGI24735J21928_100038545 | 218 |
| 9 | 3300005563 | Ga0068855_100003042 | Ga0068855_1000030427 | 218 |
| 10 | 3300009093 | Ga0105240_10002341 | Ga0105240_1000234128 | 218 |
| 11 | 3300010375 | Ga0105239_10032953 | Ga0105239_100329533 | 218 |
| 12 | 3300013100 | Ga0157373_10019329 | Ga0157373_100193292 | 218 |
| 13 | 3300013104 | Ga0157370_10001346 | Ga0157370_1000134611 | 218 |
| 14 | 3300013105 | Ga0157369_10000979 | Ga0157369_100009794 | 218 |
| 15 | 3300013296 | Ga0157374_10000107 | Ga0157374_100001077 | 218 |
| 16 | 3300013307 | Ga0157372_10004539 | Ga0157372_100045399 | 218 |
| 17 | 3300025228 | Ga0209672_100530 | Ga0209672_1005308 | 218 |
| 18 | 3300025256 | Ga0209759_1012521 | Ga0209759_10125212 | 218 |
| 19 | 3300025904 | Ga0207647_10000605 | Ga0207647_100006057 | 218 |
| 20 | 3300025913 | Ga0207695_10024266 | Ga0207695_100242663 | 218 |
| 21 | 3300025919 | Ga0207657_10004856 | Ga0207657_100048564 | 218 |
| 22 | 3300025949 | Ga0207667_10002775 | Ga0207667_1000277510 | 218 |
| 23 | 3300031250 | Ga0265331_10000303 | Ga0265331_1000030312 | 218 |
| 24 | 3300031251 | Ga0265327_10000007 | Ga0265327_10000007427 | 218 |
| 25 | 3300037418 | Ga0395900_0120046 | Ga0395900_0120046_1224_2051 | 218 |
| 26 | 3300037466 | Ga0395898_0042130 | Ga0395898_0042130_1107_1934 | 218 |
| 27 | 3300038443 | Ga0395901_0000077 | Ga0395901_0000077_84590_85417 | 218 |
| 28 | 3300044656 | Ga0466969_0023385 | Ga0466969_0023385_1523_2398 | 218 |
| 29 | 3300044684 | Ga0466966_0005728 | Ga0466966_0005728_1279_2106 | 218 |
| 30 | 3300044694 | Ga0466963_0005199 | Ga0466963_0005199_2751_3761 | 218 |
| 31 | 3300044842 | Ga0466957_0212470 | Ga0466957_0212470_138_1169 | 218 |
| 32 | 3300045836 | Ga0466958_0001681 | Ga0466958_0001681_7018_8028 | 218 |
| 33 | 3300046459 | Ga0495629_0188774 | Ga0495629_0188774_540_1391 | 218 |
| 34 | 3300042876 | Ga0451577_0013618 | Ga0451577_0013618_1840_2706 | 219 |
| 35 | 3300045051 | Ga0451576_0001379 | Ga0451576_0001379_18659_19525 | 219 |
| 36 | 3300009176 | Ga0105242_10344902 | Ga0105242_103449021 | 221 |
| 37 | 3300049568 | Ga0501031_0043440 | Ga0501031_0043440_1075_1869 | 221 |
| 38 | 3300049570 | Ga0501033_0001193 | Ga0501033_0001193_17411_18205 | 221 |
| 39 | 3300049572 | Ga0501036_0000543 | Ga0501036_0000543_8474_9268 | 221 |
| 40 | 3300049574 | Ga0501038_0000909 | Ga0501038_0000909_15581_16375 | 221 |
| 41 | 3300049575 | Ga0501039_0013843 | Ga0501039_0013843_3329_4123 | 221 |
| 42 | 3300049576 | Ga0501040_0000101 | Ga0501040_0000101_38405_39199 | 221 |
| 43 | 3300049577 | Ga0501041_0000405 | Ga0501041_0000405_9729_10523 | 221 |
| 44 | 3300049580 | Ga0501046_0004138 | Ga0501046_0004138_1798_2592 | 221 |
| 45 | 3300049587 | Ga0501071_0000233 | Ga0501071_0000233_15128_15922 | 221 |
| 46 | 3300049588 | Ga0501072_0000322 | Ga0501072_0000322_23511_24305 | 221 |
| 47 | 3300049590 | Ga0501074_0025415 | Ga0501074_0025415_1372_2166 | 221 |
| 48 | 3300049591 | Ga0501075_0001506 | Ga0501075_0001506_5197_5991 | 221 |
| 49 | 3300049592 | Ga0501076_0000092 | Ga0501076_0000092_37668_38462 | 221 |
| 50 | 3300049593 | Ga0501077_0000070 | Ga0501077_0000070_7339_8133 | 221 |
| 51 | 3300049741 | Ga0501079_0000005 | Ga0501079_0000005_53636_54430 | 221 |
| 52 | 3300049742 | Ga0501080_0070029 | Ga0501080_0070029_2227_3021 | 221 |
| 53 | 3300049743 | Ga0501081_0001379 | Ga0501081_0001379_4132_4926 | 221 |
| 54 | 3300049744 | Ga0501083_0051148 | Ga0501083_0051148_783_1577 | 221 |
| 55 | 3300049822 | Ga0501035_0001495 | Ga0501035_0001495_11248_12042 | 221 |
| 56 | 3300049823 | Ga0501044_0065993 | Ga0501044_0065993_625_1419 | 221 |
| 57 | 3300049824 | Ga0501045_0000596 | Ga0501045_0000596_10228_11022 | 221 |
| 58 | 3300054114 | Ga0501084_0001577 | Ga0501084_0001577_13009_13803 | 221 |
| 59 | 3300060353 | Ga0501082_0000755 | Ga0501082_0000755_6500_7294 | 221 |
| 60 | 3300061734 | Ga0530510_0000240 | Ga0530510_0000240_23419_24213 | 221 |
| 61 | 3300005336 | Ga0070680_100042649 | Ga0070680_1000426493 | 222 |
| 62 | 3300005549 | Ga0070704_100032076 | Ga0070704_1000320763 | 222 |
| 63 | 3300005719 | Ga0068861_100008415 | Ga0068861_1000084152 | 222 |
| 64 | 3300009553 | Ga0105249_10450169 | Ga0105249_104501691 | 222 |
| 65 | 3300025917 | Ga0207660_10100383 | Ga0207660_101003832 | 222 |
| 66 | 3300025942 | Ga0207689_10255085 | Ga0207689_102550851 | 222 |
| 67 | 3300026118 | Ga0207675_100001840 | Ga0207675_1000018405 | 222 |
| 68 | 3300003794 | Ga0055531_10004883 | Ga0055531_100048833 | 223 |
| 69 | 3300005295 | Ga0065707_10342981 | Ga0065707_103429811 | 223 |
| 70 | 3300006846 | Ga0075430_100061726 | Ga0075430_1000617262 | 223 |
| 71 | 3300006847 | Ga0075431_100014998 | Ga0075431_1000149982 | 223 |
| 72 | 3300006871 | Ga0075434_100091112 | Ga0075434_1000911122 | 223 |
| 73 | 3300006871 | Ga0075434_100421173 | Ga0075434_1004211732 | 223 |
| 74 | 3300009147 | Ga0114129_10062288 | Ga0114129_100622885 | 223 |
| 75 | 3300009147 | Ga0114129_10267296 | Ga0114129_102672962 | 223 |
| 76 | 3300009176 | Ga0105242_10021310 | Ga0105242_100213104 | 223 |
| 77 | 3300025303 | Ga0209051_1000367 | Ga0209051_100036746 | 223 |
| 78 | 3300025304 | Ga0209257_1000012 | Ga0209257_1000012568 | 223 |
| 79 | 3300025934 | Ga0207686_10009771 | Ga0207686_100097713 | 223 |
| 80 | 3300037471 | Ga0395905_0000148 | Ga0395905_0000148_38625_39497 | 223 |
| 81 | 3300042876 | Ga0451577_0000114 | Ga0451577_0000114_58211_59044 | 223 |
| 82 | 3300044673 | Ga0453683_0015371 | Ga0453683_0015371_15_839 | 223 |
| 83 | 3300044735 | Ga0466968_0005441 | Ga0466968_0005441_983_1843 | 223 |
| 84 | 3300045051 | Ga0451576_0004409 | Ga0451576_0004409_2004_2837 | 223 |
| 85 | 3300050507 | nmdc:mga05p37_113514_c2 | nmdc:mga05p37_113514_c2_1379_2203 | 223 |
| 86 | 3300050512 | nmdc:mga0n895_89883_c1 | nmdc:mga0n895_89883_c1_307_1131 | 223 |
| 87 | 3300053092 | Ga0500583_0059991 | Ga0500583_0059991_518_1351 | 223 |
| 88 | 3300001989 | JGI24739J22299_10015778 | JGI24739J22299_100157783 | 224 |
| 89 | 3300002075 | JGI24738J21930_10001689 | JGI24738J21930_100016892 | 224 |
| 90 | 3300005327 | Ga0070658_10121400 | Ga0070658_101214001 | 224 |
| 91 | 3300005334 | Ga0068869_100131549 | Ga0068869_1001315491 | 224 |
| 92 | 3300005336 | Ga0070680_100225836 | Ga0070680_1002258362 | 224 |
| 93 | 3300005339 | Ga0070660_100001084 | Ga0070660_10000108411 | 224 |
| 94 | 3300005339 | Ga0070660_100110067 | Ga0070660_1001100672 | 224 |
| 95 | 3300005343 | Ga0070687_100054985 | Ga0070687_1000549853 | 224 |
| 96 | 3300005344 | Ga0070661_100167214 | Ga0070661_1001672142 | 224 |
| 97 | 3300005365 | Ga0070688_100000242 | Ga0070688_10000024218 | 224 |
| 98 | 3300005367 | Ga0070667_100002252 | Ga0070667_1000022528 | 224 |
| 99 | 3300005539 | Ga0068853_100116954 | Ga0068853_1001169541 | 224 |
| 100 | 3300005546 | Ga0070696_100009914 | Ga0070696_1000099147 | 224 |
| 101 | 3300005563 | Ga0068855_100046760 | Ga0068855_1000467604 | 224 |
| 102 | 3300005564 | Ga0070664_100009148 | Ga0070664_1000091485 | 224 |
| 103 | 3300005564 | Ga0070664_100009861 | Ga0070664_1000098612 | 224 |
| 104 | 3300005577 | Ga0068857_100003862 | Ga0068857_10000386213 | 224 |
| 105 | 3300005577 | Ga0068857_100466057 | Ga0068857_1004660571 | 224 |
| 106 | 3300005578 | Ga0068854_100164637 | Ga0068854_1001646372 | 224 |
| 107 | 3300005841 | Ga0068863_100082483 | Ga0068863_1000824833 | 224 |
| 108 | 3300006173 | Ga0070716_100000075 | Ga0070716_10000007512 | 224 |
| 109 | 3300009093 | Ga0105240_10044913 | Ga0105240_100449133 | 224 |
| 110 | 3300009148 | Ga0105243_10038792 | Ga0105243_100387922 | 224 |
| 111 | 3300009176 | Ga0105242_10002939 | Ga0105242_100029393 | 224 |
| 112 | 3300009545 | Ga0105237_10133693 | Ga0105237_101336932 | 224 |
| 113 | 3300009545 | Ga0105237_10165934 | Ga0105237_101659342 | 224 |
| 114 | 3300009551 | Ga0105238_10059780 | Ga0105238_100597803 | 224 |
| 115 | 3300009551 | Ga0105238_10285609 | Ga0105238_102856092 | 224 |
| 116 | 3300013100 | Ga0157373_10027516 | Ga0157373_100275163 | 224 |
| 117 | 3300013102 | Ga0157371_10006694 | Ga0157371_100066948 | 224 |
| 118 | 3300013105 | Ga0157369_10000947 | Ga0157369_1000094729 | 224 |
| 119 | 3300014326 | Ga0157380_10001038 | Ga0157380_1000103815 | 224 |
| 120 | 3300014969 | Ga0157376_10000565 | Ga0157376_100005658 | 224 |
| 121 | 3300014969 | Ga0157376_10043568 | Ga0157376_100435683 | 224 |
| 122 | 3300025273 | Ga0209673_1028369 | Ga0209673_10283692 | 224 |
| 123 | 3300025728 | Ga0207655_1001746 | Ga0207655_10017466 | 224 |
| 124 | 3300025900 | Ga0207710_10011735 | Ga0207710_100117353 | 224 |
| 125 | 3300025903 | Ga0207680_10103558 | Ga0207680_101035582 | 224 |
| 126 | 3300025912 | Ga0207707_10384208 | Ga0207707_103842082 | 224 |
| 127 | 3300025918 | Ga0207662_10004730 | Ga0207662_100047304 | 224 |
| 128 | 3300025919 | Ga0207657_10111826 | Ga0207657_101118262 | 224 |
| 129 | 3300025923 | Ga0207681_10027333 | Ga0207681_100273333 | 224 |
| 130 | 3300025924 | Ga0207694_10098164 | Ga0207694_100981642 | 224 |
| 131 | 3300025924 | Ga0207694_10265458 | Ga0207694_102654582 | 224 |
| 132 | 3300025933 | Ga0207706_10078212 | Ga0207706_100782123 | 224 |
| 133 | 3300025934 | Ga0207686_10389612 | Ga0207686_103896122 | 224 |
| 134 | 3300025935 | Ga0207709_10002748 | Ga0207709_100027485 | 224 |
| 135 | 3300025942 | Ga0207689_10044208 | Ga0207689_100442083 | 224 |
| 136 | 3300025942 | Ga0207689_10208111 | Ga0207689_102081111 | 224 |
| 137 | 3300025945 | Ga0207679_10009281 | Ga0207679_100092814 | 224 |
| 138 | 3300025949 | Ga0207667_10075369 | Ga0207667_100753693 | 224 |
| 139 | 3300026116 | Ga0207674_10000437 | Ga0207674_100004372 | 224 |
| 140 | 3300026116 | Ga0207674_10363838 | Ga0207674_103638382 | 224 |
| 141 | 3300026121 | Ga0207683_10000223 | Ga0207683_1000022314 | 224 |
| 142 | 3300038443 | Ga0395901_0353097 | Ga0395901_0353097_200_1024 | 224 |
| 143 | 3300046512 | Ga0495610_0012787 | Ga0495610_0012787_2395_3219 | 224 |
| 144 | 3300046518 | Ga0495631_0013480 | Ga0495631_0013480_2550_3374 | 224 |
| 145 | 3300046537 | Ga0495598_0019217 | Ga0495598_0019217_500_1303 | 224 |
| 146 | 3300046539 | Ga0495621_0003440 | Ga0495621_0003440_235_1059 | 224 |
| 147 | 3300046683 | Ga0495658_0014681 | Ga0495658_0014681_2216_3040 | 224 |
| 148 | 3300047318 | Ga0495636_0080117 | Ga0495636_0080117_100_942 | 224 |
| 149 | 3300047321 | Ga0495676_0001397 | Ga0495676_0001397_15092_15916 | 224 |
| 150 | 3300047673 | Ga0495593_0013716 | Ga0495593_0013716_1059_1982 | 224 |
| 151 | 3300048089 | Ga0495614_0000266 | Ga0495614_0000266_5915_6838 | 224 |
| 152 | 3300048919 | Ga0496116_0004405 | Ga0496116_0004405_8467_9291 | 224 |
| 153 | 3300048920 | Ga0496117_0068787 | Ga0496117_0068787_819_1643 | 224 |
| 154 | 3300048921 | Ga0496118_0051370 | Ga0496118_0051370_1782_2606 | 224 |
| 155 | 3300048924 | Ga0496121_0096756 | Ga0496121_0096756_500_1324 | 224 |
| 156 | 3300050496 | nmdc:mga07m45_5726_c1 | nmdc:mga07m45_5726_c1_844_1668 | 224 |
| 157 | 3300053093 | Ga0500651_0000063 | Ga0500651_0000063_14777_15601 | 224 |
| 158 | 3300053110 | Ga0500571_000022 | Ga0500571_000022_23931_24755 | 224 |
| 159 | 3300053118 | Ga0500594_0009994 | Ga0500594_0009994_1200_2024 | 224 |
| 160 | 3300053134 | Ga0500658_0006845 | Ga0500658_0006845_2549_3373 | 224 |
| 161 | 3300053138 | Ga0500564_047748 | Ga0500564_047748_639_1463 | 224 |
| 162 | 3300053139 | Ga0500568_0003037 | Ga0500568_0003037_2029_2853 | 224 |
| 163 | 3300053141 | Ga0500574_000554 | Ga0500574_000554_2532_3455 | 224 |
| 164 | 3300053162 | Ga0500638_033403 | Ga0500638_033403_1183_2007 | 224 |
| 165 | 3300025915 | Ga0207693_10225050 | Ga0207693_102250502 | 225 |
| 166 | 3300025916 | Ga0207663_10304763 | Ga0207663_103047632 | 225 |
| 167 | 3300035170 | Ga0373943_0012155 | Ga0373943_0012155_711_1553 | 225 |
| 168 | 3300035172 | Ga0373955_0073983 | Ga0373955_0073983_693_1535 | 225 |
| 169 | 3300035695 | Ga0373927_0006033 | Ga0373927_0006033_1275_2117 | 225 |
| 170 | 3300037068 | Ga0373925_0163286 | Ga0373925_0163286_712_1554 | 225 |
| 171 | 3300046459 | Ga0495629_0000725 | Ga0495629_0000725_19591_20433 | 225 |
| 172 | 3300046461 | Ga0495641_0009612 | Ga0495641_0009612_4200_5042 | 225 |
| 173 | 3300046472 | Ga0495580_0000812 | Ga0495580_0000812_18874_19716 | 225 |
| 174 | 3300046473 | Ga0495582_0000614 | Ga0495582_0000614_5897_6739 | 225 |
| 175 | 3300046475 | Ga0495639_0000788 | Ga0495639_0000788_8383_9225 | 225 |
| 176 | 3300046476 | Ga0495662_0095011 | Ga0495662_0095011_282_1124 | 225 |
| 177 | 3300046499 | Ga0495594_0000364 | Ga0495594_0000364_6182_7024 | 225 |
| 178 | 3300046526 | Ga0495666_0065467 | Ga0495666_0065467_331_1173 | 225 |
| 179 | 3300046557 | Ga0495622_0002768 | Ga0495622_0002768_30_872 | 225 |
| 180 | 3300046642 | Ga0495634_0001507 | Ga0495634_0001507_15875_16717 | 225 |
| 181 | 3300046663 | Ga0495635_0135697 | Ga0495635_0135697_606_1448 | 225 |
| 182 | 3300046681 | Ga0495647_0001075 | Ga0495647_0001075_6397_7239 | 225 |
| 183 | 3300046683 | Ga0495658_0001306 | Ga0495658_0001306_7604_8446 | 225 |
| 184 | 3300046689 | Ga0495613_0001074 | Ga0495613_0001074_17453_18295 | 225 |
| 185 | 3300047315 | Ga0495581_0003415 | Ga0495581_0003415_3231_4073 | 225 |
| 186 | 3300047321 | Ga0495676_0028005 | Ga0495676_0028005_966_1808 | 225 |
| 187 | 3300047673 | Ga0495593_0003119 | Ga0495593_0003119_2188_3030 | 225 |
| 188 | 3300048089 | Ga0495614_0050574 | Ga0495614_0050574_376_1218 | 225 |
| 189 | 3300048907 | Ga0496104_0134914 | Ga0496104_0134914_1128_1970 | 225 |
| 190 | 3300048915 | Ga0496112_0271710 | Ga0496112_0271710_631_1473 | 225 |
| 191 | 3300048916 | Ga0496113_0190879 | Ga0496113_0190879_422_1264 | 225 |
| 192 | 3300048918 | Ga0496115_0212509 | Ga0496115_0212509_440_1282 | 225 |
| 193 | 3300048921 | Ga0496118_0103009 | Ga0496118_0103009_81_941 | 225 |
| 194 | 3300053085 | Ga0495619_0003111 | Ga0495619_0003111_4726_5568 | 225 |
| 195 | 3300005367 | Ga0070667_100000363 | Ga0070667_1000003634 | 226 |
| 196 | 3300006844 | Ga0075428_100019639 | Ga0075428_1000196396 | 226 |
| 197 | 3300006880 | Ga0075429_100269650 | Ga0075429_1002696502 | 226 |
| 198 | 3300009094 | Ga0111539_10044187 | Ga0111539_100441877 | 226 |
| 199 | 3300009094 | Ga0111539_10481352 | Ga0111539_104813522 | 226 |
| 200 | 3300009101 | Ga0105247_10149251 | Ga0105247_101492512 | 226 |
| 201 | 3300014968 | Ga0157379_10293153 | Ga0157379_102931532 | 226 |
| 202 | 3300020076 | Ga0206355_1144450 | Ga0206355_11444502 | 226 |
| 203 | 3300025986 | Ga0207658_10000322 | Ga0207658_1000032249 | 226 |
| 204 | 3300027907 | Ga0207428_10111489 | Ga0207428_101114892 | 226 |
| 205 | 3300031507 | Ga0307509_10155234 | Ga0307509_101552342 | 226 |
| 206 | 3300031691 | Ga0316579_10080889 | Ga0316579_100808892 | 226 |
| 207 | 3300031733 | Ga0316577_10014934 | Ga0316577_100149343 | 226 |
| 208 | 3300032133 | Ga0316583_10003221 | Ga0316583_100032215 | 226 |
| 209 | 3300032139 | Ga0316580_10018958 | Ga0316580_100189582 | 226 |
| 210 | 3300035086 | Ga0373934_0020623 | Ga0373934_0020623_1149_1991 | 226 |
| 211 | 3300035398 | Ga0316574_0030171 | Ga0316574_0030171_1910_2752 | 226 |
| 212 | 3300036647 | Ga0316582_0024709 | Ga0316582_0024709_1296_2138 | 226 |
| 213 | 3300036712 | Ga0316584_0007474 | Ga0316584_0007474_2165_3007 | 226 |
| 214 | 3300037588 | Ga0316581_0002029 | Ga0316581_0002029_2617_3459 | 226 |
| 215 | 3300046542 | Ga0495597_0028713 | Ga0495597_0028713_1498_2325 | 226 |
| 216 | 3300047321 | Ga0495676_0406120 | Ga0495676_0406120_42_884 | 226 |
| 217 | 3300050508 | nmdc:mga09592_236985_c1 | nmdc:mga09592_236985_c1_160_984 | 226 |
| 218 | 3300050511 | nmdc:mga08y16_131209_c1 | nmdc:mga08y16_131209_c1_1113_1937 | 226 |
| 219 | 3300050511 | nmdc:mga08y16_39060_c1 | nmdc:mga08y16_39060_c1_1540_2364 | 226 |
| 220 | 3300005459 | Ga0068867_100000006 | Ga0068867_10000000610 | 227 |
| 221 | 3300005471 | Ga0070698_100275359 | Ga0070698_1002753592 | 227 |
| 222 | 3300005544 | Ga0070686_100286387 | Ga0070686_1002863871 | 227 |
| 223 | 3300005616 | Ga0068852_100114812 | Ga0068852_1001148123 | 227 |
| 224 | 3300009148 | Ga0105243_10007446 | Ga0105243_100074461 | 227 |
| 225 | 3300009176 | Ga0105242_10020500 | Ga0105242_100205004 | 227 |
| 226 | 3300014745 | Ga0157377_10000013 | Ga0157377_1000001372 | 227 |
| 227 | 3300025905 | Ga0207685_10195559 | Ga0207685_101955591 | 227 |
| 228 | 3300025935 | Ga0207709_10004452 | Ga0207709_100044528 | 227 |
| 229 | 3300026089 | Ga0207648_10000006 | Ga0207648_10000006180 | 227 |
| 230 | 3300026142 | Ga0207698_10051736 | Ga0207698_100517363 | 227 |
| 231 | 3300044712 | Ga0453684_0359327 | Ga0453684_0359327_133_945 | 227 |
| 232 | 3300045051 | Ga0451576_0005551 | Ga0451576_0005551_5929_6741 | 227 |
| 233 | 3300045051 | Ga0451576_0271485 | Ga0451576_0271485_193_1005 | 227 |
| 234 | 3300005334 | Ga0068869_100101126 | Ga0068869_1001011262 | 228 |
| 235 | 3300005340 | Ga0070689_100041672 | Ga0070689_1000416723 | 228 |
| 236 | 3300005356 | Ga0070674_100079070 | Ga0070674_1000790702 | 228 |
| 237 | 3300005440 | Ga0070705_100038552 | Ga0070705_1000385521 | 228 |
| 238 | 3300005441 | Ga0070700_100012946 | Ga0070700_1000129463 | 228 |
| 239 | 3300005456 | Ga0070678_100025521 | Ga0070678_1000255212 | 228 |
| 240 | 3300005457 | Ga0070662_100385305 | Ga0070662_1003853052 | 228 |
| 241 | 3300005543 | Ga0070672_100030198 | Ga0070672_1000301982 | 228 |
| 242 | 3300005543 | Ga0070672_100102269 | Ga0070672_1001022692 | 228 |
| 243 | 3300005543 | Ga0070672_100120364 | Ga0070672_1001203642 | 228 |
| 244 | 3300005546 | Ga0070696_100095869 | Ga0070696_1000958692 | 228 |
| 245 | 3300005548 | Ga0070665_100006360 | Ga0070665_1000063602 | 228 |
| 246 | 3300005549 | Ga0070704_100047674 | Ga0070704_1000476742 | 228 |
| 247 | 3300005615 | Ga0070702_100006282 | Ga0070702_1000062822 | 228 |
| 248 | 3300005719 | Ga0068861_100018404 | Ga0068861_1000184042 | 228 |
| 249 | 3300005719 | Ga0068861_100029827 | Ga0068861_1000298273 | 228 |
| 250 | 3300005719 | Ga0068861_100124147 | Ga0068861_1001241472 | 228 |
| 251 | 3300005840 | Ga0068870_10049308 | Ga0068870_100493082 | 228 |
| 252 | 3300005841 | Ga0068863_100184441 | Ga0068863_1001844412 | 228 |
| 253 | 3300005841 | Ga0068863_100361050 | Ga0068863_1003610501 | 228 |
| 254 | 3300005843 | Ga0068860_100118924 | Ga0068860_1001189243 | 228 |
| 255 | 3300005844 | Ga0068862_100009198 | Ga0068862_1000091986 | 228 |
| 256 | 3300005844 | Ga0068862_100117675 | Ga0068862_1001176752 | 228 |
| 257 | 3300005844 | Ga0068862_100205428 | Ga0068862_1002054282 | 228 |
| 258 | 3300006237 | Ga0097621_100020799 | Ga0097621_1000207993 | 228 |
| 259 | 3300006358 | Ga0068871_100011150 | Ga0068871_1000111503 | 228 |
| 260 | 3300006881 | Ga0068865_100044895 | Ga0068865_1000448953 | 228 |
| 261 | 3300009094 | Ga0111539_10579902 | Ga0111539_105799022 | 228 |
| 262 | 3300013104 | Ga0157370_10228352 | Ga0157370_102283522 | 228 |
| 263 | 3300013308 | Ga0157375_10668214 | Ga0157375_106682141 | 228 |
| 264 | 3300014325 | Ga0163163_10020768 | Ga0163163_100207684 | 228 |
| 265 | 3300014326 | Ga0157380_10023317 | Ga0157380_100233173 | 228 |
| 266 | 3300025908 | Ga0207643_10037238 | Ga0207643_100372382 | 228 |
| 267 | 3300025908 | Ga0207643_10069351 | Ga0207643_100693512 | 228 |
| 268 | 3300025923 | Ga0207681_10229837 | Ga0207681_102298372 | 228 |
| 269 | 3300025933 | Ga0207706_10287878 | Ga0207706_102878782 | 228 |
| 270 | 3300025937 | Ga0207669_10056952 | Ga0207669_100569522 | 228 |
| 271 | 3300025940 | Ga0207691_10133018 | Ga0207691_101330182 | 228 |
| 272 | 3300025940 | Ga0207691_10163814 | Ga0207691_101638142 | 228 |
| 273 | 3300025942 | Ga0207689_10023736 | Ga0207689_100237362 | 228 |
| 274 | 3300025945 | Ga0207679_10086280 | Ga0207679_100862802 | 228 |
| 275 | 3300026075 | Ga0207708_10072561 | Ga0207708_100725612 | 228 |
| 276 | 3300026088 | Ga0207641_10189164 | Ga0207641_101891642 | 228 |
| 277 | 3300026118 | Ga0207675_100041887 | Ga0207675_1000418873 | 228 |
| 278 | 3300026118 | Ga0207675_100072042 | Ga0207675_1000720423 | 228 |
| 279 | 3300026118 | Ga0207675_100258482 | Ga0207675_1002584822 | 228 |
| 280 | 3300026121 | Ga0207683_10041600 | Ga0207683_100416003 | 228 |
| 281 | 3300028379 | Ga0268266_10005164 | Ga0268266_1000516411 | 228 |
| 282 | 3300028380 | Ga0268265_10225041 | Ga0268265_102250412 | 228 |
| 283 | 3300028794 | Ga0307515_10002761 | Ga0307515_1000276116 | 228 |
| 284 | 3300031507 | Ga0307509_10125632 | Ga0307509_101256323 | 228 |
| 285 | 3300031548 | Ga0307408_100105642 | Ga0307408_1001056422 | 228 |
| 286 | 3300031901 | Ga0307406_10014170 | Ga0307406_100141702 | 228 |
| 287 | 3300031995 | Ga0307409_100005917 | Ga0307409_1000059177 | 228 |
| 288 | 3300032005 | Ga0307411_10004935 | Ga0307411_100049354 | 228 |
| 289 | 3300032005 | Ga0307411_10313913 | Ga0307411_103139131 | 228 |
| 290 | 3300037312 | Ga0395899_0030796 | Ga0395899_0030796_589_1416 | 228 |
| 291 | 3300037418 | Ga0395900_0231168 | Ga0395900_0231168_970_1797 | 228 |
| 292 | 3300037466 | Ga0395898_0031878 | Ga0395898_0031878_921_1748 | 228 |
| 293 | 3300038443 | Ga0395901_0042064 | Ga0395901_0042064_394_1221 | 228 |
| 294 | 3300039437 | Ga0436365_0066966 | Ga0436365_0066966_1895_2707 | 228 |
| 295 | 3300046519 | Ga0495632_0063953 | Ga0495632_0063953_176_1018 | 228 |
| 296 | 3300046616 | Ga0495668_0015499 | Ga0495668_0015499_2853_3695 | 228 |
| 297 | 3300048925 | Ga0496122_0001177 | Ga0496122_0001177_39278_40120 | 228 |
| 298 | 3300048926 | Ga0496123_0000754 | Ga0496123_0000754_46905_47747 | 228 |
| 299 | 3300049578 | Ga0501042_0062265 | Ga0501042_0062265_484_1326 | 228 |
| 300 | 3300049584 | Ga0501068_0057746 | Ga0501068_0057746_595_1437 | 228 |
| 301 | 3300049586 | Ga0501070_0022979 | Ga0501070_0022979_3402_4244 | 228 |
| 302 | 3300049587 | Ga0501071_0047287 | Ga0501071_0047287_2019_2861 | 228 |
| 303 | 3300049588 | Ga0501072_0035424 | Ga0501072_0035424_2447_3289 | 228 |
| 304 | 3300049589 | Ga0501073_0000354 | Ga0501073_0000354_27695_28537 | 228 |
| 305 | 3300049590 | Ga0501074_0000738 | Ga0501074_0000738_7264_8106 | 228 |
| 306 | 3300049591 | Ga0501075_0114991 | Ga0501075_0114991_213_1055 | 228 |
| 307 | 3300049593 | Ga0501077_0012657 | Ga0501077_0012657_3276_4118 | 228 |
| 308 | 3300049741 | Ga0501079_0002075 | Ga0501079_0002075_2275_3117 | 228 |
| 309 | 3300049742 | Ga0501080_0004800 | Ga0501080_0004800_10099_10941 | 228 |
| 310 | 3300049744 | Ga0501083_0067703 | Ga0501083_0067703_930_1772 | 228 |
| 311 | 3300050511 | nmdc:mga08y16_267174_c1 | nmdc:mga08y16_267174_c1_322_1164 | 228 |
| 312 | 3300050511 | nmdc:mga08y16_39966_c1 | nmdc:mga08y16_39966_c1_2053_2880 | 228 |
| 313 | 3300050511 | nmdc:mga08y16_558217_c1 | nmdc:mga08y16_558217_c1_150_992 | 228 |
| 314 | 3300054114 | Ga0501084_0004840 | Ga0501084_0004840_9167_10009 | 228 |
| 315 | 3300060353 | Ga0501082_0019287 | Ga0501082_0019287_842_1684 | 228 |
| 316 | 3300003794 | Ga0055531_10043596 | Ga0055531_100435961 | 229 |
| 317 | 3300005353 | Ga0070669_100012088 | Ga0070669_1000120884 | 229 |
| 318 | 3300006944 | Ga0099823_1006273 | Ga0099823_10062739 | 229 |
| 319 | 3300025273 | Ga0209673_1014088 | Ga0209673_10140883 | 229 |
| 320 | 3300025298 | Ga0209050_1006055 | Ga0209050_10060555 | 229 |
| 321 | 3300025303 | Ga0209051_1001570 | Ga0209051_10015705 | 229 |
| 322 | 3300025304 | Ga0209257_1033503 | Ga0209257_10335032 | 229 |
| 323 | 3300027296 | Ga0209389_1016619 | Ga0209389_10166194 | 229 |
| 324 | 3300048927 | Ga0496124_0015626 | Ga0496124_0015626_2624_3442 | 229 |
| 325 | 3300003322 | rootL2_10007771 | rootL2_100077715 | 230 |
| 326 | 3300003771 | Ga0055526_1014942 | Ga0055526_10149422 | 230 |
| 327 | 3300005331 | Ga0070670_100217526 | Ga0070670_1002175262 | 230 |
| 328 | 3300005355 | Ga0070671_100054603 | Ga0070671_1000546032 | 230 |
| 329 | 3300005456 | Ga0070678_100120149 | Ga0070678_1001201492 | 230 |
| 330 | 3300005530 | Ga0070679_100458797 | Ga0070679_1004587972 | 230 |
| 331 | 3300005548 | Ga0070665_100231318 | Ga0070665_1002313182 | 230 |
| 332 | 3300005617 | Ga0068859_100073513 | Ga0068859_1000735133 | 230 |
| 333 | 3300005843 | Ga0068860_100086668 | Ga0068860_1000866683 | 230 |
| 334 | 3300006195 | Ga0075366_10183616 | Ga0075366_101836162 | 230 |
| 335 | 3300006931 | Ga0097620_100073511 | Ga0097620_1000735113 | 230 |
| 336 | 3300007265 | Ga0099794_10013815 | Ga0099794_100138152 | 230 |
| 337 | 3300009098 | Ga0105245_10099033 | Ga0105245_100990332 | 230 |
| 338 | 3300012497 | Ga0157319_1000006 | Ga0157319_1000006122 | 230 |
| 339 | 3300013308 | Ga0157375_10374823 | Ga0157375_103748231 | 230 |
| 340 | 3300025273 | Ga0209673_1010871 | Ga0209673_10108712 | 230 |
| 341 | 3300025295 | Ga0209564_1000003 | Ga0209564_10000031375 | 230 |
| 342 | 3300025299 | Ga0209256_1004237 | Ga0209256_10042377 | 230 |
| 343 | 3300025911 | Ga0207654_10215135 | Ga0207654_102151352 | 230 |
| 344 | 3300025912 | Ga0207707_10037528 | Ga0207707_100375282 | 230 |
| 345 | 3300025916 | Ga0207663_10209244 | Ga0207663_102092442 | 230 |
| 346 | 3300025931 | Ga0207644_10040966 | Ga0207644_100409662 | 230 |
| 347 | 3300025942 | Ga0207689_10250294 | Ga0207689_102502942 | 230 |
| 348 | 3300025986 | Ga0207658_10217759 | Ga0207658_102177592 | 230 |
| 349 | 3300026023 | Ga0207677_10423813 | Ga0207677_104238132 | 230 |
| 350 | 3300028379 | Ga0268266_10157857 | Ga0268266_101578572 | 230 |
| 351 | 3300028381 | Ga0268264_10077361 | Ga0268264_100773612 | 230 |
| 352 | 3300031239 | Ga0265328_10095711 | Ga0265328_100957111 | 230 |
| 353 | 3300031507 | Ga0307509_10122075 | Ga0307509_101220753 | 230 |
| 354 | 3300035086 | Ga0373934_0000479 | Ga0373934_0000479_8894_9715 | 230 |
| 355 | 3300035091 | Ga0373951_0040641 | Ga0373951_0040641_36_857 | 230 |
| 356 | 3300035119 | Ga0373956_0000131 | Ga0373956_0000131_10520_11341 | 230 |
| 357 | 3300035724 | Ga0373933_0001235 | Ga0373933_0001235_842_1663 | 230 |
| 358 | 3300036401 | Ga0373937_0000096 | Ga0373937_0000096_12989_13810 | 230 |
| 359 | 3300037418 | Ga0395900_0133493 | Ga0395900_0133493_1069_1929 | 230 |
| 360 | 3300042127 | Ga0450890_007887 | Ga0450890_007887_270_1088 | 230 |
| 361 | 3300046454 | Ga0495592_0079197 | Ga0495592_0079197_681_1502 | 230 |
| 362 | 3300046462 | Ga0495651_0000085 | Ga0495651_0000085_36918_37739 | 230 |
| 363 | 3300046516 | Ga0495628_0003726 | Ga0495628_0003726_4149_4970 | 230 |
| 364 | 3300046517 | Ga0495630_0047368 | Ga0495630_0047368_541_1362 | 230 |
| 365 | 3300046529 | Ga0495652_0005738 | Ga0495652_0005738_2928_3749 | 230 |
| 366 | 3300046543 | Ga0495645_0001492 | Ga0495645_0001492_5424_6245 | 230 |
| 367 | 3300046557 | Ga0495622_0073870 | Ga0495622_0073870_605_1501 | 230 |
| 368 | 3300046616 | Ga0495668_0020606 | Ga0495668_0020606_2543_3376 | 230 |
| 369 | 3300046678 | Ga0495599_0000876 | Ga0495599_0000876_11846_12667 | 230 |
| 370 | 3300046683 | Ga0495658_0140868 | Ga0495658_0140868_326_1159 | 230 |
| 371 | 3300047322 | Ga0495680_0240217 | Ga0495680_0240217_192_1013 | 230 |
| 372 | 3300047444 | Ga0495675_0046686 | Ga0495675_0046686_66_887 | 230 |
| 373 | 3300049570 | Ga0501033_0115086 | Ga0501033_0115086_768_1592 | 230 |
| 374 | 3300049579 | Ga0501043_0319819 | Ga0501043_0319819_119_943 | 230 |
| 375 | 3300049823 | Ga0501044_0144303 | Ga0501044_0144303_448_1272 | 230 |
| 376 | 3300050493 | nmdc:mga0k408_261606_c1 | nmdc:mga0k408_261606_c1_151_969 | 230 |
| 377 | 3300050514 | nmdc:mga08x19_78205_c1 | nmdc:mga08x19_78205_c1_779_1615 | 230 |
| 378 | 3300053077 | Ga0495601_0018962 | Ga0495601_0018962_722_1543 | 230 |
| 379 | 3300053156 | Ga0500622_0001272 | Ga0500622_0001272_15812_16630 | 230 |
| 380 | 3300001989 | JGI24739J22299_10000141 | JGI24739J22299_100001415 | 231 |
| 381 | 3300003187 | JGI25151J46595_10000262 | JGI25151J46595_100002624 | 231 |
| 382 | 3300003215 | JGI25153J46596_10003388 | JGI25153J46596_100033883 | 231 |
| 383 | 3300003791 | Ga0055530_10010281 | Ga0055530_100102812 | 231 |
| 384 | 3300005262 | Ga0065165_1000995 | Ga0065165_10009956 | 231 |
| 385 | 3300005262 | Ga0065165_1001389 | Ga0065165_100138918 | 231 |
| 386 | 3300005262 | Ga0065165_1002021 | Ga0065165_10020218 | 231 |
| 387 | 3300005458 | Ga0070681_10003522 | Ga0070681_100035225 | 231 |
| 388 | 3300005614 | Ga0068856_100396328 | Ga0068856_1003963282 | 231 |
| 389 | 3300006195 | Ga0075366_10251679 | Ga0075366_102516791 | 231 |
| 390 | 3300017792 | Ga0163161_10167383 | Ga0163161_101673831 | 231 |
| 391 | 3300025273 | Ga0209673_1025996 | Ga0209673_10259962 | 231 |
| 392 | 3300025294 | Ga0209025_1000057 | Ga0209025_1000057210 | 231 |
| 393 | 3300025297 | Ga0209758_1000096 | Ga0209758_1000096143 | 231 |
| 394 | 3300025298 | Ga0209050_1003867 | Ga0209050_10038679 | 231 |
| 395 | 3300025299 | Ga0209256_1024727 | Ga0209256_10247272 | 231 |
| 396 | 3300025912 | Ga0207707_10034389 | Ga0207707_100343895 | 231 |
| 397 | 3300028786 | Ga0307517_10106490 | Ga0307517_101064902 | 231 |
| 398 | 3300031616 | Ga0307508_10007413 | Ga0307508_100074135 | 231 |
| 399 | 3300031649 | Ga0307514_10178034 | Ga0307514_101780342 | 231 |
| 400 | 3300032004 | Ga0307414_10007717 | Ga0307414_100077172 | 231 |
| 401 | 3300041456 | Ga0451795_1374636 | Ga0451795_1374636_800_1624 | 231 |
| 402 | 3300041458 | Ga0451798_0725560 | Ga0451798_0725560_6348_7172 | 231 |
| 403 | 3300041463 | Ga0451804_0286988 | Ga0451804_0286988_436_1260 | 231 |
| 404 | 3300044656 | Ga0466969_0004483 | Ga0466969_0004483_2793_3668 | 231 |
| 405 | 3300046506 | Ga0495583_0000809 | Ga0495583_0000809_9342_10169 | 231 |
| 406 | 3300046522 | Ga0495643_0136732 | Ga0495643_0136732_144_971 | 231 |
| 407 | 3300046664 | Ga0495659_0006310 | Ga0495659_0006310_1302_2129 | 231 |
| 408 | 3300047445 | Ga0495677_0021867 | Ga0495677_0021867_448_1275 | 231 |
| 409 | 3300048905 | Ga0496102_0000123 | Ga0496102_0000123_106100_106927 | 231 |
| 410 | 3300048918 | Ga0496115_0035563 | Ga0496115_0035563_1613_2437 | 231 |
| 411 | 3300048929 | Ga0496126_0005728 | Ga0496126_0005728_488_1315 | 231 |
| 412 | 3300053086 | Ga0500578_0000115 | Ga0500578_0000115_26170_26994 | 231 |
| 413 | 3300053093 | Ga0500651_0008220 | Ga0500651_0008220_3054_3878 | 231 |
| 414 | 3300053130 | Ga0500642_0000832 | Ga0500642_0000832_1984_2808 | 231 |
| 415 | 3300053139 | Ga0500568_0033686 | Ga0500568_0033686_168_992 | 231 |
| 416 | 3300053156 | Ga0500622_0000205 | Ga0500622_0000205_12966_13790 | 231 |
| 417 | 3300003771 | Ga0055526_1000086 | Ga0055526_10000865 | 232 |
| 418 | 3300003773 | Ga0055537_1000012 | Ga0055537_100001284 | 232 |
| 419 | 3300003775 | Ga0055524_1009288 | Ga0055524_10092883 | 232 |
| 420 | 3300003784 | Ga0055534_1000399 | Ga0055534_100039923 | 232 |
| 421 | 3300003790 | Ga0055528_1000351 | Ga0055528_100035130 | 232 |
| 422 | 3300005331 | Ga0070670_100048002 | Ga0070670_1000480022 | 232 |
| 423 | 3300005331 | Ga0070670_100298112 | Ga0070670_1002981122 | 232 |
| 424 | 3300005339 | Ga0070660_100000923 | Ga0070660_1000009232 | 232 |
| 425 | 3300005344 | Ga0070661_100008601 | Ga0070661_1000086013 | 232 |
| 426 | 3300005347 | Ga0070668_100003227 | Ga0070668_1000032273 | 232 |
| 427 | 3300005353 | Ga0070669_100007810 | Ga0070669_1000078105 | 232 |
| 428 | 3300005354 | Ga0070675_100004454 | Ga0070675_1000044543 | 232 |
| 429 | 3300005354 | Ga0070675_100028650 | Ga0070675_1000286503 | 232 |
| 430 | 3300005354 | Ga0070675_100563773 | Ga0070675_1005637731 | 232 |
| 431 | 3300005355 | Ga0070671_100002154 | Ga0070671_1000021545 | 232 |
| 432 | 3300005355 | Ga0070671_100115804 | Ga0070671_1001158042 | 232 |
| 433 | 3300005364 | Ga0070673_100006377 | Ga0070673_1000063773 | 232 |
| 434 | 3300005364 | Ga0070673_100022059 | Ga0070673_1000220593 | 232 |
| 435 | 3300005366 | Ga0070659_100001931 | Ga0070659_1000019314 | 232 |
| 436 | 3300005367 | Ga0070667_100025943 | Ga0070667_1000259435 | 232 |
| 437 | 3300005367 | Ga0070667_100142704 | Ga0070667_1001427042 | 232 |
| 438 | 3300005457 | Ga0070662_100000859 | Ga0070662_1000008598 | 232 |
| 439 | 3300005539 | Ga0068853_100008722 | Ga0068853_1000087224 | 232 |
| 440 | 3300005543 | Ga0070672_100000208 | Ga0070672_1000002084 | 232 |
| 441 | 3300005564 | Ga0070664_100013457 | Ga0070664_1000134573 | 232 |
| 442 | 3300005564 | Ga0070664_100127051 | Ga0070664_1001270512 | 232 |
| 443 | 3300005614 | Ga0068856_100003022 | Ga0068856_10000302210 | 232 |
| 444 | 3300005616 | Ga0068852_100052664 | Ga0068852_1000526642 | 232 |
| 445 | 3300005618 | Ga0068864_100016433 | Ga0068864_1000164333 | 232 |
| 446 | 3300005841 | Ga0068863_100299206 | Ga0068863_1002992061 | 232 |
| 447 | 3300005843 | Ga0068860_100072236 | Ga0068860_1000722363 | 232 |
| 448 | 3300006237 | Ga0097621_100327126 | Ga0097621_1003271262 | 232 |
| 449 | 3300013100 | Ga0157373_10003697 | Ga0157373_100036979 | 232 |
| 450 | 3300013102 | Ga0157371_10000422 | Ga0157371_1000042222 | 232 |
| 451 | 3300013306 | Ga0163162_10354848 | Ga0163162_103548482 | 232 |
| 452 | 3300013307 | Ga0157372_10006612 | Ga0157372_100066124 | 232 |
| 453 | 3300013308 | Ga0157375_10004499 | Ga0157375_100044993 | 232 |
| 454 | 3300014325 | Ga0163163_10084331 | Ga0163163_100843312 | 232 |
| 455 | 3300014325 | Ga0163163_10439880 | Ga0163163_104398802 | 232 |
| 456 | 3300014326 | Ga0157380_10074237 | Ga0157380_100742373 | 232 |
| 457 | 3300017792 | Ga0163161_10029871 | Ga0163161_100298713 | 232 |
| 458 | 3300021361 | Ga0213872_10000046 | Ga0213872_1000004689 | 232 |
| 459 | 3300021361 | Ga0213872_10000048 | Ga0213872_1000004855 | 232 |
| 460 | 3300021361 | Ga0213872_10000086 | Ga0213872_1000008618 | 232 |
| 461 | 3300025263 | Ga0209565_1000057 | Ga0209565_100005787 | 232 |
| 462 | 3300025273 | Ga0209673_1000051 | Ga0209673_1000051201 | 232 |
| 463 | 3300025291 | Ga0209675_1000027 | Ga0209675_1000027201 | 232 |
| 464 | 3300025295 | Ga0209564_1000094 | Ga0209564_100009486 | 232 |
| 465 | 3300025299 | Ga0209256_1000139 | Ga0209256_100013986 | 232 |
| 466 | 3300025315 | Ga0207697_10021145 | Ga0207697_100211452 | 232 |
| 467 | 3300025923 | Ga0207681_10013238 | Ga0207681_100132383 | 232 |
| 468 | 3300025925 | Ga0207650_10049298 | Ga0207650_100492982 | 232 |
| 469 | 3300025925 | Ga0207650_10197962 | Ga0207650_101979622 | 232 |
| 470 | 3300025926 | Ga0207659_10010632 | Ga0207659_100106323 | 232 |
| 471 | 3300025931 | Ga0207644_10056873 | Ga0207644_100568732 | 232 |
| 472 | 3300025932 | Ga0207690_10001165 | Ga0207690_1000116512 | 232 |
| 473 | 3300025933 | Ga0207706_10000064 | Ga0207706_1000006488 | 232 |
| 474 | 3300025933 | Ga0207706_10013987 | Ga0207706_100139872 | 232 |
| 475 | 3300025940 | Ga0207691_10000087 | Ga0207691_1000008721 | 232 |
| 476 | 3300025945 | Ga0207679_10005057 | Ga0207679_100050577 | 232 |
| 477 | 3300025945 | Ga0207679_10024676 | Ga0207679_100246763 | 232 |
| 478 | 3300025949 | Ga0207667_10003108 | Ga0207667_100031088 | 232 |
| 479 | 3300025960 | Ga0207651_10009113 | Ga0207651_100091133 | 232 |
| 480 | 3300025960 | Ga0207651_10041860 | Ga0207651_100418604 | 232 |
| 481 | 3300025972 | Ga0207668_10001815 | Ga0207668_100018156 | 232 |
| 482 | 3300025986 | Ga0207658_10017921 | Ga0207658_100179215 | 232 |
| 483 | 3300025986 | Ga0207658_10102594 | Ga0207658_101025943 | 232 |
| 484 | 3300026041 | Ga0207639_10003441 | Ga0207639_100034418 | 232 |
| 485 | 3300026067 | Ga0207678_10006140 | Ga0207678_100061408 | 232 |
| 486 | 3300026078 | Ga0207702_10010543 | Ga0207702_100105435 | 232 |
| 487 | 3300026095 | Ga0207676_10165927 | Ga0207676_101659272 | 232 |
| 488 | 3300026142 | Ga0207698_10036689 | Ga0207698_100366892 | 232 |
| 489 | 3300028381 | Ga0268264_10062720 | Ga0268264_100627203 | 232 |
| 490 | 3300031548 | Ga0307408_100421549 | Ga0307408_1004215492 | 232 |
| 491 | 3300031731 | Ga0307405_10001063 | Ga0307405_100010633 | 232 |
| 492 | 3300031852 | Ga0307410_10177943 | Ga0307410_101779432 | 232 |
| 493 | 3300031901 | Ga0307406_10003525 | Ga0307406_100035252 | 232 |
| 494 | 3300031903 | Ga0307407_10004629 | Ga0307407_100046293 | 232 |
| 495 | 3300031911 | Ga0307412_10009253 | Ga0307412_100092534 | 232 |
| 496 | 3300031995 | Ga0307409_100045019 | Ga0307409_1000450193 | 232 |
| 497 | 3300032002 | Ga0307416_100039057 | Ga0307416_1000390573 | 232 |
| 498 | 3300032005 | Ga0307411_10020892 | Ga0307411_100208923 | 232 |
| 499 | 3300032126 | Ga0307415_100053831 | Ga0307415_1000538313 | 232 |
| 500 | 3300039447 | Ga0436361_0633280 | Ga0436361_0633280_18146_18967 | 232 |
| 501 | 3300039447 | Ga0436361_0943694 | Ga0436361_0943694_30791_31609 | 232 |
| 502 | 3300039447 | Ga0436361_1030340 | Ga0436361_1030340_40213_41037 | 232 |
| 503 | 3300042876 | Ga0451577_0002513 | Ga0451577_0002513_13354_14193 | 232 |
| 504 | 3300048903 | Ga0496100_0172254 | Ga0496100_0172254_604_1434 | 232 |
| 505 | 3300048905 | Ga0496102_0078328 | Ga0496102_0078328_84_914 | 232 |
| 506 | 3300048909 | Ga0496106_0005737 | Ga0496106_0005737_4793_5623 | 232 |
| 507 | 3300049649 | Ga0501198_000003 | Ga0501198_000003_45722_46603 | 232 |
| 508 | 3300049662 | Ga0501222_000014 | Ga0501222_000014_45722_46603 | 232 |
| 509 | 3300053139 | Ga0500568_0020192 | Ga0500568_0020192_693_1523 | 232 |
| 510 | iso_pu_bacteria | 2883577096 | 2883578324 | 232 |
| 511 | 3300002774 | JGI25150J39212_1000667 | JGI25150J39212_100066711 | 233 |
| 512 | 3300003215 | JGI25153J46596_10034800 | JGI25153J46596_100348001 | 233 |
| 513 | 3300003771 | Ga0055526_1000074 | Ga0055526_100007418 | 233 |
| 514 | 3300005328 | Ga0070676_10160615 | Ga0070676_101606152 | 233 |
| 515 | 3300005347 | Ga0070668_100170697 | Ga0070668_1001706972 | 233 |
| 516 | 3300005367 | Ga0070667_100616281 | Ga0070667_1006162811 | 233 |
| 517 | 3300005455 | Ga0070663_100079453 | Ga0070663_1000794532 | 233 |
| 518 | 3300005543 | Ga0070672_100047622 | Ga0070672_1000476222 | 233 |
| 519 | 3300005563 | Ga0068855_100009643 | Ga0068855_10000964313 | 233 |
| 520 | 3300005578 | Ga0068854_100177767 | Ga0068854_1001777672 | 233 |
| 521 | 3300005843 | Ga0068860_100227804 | Ga0068860_1002278042 | 233 |
| 522 | 3300006042 | Ga0075368_10095893 | Ga0075368_100958932 | 233 |
| 523 | 3300006048 | Ga0075363_100083329 | Ga0075363_1000833292 | 233 |
| 524 | 3300006177 | Ga0075362_10005262 | Ga0075362_100052624 | 233 |
| 525 | 3300006178 | Ga0075367_10007819 | Ga0075367_100078194 | 233 |
| 526 | 3300006353 | Ga0075370_10008613 | Ga0075370_100086133 | 233 |
| 527 | 3300006353 | Ga0075370_10021076 | Ga0075370_100210762 | 233 |
| 528 | 3300006353 | Ga0075370_10105203 | Ga0075370_101052032 | 233 |
| 529 | 3300006358 | Ga0068871_100185256 | Ga0068871_1001852561 | 233 |
| 530 | 3300006946 | Ga0079104_1004305 | Ga0079104_10043052 | 233 |
| 531 | 3300009036 | Ga0105244_10005473 | Ga0105244_100054734 | 233 |
| 532 | 3300009094 | Ga0111539_11099492 | Ga0111539_110994921 | 233 |
| 533 | 3300009098 | Ga0105245_10096658 | Ga0105245_100966583 | 233 |
| 534 | 3300009148 | Ga0105243_10059329 | Ga0105243_100593292 | 233 |
| 535 | 3300009148 | Ga0105243_10100525 | Ga0105243_101005252 | 233 |
| 536 | 3300009177 | Ga0105248_10003709 | Ga0105248_1000370916 | 233 |
| 537 | 3300009553 | Ga0105249_10286980 | Ga0105249_102869802 | 233 |
| 538 | 3300013308 | Ga0157375_10125562 | Ga0157375_101255623 | 233 |
| 539 | 3300014326 | Ga0157380_10098497 | Ga0157380_100984971 | 233 |
| 540 | 3300014497 | Ga0182008_10014563 | Ga0182008_100145632 | 233 |
| 541 | 3300015261 | Ga0182006_1000002 | Ga0182006_1000002505 | 233 |
| 542 | 3300015261 | Ga0182006_1000026 | Ga0182006_1000026149 | 233 |
| 543 | 3300015262 | Ga0182007_10000073 | Ga0182007_1000007323 | 233 |
| 544 | 3300015265 | Ga0182005_1000002 | Ga0182005_1000002587 | 233 |
| 545 | 3300015265 | Ga0182005_1000007 | Ga0182005_1000007230 | 233 |
| 546 | 3300021361 | Ga0213872_10000028 | Ga0213872_1000002884 | 233 |
| 547 | 3300025245 | Ga0207425_1000192 | Ga0207425_100019236 | 233 |
| 548 | 3300025294 | Ga0209025_1007891 | Ga0209025_10078917 | 233 |
| 549 | 3300025295 | Ga0209564_1000009 | Ga0209564_1000009281 | 233 |
| 550 | 3300025297 | Ga0209758_1000227 | Ga0209758_100022748 | 233 |
| 551 | 3300025917 | Ga0207660_10081617 | Ga0207660_100816173 | 233 |
| 552 | 3300025923 | Ga0207681_10189141 | Ga0207681_101891412 | 233 |
| 553 | 3300025931 | Ga0207644_10019073 | Ga0207644_100190731 | 233 |
| 554 | 3300025940 | Ga0207691_10038626 | Ga0207691_100386264 | 233 |
| 555 | 3300025940 | Ga0207691_10053485 | Ga0207691_100534853 | 233 |
| 556 | 3300025941 | Ga0207711_10214096 | Ga0207711_102140962 | 233 |
| 557 | 3300025981 | Ga0207640_10020459 | Ga0207640_100204594 | 233 |
| 558 | 3300025986 | Ga0207658_10276004 | Ga0207658_102760042 | 233 |
| 559 | 3300026116 | Ga0207674_10306920 | Ga0207674_103069202 | 233 |
| 560 | 3300026116 | Ga0207674_10329185 | Ga0207674_103291851 | 233 |
| 561 | 3300026142 | Ga0207698_10127853 | Ga0207698_101278532 | 233 |
| 562 | 3300027866 | Ga0209813_10031522 | Ga0209813_100315222 | 233 |
| 563 | 3300027907 | Ga0207428_10287455 | Ga0207428_102874552 | 233 |
| 564 | 3300028381 | Ga0268264_10292743 | Ga0268264_102927432 | 233 |
| 565 | 3300029957 | Ga0265324_10019937 | Ga0265324_100199372 | 233 |
| 566 | 3300031251 | Ga0265327_10000217 | Ga0265327_1000021781 | 233 |
| 567 | 3300031251 | Ga0265327_10021683 | Ga0265327_100216832 | 233 |
| 568 | 3300031507 | Ga0307509_10175510 | Ga0307509_101755102 | 233 |
| 569 | 3300031730 | Ga0307516_10225042 | Ga0307516_102250422 | 233 |
| 570 | 3300032004 | Ga0307414_10043954 | Ga0307414_100439541 | 233 |
| 571 | 3300035114 | Ga0373939_0026399 | Ga0373939_0026399_10_834 | 233 |
| 572 | 3300038726 | Ga0400490_40529 | Ga0400490_40529_866_1693 | 233 |
| 573 | 3300039447 | Ga0436361_0420505 | Ga0436361_0420505_81117_81944 | 233 |
| 574 | 3300044673 | Ga0453683_0052988 | Ga0453683_0052988_1209_2027 | 233 |
| 575 | 3300044712 | Ga0453684_0033923 | Ga0453684_0033923_5585_6403 | 233 |
| 576 | 3300044712 | Ga0453684_0779254 | Ga0453684_0779254_43_870 | 233 |
| 577 | 3300045051 | Ga0451576_0008593 | Ga0451576_0008593_7099_7917 | 233 |
| 578 | 3300046452 | Ga0495617_000039 | Ga0495617_000039_116026_116850 | 233 |
| 579 | 3300046453 | Ga0495627_000280 | Ga0495627_000280_39395_40219 | 233 |
| 580 | 3300046457 | Ga0495590_0000018 | Ga0495590_0000018_106406_107230 | 233 |
| 581 | 3300046457 | Ga0495590_0016311 | Ga0495590_0016311_436_1260 | 233 |
| 582 | 3300046458 | Ga0495591_000218 | Ga0495591_000218_14688_15512 | 233 |
| 583 | 3300046459 | Ga0495629_0183757 | Ga0495629_0183757_418_1248 | 233 |
| 584 | 3300046463 | Ga0495653_0053267 | Ga0495653_0053267_1546_2376 | 233 |
| 585 | 3300046471 | Ga0495650_0000166 | Ga0495650_0000166_71464_72291 | 233 |
| 586 | 3300046471 | Ga0495650_0000442 | Ga0495650_0000442_40344_41171 | 233 |
| 587 | 3300046474 | Ga0495605_0000059 | Ga0495605_0000059_78305_79132 | 233 |
| 588 | 3300046474 | Ga0495605_0000256 | Ga0495605_0000256_492_1316 | 233 |
| 589 | 3300046474 | Ga0495605_0024925 | Ga0495605_0024925_2288_3112 | 233 |
| 590 | 3300046492 | Ga0495585_0000288 | Ga0495585_0000288_29262_30086 | 233 |
| 591 | 3300046492 | Ga0495585_0010453 | Ga0495585_0010453_2914_3738 | 233 |
| 592 | 3300046499 | Ga0495594_0057981 | Ga0495594_0057981_906_1736 | 233 |
| 593 | 3300046501 | Ga0495607_0002393 | Ga0495607_0002393_4616_5440 | 233 |
| 594 | 3300046506 | Ga0495583_0000121 | Ga0495583_0000121_28416_29240 | 233 |
| 595 | 3300046507 | Ga0495606_0000064 | Ga0495606_0000064_102873_103700 | 233 |
| 596 | 3300046512 | Ga0495610_0002499 | Ga0495610_0002499_4685_5509 | 233 |
| 597 | 3300046512 | Ga0495610_0006142 | Ga0495610_0006142_7430_8257 | 233 |
| 598 | 3300046513 | Ga0495616_0006600 | Ga0495616_0006600_5165_5989 | 233 |
| 599 | 3300046513 | Ga0495616_0028044 | Ga0495616_0028044_796_1626 | 233 |
| 600 | 3300046518 | Ga0495631_0001316 | Ga0495631_0001316_548_1372 | 233 |
| 601 | 3300046518 | Ga0495631_0005164 | Ga0495631_0005164_3678_4502 | 233 |
| 602 | 3300046519 | Ga0495632_0012093 | Ga0495632_0012093_2431_3258 | 233 |
| 603 | 3300046520 | Ga0495637_0000004 | Ga0495637_0000004_500781_501605 | 233 |
| 604 | 3300046523 | Ga0495644_0018028 | Ga0495644_0018028_796_1626 | 233 |
| 605 | 3300046524 | Ga0495648_0000149 | Ga0495648_0000149_9533_10357 | 233 |
| 606 | 3300046524 | Ga0495648_0000908 | Ga0495648_0000908_20419_21243 | 233 |
| 607 | 3300046526 | Ga0495666_0050297 | Ga0495666_0050297_181_1014 | 233 |
| 608 | 3300046528 | Ga0495642_0001386 | Ga0495642_0001386_9125_9949 | 233 |
| 609 | 3300046531 | Ga0495665_0017932 | Ga0495665_0017932_2017_2847 | 233 |
| 610 | 3300046531 | Ga0495665_0142255 | Ga0495665_0142255_347_1180 | 233 |
| 611 | 3300046536 | Ga0495587_0010410 | Ga0495587_0010410_4741_5574 | 233 |
| 612 | 3300046537 | Ga0495598_0022229 | Ga0495598_0022229_385_1215 | 233 |
| 613 | 3300046538 | Ga0495609_0005541 | Ga0495609_0005541_880_1704 | 233 |
| 614 | 3300046538 | Ga0495609_0011626 | Ga0495609_0011626_1015_1839 | 233 |
| 615 | 3300046557 | Ga0495622_0009230 | Ga0495622_0009230_187_1020 | 233 |
| 616 | 3300046557 | Ga0495622_0017647 | Ga0495622_0017647_1424_2254 | 233 |
| 617 | 3300046558 | Ga0495633_0004666 | Ga0495633_0004666_5878_6702 | 233 |
| 618 | 3300046558 | Ga0495633_0021525 | Ga0495633_0021525_1991_2821 | 233 |
| 619 | 3300046616 | Ga0495668_0000185 | Ga0495668_0000185_35393_36220 | 233 |
| 620 | 3300046616 | Ga0495668_0004037 | Ga0495668_0004037_218_1048 | 233 |
| 621 | 3300046648 | Ga0495611_0001338 | Ga0495611_0001338_7011_7835 | 233 |
| 622 | 3300046648 | Ga0495611_0001418 | Ga0495611_0001418_2207_3031 | 233 |
| 623 | 3300046648 | Ga0495611_0020618 | Ga0495611_0020618_1681_2505 | 233 |
| 624 | 3300046648 | Ga0495611_0034931 | Ga0495611_0034931_379_1203 | 233 |
| 625 | 3300046648 | Ga0495611_0073261 | Ga0495611_0073261_244_1068 | 233 |
| 626 | 3300046660 | Ga0495625_0000372 | Ga0495625_0000372_32108_32935 | 233 |
| 627 | 3300046660 | Ga0495625_0063464 | Ga0495625_0063464_86_913 | 233 |
| 628 | 3300046663 | Ga0495635_0010057 | Ga0495635_0010057_1777_2607 | 233 |
| 629 | 3300046664 | Ga0495659_0000065 | Ga0495659_0000065_7790_8617 | 233 |
| 630 | 3300046665 | Ga0495661_0006787 | Ga0495661_0006787_1310_2134 | 233 |
| 631 | 3300046665 | Ga0495661_0135356 | Ga0495661_0135356_493_1317 | 233 |
| 632 | 3300046674 | Ga0495588_0112599 | Ga0495588_0112599_201_1031 | 233 |
| 633 | 3300046674 | Ga0495588_0148341 | Ga0495588_0148341_249_1082 | 233 |
| 634 | 3300046679 | Ga0495623_0068045 | Ga0495623_0068045_928_1761 | 233 |
| 635 | 3300046684 | Ga0495669_0000870 | Ga0495669_0000870_3862_4686 | 233 |
| 636 | 3300046691 | Ga0495670_0059855 | Ga0495670_0059855_1022_1846 | 233 |
| 637 | 3300046692 | Ga0495671_0000903 | Ga0495671_0000903_11501_12325 | 233 |
| 638 | 3300046694 | Ga0495649_0017065 | Ga0495649_0017065_114_941 | 233 |
| 639 | 3300046810 | Ga0495660_0013101 | Ga0495660_0013101_3788_4612 | 233 |
| 640 | 3300047315 | Ga0495581_0001952 | Ga0495581_0001952_7425_8255 | 233 |
| 641 | 3300047315 | Ga0495581_0019225 | Ga0495581_0019225_2262_3095 | 233 |
| 642 | 3300047320 | Ga0495672_0000477 | Ga0495672_0000477_39056_39880 | 233 |
| 643 | 3300047320 | Ga0495672_0000627 | Ga0495672_0000627_33120_33947 | 233 |
| 644 | 3300047320 | Ga0495672_0131721 | Ga0495672_0131721_27_851 | 233 |
| 645 | 3300047322 | Ga0495680_0016593 | Ga0495680_0016593_1713_2543 | 233 |
| 646 | 3300047323 | Ga0495683_0000041 | Ga0495683_0000041_123156_123980 | 233 |
| 647 | 3300047323 | Ga0495683_0004175 | Ga0495683_0004175_7310_8134 | 233 |
| 648 | 3300047323 | Ga0495683_0019448 | Ga0495683_0019448_1927_2751 | 233 |
| 649 | 3300047323 | Ga0495683_0068444 | Ga0495683_0068444_723_1547 | 233 |
| 650 | 3300047443 | Ga0495687_042191 | Ga0495687_042191_408_1235 | 233 |
| 651 | 3300047444 | Ga0495675_0024438 | Ga0495675_0024438_1419_2249 | 233 |
| 652 | 3300047444 | Ga0495675_0108964 | Ga0495675_0108964_23_856 | 233 |
| 653 | 3300047445 | Ga0495677_0002560 | Ga0495677_0002560_5501_6325 | 233 |
| 654 | 3300047445 | Ga0495677_0002828 | Ga0495677_0002828_4663_5493 | 233 |
| 655 | 3300047445 | Ga0495677_0030456 | Ga0495677_0030456_219_1043 | 233 |
| 656 | 3300047446 | Ga0495679_009023 | Ga0495679_009023_1560_2384 | 233 |
| 657 | 3300047469 | Ga0495673_0000003 | Ga0495673_0000003_1408317_1409144 | 233 |
| 658 | 3300047469 | Ga0495673_0003810 | Ga0495673_0003810_7622_8446 | 233 |
| 659 | 3300047470 | Ga0495681_0011038 | Ga0495681_0011038_355_1179 | 233 |
| 660 | 3300047470 | Ga0495681_0081933 | Ga0495681_0081933_57_884 | 233 |
| 661 | 3300047472 | Ga0495686_0000350 | Ga0495686_0000350_74011_74835 | 233 |
| 662 | 3300047472 | Ga0495686_0000675 | Ga0495686_0000675_2217_3041 | 233 |
| 663 | 3300047673 | Ga0495593_0002755 | Ga0495593_0002755_8965_9795 | 233 |
| 664 | 3300048088 | Ga0495602_0055501 | Ga0495602_0055501_76_909 | 233 |
| 665 | 3300048089 | Ga0495614_0005291 | Ga0495614_0005291_1252_2082 | 233 |
| 666 | 3300048091 | Ga0495626_0089260 | Ga0495626_0089260_420_1244 | 233 |
| 667 | 3300048905 | Ga0496102_0000351 | Ga0496102_0000351_45562_46386 | 233 |
| 668 | 3300048918 | Ga0496115_0159423 | Ga0496115_0159423_481_1305 | 233 |
| 669 | 3300048918 | Ga0496115_0171688 | Ga0496115_0171688_473_1297 | 233 |
| 670 | 3300048920 | Ga0496117_0000001 | Ga0496117_0000001_1522185_1523012 | 233 |
| 671 | 3300048921 | Ga0496118_0000002 | Ga0496118_0000002_1522185_1523012 | 233 |
| 672 | 3300048927 | Ga0496124_0146234 | Ga0496124_0146234_632_1456 | 233 |
| 673 | 3300048927 | Ga0496124_0156254 | Ga0496124_0156254_464_1288 | 233 |
| 674 | 3300048929 | Ga0496126_0005441 | Ga0496126_0005441_5554_6381 | 233 |
| 675 | 3300049459 | Ga0495678_000121 | Ga0495678_000121_10650_11474 | 233 |
| 676 | 3300050492 | nmdc:mga0yw44_274305_c1 | nmdc:mga0yw44_274305_c1_29_856 | 233 |
| 677 | 3300050493 | nmdc:mga0k408_6321_c1 | nmdc:mga0k408_6321_c1_5066_5893 | 233 |
| 678 | 3300050494 | nmdc:mga06z11_26874_c1 | nmdc:mga06z11_26874_c1_36_863 | 233 |
| 679 | 3300050496 | nmdc:mga07m45_14547_c1 | nmdc:mga07m45_14547_c1_2703_3530 | 233 |
| 680 | 3300050507 | nmdc:mga05p37_846524_c1 | nmdc:mga05p37_846524_c1_80_904 | 233 |
| 681 | 3300003763 | Ga0055529_1000392 | Ga0055529_100039228 | 234 |
| 682 | 3300003775 | Ga0055524_1000021 | Ga0055524_100002160 | 234 |
| 683 | 3300003775 | Ga0055524_1000099 | Ga0055524_100009931 | 234 |
| 684 | 3300005327 | Ga0070658_10013796 | Ga0070658_100137965 | 234 |
| 685 | 3300005337 | Ga0070682_100314188 | Ga0070682_1003141881 | 234 |
| 686 | 3300005339 | Ga0070660_100000646 | Ga0070660_1000006466 | 234 |
| 687 | 3300005366 | Ga0070659_100144393 | Ga0070659_1001443932 | 234 |
| 688 | 3300005539 | Ga0068853_100040591 | Ga0068853_1000405912 | 234 |
| 689 | 3300005614 | Ga0068856_100100140 | Ga0068856_1001001401 | 234 |
| 690 | 3300005616 | Ga0068852_100659250 | Ga0068852_1006592501 | 234 |
| 691 | 3300005937 | Ga0081455_10004332 | Ga0081455_100043326 | 234 |
| 692 | 3300006195 | Ga0075366_10015633 | Ga0075366_100156333 | 234 |
| 693 | 3300006846 | Ga0075430_100174741 | Ga0075430_1001747413 | 234 |
| 694 | 3300006871 | Ga0075434_100305682 | Ga0075434_1003056822 | 234 |
| 695 | 3300006948 | Ga0099826_10000002 | Ga0099826_10000002984 | 234 |
| 696 | 3300007076 | Ga0075435_100047799 | Ga0075435_1000477993 | 234 |
| 697 | 3300009093 | Ga0105240_10008869 | Ga0105240_1000886911 | 234 |
| 698 | 3300009093 | Ga0105240_10025060 | Ga0105240_1002506010 | 234 |
| 699 | 3300009094 | Ga0111539_10010207 | Ga0111539_100102075 | 234 |
| 700 | 3300009551 | Ga0105238_10134544 | Ga0105238_101345442 | 234 |
| 701 | 3300013307 | Ga0157372_10207410 | Ga0157372_102074103 | 234 |
| 702 | 3300015261 | Ga0182006_1052716 | Ga0182006_10527162 | 234 |
| 703 | 3300015265 | Ga0182005_1000662 | Ga0182005_10006625 | 234 |
| 704 | 3300025231 | Ga0207427_100592 | Ga0207427_10059217 | 234 |
| 705 | 3300025263 | Ga0209565_1029489 | Ga0209565_10294892 | 234 |
| 706 | 3300025272 | Ga0209455_1000037 | Ga0209455_1000037181 | 234 |
| 707 | 3300025299 | Ga0209256_1000044 | Ga0209256_1000044144 | 234 |
| 708 | 3300025913 | Ga0207695_10100163 | Ga0207695_101001633 | 234 |
| 709 | 3300025913 | Ga0207695_10173512 | Ga0207695_101735121 | 234 |
| 710 | 3300025935 | Ga0207709_10444253 | Ga0207709_104442532 | 234 |
| 711 | 3300025949 | Ga0207667_10090963 | Ga0207667_100909632 | 234 |
| 712 | 3300026041 | Ga0207639_10036308 | Ga0207639_100363082 | 234 |
| 713 | 3300026078 | Ga0207702_10385526 | Ga0207702_103855262 | 234 |
| 714 | 3300027666 | Ga0209282_1000001 | Ga0209282_1000001177 | 234 |
| 715 | 3300027907 | Ga0207428_10007839 | Ga0207428_100078394 | 234 |
| 716 | 3300031238 | Ga0265332_10002144 | Ga0265332_100021441 | 234 |
| 717 | 3300031239 | Ga0265328_10049342 | Ga0265328_100493422 | 234 |
| 718 | 3300031241 | Ga0265325_10044008 | Ga0265325_100440082 | 234 |
| 719 | 3300031242 | Ga0265329_10001607 | Ga0265329_100016076 | 234 |
| 720 | 3300031250 | Ga0265331_10000565 | Ga0265331_1000056526 | 234 |
| 721 | 3300031838 | Ga0307518_10014580 | Ga0307518_100145806 | 234 |
| 722 | 3300037312 | Ga0395899_0003408 | Ga0395899_0003408_90_917 | 234 |
| 723 | 3300037418 | Ga0395900_0627722 | Ga0395900_0627722_133_960 | 234 |
| 724 | 3300039447 | Ga0436361_0299736 | Ga0436361_0299736_1409_2233 | 234 |
| 725 | 3300044658 | Ga0466972_0000060 | Ga0466972_0000060_55175_56002 | 234 |
| 726 | 3300044683 | Ga0466965_0001277 | Ga0466965_0001277_1080_1907 | 234 |
| 727 | 3300044842 | Ga0466957_0212841 | Ga0466957_0212841_177_1001 | 234 |
| 728 | 3300045051 | Ga0451576_0000119 | Ga0451576_0000119_141376_142194 | 234 |
| 729 | 3300045051 | Ga0451576_0181381 | Ga0451576_0181381_184_1017 | 234 |
| 730 | 3300045976 | Ga0466967_0225430 | Ga0466967_0225430_418_1245 | 234 |
| 731 | 3300046462 | Ga0495651_0121874 | Ga0495651_0121874_911_1738 | 234 |
| 732 | 3300046463 | Ga0495653_0012213 | Ga0495653_0012213_2692_3519 | 234 |
| 733 | 3300046492 | Ga0495585_0002218 | Ga0495585_0002218_13072_13911 | 234 |
| 734 | 3300046501 | Ga0495607_0075043 | Ga0495607_0075043_388_1215 | 234 |
| 735 | 3300046506 | Ga0495583_0001694 | Ga0495583_0001694_14844_15671 | 234 |
| 736 | 3300046514 | Ga0495618_0013302 | Ga0495618_0013302_1939_2766 | 234 |
| 737 | 3300046516 | Ga0495628_0003383 | Ga0495628_0003383_9078_9905 | 234 |
| 738 | 3300046558 | Ga0495633_0056826 | Ga0495633_0056826_204_1028 | 234 |
| 739 | 3300046648 | Ga0495611_0001094 | Ga0495611_0001094_136_975 | 234 |
| 740 | 3300046678 | Ga0495599_0000788 | Ga0495599_0000788_2560_3387 | 234 |
| 741 | 3300046684 | Ga0495669_0001618 | Ga0495669_0001618_3249_4088 | 234 |
| 742 | 3300046809 | Ga0495600_0000151 | Ga0495600_0000151_13779_14606 | 234 |
| 743 | 3300047317 | Ga0495604_0016637 | Ga0495604_0016637_1961_2788 | 234 |
| 744 | 3300047443 | Ga0495687_000437 | Ga0495687_000437_40630_41469 | 234 |
| 745 | 3300048088 | Ga0495602_0026848 | Ga0495602_0026848_177_1004 | 234 |
| 746 | 3300048913 | Ga0496110_0453856 | Ga0496110_0453856_254_1084 | 234 |
| 747 | 3300048915 | Ga0496112_0013000 | Ga0496112_0013000_4257_5087 | 234 |
| 748 | 3300048916 | Ga0496113_0026162 | Ga0496113_0026162_1016_1846 | 234 |
| 749 | 3300048921 | Ga0496118_0121539 | Ga0496118_0121539_211_1038 | 234 |
| 750 | 3300048928 | Ga0496125_0001032 | Ga0496125_0001032_4764_5588 | 234 |
| 751 | 3300049580 | Ga0501046_0415155 | Ga0501046_0415155_32_874 | 234 |
| 752 | 3300049582 | Ga0501048_0188329 | Ga0501048_0188329_489_1331 | 234 |
| 753 | 3300049587 | Ga0501071_0079840 | Ga0501071_0079840_1260_2102 | 234 |
| 754 | 3300049588 | Ga0501072_0297287 | Ga0501072_0297287_145_987 | 234 |
| 755 | 3300049592 | Ga0501076_0056508 | Ga0501076_0056508_503_1345 | 234 |
| 756 | 3300049744 | Ga0501083_0181134 | Ga0501083_0181134_355_1197 | 234 |
| 757 | 3300050511 | nmdc:mga08y16_6905_c1 | nmdc:mga08y16_6905_c1_4364_5209 | 234 |
| 758 | 3300050513 | nmdc:mga0rr50_44110_c1 | nmdc:mga0rr50_44110_c1_997_1827 | 234 |
| 759 | 3300054114 | Ga0501084_0159229 | Ga0501084_0159229_602_1444 | 234 |
| 760 | 3300059505 | Ga0587083_0042145 | Ga0587083_0042145_56_883 | 234 |
| 761 | 3300059510 | Ga0587090_001158 | Ga0587090_001158_153_980 | 234 |
| 762 | 3300060353 | Ga0501082_0116368 | Ga0501082_0116368_652_1494 | 234 |
| 763 | iso_pu_bacteria | 2831864461 | 2831869908 | 234 |
| 764 | 3300002704 | JGI25155J39150_1000117 | JGI25155J39150_100011717 | 235 |
| 765 | 3300002704 | JGI25155J39150_1000303 | JGI25155J39150_10003033 | 235 |
| 766 | 3300002705 | JGI25156J39149_1000108 | JGI25156J39149_100010840 | 235 |
| 767 | 3300002737 | JGI25162J39368_1005095 | JGI25162J39368_10050953 | 235 |
| 768 | 3300002738 | JGI25154J39366_1000222 | JGI25154J39366_100022217 | 235 |
| 769 | 3300002738 | JGI25154J39366_1000463 | JGI25154J39366_100046313 | 235 |
| 770 | 3300002741 | JGI25157J39369_1000120 | JGI25157J39369_100012036 | 235 |
| 771 | 3300003758 | Ga0055532_1000051 | Ga0055532_1000051114 | 235 |
| 772 | 3300005344 | Ga0070661_100003476 | Ga0070661_1000034768 | 235 |
| 773 | 3300005356 | Ga0070674_100102615 | Ga0070674_1001026152 | 235 |
| 774 | 3300006195 | Ga0075366_10020636 | Ga0075366_100206365 | 235 |
| 775 | 3300009093 | Ga0105240_10022945 | Ga0105240_100229453 | 235 |
| 776 | 3300013307 | Ga0157372_10004653 | Ga0157372_1000465310 | 235 |
| 777 | 3300014497 | Ga0182008_10035124 | Ga0182008_100351242 | 235 |
| 778 | 3300015261 | Ga0182006_1031040 | Ga0182006_10310402 | 235 |
| 779 | 3300025206 | Ga0209435_100028 | Ga0209435_10002823 | 235 |
| 780 | 3300025206 | Ga0209435_100139 | Ga0209435_1001394 | 235 |
| 781 | 3300025229 | Ga0209147_100004 | Ga0209147_100004370 | 235 |
| 782 | 3300025233 | Ga0209437_100053 | Ga0209437_100053281 | 235 |
| 783 | 3300025246 | Ga0209646_1000021 | Ga0209646_1000021151 | 235 |
| 784 | 3300025246 | Ga0209646_1000095 | Ga0209646_100009523 | 235 |
| 785 | 3300025250 | Ga0209026_1000110 | Ga0209026_100011023 | 235 |
| 786 | 3300025256 | Ga0209759_1000080 | Ga0209759_1000080109 | 235 |
| 787 | 3300025256 | Ga0209759_1000115 | Ga0209759_100011523 | 235 |
| 788 | 3300025256 | Ga0209759_1000155 | Ga0209759_100015586 | 235 |
| 789 | 3300025272 | Ga0209455_1004470 | Ga0209455_10044703 | 235 |
| 790 | 3300025913 | Ga0207695_10002201 | Ga0207695_1000220126 | 235 |
| 791 | 3300025913 | Ga0207695_10395223 | Ga0207695_103952231 | 235 |
| 792 | 3300026116 | Ga0207674_10511969 | Ga0207674_105119692 | 235 |
| 793 | 3300031238 | Ga0265332_10000094 | Ga0265332_1000009413 | 235 |
| 794 | 3300037312 | Ga0395899_0000082 | Ga0395899_0000082_59904_60731 | 235 |
| 795 | 3300046459 | Ga0495629_0018715 | Ga0495629_0018715_2047_2883 | 235 |
| 796 | 3300046491 | Ga0495584_0000006 | Ga0495584_0000006_113145_113981 | 235 |
| 797 | 3300046499 | Ga0495594_0069218 | Ga0495594_0069218_298_1134 | 235 |
| 798 | 3300046526 | Ga0495666_0045536 | Ga0495666_0045536_582_1418 | 235 |
| 799 | 3300046531 | Ga0495665_0001409 | Ga0495665_0001409_6060_6902 | 235 |
| 800 | 3300046660 | Ga0495625_0001737 | Ga0495625_0001737_19437_20273 | 235 |
| 801 | 3300046674 | Ga0495588_0049916 | Ga0495588_0049916_735_1571 | 235 |
| 802 | 3300046691 | Ga0495670_0063406 | Ga0495670_0063406_972_1811 | 235 |
| 803 | 3300047319 | Ga0495674_0003612 | Ga0495674_0003612_7991_8827 | 235 |
| 804 | 3300047321 | Ga0495676_0212855 | Ga0495676_0212855_206_1039 | 235 |
| 805 | 3300048925 | Ga0496122_0003153 | Ga0496122_0003153_1030_1866 | 235 |
| 806 | 3300048926 | Ga0496123_0000295 | Ga0496123_0000295_27900_28736 | 235 |
| 807 | 3300048928 | Ga0496125_0010264 | Ga0496125_0010264_274_1110 | 235 |
| 808 | 3300050493 | nmdc:mga0k408_7248_c1 | nmdc:mga0k408_7248_c1_3200_4039 | 235 |
| 809 | 3300053156 | Ga0500622_0109934 | Ga0500622_0109934_39_869 | 235 |
| 810 | iso_pu_bacteria | 2506520008 | 2506585213 | 235 |
| 811 | iso_pu_bacteria | 2508501071 | 2508853880 | 235 |
| 812 | iso_pu_bacteria | 2547132181 | 2547696688 | 235 |
| 813 | iso_pu_bacteria | 2547132512 | 2548848177 | 235 |
| 814 | iso_pu_bacteria | 2554235234 | 2555261927 | 235 |
| 815 | iso_pu_bacteria | 2561511199 | 2562466047 | 235 |
| 816 | iso_pu_bacteria | 2574179768 | 2574432208 | 235 |
| 817 | iso_pu_bacteria | 2599185169 | 2599412288 | 235 |
| 818 | iso_pu_bacteria | 2600255254 | 2601525478 | 235 |
| 819 | iso_pu_bacteria | 2600255255 | 2601530549 | 235 |
| 820 | iso_pu_bacteria | 2600255256 | 2601534098 | 235 |
| 821 | iso_pu_bacteria | 2600255257 | 2601540266 | 235 |
| 822 | iso_pu_bacteria | 2600255280 | 2601617599 | 235 |
| 823 | iso_pu_bacteria | 2600255281 | 2601622633 | 235 |
| 824 | iso_pu_bacteria | 2600255287 | 2601644459 | 235 |
| 825 | iso_pu_bacteria | 2600255288 | 2601650907 | 235 |
| 826 | iso_pu_bacteria | 2600255289 | 2601655957 | 235 |
| 827 | iso_pu_bacteria | 2600255290 | 2601660763 | 235 |
| 828 | iso_pu_bacteria | 2600255291 | 2601664624 | 235 |
| 829 | iso_pu_bacteria | 2600255298 | 2601697508 | 235 |
| 830 | iso_pu_bacteria | 2600255299 | 2601702896 | 235 |
| 831 | iso_pu_bacteria | 2600255300 | 2601708723 | 235 |
| 832 | iso_pu_bacteria | 2600255301 | 2601713581 | 235 |
| 833 | iso_pu_bacteria | 2600255302 | 2601718806 | 235 |
| 834 | iso_pu_bacteria | 2600255303 | 2601722445 | 235 |
| 835 | iso_pu_bacteria | 2600255304 | 2601728713 | 235 |
| 836 | iso_pu_bacteria | 2600255305 | 2601733636 | 235 |
| 837 | iso_pu_bacteria | 2600255306 | 2601738611 | 235 |
| 838 | iso_pu_bacteria | 2600255307 | 2601743057 | 235 |
| 839 | iso_pu_bacteria | 2600255309 | 2601753851 | 235 |
| 840 | iso_pu_bacteria | 2600255310 | 2601758751 | 235 |
| 841 | iso_pu_bacteria | 2600255311 | 2601762898 | 235 |
| 842 | iso_pu_bacteria | 2600255392 | 2602020619 | 235 |
| 843 | iso_pu_bacteria | 2602042046 | 2603640751 | 235 |
| 844 | iso_pu_bacteria | 2602042047 | 2603644456 | 235 |
| 845 | iso_pu_bacteria | 2602042052 | 2603663059 | 235 |
| 846 | iso_pu_bacteria | 2602042053 | 2603667957 | 235 |
| 847 | iso_pu_bacteria | 2602042066 | 2603700315 | 235 |
| 848 | iso_pu_bacteria | 2602042067 | 2603706071 | 235 |
| 849 | iso_pu_bacteria | 2602042103 | 2603841276 | 235 |
| 850 | iso_pu_bacteria | 2602042104 | 2603846348 | 235 |
| 851 | iso_pu_bacteria | 2602042105 | 2603851423 | 235 |
| 852 | iso_pu_bacteria | 2602042106 | 2603856490 | 235 |
| 853 | iso_pu_bacteria | 2602042109 | 2603868701 | 235 |
| 854 | iso_pu_bacteria | 2602042110 | 2603874070 | 235 |
| 855 | iso_pu_bacteria | 2602042111 | 2603878765 | 235 |
| 856 | iso_pu_bacteria | 2603880178 | 2606051250 | 235 |
| 857 | iso_pu_bacteria | 2603880184 | 2606072113 | 235 |
| 858 | iso_pu_bacteria | 2603880202 | 2606148819 | 235 |
| 859 | iso_pu_bacteria | 2603880211 | 2606179141 | 235 |
| 860 | iso_pu_bacteria | 2609459761 | 2609911817 | 235 |
| 861 | iso_pu_bacteria | 2636415599 | 2637226992 | 235 |
| 862 | iso_pu_bacteria | 2643221554 | 2643787073 | 235 |
| 863 | iso_pu_bacteria | 2643221638 | 2644215836 | 235 |
| 864 | iso_pu_bacteria | 2643221665 | 2644365316 | 235 |
| 865 | iso_pu_bacteria | 2667528172 | 2671103570 | 235 |
| 866 | iso_pu_bacteria | 2671180115 | 2671587865 | 235 |
| 867 | iso_pu_bacteria | 2675903046 | 2676409520 | 235 |
| 868 | iso_pu_bacteria | 2681812866 | 2681996980 | 235 |
| 869 | iso_pu_bacteria | 2681812869 | 2682008766 | 235 |
| 870 | iso_pu_bacteria | 2687453601 | 2689446617 | 235 |
| 871 | iso_pu_bacteria | 2690315857 | 2691330939 | 235 |
| 872 | iso_pu_bacteria | 2706794495 | 2707100125 | 235 |
| 873 | iso_pu_bacteria | 2711768156 | 2712470777 | 235 |
| 874 | iso_pu_bacteria | 2751185917 | 2753854698 | 235 |
| 875 | iso_pu_bacteria | 2765235842 | 2765587564 | 235 |
| 876 | iso_pu_bacteria | 2772190666 | 2772440529 | 235 |
| 877 | iso_pu_bacteria | 2773857761 | 2774389846 | 235 |
| 878 | iso_pu_bacteria | 2775506706 | 2775540958 | 235 |
| 879 | iso_pu_bacteria | 2775507074 | 2777021390 | 235 |
| 880 | iso_pu_bacteria | 2791354903 | 2791924374 | 235 |
| 881 | iso_pu_bacteria | 2791355010 | 2792313463 | 235 |
| 882 | iso_pu_bacteria | 2791355275 | 2793406764 | 235 |
| 883 | iso_pu_bacteria | 2806310673 | 2807178447 | 235 |
| 884 | iso_pu_bacteria | 2811995292 | 2813730487 | 235 |
| 885 | iso_pu_bacteria | 2814123068 | 2814698095 | 235 |
| 886 | iso_pu_bacteria | 2821118458 | 2821121562 | 235 |
| 887 | iso_pu_bacteria | 2823373977 | 2823377315 | 235 |
| 888 | iso_pu_bacteria | 2844425489 | 2844426260 | 235 |
| 889 | iso_pu_bacteria | 2881101125 | 2881101867 | 235 |
| 890 | iso_pu_bacteria | 2881714928 | 2881715394 | 235 |
| 891 | iso_pu_bacteria | 2884086401 | 2884090337 | 235 |
| 892 | iso_pu_bacteria | 2888366609 | 2888370608 | 235 |
| 893 | iso_pu_bacteria | 2888373701 | 2888376924 | 235 |
| 894 | iso_pu_bacteria | 2891633521 | 2891637574 | 235 |
| 895 | iso_pu_bacteria | 2891670763 | 2891671942 | 235 |
| 896 | iso_pu_bacteria | 2904479285 | 2904483008 | 235 |
| 897 | iso_pu_bacteria | 2904513164 | 2904516288 | 235 |
| 898 | iso_pu_bacteria | 2908669403 | 2908673289 | 235 |
| 899 | iso_pu_bacteria | 2916178963 | 2916183028 | 235 |
| 900 | iso_pu_bacteria | 2916699645 | 2916701988 | 235 |
| 901 | iso_pu_bacteria | 2919108558 | 2919112505 | 235 |
| 902 | iso_pu_bacteria | 2919493220 | 2919496680 | 235 |
| 903 | iso_pu_bacteria | 2919497567 | 2919498947 | 235 |
| 904 | iso_pu_bacteria | 2919506607 | 2919508203 | 235 |
| 905 | iso_pu_bacteria | 2919543075 | 2919546839 | 235 |
| 906 | iso_pu_bacteria | 2919688452 | 2919692219 | 235 |
| 907 | iso_pu_bacteria | 2919704043 | 2919705361 | 235 |
| 908 | iso_pu_bacteria | 2923634449 | 2923638112 | 235 |
| 909 | iso_pu_bacteria | 2927833300 | 2927835468 | 235 |
| 910 | iso_pu_bacteria | 2928515477 | 2928515851 | 235 |
| 911 | iso_pu_bacteria | 2929199973 | 2929205218 | 235 |
| 912 | iso_pu_bacteria | 2932406140 | 2932410421 | 235 |
| 913 | iso_pu_bacteria | 2935625433 | 2935628055 | 235 |
| 914 | iso_pu_bacteria | 2937539931 | 2937544567 | 235 |
| 915 | iso_pu_bacteria | 2937967321 | 2937971833 | 235 |
| 916 | iso_pu_bacteria | 2939568625 | 2939571449 | 235 |
| 917 | iso_pu_bacteria | 2939573065 | 2939576186 | 235 |
| 918 | iso_pu_bacteria | 2939577877 | 2939581525 | 235 |
| 919 | iso_pu_bacteria | 2939602548 | 2939605286 | 235 |
| 920 | iso_pu_bacteria | 2939607340 | 2939609340 | 235 |
| 921 | iso_pu_bacteria | 2939617950 | 2939619526 | 235 |
| 922 | iso_pu_bacteria | 2939642701 | 2939646142 | 235 |
| 923 | iso_pu_bacteria | 2945874760 | 2945879640 | 235 |
| 924 | iso_pu_bacteria | 2969079654 | 2969084003 | 235 |
| 925 | iso_pu_bacteria | 2971820967 | 2971825479 | 235 |
| 926 | iso_pu_bacteria | 2974310843 | 2974313500 | 235 |
| 927 | iso_pu_bacteria | 2974435778 | 2974437081 | 235 |
| 928 | iso_pu_bacteria | 2984559226 | 2984561080 | 235 |
| 929 | iso_pu_bacteria | 2984568884 | 2984570373 | 235 |
| 930 | iso_pu_bacteria | 2984595703 | 2984599153 | 235 |
| 931 | iso_pu_bacteria | 3000376612 | 3000380389 | 235 |
| 932 | iso_pu_bacteria | 639633007 | 639787153 | 235 |
| 933 | iso_pu_bacteria | 640753048 | 640939350 | 235 |
| 934 | iso_pu_bacteria | 8004592986 | 8004593170 | 235 |
| 935 | iso_pu_bacteria | 8015394850 | 8015396916 | 235 |
| 936 | iso_pu_bacteria | 8018221730 | 8018225262 | 235 |
| 937 | iso_pu_bacteria | 8018405270 | 8018410155 | 235 |
| 938 | iso_pu_bacteria | 8019504834 | 8019506953 | 235 |
| 939 | iso_pu_bacteria | 8033232454 | 8033233950 | 235 |
| 940 | iso_pu_bacteria | 8048746797 | 8048748404 | 235 |
| 941 | iso_pu_bacteria | 8055087960 | 8055092471 | 235 |
| 942 | iso_pu_bacteria | 8055092621 | 8055093670 | 235 |
| 943 | iso_pu_bacteria | 8055097453 | 8055100542 | 235 |
| 944 | iso_pu_bacteria | 8055693939 | 8055697405 | 235 |
| 945 | iso_pu_bacteria | 8055909800 | 8055913397 | 235 |
| 946 | iso_pu_bacteria | 8057304971 | 8057307211 | 235 |
| 947 | 3300001979 | JGI24740J21852_10035369 | JGI24740J21852_100353692 | 236 |
| 948 | 3300001989 | JGI24739J22299_10007778 | JGI24739J22299_100077782 | 236 |
| 949 | 3300001989 | JGI24739J22299_10009567 | JGI24739J22299_100095674 | 236 |
| 950 | 3300001990 | JGI24737J22298_10026242 | JGI24737J22298_100262423 | 236 |
| 951 | 3300002067 | JGI24735J21928_10000304 | JGI24735J21928_100003046 | 236 |
| 952 | 3300002067 | JGI24735J21928_10000462 | JGI24735J21928_1000046212 | 236 |
| 953 | 3300002075 | JGI24738J21930_10012456 | JGI24738J21930_100124562 | 236 |
| 954 | 3300002705 | JGI25156J39149_1001040 | JGI25156J39149_10010404 | 236 |
| 955 | 3300002705 | JGI25156J39149_1001634 | JGI25156J39149_10016342 | 236 |
| 956 | 3300003214 | JGI25165J46597_1002348 | JGI25165J46597_10023482 | 236 |
| 957 | 3300003354 | JGI25160J50197_1000102 | JGI25160J50197_100010211 | 236 |
| 958 | 3300003479 | Ga0006556J51387_1030668 | Ga0006556J51387_10306681 | 236 |
| 959 | 3300003567 | Ga0006554J51385_1028769 | Ga0006554J51385_10287692 | 236 |
| 960 | 3300003751 | Ga0055538_1000002 | Ga0055538_1000002534 | 236 |
| 961 | 3300003752 | Ga0055539_1000002 | Ga0055539_1000002534 | 236 |
| 962 | 3300003756 | Ga0055533_1000004 | Ga0055533_1000004534 | 236 |
| 963 | 3300003756 | Ga0055533_1000235 | Ga0055533_10002354 | 236 |
| 964 | 3300003758 | Ga0055532_1000001 | Ga0055532_1000001233 | 236 |
| 965 | 3300003759 | Ga0055525_1000002 | Ga0055525_1000002534 | 236 |
| 966 | 3300003760 | Ga0055527_1000002 | Ga0055527_1000002526 | 236 |
| 967 | 3300003761 | Ga0055535_1000001 | Ga0055535_1000001771 | 236 |
| 968 | 3300003762 | Ga0055542_1000001 | Ga0055542_1000001233 | 236 |
| 969 | 3300003763 | Ga0055529_1000026 | Ga0055529_100002651 | 236 |
| 970 | 3300003763 | Ga0055529_1001316 | Ga0055529_10013167 | 236 |
| 971 | 3300003790 | Ga0055528_1003000 | Ga0055528_10030003 | 236 |
| 972 | 3300003841 | Ga0055541_1000002 | Ga0055541_1000002309 | 236 |
| 973 | 3300005262 | Ga0065165_1000848 | Ga0065165_100084825 | 236 |
| 974 | 3300005293 | Ga0065715_10009513 | Ga0065715_100095132 | 236 |
| 975 | 3300005327 | Ga0070658_10003785 | Ga0070658_100037852 | 236 |
| 976 | 3300005335 | Ga0070666_10026070 | Ga0070666_100260702 | 236 |
| 977 | 3300005339 | Ga0070660_100000046 | Ga0070660_10000004670 | 236 |
| 978 | 3300005356 | Ga0070674_100094515 | Ga0070674_1000945152 | 236 |
| 979 | 3300005364 | Ga0070673_100188295 | Ga0070673_1001882953 | 236 |
| 980 | 3300005455 | Ga0070663_100018600 | Ga0070663_1000186003 | 236 |
| 981 | 3300005548 | Ga0070665_100197511 | Ga0070665_1001975112 | 236 |
| 982 | 3300005563 | Ga0068855_100001741 | Ga0068855_10000174116 | 236 |
| 983 | 3300005563 | Ga0068855_100039740 | Ga0068855_1000397406 | 236 |
| 984 | 3300005564 | Ga0070664_100072980 | Ga0070664_1000729801 | 236 |
| 985 | 3300005578 | Ga0068854_100011136 | Ga0068854_1000111364 | 236 |
| 986 | 3300005616 | Ga0068852_100052466 | Ga0068852_1000524663 | 236 |
| 987 | 3300005842 | Ga0068858_100266933 | Ga0068858_1002669332 | 236 |
| 988 | 3300006175 | Ga0070712_100089568 | Ga0070712_1000895682 | 236 |
| 989 | 3300009092 | Ga0105250_10029331 | Ga0105250_100293312 | 236 |
| 990 | 3300009093 | Ga0105240_10065376 | Ga0105240_100653763 | 236 |
| 991 | 3300009093 | Ga0105240_10169689 | Ga0105240_101696892 | 236 |
| 992 | 3300009545 | Ga0105237_10015121 | Ga0105237_100151214 | 236 |
| 993 | 3300009545 | Ga0105237_10121127 | Ga0105237_101211272 | 236 |
| 994 | 3300009551 | Ga0105238_10000977 | Ga0105238_1000097715 | 236 |
| 995 | 3300010375 | Ga0105239_10022568 | Ga0105239_100225682 | 236 |
| 996 | 3300010375 | Ga0105239_10195897 | Ga0105239_101958972 | 236 |
| 997 | 3300013105 | Ga0157369_10009691 | Ga0157369_100096915 | 236 |
| 998 | 3300013105 | Ga0157369_10047494 | Ga0157369_100474942 | 236 |
| 999 | 3300013306 | Ga0163162_10008076 | Ga0163162_100080763 | 236 |
| 1000 | 3300013307 | Ga0157372_10126293 | Ga0157372_101262931 | 236 |
| 1001 | 3300015262 | Ga0182007_10000581 | Ga0182007_100005815 | 236 |
| 1002 | 3300015265 | Ga0182005_1064419 | Ga0182005_10644192 | 236 |
| 1003 | 3300016635 | Ga0183361_10006 | Ga0183361_10006177 | 236 |
| 1004 | 3300021361 | Ga0213872_10042905 | Ga0213872_100429052 | 236 |
| 1005 | 3300025224 | Ga0209784_100002 | Ga0209784_100002760 | 236 |
| 1006 | 3300025225 | Ga0209566_100003 | Ga0209566_100003760 | 236 |
| 1007 | 3300025225 | Ga0209566_100504 | Ga0209566_1005046 | 236 |
| 1008 | 3300025226 | Ga0209674_100004 | Ga0209674_100004760 | 236 |
| 1009 | 3300025226 | Ga0209674_100005 | Ga0209674_100005603 | 236 |
| 1010 | 3300025226 | Ga0209674_101381 | Ga0209674_1013813 | 236 |
| 1011 | 3300025228 | Ga0209672_100001 | Ga0209672_1000011065 | 236 |
| 1012 | 3300025228 | Ga0209672_100014 | Ga0209672_100014168 | 236 |
| 1013 | 3300025228 | Ga0209672_100023 | Ga0209672_100023204 | 236 |
| 1014 | 3300025229 | Ga0209147_100001 | Ga0209147_1000011065 | 236 |
| 1015 | 3300025229 | Ga0209147_100094 | Ga0209147_100094138 | 236 |
| 1016 | 3300025229 | Ga0209147_100104 | Ga0209147_100104113 | 236 |
| 1017 | 3300025230 | Ga0209563_100006 | Ga0209563_100006760 | 236 |
| 1018 | 3300025230 | Ga0209563_100468 | Ga0209563_1004684 | 236 |
| 1019 | 3300025242 | Ga0209258_100001 | Ga0209258_1000011065 | 236 |
| 1020 | 3300025242 | Ga0209258_100040 | Ga0209258_100040337 | 236 |
| 1021 | 3300025242 | Ga0209258_100142 | Ga0209258_100142127 | 236 |
| 1022 | 3300025253 | Ga0209677_100003 | Ga0209677_100003760 | 236 |
| 1023 | 3300025254 | Ga0209148_1000003 | Ga0209148_10000031065 | 236 |
| 1024 | 3300025254 | Ga0209148_1000035 | Ga0209148_1000035337 | 236 |
| 1025 | 3300025254 | Ga0209148_1002027 | Ga0209148_10020273 | 236 |
| 1026 | 3300025256 | Ga0209759_1000030 | Ga0209759_100003072 | 236 |
| 1027 | 3300025256 | Ga0209759_1000260 | Ga0209759_100026051 | 236 |
| 1028 | 3300025256 | Ga0209759_1001844 | Ga0209759_10018449 | 236 |
| 1029 | 3300025261 | Ga0209233_1000016 | Ga0209233_100001625 | 236 |
| 1030 | 3300025272 | Ga0209455_1000001 | Ga0209455_10000011065 | 236 |
| 1031 | 3300025272 | Ga0209455_1000072 | Ga0209455_1000072115 | 236 |
| 1032 | 3300025272 | Ga0209455_1009709 | Ga0209455_10097092 | 236 |
| 1033 | 3300025273 | Ga0209673_1000140 | Ga0209673_10001403 | 236 |
| 1034 | 3300025295 | Ga0209564_1022747 | Ga0209564_10227472 | 236 |
| 1035 | 3300025302 | Ga0207426_1000125 | Ga0207426_1000125136 | 236 |
| 1036 | 3300025711 | Ga0207696_1021964 | Ga0207696_10219642 | 236 |
| 1037 | 3300025735 | Ga0207713_1000252 | Ga0207713_10002523 | 236 |
| 1038 | 3300025735 | Ga0207713_1000864 | Ga0207713_10008644 | 236 |
| 1039 | 3300025903 | Ga0207680_10146406 | Ga0207680_101464062 | 236 |
| 1040 | 3300025904 | Ga0207647_10000498 | Ga0207647_100004984 | 236 |
| 1041 | 3300025913 | Ga0207695_10000926 | Ga0207695_1000092647 | 236 |
| 1042 | 3300025913 | Ga0207695_10081775 | Ga0207695_100817752 | 236 |
| 1043 | 3300025914 | Ga0207671_10026114 | Ga0207671_100261142 | 236 |
| 1044 | 3300025914 | Ga0207671_10052850 | Ga0207671_100528502 | 236 |
| 1045 | 3300025915 | Ga0207693_10097305 | Ga0207693_100973052 | 236 |
| 1046 | 3300025919 | Ga0207657_10000004 | Ga0207657_1000000455 | 236 |
| 1047 | 3300025924 | Ga0207694_10008234 | Ga0207694_100082343 | 236 |
| 1048 | 3300025924 | Ga0207694_10029080 | Ga0207694_100290802 | 236 |
| 1049 | 3300025937 | Ga0207669_10096727 | Ga0207669_100967272 | 236 |
| 1050 | 3300025940 | Ga0207691_10071826 | Ga0207691_100718262 | 236 |
| 1051 | 3300025949 | Ga0207667_10000036 | Ga0207667_1000003633 | 236 |
| 1052 | 3300025949 | Ga0207667_10011537 | Ga0207667_100115379 | 236 |
| 1053 | 3300025960 | Ga0207651_10126061 | Ga0207651_101260614 | 236 |
| 1054 | 3300025981 | Ga0207640_10010935 | Ga0207640_100109354 | 236 |
| 1055 | 3300026067 | Ga0207678_10003926 | Ga0207678_100039263 | 236 |
| 1056 | 3300026067 | Ga0207678_10173808 | Ga0207678_101738082 | 236 |
| 1057 | 3300026067 | Ga0207678_10341463 | Ga0207678_103414632 | 236 |
| 1058 | 3300026116 | Ga0207674_10144921 | Ga0207674_101449213 | 236 |
| 1059 | 3300026142 | Ga0207698_10028347 | Ga0207698_100283475 | 236 |
| 1060 | 3300027312 | Ga0209371_1000079 | Ga0209371_100007985 | 236 |
| 1061 | 3300028379 | Ga0268266_10098585 | Ga0268266_100985852 | 236 |
| 1062 | 3300028800 | Ga0265338_10000028 | Ga0265338_10000028127 | 236 |
| 1063 | 3300030500 | Ga0268256_1000090 | Ga0268256_100009088 | 236 |
| 1064 | 3300031238 | Ga0265332_10007434 | Ga0265332_100074345 | 236 |
| 1065 | 3300031507 | Ga0307509_10225497 | Ga0307509_102254972 | 236 |
| 1066 | 3300031548 | Ga0307408_100005566 | Ga0307408_1000055664 | 236 |
| 1067 | 3300031911 | Ga0307412_10000021 | Ga0307412_10000021174 | 236 |
| 1068 | 3300031911 | Ga0307412_10419582 | Ga0307412_104195822 | 236 |
| 1069 | 3300035724 | Ga0373933_0084980 | Ga0373933_0084980_826_1665 | 236 |
| 1070 | 3300037471 | Ga0395905_0000459 | Ga0395905_0000459_11733_12560 | 236 |
| 1071 | 3300039447 | Ga0436361_0091859 | Ga0436361_0091859_2138_2971 | 236 |
| 1072 | 3300039447 | Ga0436361_0624331 | Ga0436361_0624331_1652_2479 | 236 |
| 1073 | 3300044666 | Ga0466977_0016580 | Ga0466977_0016580_766_1593 | 236 |
| 1074 | 3300044684 | Ga0466966_0291233 | Ga0466966_0291233_123_950 | 236 |
| 1075 | 3300046454 | Ga0495592_0010535 | Ga0495592_0010535_5648_6475 | 236 |
| 1076 | 3300046454 | Ga0495592_0021747 | Ga0495592_0021747_2517_3344 | 236 |
| 1077 | 3300046455 | Ga0495603_0007351 | Ga0495603_0007351_625_1452 | 236 |
| 1078 | 3300046455 | Ga0495603_0106439 | Ga0495603_0106439_348_1175 | 236 |
| 1079 | 3300046457 | Ga0495590_0005435 | Ga0495590_0005435_2545_3372 | 236 |
| 1080 | 3300046458 | Ga0495591_029225 | Ga0495591_029225_812_1639 | 236 |
| 1081 | 3300046459 | Ga0495629_0000172 | Ga0495629_0000172_13176_14003 | 236 |
| 1082 | 3300046459 | Ga0495629_0000506 | Ga0495629_0000506_18778_19605 | 236 |
| 1083 | 3300046459 | Ga0495629_0002744 | Ga0495629_0002744_12017_12844 | 236 |
| 1084 | 3300046462 | Ga0495651_0017252 | Ga0495651_0017252_339_1166 | 236 |
| 1085 | 3300046463 | Ga0495653_0019400 | Ga0495653_0019400_4427_5335 | 236 |
| 1086 | 3300046463 | Ga0495653_0030155 | Ga0495653_0030155_606_1433 | 236 |
| 1087 | 3300046463 | Ga0495653_0043631 | Ga0495653_0043631_743_1570 | 236 |
| 1088 | 3300046471 | Ga0495650_0007870 | Ga0495650_0007870_413_1240 | 236 |
| 1089 | 3300046471 | Ga0495650_0078939 | Ga0495650_0078939_361_1188 | 236 |
| 1090 | 3300046472 | Ga0495580_0002910 | Ga0495580_0002910_3346_4173 | 236 |
| 1091 | 3300046472 | Ga0495580_0018014 | Ga0495580_0018014_3973_4800 | 236 |
| 1092 | 3300046472 | Ga0495580_0059891 | Ga0495580_0059891_14_841 | 236 |
| 1093 | 3300046473 | Ga0495582_0189132 | Ga0495582_0189132_227_1054 | 236 |
| 1094 | 3300046474 | Ga0495605_0003771 | Ga0495605_0003771_183_1010 | 236 |
| 1095 | 3300046474 | Ga0495605_0032897 | Ga0495605_0032897_511_1338 | 236 |
| 1096 | 3300046476 | Ga0495662_0067007 | Ga0495662_0067007_256_1083 | 236 |
| 1097 | 3300046477 | Ga0495664_0021769 | Ga0495664_0021769_424_1251 | 236 |
| 1098 | 3300046477 | Ga0495664_0073651 | Ga0495664_0073651_306_1133 | 236 |
| 1099 | 3300046506 | Ga0495583_0012014 | Ga0495583_0012014_1030_1857 | 236 |
| 1100 | 3300046507 | Ga0495606_0005502 | Ga0495606_0005502_259_1086 | 236 |
| 1101 | 3300046507 | Ga0495606_0025325 | Ga0495606_0025325_2575_3402 | 236 |
| 1102 | 3300046511 | Ga0495608_0006938 | Ga0495608_0006938_5355_6263 | 236 |
| 1103 | 3300046512 | Ga0495610_0001938 | Ga0495610_0001938_9383_10210 | 236 |
| 1104 | 3300046516 | Ga0495628_0012653 | Ga0495628_0012653_1798_2625 | 236 |
| 1105 | 3300046516 | Ga0495628_0088195 | Ga0495628_0088195_828_1655 | 236 |
| 1106 | 3300046517 | Ga0495630_0095077 | Ga0495630_0095077_383_1210 | 236 |
| 1107 | 3300046517 | Ga0495630_0165145 | Ga0495630_0165145_679_1506 | 236 |
| 1108 | 3300046517 | Ga0495630_0176096 | Ga0495630_0176096_575_1402 | 236 |
| 1109 | 3300046524 | Ga0495648_0051755 | Ga0495648_0051755_643_1470 | 236 |
| 1110 | 3300046524 | Ga0495648_0070358 | Ga0495648_0070358_461_1288 | 236 |
| 1111 | 3300046526 | Ga0495666_0000427 | Ga0495666_0000427_17124_17951 | 236 |
| 1112 | 3300046528 | Ga0495642_0117975 | Ga0495642_0117975_15_842 | 236 |
| 1113 | 3300046529 | Ga0495652_0043262 | Ga0495652_0043262_2903_3811 | 236 |
| 1114 | 3300046531 | Ga0495665_0059385 | Ga0495665_0059385_134_961 | 236 |
| 1115 | 3300046531 | Ga0495665_0065258 | Ga0495665_0065258_99_1007 | 236 |
| 1116 | 3300046531 | Ga0495665_0086174 | Ga0495665_0086174_187_1014 | 236 |
| 1117 | 3300046533 | Ga0495640_0093109 | Ga0495640_0093109_650_1477 | 236 |
| 1118 | 3300046535 | Ga0495586_0004311 | Ga0495586_0004311_3609_4436 | 236 |
| 1119 | 3300046535 | Ga0495586_0125013 | Ga0495586_0125013_488_1315 | 236 |
| 1120 | 3300046542 | Ga0495597_0003154 | Ga0495597_0003154_5966_6793 | 236 |
| 1121 | 3300046543 | Ga0495645_0000357 | Ga0495645_0000357_25270_26097 | 236 |
| 1122 | 3300046557 | Ga0495622_0000551 | Ga0495622_0000551_480_1307 | 236 |
| 1123 | 3300046642 | Ga0495634_0029934 | Ga0495634_0029934_2376_3203 | 236 |
| 1124 | 3300046663 | Ga0495635_0005954 | Ga0495635_0005954_583_1410 | 236 |
| 1125 | 3300046663 | Ga0495635_0030228 | Ga0495635_0030228_2788_3696 | 236 |
| 1126 | 3300046675 | Ga0495657_0115803 | Ga0495657_0115803_581_1408 | 236 |
| 1127 | 3300046678 | Ga0495599_0087493 | Ga0495599_0087493_246_1073 | 236 |
| 1128 | 3300046678 | Ga0495599_0095101 | Ga0495599_0095101_963_1790 | 236 |
| 1129 | 3300046679 | Ga0495623_0020310 | Ga0495623_0020310_736_1563 | 236 |
| 1130 | 3300046679 | Ga0495623_0109472 | Ga0495623_0109472_70_978 | 236 |
| 1131 | 3300046680 | Ga0495646_0009887 | Ga0495646_0009887_791_1699 | 236 |
| 1132 | 3300046684 | Ga0495669_0066699 | Ga0495669_0066699_18_845 | 236 |
| 1133 | 3300046689 | Ga0495613_0003580 | Ga0495613_0003580_7923_8750 | 236 |
| 1134 | 3300046690 | Ga0495624_0004787 | Ga0495624_0004787_7337_8164 | 236 |
| 1135 | 3300046690 | Ga0495624_0110253 | Ga0495624_0110253_215_1123 | 236 |
| 1136 | 3300046694 | Ga0495649_0055457 | Ga0495649_0055457_580_1407 | 236 |
| 1137 | 3300046694 | Ga0495649_0120694 | Ga0495649_0120694_296_1123 | 236 |
| 1138 | 3300046794 | Ga0495589_0012497 | Ga0495589_0012497_2352_3179 | 236 |
| 1139 | 3300046794 | Ga0495589_0013954 | Ga0495589_0013954_2010_2837 | 236 |
| 1140 | 3300046809 | Ga0495600_0146905 | Ga0495600_0146905_174_1001 | 236 |
| 1141 | 3300047317 | Ga0495604_0036410 | Ga0495604_0036410_2309_3217 | 236 |
| 1142 | 3300047317 | Ga0495604_0038131 | Ga0495604_0038131_2461_3288 | 236 |
| 1143 | 3300047317 | Ga0495604_0057846 | Ga0495604_0057846_555_1382 | 236 |
| 1144 | 3300047319 | Ga0495674_0008069 | Ga0495674_0008069_8420_9247 | 236 |
| 1145 | 3300047319 | Ga0495674_0048438 | Ga0495674_0048438_1745_2572 | 236 |
| 1146 | 3300047319 | Ga0495674_0092897 | Ga0495674_0092897_51_878 | 236 |
| 1147 | 3300047319 | Ga0495674_0188638 | Ga0495674_0188638_552_1379 | 236 |
| 1148 | 3300047319 | Ga0495674_0194483 | Ga0495674_0194483_292_1200 | 236 |
| 1149 | 3300047319 | Ga0495674_0321061 | Ga0495674_0321061_59_886 | 236 |
| 1150 | 3300047320 | Ga0495672_0003268 | Ga0495672_0003268_474_1301 | 236 |
| 1151 | 3300047320 | Ga0495672_0037296 | Ga0495672_0037296_348_1175 | 236 |
| 1152 | 3300047320 | Ga0495672_0048418 | Ga0495672_0048418_225_1052 | 236 |
| 1153 | 3300047321 | Ga0495676_0266921 | Ga0495676_0266921_242_1069 | 236 |
| 1154 | 3300047322 | Ga0495680_0018438 | Ga0495680_0018438_2582_3490 | 236 |
| 1155 | 3300047323 | Ga0495683_0035521 | Ga0495683_0035521_1260_2168 | 236 |
| 1156 | 3300047323 | Ga0495683_0072097 | Ga0495683_0072097_178_1005 | 236 |
| 1157 | 3300047443 | Ga0495687_008170 | Ga0495687_008170_4114_4941 | 236 |
| 1158 | 3300047443 | Ga0495687_038829 | Ga0495687_038829_843_1751 | 236 |
| 1159 | 3300047443 | Ga0495687_101599 | Ga0495687_101599_189_1016 | 236 |
| 1160 | 3300047444 | Ga0495675_0019316 | Ga0495675_0019316_2989_3816 | 236 |
| 1161 | 3300047446 | Ga0495679_000214 | Ga0495679_000214_17076_17903 | 236 |
| 1162 | 3300047469 | Ga0495673_0061029 | Ga0495673_0061029_532_1359 | 236 |
| 1163 | 3300047472 | Ga0495686_0000002 | Ga0495686_0000002_761101_761928 | 236 |
| 1164 | 3300048088 | Ga0495602_0032598 | Ga0495602_0032598_59_886 | 236 |
| 1165 | 3300048088 | Ga0495602_0059754 | Ga0495602_0059754_1981_2808 | 236 |
| 1166 | 3300048088 | Ga0495602_0085305 | Ga0495602_0085305_1538_2446 | 236 |
| 1167 | 3300048088 | Ga0495602_0122900 | Ga0495602_0122900_643_1470 | 236 |
| 1168 | 3300048088 | Ga0495602_0142272 | Ga0495602_0142272_20_847 | 236 |
| 1169 | 3300048089 | Ga0495614_0035946 | Ga0495614_0035946_59_886 | 236 |
| 1170 | 3300048903 | Ga0496100_0002406 | Ga0496100_0002406_5651_6478 | 236 |
| 1171 | 3300048903 | Ga0496100_0119378 | Ga0496100_0119378_294_1121 | 236 |
| 1172 | 3300048904 | Ga0496101_0001779 | Ga0496101_0001779_758_1585 | 236 |
| 1173 | 3300048904 | Ga0496101_0238945 | Ga0496101_0238945_309_1136 | 236 |
| 1174 | 3300048905 | Ga0496102_0001049 | Ga0496102_0001049_12354_13181 | 236 |
| 1175 | 3300048905 | Ga0496102_0005053 | Ga0496102_0005053_5857_6684 | 236 |
| 1176 | 3300048906 | Ga0496103_0002203 | Ga0496103_0002203_5766_6593 | 236 |
| 1177 | 3300048906 | Ga0496103_0003261 | Ga0496103_0003261_221_1048 | 236 |
| 1178 | 3300048906 | Ga0496103_0053524 | Ga0496103_0053524_1657_2484 | 236 |
| 1179 | 3300048907 | Ga0496104_0045619 | Ga0496104_0045619_769_1596 | 236 |
| 1180 | 3300048908 | Ga0496105_0167086 | Ga0496105_0167086_751_1578 | 236 |
| 1181 | 3300048909 | Ga0496106_0003051 | Ga0496106_0003051_5395_6222 | 236 |
| 1182 | 3300048910 | Ga0496107_0029551 | Ga0496107_0029551_292_1119 | 236 |
| 1183 | 3300048912 | Ga0496109_0605821 | Ga0496109_0605821_71_898 | 236 |
| 1184 | 3300048913 | Ga0496110_0003569 | Ga0496110_0003569_10043_10870 | 236 |
| 1185 | 3300048914 | Ga0496111_0036636 | Ga0496111_0036636_1302_2129 | 236 |
| 1186 | 3300048915 | Ga0496112_0016390 | Ga0496112_0016390_5459_6286 | 236 |
| 1187 | 3300048916 | Ga0496113_0002808 | Ga0496113_0002808_7043_7870 | 236 |
| 1188 | 3300048919 | Ga0496116_0067029 | Ga0496116_0067029_594_1421 | 236 |
| 1189 | 3300048920 | Ga0496117_0000589 | Ga0496117_0000589_23262_24089 | 236 |
| 1190 | 3300048920 | Ga0496117_0071738 | Ga0496117_0071738_974_1801 | 236 |
| 1191 | 3300048920 | Ga0496117_0114786 | Ga0496117_0114786_393_1220 | 236 |
| 1192 | 3300048920 | Ga0496117_0122632 | Ga0496117_0122632_684_1511 | 236 |
| 1193 | 3300048921 | Ga0496118_0000760 | Ga0496118_0000760_29955_30782 | 236 |
| 1194 | 3300048921 | Ga0496118_0002012 | Ga0496118_0002012_14766_15593 | 236 |
| 1195 | 3300048921 | Ga0496118_0026170 | Ga0496118_0026170_3716_4543 | 236 |
| 1196 | 3300048921 | Ga0496118_0062401 | Ga0496118_0062401_1743_2570 | 236 |
| 1197 | 3300048922 | Ga0496119_0129734 | Ga0496119_0129734_475_1302 | 236 |
| 1198 | 3300048924 | Ga0496121_0002856 | Ga0496121_0002856_11806_12633 | 236 |
| 1199 | 3300048924 | Ga0496121_0006525 | Ga0496121_0006525_6604_7431 | 236 |
| 1200 | 3300048924 | Ga0496121_0013134 | Ga0496121_0013134_5106_5933 | 236 |
| 1201 | 3300048925 | Ga0496122_0002190 | Ga0496122_0002190_7853_8680 | 236 |
| 1202 | 3300048926 | Ga0496123_0008961 | Ga0496123_0008961_557_1384 | 236 |
| 1203 | 3300048927 | Ga0496124_0018274 | Ga0496124_0018274_685_1512 | 236 |
| 1204 | 3300048928 | Ga0496125_0078172 | Ga0496125_0078172_503_1330 | 236 |
| 1205 | 3300049460 | Ga0495682_0016024 | Ga0495682_0016024_136_963 | 236 |
| 1206 | 3300050515 | nmdc:mga0a205_366292_c1 | nmdc:mga0a205_366292_c1_203_1033 | 236 |
| 1207 | 3300053103 | Ga0500555_050912 | Ga0500555_050912_177_1022 | 236 |
| 1208 | 3300059643 | Ga0587072_042043 | Ga0587072_042043_50_877 | 236 |
| 1209 | iso_pu_bacteria | 2513020051 | 2513228729 | 236 |
| 1210 | iso_pu_bacteria | 2547132374 | 2548497500 | 236 |
| 1211 | iso_pu_bacteria | 2585428057 | 2587729188 | 236 |
| 1212 | iso_pu_bacteria | 2585428058 | 2587734739 | 236 |
| 1213 | iso_pu_bacteria | 2588253510 | 2588293527 | 236 |
| 1214 | iso_pu_bacteria | 2599185214 | 2599623704 | 236 |
| 1215 | iso_pu_bacteria | 2599185226 | 2599671677 | 236 |
| 1216 | iso_pu_bacteria | 2599185227 | 2599681310 | 236 |
| 1217 | iso_pu_bacteria | 2599185229 | 2599693287 | 236 |
| 1218 | iso_pu_bacteria | 2599185292 | 2599904965 | 236 |
| 1219 | iso_pu_bacteria | 2643221556 | 2643802275 | 236 |
| 1220 | iso_pu_bacteria | 2643221569 | 2643860398 | 236 |
| 1221 | iso_pu_bacteria | 2643221592 | 2643971624 | 236 |
| 1222 | iso_pu_bacteria | 2643221594 | 2643981746 | 236 |
| 1223 | iso_pu_bacteria | 2643221596 | 2643993191 | 236 |
| 1224 | iso_pu_bacteria | 2643221609 | 2644061856 | 236 |
| 1225 | iso_pu_bacteria | 2643221611 | 2644073561 | 236 |
| 1226 | iso_pu_bacteria | 2643221621 | 2644119866 | 236 |
| 1227 | iso_pu_bacteria | 2643221625 | 2644141867 | 236 |
| 1228 | iso_pu_bacteria | 2643221628 | 2644159622 | 236 |
| 1229 | iso_pu_bacteria | 2643221648 | 2644275801 | 236 |
| 1230 | iso_pu_bacteria | 2643221652 | 2644294218 | 236 |
| 1231 | iso_pu_bacteria | 2643221658 | 2644327647 | 236 |
| 1232 | iso_pu_bacteria | 2643221660 | 2644337903 | 236 |
| 1233 | iso_pu_bacteria | 2643221672 | 2644401449 | 236 |
| 1234 | iso_pu_bacteria | 2643221683 | 2644468192 | 236 |
| 1235 | iso_pu_bacteria | 2643221684 | 2644475783 | 236 |
| 1236 | iso_pu_bacteria | 2643221717 | 2644647379 | 236 |
| 1237 | iso_pu_bacteria | 2734482258 | 2735817300 | 236 |
| 1238 | iso_pu_bacteria | 2738541277 | 2738717765 | 236 |
| 1239 | iso_pu_bacteria | 2738541307 | 2738879376 | 236 |
| 1240 | iso_pu_bacteria | 2738543012 | 2739243004 | 236 |
| 1241 | iso_pu_bacteria | 2738543013 | 2739250649 | 236 |
| 1242 | iso_pu_bacteria | 2738543019 | 2739278451 | 236 |
| 1243 | iso_pu_bacteria | 2739367655 | 2739612898 | 236 |
| 1244 | iso_pu_bacteria | 2808606395 | 2809035650 | 236 |
| 1245 | iso_pu_bacteria | 2808606418 | 2809145326 | 236 |
| 1246 | iso_pu_bacteria | 2816332133 | 2816473305 | 236 |
| 1247 | iso_pu_bacteria | 2818991446 | 2819597248 | 236 |
| 1248 | iso_pu_bacteria | 2831265667 | 2831266374 | 236 |
| 1249 | iso_pu_bacteria | 2838054893 | 2838057505 | 236 |
| 1250 | iso_pu_bacteria | 2842677519 | 2842679944 | 236 |
| 1251 | iso_pu_bacteria | 2842733646 | 2842736747 | 236 |
| 1252 | iso_pu_bacteria | 2842747753 | 2842747834 | 236 |
| 1253 | iso_pu_bacteria | 2855195626 | 2855197869 | 236 |
| 1254 | iso_pu_bacteria | 2855730933 | 2855732524 | 236 |
| 1255 | iso_pu_bacteria | 2855767633 | 2855769232 | 236 |
| 1256 | iso_pu_bacteria | 2857537821 | 2857539078 | 236 |
| 1257 | iso_pu_bacteria | 2857542790 | 2857546943 | 236 |
| 1258 | iso_pu_bacteria | 2858466076 | 2858469798 | 236 |
| 1259 | iso_pu_bacteria | 2858950400 | 2858956101 | 236 |
| 1260 | iso_pu_bacteria | 2871272651 | 2871276870 | 236 |
| 1261 | iso_pu_bacteria | 2871282230 | 2871284048 | 236 |
| 1262 | iso_pu_bacteria | 2881412998 | 2881414876 | 236 |
| 1263 | iso_pu_bacteria | 2881927736 | 2881928133 | 236 |
| 1264 | iso_pu_bacteria | 2885192300 | 2885192670 | 236 |
| 1265 | iso_pu_bacteria | 2885198086 | 2885204508 | 236 |
| 1266 | iso_pu_bacteria | 2885211737 | 2885218161 | 236 |
| 1267 | iso_pu_bacteria | 2887375801 | 2887379252 | 236 |
| 1268 | iso_pu_bacteria | 2894023352 | 2894025649 | 236 |
| 1269 | iso_pu_bacteria | 2899924645 | 2899924755 | 236 |
| 1270 | iso_pu_bacteria | 2900051742 | 2900054399 | 236 |
| 1271 | iso_pu_bacteria | 2904449895 | 2904454405 | 236 |
| 1272 | iso_pu_bacteria | 2904456579 | 2904461152 | 236 |
| 1273 | iso_pu_bacteria | 2904541872 | 2904548265 | 236 |
| 1274 | iso_pu_bacteria | 2928037797 | 2928039119 | 236 |
| 1275 | iso_pu_bacteria | 2928044640 | 2928045276 | 236 |
| 1276 | iso_pu_bacteria | 2928051484 | 2928053081 | 236 |
| 1277 | iso_pu_bacteria | 2928064002 | 2928064248 | 236 |
| 1278 | iso_pu_bacteria | 2928070936 | 2928071677 | 236 |
| 1279 | iso_pu_bacteria | 2928084124 | 2928084373 | 236 |
| 1280 | iso_pu_bacteria | 2928115317 | 2928121284 | 236 |
| 1281 | iso_pu_bacteria | 2929160207 | 2929163255 | 236 |
| 1282 | iso_pu_bacteria | 2929520902 | 2929527034 | 236 |
| 1283 | iso_pu_bacteria | 2932422444 | 2932423456 | 236 |
| 1284 | iso_pu_bacteria | 2939631187 | 2939631511 | 236 |
| 1285 | iso_pu_bacteria | 2945909444 | 2945911686 | 236 |
| 1286 | iso_pu_bacteria | 2945945610 | 2945948112 | 236 |
| 1287 | iso_pu_bacteria | 2945972063 | 2945977194 | 236 |
| 1288 | iso_pu_bacteria | 2945984333 | 2945986018 | 236 |
| 1289 | iso_pu_bacteria | 2954767861 | 2954772279 | 236 |
| 1290 | iso_pu_bacteria | 2974320154 | 2974323566 | 236 |
| 1291 | iso_pu_bacteria | 2990710928 | 2990712372 | 236 |
| 1292 | iso_pu_bacteria | 8047673197 | 8047673867 | 236 |
| 1293 | iso_pu_bacteria | 8055225921 | 8055228253 | 236 |
| 1294 | 3300021361 | Ga0213872_10016214 | Ga0213872_100162144 | 237 |
| 1295 | 3300028381 | Ga0268264_10710253 | Ga0268264_107102531 | 237 |
| 1296 | 3300037471 | Ga0395905_0014764 | Ga0395905_0014764_183_1022 | 237 |
| 1297 | 3300039447 | Ga0436361_0247137 | Ga0436361_0247137_1588_2427 | 237 |
| 1298 | 3300047317 | Ga0495604_0072862 | Ga0495604_0072862_1305_2132 | 237 |
| 1299 | 3300048924 | Ga0496121_0036376 | Ga0496121_0036376_2761_3615 | 237 |
| 1300 | 3300049589 | Ga0501073_0099000 | Ga0501073_0099000_10_831 | 237 |
| 1301 | 3300049649 | Ga0501198_000015 | Ga0501198_000015_56734_57555 | 237 |
| 1302 | 3300049662 | Ga0501222_000045 | Ga0501222_000045_1007_1828 | 237 |
| 1303 | 3300053108 | Ga0500562_001011 | Ga0500562_001011_4126_4977 | 237 |
| 1304 | 3300060353 | Ga0501082_0012597 | Ga0501082_0012597_1032_1853 | 237 |
| 1305 | iso_pu_bacteria | 2501025502 | 2501080633 | 237 |
| 1306 | iso_pu_bacteria | 2501025504 | 2501410656 | 237 |
| 1307 | iso_pu_bacteria | 2508501125 | 2509131232 | 237 |
| 1308 | iso_pu_bacteria | 2510065045 | 2510251395 | 237 |
| 1309 | iso_pu_bacteria | 2510917013 | 2511086914 | 237 |
| 1310 | iso_pu_bacteria | 2510917014 | 2511096882 | 237 |
| 1311 | iso_pu_bacteria | 2510917015 | 2511103691 | 237 |
| 1312 | iso_pu_bacteria | 2511231002 | 2511245906 | 237 |
| 1313 | iso_pu_bacteria | 2512047030 | 2512345668 | 237 |
| 1314 | iso_pu_bacteria | 2513237082 | 2513553847 | 237 |
| 1315 | iso_pu_bacteria | 2513237083 | 2513564790 | 237 |
| 1316 | iso_pu_bacteria | 2513237150 | 2513955186 | 237 |
| 1317 | iso_pu_bacteria | 2513237151 | 2513961950 | 237 |
| 1318 | iso_pu_bacteria | 2513237165 | 2514043672 | 237 |
| 1319 | iso_pu_bacteria | 2513237166 | 2514051837 | 237 |
| 1320 | iso_pu_bacteria | 2515154122 | 2515680936 | 237 |
| 1321 | iso_pu_bacteria | 2515154123 | 2515689926 | 237 |
| 1322 | iso_pu_bacteria | 2515154189 | 2516019359 | 237 |
| 1323 | iso_pu_bacteria | 2519103095 | 2519459075 | 237 |
| 1324 | iso_pu_bacteria | 2522572158 | 2523104322 | 237 |
| 1325 | iso_pu_bacteria | 2526164713 | 2527075360 | 237 |
| 1326 | iso_pu_bacteria | 2562617112 | 2563058721 | 237 |
| 1327 | iso_pu_bacteria | 2582581311 | 2585291408 | 237 |
| 1328 | iso_pu_bacteria | 2596583598 | 2597028529 | 237 |
| 1329 | iso_pu_bacteria | 2597490356 | 2599105222 | 237 |
| 1330 | iso_pu_bacteria | 2599185178 | 2599444548 | 237 |
| 1331 | iso_pu_bacteria | 2599185239 | 2599736677 | 237 |
| 1332 | iso_pu_bacteria | 2599185240 | 2599744732 | 237 |
| 1333 | iso_pu_bacteria | 2599185355 | 2600205907 | 237 |
| 1334 | iso_pu_bacteria | 2600255067 | 2600809443 | 237 |
| 1335 | iso_pu_bacteria | 2600255292 | 2601667599 | 237 |
| 1336 | iso_pu_bacteria | 2643221603 | 2644027287 | 237 |
| 1337 | iso_pu_bacteria | 2643221645 | 2644254323 | 237 |
| 1338 | iso_pu_bacteria | 2643221664 | 2644358009 | 237 |
| 1339 | iso_pu_bacteria | 2675903129 | 2676742858 | 237 |
| 1340 | iso_pu_bacteria | 2711768613 | 2713476630 | 237 |
| 1341 | iso_pu_bacteria | 2718217991 | 2719640510 | 237 |
| 1342 | iso_pu_bacteria | 2721755763 | 2723877450 | 237 |
| 1343 | iso_pu_bacteria | 2738541280 | 2738741141 | 237 |
| 1344 | iso_pu_bacteria | 2738541296 | 2738818425 | 237 |
| 1345 | iso_pu_bacteria | 2738541297 | 2738829324 | 237 |
| 1346 | iso_pu_bacteria | 2738541298 | 2738831418 | 237 |
| 1347 | iso_pu_bacteria | 2738541300 | 2738845607 | 237 |
| 1348 | iso_pu_bacteria | 2738541306 | 2738872946 | 237 |
| 1349 | iso_pu_bacteria | 2738541357 | 2739153120 | 237 |
| 1350 | iso_pu_bacteria | 2738543002 | 2739184576 | 237 |
| 1351 | iso_pu_bacteria | 2738543003 | 2739195040 | 237 |
| 1352 | iso_pu_bacteria | 2738543008 | 2739219545 | 237 |
| 1353 | iso_pu_bacteria | 2738543018 | 2739276664 | 237 |
| 1354 | iso_pu_bacteria | 2738543026 | 2739321516 | 237 |
| 1355 | iso_pu_bacteria | 2738543029 | 2739339928 | 237 |
| 1356 | iso_pu_bacteria | 2738543030 | 2739345708 | 237 |
| 1357 | iso_pu_bacteria | 2744054900 | 2746085785 | 237 |
| 1358 | iso_pu_bacteria | 2744054901 | 2746096223 | 237 |
| 1359 | iso_pu_bacteria | 2791355137 | 2792835963 | 237 |
| 1360 | iso_pu_bacteria | 2808606384 | 2808972415 | 237 |
| 1361 | iso_pu_bacteria | 2808606390 | 2809007244 | 237 |
| 1362 | iso_pu_bacteria | 2808606391 | 2809014382 | 237 |
| 1363 | iso_pu_bacteria | 2816332253 | 2817261363 | 237 |
| 1364 | iso_pu_bacteria | 2816332256 | 2817279040 | 237 |
| 1365 | iso_pu_bacteria | 2816332286 | 2817451236 | 237 |
| 1366 | iso_pu_bacteria | 2818991436 | 2819542811 | 237 |
| 1367 | iso_pu_bacteria | 2818991450 | 2819622795 | 237 |
| 1368 | iso_pu_bacteria | 2818991452 | 2819631161 | 237 |
| 1369 | iso_pu_bacteria | 2821131069 | 2821131494 | 237 |
| 1370 | iso_pu_bacteria | 2834641062 | 2834642749 | 237 |
| 1371 | iso_pu_bacteria | 2842324504 | 2842327929 | 237 |
| 1372 | iso_pu_bacteria | 2842348783 | 2842352246 | 237 |
| 1373 | iso_pu_bacteria | 2842454564 | 2842458599 | 237 |
| 1374 | iso_pu_bacteria | 2842711865 | 2842714151 | 237 |
| 1375 | iso_pu_bacteria | 2846952575 | 2846955099 | 237 |
| 1376 | iso_pu_bacteria | 2848858292 | 2848858608 | 237 |
| 1377 | iso_pu_bacteria | 2856287931 | 2856294322 | 237 |
| 1378 | iso_pu_bacteria | 2857357740 | 2857367579 | 237 |
| 1379 | iso_pu_bacteria | 2857547612 | 2857551680 | 237 |
| 1380 | iso_pu_bacteria | 2857553236 | 2857554384 | 237 |
| 1381 | iso_pu_bacteria | 2857558681 | 2857559985 | 237 |
| 1382 | iso_pu_bacteria | 2857564685 | 2857564847 | 237 |
| 1383 | iso_pu_bacteria | 2858688981 | 2858699869 | 237 |
| 1384 | iso_pu_bacteria | 2863421361 | 2863424737 | 237 |
| 1385 | iso_pu_bacteria | 2870068957 | 2870070973 | 237 |
| 1386 | iso_pu_bacteria | 2883087390 | 2883092953 | 237 |
| 1387 | iso_pu_bacteria | 2885080285 | 2885086361 | 237 |
| 1388 | iso_pu_bacteria | 2885266251 | 2885267125 | 237 |
| 1389 | iso_pu_bacteria | 2885270888 | 2885275450 | 237 |
| 1390 | iso_pu_bacteria | 2900577576 | 2900578695 | 237 |
| 1391 | iso_pu_bacteria | 2900634093 | 2900634371 | 237 |
| 1392 | iso_pu_bacteria | 2901300506 | 2901301120 | 237 |
| 1393 | iso_pu_bacteria | 2902682994 | 2902683608 | 237 |
| 1394 | iso_pu_bacteria | 2904424332 | 2904426128 | 237 |
| 1395 | iso_pu_bacteria | 2904483920 | 2904484682 | 237 |
| 1396 | iso_pu_bacteria | 2904564687 | 2904571545 | 237 |
| 1397 | iso_pu_bacteria | 2904571731 | 2904575984 | 237 |
| 1398 | iso_pu_bacteria | 2904615490 | 2904624096 | 237 |
| 1399 | iso_pu_bacteria | 2919476304 | 2919478512 | 237 |
| 1400 | iso_pu_bacteria | 2919527303 | 2919531356 | 237 |
| 1401 | iso_pu_bacteria | 2921643360 | 2921649577 | 237 |
| 1402 | iso_pu_bacteria | 2928058823 | 2928062545 | 237 |
| 1403 | iso_pu_bacteria | 2928108538 | 2928113321 | 237 |
| 1404 | iso_pu_bacteria | 2928135762 | 2928140480 | 237 |
| 1405 | iso_pu_bacteria | 2928157003 | 2928162997 | 237 |
| 1406 | iso_pu_bacteria | 2928163908 | 2928169659 | 237 |
| 1407 | iso_pu_bacteria | 2928170801 | 2928171721 | 237 |
| 1408 | iso_pu_bacteria | 2928503688 | 2928507437 | 237 |
| 1409 | iso_pu_bacteria | 2928536128 | 2928539877 | 237 |
| 1410 | iso_pu_bacteria | 2932410948 | 2932411202 | 237 |
| 1411 | iso_pu_bacteria | 2932416698 | 2932419231 | 237 |
| 1412 | iso_pu_bacteria | 2945934425 | 2945937136 | 237 |
| 1413 | iso_pu_bacteria | 2981990288 | 2981994808 | 237 |
| 1414 | iso_pu_bacteria | 2990703756 | 2990706129 | 237 |
| 1415 | iso_pu_bacteria | 641736154 | 642420217 | 237 |
| 1416 | iso_pu_bacteria | 642555112 | 642593126 | 237 |
| 1417 | iso_pu_bacteria | 642555113 | 642622021 | 237 |
| 1418 | iso_pu_bacteria | 644736347 | 644748008 | 237 |
| 1419 | iso_pu_bacteria | 8003400568 | 8003401527 | 237 |
| 1420 | iso_pu_bacteria | 8003955200 | 8003961196 | 237 |
| 1421 | iso_pu_bacteria | 8018845410 | 8018851361 | 237 |
| 1422 | iso_pu_bacteria | 8020807995 | 8020810207 | 237 |
| 1423 | iso_pu_bacteria | 8020938398 | 8020945015 | 237 |
| 1424 | iso_pu_bacteria | 8020945358 | 8020951409 | 237 |
| 1425 | iso_pu_bacteria | 8020953355 | 8020956948 | 237 |
| 1426 | iso_pu_bacteria | 8021120328 | 8021122198 | 237 |
| 1427 | iso_pu_bacteria | 8039098773 | 8039102557 | 237 |
| 1428 | iso_pu_bacteria | 8040167225 | 8040168788 | 237 |
| 1429 | iso_pu_bacteria | 8040173305 | 8040174714 | 237 |
| 1430 | iso_pu_bacteria | 8055266321 | 8055267638 | 237 |
| 1431 | iso_pu_bacteria | 8055301274 | 8055302205 | 237 |
| 1432 | 3300005435 | Ga0070714_100003461 | Ga0070714_1000034614 | 238 |
| 1433 | 3300025929 | Ga0207664_10005455 | Ga0207664_100054559 | 238 |
| 1434 | iso_pu_bacteria | 2511231003 | 2511247732 | 238 |
| 1435 | iso_pu_bacteria | 2511231026 | 2511388090 | 238 |
| 1436 | iso_pu_bacteria | 2521172590 | 2521558119 | 238 |
| 1437 | iso_pu_bacteria | 2526164512 | 2526213499 | 238 |
| 1438 | iso_pu_bacteria | 2548876994 | 2550692910 | 238 |
| 1439 | iso_pu_bacteria | 2551306416 | 2553003246 | 238 |
| 1440 | iso_pu_bacteria | 2643221654 | 2644305184 | 238 |
| 1441 | iso_pu_bacteria | 2765235838 | 2765569252 | 238 |
| 1442 | iso_pu_bacteria | 2808606386 | 2808983882 | 238 |
| 1443 | iso_pu_bacteria | 2808606415 | 2809130942 | 238 |
| 1444 | iso_pu_bacteria | 2808606419 | 2809150723 | 238 |
| 1445 | iso_pu_bacteria | 2818991445 | 2819593239 | 238 |
| 1446 | iso_pu_bacteria | 2818991449 | 2819614736 | 238 |
| 1447 | iso_pu_bacteria | 2839094727 | 2839095862 | 238 |
| 1448 | iso_pu_bacteria | 2852618963 | 2852622240 | 238 |
| 1449 | iso_pu_bacteria | 2884811622 | 2884812508 | 238 |
| 1450 | iso_pu_bacteria | 2884836552 | 2884838139 | 238 |
| 1451 | iso_pu_bacteria | 2884852848 | 2884854432 | 238 |
| 1452 | iso_pu_bacteria | 2896154374 | 2896154452 | 238 |
| 1453 | iso_pu_bacteria | 2904439833 | 2904441105 | 238 |
| 1454 | iso_pu_bacteria | 2904530477 | 2904531952 | 238 |
| 1455 | iso_pu_bacteria | 2904584206 | 2904587822 | 238 |
| 1456 | iso_pu_bacteria | 2904589729 | 2904590018 | 238 |
| 1457 | iso_pu_bacteria | 2904601388 | 2904602594 | 238 |
| 1458 | iso_pu_bacteria | 2919046199 | 2919046584 | 238 |
| 1459 | iso_pu_bacteria | 2919079590 | 2919079900 | 238 |
| 1460 | iso_pu_bacteria | 2923510766 | 2923511368 | 238 |
| 1461 | iso_pu_bacteria | 2928130867 | 2928131300 | 238 |
| 1462 | 3300005355 | Ga0070671_100187887 | Ga0070671_1001878872 | 239 |
| 1463 | 3300005366 | Ga0070659_100083127 | Ga0070659_1000831272 | 239 |
| 1464 | 3300005563 | Ga0068855_100026769 | Ga0068855_1000267696 | 239 |
| 1465 | 3300009094 | Ga0111539_10017857 | Ga0111539_100178575 | 239 |
| 1466 | 3300025932 | Ga0207690_10098960 | Ga0207690_100989602 | 239 |
| 1467 | 3300025949 | Ga0207667_10029744 | Ga0207667_100297441 | 239 |
| 1468 | 3300026116 | Ga0207674_10241613 | Ga0207674_102416132 | 239 |
| 1469 | 3300031456 | Ga0307513_10378038 | Ga0307513_103780382 | 239 |
| 1470 | 3300031548 | Ga0307408_100012826 | Ga0307408_1000128265 | 239 |
| 1471 | 3300031731 | Ga0307405_10165804 | Ga0307405_101658042 | 239 |
| 1472 | 3300031901 | Ga0307406_10012543 | Ga0307406_100125435 | 239 |
| 1473 | 3300031911 | Ga0307412_10005897 | Ga0307412_100058973 | 239 |
| 1474 | 3300032002 | Ga0307416_100010456 | Ga0307416_1000104568 | 239 |
| 1475 | 3300035691 | Ga0373931_0014996 | Ga0373931_0014996_1285_2109 | 239 |
| 1476 | 3300046530 | Ga0495654_0037660 | Ga0495654_0037660_122_958 | 239 |
| 1477 | 3300048924 | Ga0496121_0087799 | Ga0496121_0087799_1324_2145 | 239 |
| 1478 | 3300049586 | Ga0501070_0106873 | Ga0501070_0106873_186_1028 | 239 |
| 1479 | 3300049663 | Ga0501223_019752 | Ga0501223_019752_159_995 | 239 |
| 1480 | 3300049686 | Ga0501257_013553 | Ga0501257_013553_939_1775 | 239 |
| 1481 | 3300049776 | Ga0501280_001851 | Ga0501280_001851_694_1530 | 239 |
| 1482 | 3300053087 | Ga0500643_000372 | Ga0500643_000372_6670_7512 | 239 |
| 1483 | 3300053087 | Ga0500643_000839 | Ga0500643_000839_13542_14378 | 239 |
| 1484 | 3300053116 | Ga0500592_000173 | Ga0500592_000173_7397_8233 | 239 |
| 1485 | 3300053134 | Ga0500658_0019208 | Ga0500658_0019208_1608_2444 | 239 |
| 1486 | 3300053158 | Ga0500627_0001084 | Ga0500627_0001084_2625_3461 | 239 |
| 1487 | iso_pu_bacteria | 2857576091 | 2857579465 | 239 |
| 1488 | 3300005530 | Ga0070679_100319142 | Ga0070679_1003191422 | 240 |
| 1489 | 3300013104 | Ga0157370_10258120 | Ga0157370_102581202 | 240 |
| 1490 | 3300025919 | Ga0207657_10035316 | Ga0207657_100353163 | 240 |
| 1491 | 3300027682 | Ga0209971_1002887 | Ga0209971_10028871 | 240 |
| 1492 | 3300027876 | Ga0209974_10015038 | Ga0209974_100150382 | 240 |
| 1493 | iso_pu_bacteria | 2501025501 | 2501070266 | 240 |
| 1494 | iso_pu_bacteria | 2751185846 | 2753566562 | 240 |
| 1495 | iso_pu_bacteria | 2904434214 | 2904438584 | 240 |
| 1496 | 3300001976 | JGI24752J21851_1004205 | JGI24752J21851_10042052 | 243 |
| 1497 | 3300001991 | JGI24743J22301_10010713 | JGI24743J22301_100107132 | 243 |
| 1498 | 3300005328 | Ga0070676_10073195 | Ga0070676_100731952 | 243 |
| 1499 | 3300005329 | Ga0070683_100017131 | Ga0070683_1000171314 | 243 |
| 1500 | 3300005330 | Ga0070690_100107845 | Ga0070690_1001078452 | 243 |
| 1501 | 3300005331 | Ga0070670_100179598 | Ga0070670_1001795981 | 243 |
| 1502 | 3300005333 | Ga0070677_10003511 | Ga0070677_100035114 | 243 |
| 1503 | 3300005334 | Ga0068869_100087182 | Ga0068869_1000871821 | 243 |
| 1504 | 3300005339 | Ga0070660_100041917 | Ga0070660_1000419173 | 243 |
| 1505 | 3300005340 | Ga0070689_100011686 | Ga0070689_1000116864 | 243 |
| 1506 | 3300005343 | Ga0070687_100004224 | Ga0070687_1000042242 | 243 |
| 1507 | 3300005347 | Ga0070668_100185688 | Ga0070668_1001856881 | 243 |
| 1508 | 3300005353 | Ga0070669_100105277 | Ga0070669_1001052772 | 243 |
| 1509 | 3300005356 | Ga0070674_100024486 | Ga0070674_1000244863 | 243 |
| 1510 | 3300005365 | Ga0070688_100023760 | Ga0070688_1000237601 | 243 |
| 1511 | 3300005441 | Ga0070700_100005082 | Ga0070700_1000050824 | 243 |
| 1512 | 3300005455 | Ga0070663_100009438 | Ga0070663_1000094386 | 243 |
| 1513 | 3300005459 | Ga0068867_100079870 | Ga0068867_1000798703 | 243 |
| 1514 | 3300005466 | Ga0070685_10003093 | Ga0070685_100030934 | 243 |
| 1515 | 3300005535 | Ga0070684_100150710 | Ga0070684_1001507103 | 243 |
| 1516 | 3300005544 | Ga0070686_100035549 | Ga0070686_1000355493 | 243 |
| 1517 | 3300005548 | Ga0070665_100114056 | Ga0070665_1001140562 | 243 |
| 1518 | 3300005564 | Ga0070664_100038486 | Ga0070664_1000384861 | 243 |
| 1519 | 3300005577 | Ga0068857_100049862 | Ga0068857_1000498623 | 243 |
| 1520 | 3300005578 | Ga0068854_100025157 | Ga0068854_1000251572 | 243 |
| 1521 | 3300005614 | Ga0068856_100103691 | Ga0068856_1001036913 | 243 |
| 1522 | 3300005616 | Ga0068852_100378390 | Ga0068852_1003783901 | 243 |
| 1523 | 3300005618 | Ga0068864_100025688 | Ga0068864_1000256883 | 243 |
| 1524 | 3300005718 | Ga0068866_10001055 | Ga0068866_100010556 | 243 |
| 1525 | 3300005834 | Ga0068851_10117239 | Ga0068851_101172392 | 243 |
| 1526 | 3300005840 | Ga0068870_10004404 | Ga0068870_100044043 | 243 |
| 1527 | 3300005841 | Ga0068863_100180440 | Ga0068863_1001804403 | 243 |
| 1528 | 3300005842 | Ga0068858_100028665 | Ga0068858_1000286654 | 243 |
| 1529 | 3300005843 | Ga0068860_100039561 | Ga0068860_1000395613 | 243 |
| 1530 | 3300005844 | Ga0068862_100142493 | Ga0068862_1001424931 | 243 |
| 1531 | 3300006237 | Ga0097621_100504237 | Ga0097621_1005042372 | 243 |
| 1532 | 3300006881 | Ga0068865_100019463 | Ga0068865_1000194633 | 243 |
| 1533 | 3300009094 | Ga0111539_10008224 | Ga0111539_100082242 | 243 |
| 1534 | 3300009176 | Ga0105242_10038050 | Ga0105242_100380504 | 243 |
| 1535 | 3300010375 | Ga0105239_10291735 | Ga0105239_102917351 | 243 |
| 1536 | 3300011119 | Ga0105246_10194277 | Ga0105246_101942772 | 243 |
| 1537 | 3300013104 | Ga0157370_10000850 | Ga0157370_1000085020 | 243 |
| 1538 | 3300013296 | Ga0157374_10623742 | Ga0157374_106237422 | 243 |
| 1539 | 3300013297 | Ga0157378_10072572 | Ga0157378_100725722 | 243 |
| 1540 | 3300013308 | Ga0157375_10161243 | Ga0157375_101612433 | 243 |
| 1541 | 3300014325 | Ga0163163_10083221 | Ga0163163_100832213 | 243 |
| 1542 | 3300014968 | Ga0157379_10006759 | Ga0157379_1000675910 | 243 |
| 1543 | 3300014969 | Ga0157376_10302009 | Ga0157376_103020092 | 243 |
| 1544 | 3300017792 | Ga0163161_10009466 | Ga0163161_100094663 | 243 |
| 1545 | 3300025271 | Ga0207666_1002150 | Ga0207666_10021502 | 243 |
| 1546 | 3300025315 | Ga0207697_10000129 | Ga0207697_100001293 | 243 |
| 1547 | 3300025321 | Ga0207656_10011124 | Ga0207656_100111242 | 243 |
| 1548 | 3300025893 | Ga0207682_10000157 | Ga0207682_1000015724 | 243 |
| 1549 | 3300025899 | Ga0207642_10054369 | Ga0207642_100543692 | 243 |
| 1550 | 3300025901 | Ga0207688_10000508 | Ga0207688_1000050815 | 243 |
| 1551 | 3300025903 | Ga0207680_10030205 | Ga0207680_100302052 | 243 |
| 1552 | 3300025907 | Ga0207645_10001209 | Ga0207645_1000120911 | 243 |
| 1553 | 3300025908 | Ga0207643_10000883 | Ga0207643_100008836 | 243 |
| 1554 | 3300025918 | Ga0207662_10002138 | Ga0207662_100021388 | 243 |
| 1555 | 3300025919 | Ga0207657_10007145 | Ga0207657_100071455 | 243 |
| 1556 | 3300025923 | Ga0207681_10486921 | Ga0207681_104869211 | 243 |
| 1557 | 3300025925 | Ga0207650_10012131 | Ga0207650_100121315 | 243 |
| 1558 | 3300025926 | Ga0207659_10416329 | Ga0207659_104163292 | 243 |
| 1559 | 3300025931 | Ga0207644_10215812 | Ga0207644_102158122 | 243 |
| 1560 | 3300025933 | Ga0207706_10000928 | Ga0207706_1000092811 | 243 |
| 1561 | 3300025936 | Ga0207670_10249718 | Ga0207670_102497181 | 243 |
| 1562 | 3300025937 | Ga0207669_10005626 | Ga0207669_100056264 | 243 |
| 1563 | 3300025938 | Ga0207704_10094380 | Ga0207704_100943802 | 243 |
| 1564 | 3300025940 | Ga0207691_10039177 | Ga0207691_100391772 | 243 |
| 1565 | 3300025941 | Ga0207711_10024058 | Ga0207711_100240583 | 243 |
| 1566 | 3300025942 | Ga0207689_10003785 | Ga0207689_100037853 | 243 |
| 1567 | 3300025944 | Ga0207661_10073969 | Ga0207661_100739692 | 243 |
| 1568 | 3300025945 | Ga0207679_10572556 | Ga0207679_105725562 | 243 |
| 1569 | 3300025972 | Ga0207668_10057056 | Ga0207668_100570562 | 243 |
| 1570 | 3300025981 | Ga0207640_10110301 | Ga0207640_101103012 | 243 |
| 1571 | 3300026067 | Ga0207678_10006659 | Ga0207678_100066593 | 243 |
| 1572 | 3300026075 | Ga0207708_10002281 | Ga0207708_1000228110 | 243 |
| 1573 | 3300026089 | Ga0207648_10004444 | Ga0207648_100044448 | 243 |
| 1574 | 3300026095 | Ga0207676_10136478 | Ga0207676_101364781 | 243 |
| 1575 | 3300026116 | Ga0207674_10002032 | Ga0207674_1000203217 | 243 |
| 1576 | 3300026118 | Ga0207675_100012754 | Ga0207675_1000127541 | 243 |
| 1577 | 3300026121 | Ga0207683_10053360 | Ga0207683_100533603 | 243 |
| 1578 | 3300028379 | Ga0268266_10022948 | Ga0268266_100229482 | 243 |
| 1579 | 3300035118 | Ga0373954_0066196 | Ga0373954_0066196_703_1533 | 243 |
| 1580 | 3300035172 | Ga0373955_0081153 | Ga0373955_0081153_149_979 | 243 |
| 1581 | 3300048904 | Ga0496101_0135646 | Ga0496101_0135646_905_1735 | 243 |
| 1582 | 3300048905 | Ga0496102_0731416 | Ga0496102_0731416_58_888 | 243 |
| 1583 | 3300048907 | Ga0496104_0022546 | Ga0496104_0022546_3731_4561 | 243 |
| 1584 | 3300048908 | Ga0496105_0013612 | Ga0496105_0013612_4239_5069 | 243 |
| 1585 | 3300048911 | Ga0496108_0186218 | Ga0496108_0186218_555_1385 | 243 |
| 1586 | 3300048912 | Ga0496109_0006339 | Ga0496109_0006339_5747_6577 | 243 |
| 1587 | 3300048913 | Ga0496110_0016993 | Ga0496110_0016993_2327_3157 | 243 |
| 1588 | 3300048917 | Ga0496114_0025936 | Ga0496114_0025936_2737_3567 | 243 |
| 1589 | 3300050511 | nmdc:mga08y16_254065_c1 | nmdc:mga08y16_254065_c1_491_1321 | 243 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6x3c-assembly2.cif.gz_B | crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) | 0.9414 | 147 | 204 |
| 3tk8-assembly1.cif.gz_B | structure of a 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate n-succinyltransferase from burkholderia pseudomallei | 0.9354 | 1 | 227 |
| 6ckt-assembly1.cif.gz_A | crystal structure of 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate n-succinyltransferase from legionella pneumophila philadelphia 1 | 0.9346 | 1 | 242 |
| 1tdt-assembly1.cif.gz_C | three-dimensional structure of tetrahydrodipicolinate-n-succinyltransferase | 0.9336 | 5 | 227 |
| 4e6u-assembly1.cif.gz_A | structure of lpxa from acinetobacter baumannii at 1.4a resolution (p63 form) | 0.9328 | 147 | 205 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3tk8C01 | Mainly Alpha;Orthogonal Bundle;Tetrahydrodipicolinate-N-succinyltransferase; Chain A, domain 1;Tetrahydrodipicolinate-N-succinyltransferase, N-terminal domain | 0.9831 | 1 | 69 | 1.10.166.10 |
| 3tk8A01 | Mainly Alpha;Orthogonal Bundle;Tetrahydrodipicolinate-N-succinyltransferase; Chain A, domain 1;Tetrahydrodipicolinate-N-succinyltransferase, N-terminal domain | 0.9796 | 2 | 69 | 1.10.166.10 |
| 6amyA01 | Mainly Alpha;Orthogonal Bundle;Tetrahydrodipicolinate-N-succinyltransferase; Chain A, domain 1;Tetrahydrodipicolinate-N-succinyltransferase, N-terminal domain | 0.9753 | 3 | 69 | 1.10.166.10 |
| 3tk8C01 | Mainly Alpha;Orthogonal Bundle;Tetrahydrodipicolinate-N-succinyltransferase; Chain A, domain 1;Tetrahydrodipicolinate-N-succinyltransferase, N-terminal domain | 0.9558 | 1 | 69 | 1.10.166.10 |
| af_A0A0P0WBK1_1725_1883_2.160.10.10 | Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins | 0.9479 | 147 | 205 | 2.160.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Y9Q6J3-F1-model_v4 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | 1.007 | 1 | 56 |
GO:0016740
|
| AF-A0A354Z193-F1-model_v4 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | 1.002 | 186 | 242 |
GO:0016740
|
| AF-A0A4U6LD75-F1-model_v4 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (EC 2.3.1.117) | 1.002 | 1 | 55 |
GO:0008666
|
| AF-K2A529-F1-model_v4 | 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase (EC 2.3.1.117) | 0.9987 | 175 | 243 |
GO:0008666
|
| AF-A0A3C2E297-F1-model_v4 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | 0.9966 | 164 | 243 |
GO:0016740
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar