metagRoot

F494919

General Info

Members	Datasets	Scaffolds	Average Seq Length
1587	1135	829	296

Family's Representative Sequence

Representative Sequence	3300013307\|Ga0157372_10046289\|Ga0157372_100462895
Length	315
Sequence	LQALLVLVKKKTTDYMSKKRIFFTGGSGKAGKHVIPYLLNQGYRVMNVDLTPLPYPGVDNLVADITDSGQMFNAMSSYAGLDELEGGNGVPPFDAVVHFAAVARILIKPDNETFRVNTIGTYNVIEAAVKLGVKKIIIASSETTYGVCFSDGQTNPHVLPLEEDYDVDPMDSYGLSKVVNEQTARSFQRRSGFDIYALRIGNVIEPHEYAELFPHFFKNPEVRRRNAFCYIDARDLGQIVDLCLQKDGLGFQVFNAGNDHNGAIIPSKQLAEQFFPGVPITRELGEHEALFSNRKIREVLGFKEQHNWRNYVKVD

Samples

	Sample ID	Description	Type	Environment
1	2010549000	Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes	Metagenome	Endosphere
2	2503198000	Mesorhizobium opportunistum WSM2075	Isolate	Nodule
3	2508501122	Ensifer yinggardensis WSM1721	Isolate	Nodule
4	2508501123	Mesorhizobium sp. WSM3626	Isolate	Nodule
5	2509276018	Mesorhizobium ciceri CMG6	Isolate	Nodule
6	2509276019	Ensifer aridi TW10	Isolate	Nodule
7	2509276021	Rhizobium leguminosarum bv. trifolii WSM597	Isolate	Nodule
8	2509276022	Mesorhizobium australicum WSM2073	Isolate	Nodule
9	2509276033	Rhizobium leguminosarum bv. trifolii WSM2012	Isolate	Nodule
10	2510065019	Rhizobium leguminosarum bv. trifolii WSM1689	Isolate	Nodule
11	2510065057	Sinorhizobium meliloti WSM1022	Isolate	Nodule
12	2510461069	Rhizobium sp. PDO1-076	Isolate	Rhizosphere
13	2510461076	Rhizobium leguminosarum bv. trifolii TA1	Isolate	Nodule
14	2510917022	Rhizobium sp. AP16	Isolate	Rhizosphere
15	2510917026	Rhizobium sp. CF80	Isolate	Rhizosphere
16	2510917028	Rhizobium sp. CF122	Isolate	Rhizosphere
17	2510917030	Rhizobium sp. CF142	Isolate	Rhizosphere
18	2511231052	Sinorhizobium meliloti AK58	Isolate	Nodule
19	2512047086	Sinorhizobium arboris LMG 14919	Isolate	Nodule
20	2512875016	Mesorhizobium japonicum R7A	Isolate	Nodule
21	2512875024	Mesorhizobium loti R88b	Isolate	Nodule
22	2512875026	Sinorhizobium medicae WSM1115	Isolate	Nodule
23	2513237084	Rhizobium leguminosarum bv. viciae UPM1131	Isolate	Nodule
24	2513237085	Rhizobium leguminosarum bv. viciae UPM1137	Isolate	Nodule
25	2513237086	Sinorhizobium meliloti MVII-I	Isolate	Nodule
26	2513237088	Rhizobium mesoamericanum STM6155	Isolate	Nodule
27	2513237089	Sinorhizobium medicae DI28	Isolate	Nodule
28	2513237091	Sinorhizobium meliloti RRI128	Isolate	Nodule
29	2513237093	Rhizobium leguminosarum bv. phaseoli FA23	Isolate	Nodule
30	2513237103	Rhizobium leguminosarum bv. viciae VF39	Isolate	Nodule
31	2513237138	Rhizobium favelukesii OR191	Isolate	Nodule
32	2513237140	Sinorhizobium meliloti GVPV12	Isolate	Nodule
33	2513237143	Sinorhizobium meliloti Mlalz-1	Isolate	Nodule
34	2513237146	Rhizobium mongolense USDA 1844 (Illumina)	Isolate	Nodule
35	2513237156	Sinorhizobium medicae WSM1369	Isolate	Nodule
36	2513237159	Rhizobium giardinii bv. giardinii H152	Isolate	Nodule
37	2513237160	Sinorhizobium medicae WSM244	Isolate	Nodule
38	2513237162	Rhizobium ruizarguesonis GB30	Isolate	Nodule
39	2513237164	Mesorhizobium loti CJ3sym	Isolate	Nodule
40	2513237305	Mesorhizobium amorphae CCNWGS0123	Isolate	Nodule
41	2515075009	Rhizobium leguminosarum bv. viciae 248	Isolate	Nodule
42	2515154107	Sinorhizobium meliloti 4H41	Isolate	Nodule
43	2515154113	Rhizobium ruizarguesonis Vc2	Isolate	Nodule
44	2515154114	Rhizobium ruizarguesonis Vh3	Isolate	Nodule
45	2515154116	Rhizobium ruizarguesonis Ps8	Isolate	Nodule
46	2515154134	Rhizobium gallicum bv. gallicum R602sp	Isolate	Nodule
47	2516143018	Ensifer sp. BR816	Isolate	Nodule
48	2516653046	Sinorhizobium meliloti BO21CC	Isolate	Nodule
49	2516653077	Rhizobium acaciae WSM1481	Isolate	Nodule
50	2516653085	Rhizobium leguminosarum bv. phaseoli 4292	Isolate	Nodule
51	2517093000	Rhizobium leguminosarum bv. trifolii SRDI943	Isolate	Nodule
52	2517287029	Rhizobium leguminosarum bv. trifolii SRDI565	Isolate	Nodule
53	2517487022	Sinorhizobium medicae WSM4191	Isolate	Nodule
54	2519899620	Rhizobium sp. Pop5	Isolate	Nodule
55	2523231067	Pleomorphomonas oryzae DSM 16300	Isolate	Unclassified
56	2524023207	Ensifer sp. USDA 6670	Isolate	Nodule
57	2524023209	Rhizobium leucaenae USDA 9039	Isolate	Nodule
58	2529292951	Rhizobium sp. CCGE 510	Isolate	Nodule
59	2534681796	Rhizobium grahamii CCGE 502	Isolate	Nodule
60	2551306084	Sinorhizobium meliloti 5A14	Isolate	Nodule
61	2551306085	Sinorhizobium meliloti AE608H	Isolate	Nodule
62	2551306086	Sinorhizobium meliloti AK11	Isolate	Nodule
63	2551306087	Sinorhizobium meliloti A0643DD	Isolate	Nodule
64	2551306089	Sinorhizobium meliloti 1A42	Isolate	Nodule
65	2551306090	Sinorhizobium meliloti A0641M	Isolate	Nodule
66	2551306091	Sinorhizobium meliloti C0431A	Isolate	Nodule
67	2551306092	Sinorhizobium meliloti AK75	Isolate	Nodule
68	2551306093	Sinorhizobium meliloti C0438LL	Isolate	Nodule
69	2558860100	Sinorhizobium sp. PC2	Isolate	Nodule
70	2582581283	Rhizobium sp. OK665	Isolate	Rhizosphere
71	2582581294	Rhizobium sp. CF394	Isolate	Rhizosphere
72	2582581298	Rhizobium alamii YR540	Isolate	Rhizosphere
73	2582581299	Rhizobium leguminosarum OV483	Isolate	Rhizosphere
74	2582581304	Rhizobium sp. YR519	Isolate	Rhizosphere
75	2582581306	Rhizobium sp. YR295	Isolate	Rhizosphere
76	2582581307	Rhizobium sp. YR060	Isolate	Rhizosphere
77	2582581308	Rhizobium sp. OK494	Isolate	Rhizosphere
78	2582581315	Agrobacterium rhizogenes YR147	Isolate	Rhizosphere
79	2582581316	Agrobacterium rhizogenes OK036	Isolate	Rhizosphere
80	2582581865	Rhizobium sp. CF258	Isolate	Rhizosphere
81	2582581866	Rhizobium sp. CF097	Isolate	Rhizosphere
82	2582581867	Rhizobium sp. OV201	Isolate	Rhizosphere
83	2585427526	Rhizobium leguminosarum OV152	Isolate	Rhizosphere
84	2585427527	Rhizobium lusitanum YR374	Isolate	Rhizosphere
85	2585427528	Rhizobium leguminosarum CF307	Isolate	Rhizosphere
86	2585427529	Rhizobium alamii YR584	Isolate	Rhizosphere
87	2585427530	Rhizobium tropici YR635	Isolate	Rhizosphere
88	2585427531	Agrobacterium rhizogenes YR530	Isolate	Rhizosphere
89	2585427590	Rhizobium sp. CF048	Isolate	Rhizosphere
90	2585427593	Rhizobium tropici CF286	Isolate	Rhizosphere
91	2585427594	Rhizobium sp. YR528	Isolate	Rhizosphere
92	2585427608	Agrobacterium rhizogenes OV677	Isolate	Rhizosphere
93	2585427609	Agrobacterium rhizogenes CF263	Isolate	Rhizosphere
94	2585427633	Neorhizobium galegae bv. officinalis HAMBI 1141	Isolate	Nodule
95	2585427634	Neorhizobium galegae bv. orientalis HAMBI 540	Isolate	Nodule
96	2585428125	Agrobacterium rhizogenes CF262	Isolate	Rhizosphere
97	2588253730	Mesorhizobium huakuii 7653R	Isolate	Rhizosphere
98	2599185156	Rhizobium sp. NFR03	Isolate	Rhizoplane
99	2599185170	Rhizobium mongolense USDA 1844 (PacBio)	Isolate	Nodule
100	2599185352	Sinorhizobium sp. NFACC03	Isolate	Rhizoplane
101	2600255279	Rhizobium sp. NFIX01	Isolate	Rhizoplane
102	2600255308	Rhizobium sp. NFIX02	Isolate	Rhizoplane
103	2615840624	Rhizobium aethiopicum HBR26	Isolate	Nodule
104	2615840626	Rhizobium lusitanum P1-7	Isolate	Nodule
105	2615840698	Rhizobium multihospitium HAMBI 2975	Isolate	Nodule
106	2617270742	Rhizobium miluonense HAMBI 2971	Isolate	Nodule
107	2643221558	Rhizobium sp. Root149	Isolate	Unclassified
108	2643221568	Rhizobium sp. Root564	Isolate	Unclassified
109	2643221599	Rhizobium sp. Root708	Isolate	Unclassified
110	2643221607	Rhizobium sp. Root73	Isolate	Unclassified
111	2643221618	Ensifer sp. Root231	Isolate	Unclassified
112	2643221626	Ensifer sp. Root31	Isolate	Unclassified
113	2643221629	Devosia sp. Root105	Isolate	Unclassified
114	2643221634	Rhizobium sp. Root1203	Isolate	Unclassified
115	2643221636	Rhizobium sp. Root1204	Isolate	Unclassified
116	2643221643	Rhizobium sp. Root1220	Isolate	Unclassified
117	2643221653	Rhizobium sp. Root1240	Isolate	Unclassified
118	2643221655	Ensifer sp. Root1252	Isolate	Unclassified
119	2643221659	Ensifer sp. Root127	Isolate	Unclassified
120	2643221662	Devosia sp. Root413D1	Isolate	Unclassified
121	2643221686	Rhizobium sp. Root1334	Isolate	Unclassified
122	2643221689	Rhizobium sp. Root483D2	Isolate	Unclassified
123	2643221698	Ensifer sp. Root142	Isolate	Unclassified
124	2643221712	Ensifer sp. Root258	Isolate	Unclassified
125	2643221719	Rhizobium sp. Root274	Isolate	Unclassified
126	2643221723	Ensifer sp. Root278	Isolate	Unclassified
127	2657244999	Sinorhizobium sojae CCBAU 05684	Isolate	Unclassified
128	2667528174	Rhizobium sp. NFR17	Isolate	Rhizoplane
129	2671180139	Chelativorans sp. A52C2	Isolate	Unclassified
130	2687453392	Mesorhizobium ciceri biserrulae WSM1284	Isolate	Unclassified
131	2690316117	Sinorhizobium fredii CCBAU 45436	Isolate	Unclassified
132	2718217927	Rhizobium sp. N324	Isolate	Nodule
133	2718217997	Rhizobium phaseoli sv. phaseoli R723	Isolate	Nodule
134	2718218009	Rhizobium sp. N561	Isolate	Nodule
135	2718218199	Rhizobium phaseoli sv. phaseoli N261	Isolate	Nodule
136	2718218232	Rhizobium phaseoli sv. phaseoli N161	Isolate	Nodule
137	2718218233	Rhizobium phaseoli sv. phaseoli R744	Isolate	Nodule
138	2718218235	Rhizobium phaseoli sv. phaseoli R620	Isolate	Nodule
139	2718218269	Rhizobium phaseoli sv. phaseoli N671	Isolate	Nodule
140	2718218363	Rhizobium sp. N113	Isolate	Nodule
141	2718218365	Rhizobium sp. N731	Isolate	Nodule
142	2718218366	Rhizobium sp. N621	Isolate	Nodule
143	2718218423	Rhizobium sp. N941	Isolate	Nodule
144	2721755514	Rhizobium sp. N6212	Isolate	Nodule
145	2721755556	Rhizobium phaseoli sv. phaseoli N931	Isolate	Nodule
146	2721755684	Rhizobium phaseoli sv. phaseoli N841	Isolate	Nodule
147	2721755685	Rhizobium phaseoli sv. phaseoli R611	Isolate	Nodule
148	2721755686	Mesorhizobium amorphae CCNWGS0123	Isolate	Nodule
149	2721755809	Rhizobium sp. N541	Isolate	Nodule
150	2721755810	Rhizobium sp. N871	Isolate	Nodule
151	2721755819	Rhizobium phaseoli sv. phaseoli N771	Isolate	Nodule
152	2721755822	Rhizobium phaseoli sv. phaseoli R650	Isolate	Nodule
153	2721755823	Rhizobium phaseoli sv. phaseoli R630	Isolate	Nodule
154	2724679232	Rhizobium leguminosarum Vaf12	Isolate	Unclassified
155	2728369352	Rhizobium phaseoli sv. phaseoli N831	Isolate	Nodule
156	2728369365	Rhizobium sp. N1341	Isolate	Nodule
157	2728369397	Rhizobium sp. N1314	Isolate	Nodule
158	2738541293	Rhizobium sp. GV031	Isolate	Unclassified
159	2738541317	Rhizobium halophytocola DSM 21600	Isolate	Unclassified
160	2738541333	Rhizobium sophoriradicis CCBAU 03470	Isolate	Unclassified
161	2738543024	Aminobacter sp. AP02	Isolate	Unclassified
162	2738543031	Pleomorphomonas sp. CF100	Isolate	Unclassified
163	2756170246	Mesorhizobium loti DSM 2626	Isolate	Nodule
164	2765235802	Phyllobacterium bourgognense 31-25a	Isolate	Rhizoplane
165	2765235942	Rhizobium sp. WYCCWR10014	Isolate	Nodule
166	2767802442	Phyllobacterium brassicacearum 29-15	Isolate	Rhizoplane
167	2775506902	Phyllobacterium zundukense Tri-48	Isolate	Unclassified
168	2775506904	Phyllobacterium zundukense Tri-38	Isolate	Unclassified
169	2775507266	Rhizobium tropici PRF 81	Isolate	Nodule
170	2791355082	Ensifer alkalisoli YIC4027	Isolate	Nodule
171	2791355091	Sinorhizobium sp. FG01	Isolate	Nodule
172	2791355092	Sinorhizobium sp. NG07B	Isolate	Nodule
173	2791355094	Sinorhizobium sp. BJ1	Isolate	Nodule
174	2791355253	Rhizobium rhizosphaerae RD15	Isolate	Rhizosphere
175	2791355256	Rhizobium sp. M10	Isolate	Nodule
176	2791355259	Rhizobium hidalgonense FH14	Isolate	Nodule
177	2791355260	Rhizobium sp. L9	Isolate	Nodule
178	2791355261	Rhizobium sp. J15	Isolate	Nodule
179	2791355262	Rhizobium sp. M1	Isolate	Nodule
180	2791355263	Rhizobium chutanense C5	Isolate	Nodule
181	2791355264	Rhizobium sp. S9	Isolate	Nodule
182	2791355265	Rhizobium sp. H4	Isolate	Nodule
183	2791355266	Rhizobium sp. L43	Isolate	Nodule
184	2791355267	Rhizobium sp. L18	Isolate	Nodule
185	2802428858	Sinorhizobium medicae M14-1	Isolate	Nodule
186	2802428859	Sinorhizobium medicae SF3.41	Isolate	Nodule
187	2802428860	Sinorhizobium medicae M19-1	Isolate	Nodule
188	2802428861	Sinorhizobium medicae USDA1037	Isolate	Nodule
189	2802428862	Sinorhizobium medicae M7-4	Isolate	Nodule
190	2802428863	Sinorhizobium medicae M26-2	Isolate	Nodule
191	2802429268	Sinorhizobium sojae CCBAU 05684	Isolate	Unclassified
192	2802429605	Rhizobium sophoriradicis L101	Isolate	Nodule
193	2802429606	Rhizobium sophoriradicis JJW1	Isolate	Nodule
194	2802429633	Rhizobium anhuiense J3	Isolate	Nodule
195	2802429634	Rhizobium anhuiense S10	Isolate	Nodule
196	2802429635	Rhizobium anhuiense Y27	Isolate	Nodule
197	2802429636	Rhizobium anhuiense JX3	Isolate	Nodule
198	2802429637	Rhizobium anhuiense C15	Isolate	Nodule
199	2818991439	Agrobacterium tumefaciens 1187	Isolate	Unclassified
200	2818991448	Rhizobium miluonense 1234	Isolate	Unclassified
201	2818991453	Rhizobium lusitanum 1158	Isolate	Unclassified
202	2837651117	Pseudohoeflea suaedae YC6898	Isolate	Unclassified
203	2838016132	Rhizobium phaseoli SEMIA 4071	Isolate	Nodule
204	2838022645	Rhizobium aethiopicum SEMIA 4074	Isolate	Nodule
205	2838029111	Rhizobium tropici SEMIA 4079	Isolate	Nodule
206	2838035591	Rhizobium mongolense SEMIA 4087	Isolate	Nodule
207	2838042994	Rhizobium esperanzae SEMIA 4089	Isolate	Nodule
208	2838048938	Rhizobium pisi 27/80	Isolate	Nodule
209	2838061910	Rhizobium phaseoli L15	Isolate	Nodule
210	2838068647	Rhizobium esperanzae VC28	Isolate	Nodule
211	2838074704	Sinorhizobium terangae SEMIA 6460	Isolate	Unclassified
212	2838661181	Rhizobium mongolense SEMIA 402	Isolate	Nodule
213	2838668709	Rhizobium sophoriradicis SEMIA 403	Isolate	Nodule
214	2838675328	Agrobacterium radiobacter SEMIA 410	Isolate	Nodule
215	2838680041	Rhizobium leguminosarum SEMIA 415	Isolate	Nodule
216	2838686498	Rhizobium leguminosarum SEMIA 416	Isolate	Nodule
217	2838694306	Rhizobium leguminosarum SEMIA 421	Isolate	Nodule
218	2838701080	Rhizobium aethiopicum SEMIA 428	Isolate	Nodule
219	2838707686	Rhizobium leguminosarum SEMIA 430	Isolate	Nodule
220	2838714209	Agrobacterium radiobacter SEMIA 435	Isolate	Nodule
221	2838719591	Agrobacterium radiobacter SEMIA 436	Isolate	Nodule
222	2838724970	Agrobacterium radiobacter SEMIA 437	Isolate	Nodule
223	2838729681	Rhizobium leguminosarum SEMIA 445	Isolate	Nodule
224	2838742623	Rhizobium leguminosarum SEMIA 449	Isolate	Nodule
225	2839993093	Phyllobacterium endophyticum PEPV15	Isolate	Unclassified
226	2840764183	Phyllobacterium sophorae CCBAU 03422	Isolate	Unclassified
227	2841734538	Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1	Isolate	Nodule
228	2841846520	Agrobacterium radiobacter SEMIA 440	Isolate	Nodule
229	2841851746	Rhizobium leguminosarum SEMIA 498	Isolate	Nodule
230	2841864319	Rhizobium leguminosarum SEMIA 4052	Isolate	Nodule
231	2842077413	Rhizobium leguminosarum SEMIA 422	Isolate	Nodule
232	2842110456	Rhizobium esperanzae SEMIA 414	Isolate	Nodule
233	2842118031	Rhizobium esperanzae SEMIA 420	Isolate	Nodule
234	2842124991	Agrobacterium radiobacter SEMIA 434	Isolate	Nodule
235	2842130223	Agrobacterium radiobacter SEMIA 441	Isolate	Nodule
236	2842146304	Rhizobium sophoriradicis SEMIA 454	Isolate	Nodule
237	2842152218	Agrobacterium radiobacter SEMIA 457	Isolate	Nodule
238	2842156927	Rhizobium leguminosarum SEMIA 459	Isolate	Nodule
239	2842163707	Rhizobium leguminosarum SEMIA 460	Isolate	Nodule
240	2842170452	Agrobacterium radiobacter SEMIA 461	Isolate	Nodule
241	2842175837	Agrobacterium radiobacter SEMIA 462	Isolate	Nodule
242	2842180545	Rhizobium leguminosarum SEMIA 463	Isolate	Nodule
243	2842187318	Agrobacterium radiobacter SEMIA 464	Isolate	Nodule
244	2842192696	Rhizobium esperanzae SEMIA 468	Isolate	Nodule
245	2842198810	Rhizobium aethiopicum SEMIA 470	Isolate	Nodule
246	2842205361	Rhizobium etli SEMIA 471	Isolate	Nodule
247	2842211629	Agrobacterium radiobacter SEMIA 472	Isolate	Nodule
248	2842217011	Rhizobium leguminosarum SEMIA 475	Isolate	Nodule
249	2842224351	Agrobacterium radiobacter SEMIA 480	Isolate	Nodule
250	2842229732	Rhizobium leguminosarum SEMIA 481	Isolate	Nodule
251	2842237096	Rhizobium leguminosarum SEMIA 482	Isolate	Nodule
252	2842243621	Rhizobium leguminosarum SEMIA 483	Isolate	Nodule
253	2842250916	Rhizobium etli SEMIA 484	Isolate	Nodule
254	2842257432	Rhizobium leguminosarum SEMIA 485	Isolate	Nodule
255	2842264693	Rhizobium phaseoli SEMIA 487	Isolate	Nodule
256	2842271015	Rhizobium leguminosarum SEMIA 488	Isolate	Nodule
257	2842278818	Rhizobium etli SEMIA 489	Isolate	Nodule
258	2842285085	Rhizobium lentis SEMIA 490	Isolate	Nodule
259	2842291075	Rhizobium leguminosarum SEMIA 491	Isolate	Nodule
260	2842298080	Rhizobium leucaenae SEMIA 492	Isolate	Nodule
261	2842304105	Rhizobium leguminosarum SEMIA 499	Isolate	Nodule
262	2842311132	Rhizobium phaseoli SEMIA 4002	Isolate	Nodule
263	2842317721	Rhizobium etli SEMIA 4004	Isolate	Nodule
264	2842341865	Rhizobium leguminosarum SEMIA 4011	Isolate	Nodule
265	2842357229	Rhizobium leucaenae SEMIA 4015	Isolate	Nodule
266	2842363717	Rhizobium leguminosarum SEMIA 4016	Isolate	Nodule
267	2842370503	Rhizobium leguminosarum SEMIA 4022	Isolate	Nodule
268	2842377471	Rhizobium leguminosarum SEMIA 4024	Isolate	Nodule
269	2842384541	Rhizobium leguminosarum SEMIA 4025	Isolate	Nodule
270	2842395702	Rhizobium ecuadorense SEMIA 4029	Isolate	Nodule
271	2842402390	Rhizobium lentis SEMIA 4033	Isolate	Nodule
272	2842409023	Rhizobium lentis SEMIA 4034	Isolate	Nodule
273	2842415677	Rhizobium lentis SEMIA 4036	Isolate	Nodule
274	2842422224	Rhizobium esperanzae SEMIA 4042	Isolate	Nodule
275	2842428310	Rhizobium phaseoli SEMIA 4050	Isolate	Nodule
276	2842434925	Rhizobium esperanzae SEMIA 4051	Isolate	Nodule
277	2842441272	Rhizobium esperanzae SEMIA 4053	Isolate	Nodule
278	2842447887	Rhizobium esperanzae SEMIA 4055	Isolate	Nodule
279	2842462802	Rhizobium phaseoli SEMIA 4057	Isolate	Nodule
280	2842469257	Rhizobium phaseoli SEMIA 4058	Isolate	Nodule
281	2842475841	Rhizobium tropici SEMIA 4059	Isolate	Nodule
282	2842482326	Rhizobium lusitanum SEMIA 4060	Isolate	Nodule
283	2842489311	Rhizobium sophoriradicis SEMIA 4061	Isolate	Nodule
284	2842495871	Rhizobium etli SEMIA 4062	Isolate	Nodule
285	2842502639	Rhizobium tropici SEMIA 4063	Isolate	Nodule
286	2842509118	Rhizobium paranaense SEMIA 4064	Isolate	Nodule
287	2842521101	Rhizobium giardinii SEMIA 4084	Isolate	Nodule
288	2842922631	Pararhizobium sp. R-72066	Isolate	Unclassified
289	2844002411	Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1	Isolate	Nodule
290	2844009547	Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1	Isolate	Nodule
291	2844163670	Ensifer sp. 1H6	Isolate	Unclassified
292	2844454524	Rhizobium leguminosarum bv. viciae BIHB 1217	Isolate	Nodule
293	2847417321	Sinorhizobium fredii CCBAU 45436	Isolate	Unclassified
294	2848992105	Sinorhizobium fredii CCBAU 25509	Isolate	Unclassified
295	2850079185	Ensifer aridi JNVU TP6	Isolate	Unclassified
296	2852387548	Rhizobium jaguaris CCGE525	Isolate	Unclassified
297	2854896431	Neorhizobium alkalisoli DSM 21826	Isolate	Unclassified
298	2854916844	Neorhizobium huautlense DSM 21817	Isolate	Unclassified
299	2855825444	Sinorhizobium meliloti CXM1-105	Isolate	Nodule
300	2855839649	Sinorhizobium meliloti AK555	Isolate	Unclassified
301	2855872281	Sinorhizobium fredii PCH1	Isolate	Nodule
302	2856320880	Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1	Isolate	Nodule
303	2856334872	Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1	Isolate	Nodule
304	2856349417	Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1	Isolate	Nodule
305	2856356410	Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1	Isolate	Nodule
306	2857367948	Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1	Isolate	Nodule
307	2857516855	Rhizobium sp. R-72456	Isolate	Unclassified
308	2858800743	Sinorhizobium meliloti AK170	Isolate	Unclassified
309	2869162929	Mesorhizobium sanjuanii BSA136	Isolate	Nodule
310	2869169390	Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1	Isolate	Nodule
311	2869234852	Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1	Isolate	Nodule
312	2869242130	Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1	Isolate	Nodule
313	2869249662	Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1	Isolate	Nodule
314	2869256925	Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0	Isolate	Nodule
315	2869264136	Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1	Isolate	Nodule
316	2869271264	Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1	Isolate	Nodule
317	2869278585	Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1	Isolate	Nodule
318	2871435913	Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0	Isolate	Nodule
319	2871451962	Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1	Isolate	Nodule
320	2871459585	Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1	Isolate	Nodule
321	2871466892	Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1	Isolate	Nodule
322	2871474448	Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1	Isolate	Nodule
323	2871481445	Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1	Isolate	Nodule
324	2871488783	Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1	Isolate	Nodule
325	2874109183	Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1	Isolate	Nodule
326	2874116593	Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1	Isolate	Nodule
327	2874123672	Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1	Isolate	Nodule
328	2874131515	Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1	Isolate	Nodule
329	2874139085	Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1	Isolate	Nodule
330	2874162495	Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1	Isolate	Nodule
331	2874168670	Mesorhizobium kowhaii Ach-343	Isolate	Nodule
332	2876363079	Mesorhizobium loti R7ANS::ICEMlSym2042	Isolate	Nodule
333	2876386047	Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1	Isolate	Nodule
334	2876399893	Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1	Isolate	Nodule
335	2876406927	Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1	Isolate	Nodule
336	2876420981	Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1	Isolate	Nodule
337	2878738818	Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1	Isolate	Nodule
338	2878753008	Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1	Isolate	Nodule
339	2878774303	Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1	Isolate	Nodule
340	2878781027	Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1	Isolate	Nodule
341	2878788777	Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1	Isolate	Nodule
342	2881155292	Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1	Isolate	Nodule
343	2881161766	Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1	Isolate	Nodule
344	2881845957	Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1	Isolate	Nodule
345	2881853255	Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1	Isolate	Nodule
346	2881861095	Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2	Isolate	Nodule
347	2882912400	Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1	Isolate	Nodule
348	2884634485	Algoriphagus kandeliae XY-J91	Isolate	Unclassified
349	2885312484	Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2	Isolate	Nodule
350	2885318864	Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1	Isolate	Nodule
351	2885342637	Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1	Isolate	Nodule
352	2885350715	Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1	Isolate	Nodule
353	2888337043	Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1	Isolate	Nodule
354	2888343758	Mesorhizobium sp. AA22	Isolate	Unclassified
355	2889010040	Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1	Isolate	Nodule
356	2891048133	Martelella lutilitoris GH2-6	Isolate	Rhizosphere
357	2894652903	Phyllobacterium sp. SYP-B3895	Isolate	Rhizosphere
358	2894817345	Aureimonas psammosilenae YIM DR1026	Isolate	Unclassified
359	2896384573	Ensifer sp. MPMI2T	Isolate	Unclassified
360	2899275550	Paracoccus hibiscisoli CCTCC AB2016182	Isolate	Rhizosphere
361	2899803654	Agrobacterium sp. a22-2	Isolate	Unclassified
362	2903448605	Mesorhizobium japonicum Opo-235	Isolate	Nodule
363	2903492973	Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1	Isolate	Nodule
364	2903513507	Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2	Isolate	Nodule
365	2903521522	Mesorhizobium loti R7ANS::ICEMlSym2014	Isolate	Nodule
366	2903528002	Mesorhizobium loti R7ANS::ICEMlSym2037	Isolate	Nodule
367	2904578770	Phyllobacterium sp. 586	Isolate	Unclassified
368	2906363423	Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1	Isolate	Nodule
369	2906370794	Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1	Isolate	Nodule
370	2906378014	Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1	Isolate	Nodule
371	2906386501	Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1	Isolate	Nodule
372	2906393657	Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1	Isolate	Nodule
373	2906401398	Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1	Isolate	Nodule
374	2906408224	Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1	Isolate	Nodule
375	2906427513	Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1	Isolate	Nodule
376	2911138879	Spirosoma sp. KUDC1026	Isolate	Rhizosphere
377	2913295892	Sinorhizobium kostiensis DSM 13372	Isolate	Nodule
378	2913308742	Rhizobium halophytocola DSM 21600	Isolate	Unclassified
379	2915980308	Sinorhizobium medicae USDA1149	Isolate	Nodule
380	2915986958	Sinorhizobium meliloti USDA1659	Isolate	Nodule
381	2915993759	Sinorhizobium meliloti USDA1336	Isolate	Nodule
382	2916000859	Sinorhizobium meliloti USDA1562	Isolate	Nodule
383	2916007675	Sinorhizobium meliloti USDA1289	Isolate	Nodule
384	2916014648	Sinorhizobium meliloti USDA1583	Isolate	Nodule
385	2916021584	Sinorhizobium meliloti USDA1550	Isolate	Nodule
386	2916028427	Sinorhizobium meliloti USDA1613	Isolate	Nodule
387	2916035215	Sinorhizobium meliloti 3011	Isolate	Nodule
388	2916041962	Sinorhizobium meliloti USDA1795	Isolate	Nodule
389	2916048683	Sinorhizobium meliloti USDA1796	Isolate	Nodule
390	2916055098	Sinorhizobium meliloti USDA1770	Isolate	Nodule
391	2916061851	Sinorhizobium medicae USDA1638	Isolate	Nodule
392	2916068649	Sinorhizobium meliloti USDA1220	Isolate	Nodule
393	2916076590	Sinorhizobium meliloti USDA1661	Isolate	Nodule
394	2919100787	Rhizobium sp. 1399	Isolate	Rhizosphere
395	2919114240	Agrobacterium tumefaciens 1457	Isolate	Rhizosphere
396	2919119836	Phyllobacterium sp. 1468	Isolate	Rhizosphere
397	2919166419	Agrobacterium cavarae 2074	Isolate	Unclassified
398	2919171160	Neorhizobium sp. 2083	Isolate	Unclassified
399	2919408235	Rhizobium miluonense 3199	Isolate	Unclassified
400	2919679072	Pseudotabrizicola sp. 4114	Isolate	Unclassified
401	2920760137	Ensifer psoraleae CCBAU 65732	Isolate	Unclassified
402	2920822456	Ensifer sesbaniae CCBAU 65729	Isolate	Unclassified
403	2921201388	Sinorhizobium meliloti USDA1692	Isolate	Nodule
404	2921208531	Sinorhizobium meliloti USDA1660	Isolate	Nodule
405	2921237296	Sinorhizobium meliloti USDA1508	Isolate	Nodule
406	2921244191	Sinorhizobium meliloti 2119	Isolate	Nodule
407	2921250672	Sinorhizobium medicae USDA1169	Isolate	Nodule
408	2921257292	Sinorhizobium meliloti USDA1320	Isolate	Nodule
409	2921263974	Sinorhizobium meliloti USDA1107	Isolate	Nodule
410	2921282425	Sinorhizobium meliloti USDA1203	Isolate	Nodule
411	2921289301	Sinorhizobium meliloti USDA1730	Isolate	Nodule
412	2921296804	Sinorhizobium meliloti USDA1200	Isolate	Nodule
413	2922151315	Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1	Isolate	Nodule
414	2922172374	Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1	Isolate	Nodule
415	2922178524	Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1	Isolate	Nodule
416	2923556063	Rhizobium tibeticum 3740	Isolate	Unclassified
417	2924150972	Sinorhizobium meliloti USDA1700	Isolate	Nodule
418	2924158325	Sinorhizobium meliloti USDA1146	Isolate	Nodule
419	2924165586	Sinorhizobium meliloti USDA1264	Isolate	Nodule
420	2924172951	Sinorhizobium meliloti USDA1626	Isolate	Nodule
421	2924179722	Sinorhizobium meliloti USDA1280	Isolate	Nodule
422	2924186466	Sinorhizobium meliloti USDA1389	Isolate	Nodule
423	2924193448	Sinorhizobium meliloti USDA1158	Isolate	Nodule
424	2924207177	Sinorhizobium meliloti USDA1589	Isolate	Nodule
425	2924214083	Sinorhizobium meliloti USDA1702	Isolate	Nodule
426	2924221636	Sinorhizobium meliloti USDA1416	Isolate	Nodule
427	2924228884	Sinorhizobium meliloti USDA1581	Isolate	Nodule
428	2924710171	Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2	Isolate	Nodule
429	2924718760	Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1	Isolate	Nodule
430	2924733363	Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1	Isolate	Nodule
431	2924741084	Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2	Isolate	Nodule
432	2924748358	Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2	Isolate	Nodule
433	2924754689	Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1	Isolate	Nodule
434	2924762789	Mesorhizobium sp. WSM4303	Isolate	Unclassified
435	2924776078	Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1	Isolate	Nodule
436	2924784321	Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1	Isolate	Nodule
437	2926754445	Agrobacterium radiobacter SLBN-94	Isolate	Rhizosphere
438	2928521798	Phyllobacterium ifriqiyense 1451	Isolate	Rhizosphere
439	2933006813	Rhizobium sp. SEMIA 439	Isolate	Unclassified
440	2933570622	Rhizobium leguminosarum SEMIA 409	Isolate	Nodule
441	2933586486	Rhizobium leguminosarum SEMIA 4039	Isolate	Nodule
442	2933594066	Agrobacterium fabrum 35/80	Isolate	Nodule
443	2933599457	Rhizobium phaseoli M3	Isolate	Nodule
444	2935894831	Rhizobium leguminosarum SEMIA 419	Isolate	Nodule
445	2935901341	Rhizobium leguminosarum SEMIA 4082	Isolate	Nodule
446	2936367885	Rhizobium changzhiense WYCCWR 11290	Isolate	Nodule
447	2936375103	Rhizobium changzhiense WYCCWR 11317	Isolate	Nodule
448	2936381700	Rhizobium chutanense C16	Isolate	Unclassified
449	2936996657	Sinorhizobium meliloti USDA1025	Isolate	Nodule
450	2937002841	Sinorhizobium meliloti USDA1006	Isolate	Nodule
451	2937009748	Sinorhizobium meliloti USDA1162	Isolate	Nodule
452	2937016420	Sinorhizobium meliloti USDA1027	Isolate	Nodule
453	2937023124	Sinorhizobium meliloti USDA1335	Isolate	Nodule
454	2937029754	Sinorhizobium medicae USDA1624	Isolate	Nodule
455	2937036028	Sinorhizobium medicae USDA1608	Isolate	Nodule
456	2937042894	Sinorhizobium meliloti USDA1687	Isolate	Nodule
457	2937049772	Sinorhizobium meliloti USDA1691	Isolate	Nodule
458	2937056579	Sinorhizobium meliloti USDA1357	Isolate	Nodule
459	2937063883	Sinorhizobium meliloti USDA1808	Isolate	Nodule
460	2937071275	Sinorhizobium meliloti USDA1623	Isolate	Nodule
461	2937078374	Sinorhizobium medicae USDA1004	Isolate	Nodule
462	2937084907	Sinorhizobium medicae USDA1664	Isolate	Nodule
463	2937091812	Sinorhizobium meliloti USDA1221	Isolate	Nodule
464	2937098957	Sinorhizobium meliloti USDA1519	Isolate	Nodule
465	2937106411	Sinorhizobium meliloti USDA1214	Isolate	Nodule
466	2937113482	Sinorhizobium meliloti USDA1180	Isolate	Nodule
467	2937119839	Sinorhizobium meliloti USDA1790	Isolate	Nodule
468	2937126314	Sinorhizobium meliloti USDA1612	Isolate	Nodule
469	2937822353	Mesorhizobium neociceri CCANP35	Isolate	Nodule
470	2937836603	Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1	Isolate	Nodule
471	2937843397	Mesorhizobium xinjiangense lm94	Isolate	Rhizosphere
472	2937848649	Mesorhizobium sp. WSM4310	Isolate	Unclassified
473	2937861824	Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1	Isolate	Nodule
474	2937868953	Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1	Isolate	Nodule
475	2937877337	Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1	Isolate	Nodule
476	2937972304	Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1	Isolate	Nodule
477	2937980651	Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1	Isolate	Nodule
478	2941499720	Ensifer sp. 4252	Isolate	Rhizosphere
479	2954011201	Phyllobacterium ifrigiyense W4I11	Isolate	Rhizosphere
480	2957375807	Sinorhizobium medicae USDA1632	Isolate	Nodule
481	2957382221	Sinorhizobium meliloti USDA1919	Isolate	Nodule
482	2957388812	Sinorhizobium meliloti USDA1195	Isolate	Nodule
483	2957395598	Sinorhizobium meliloti USDA1237	Isolate	Nodule
484	2957402308	Sinorhizobium meliloti USDA1794	Isolate	Nodule
485	2957408893	Sinorhizobium meliloti USDA1163	Isolate	Nodule
486	2957415311	Sinorhizobium meliloti USDA1724	Isolate	Nodule
487	2957422303	Sinorhizobium meliloti USDA1497	Isolate	Nodule
488	2957430029	Sinorhizobium meliloti USDA1590	Isolate	Nodule
489	2957437181	Sinorhizobium medicae USDA1694	Isolate	Nodule
490	2957443900	Sinorhizobium meliloti USDA1734	Isolate	Nodule
491	2957450854	Sinorhizobium meliloti USDA1655	Isolate	Nodule
492	2957457609	Sinorhizobium meliloti USDA1751	Isolate	Nodule
493	2957464669	Sinorhizobium meliloti USDA1520	Isolate	Nodule
494	2957471148	Sinorhizobium meliloti USDA1204	Isolate	Nodule
495	2957478035	Sinorhizobium meliloti USDA1171	Isolate	Nodule
496	2957484790	Sinorhizobium meliloti USDA1464	Isolate	Nodule
497	2957491536	Sinorhizobium meliloti USDA1804	Isolate	Nodule
498	2957498199	Sinorhizobium meliloti USDA1561	Isolate	Nodule
499	2957505466	Sinorhizobium meliloti USDA1696	Isolate	Nodule
500	2958034702	Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1	Isolate	Nodule
501	2958041894	Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1	Isolate	Nodule
502	2958064165	Mesorhizobium sp. SARCC-RB16n	Isolate	Unclassified
503	2958071322	Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1	Isolate	Nodule
504	2958084443	Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1	Isolate	Nodule
505	2958092219	Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1	Isolate	Nodule
506	2958108152	Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1	Isolate	Nodule
507	2958122699	Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1	Isolate	Nodule
508	2958144490	Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1	Isolate	Nodule
509	2958158011	Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1	Isolate	Nodule
510	2960584000	Sinorhizobium meliloti USDA1530	Isolate	Nodule
511	2960591022	Sinorhizobium medicae USDA1066	Isolate	Nodule
512	2960597568	Sinorhizobium meliloti 3085	Isolate	Nodule
513	2960603979	Sinorhizobium meliloti USDA1580	Isolate	Nodule
514	2960610863	Sinorhizobium meliloti USDA1792	Isolate	Nodule
515	2960617483	Sinorhizobium meliloti USDA1719	Isolate	Nodule
516	2960624210	Sinorhizobium meliloti USDA1415	Isolate	Nodule
517	2960631154	Sinorhizobium medicae USDA1629	Isolate	Nodule
518	2960637947	Sinorhizobium meliloti USDA1202	Isolate	Nodule
519	2960645483	Sinorhizobium meliloti USDA1703	Isolate	Nodule
520	2960652885	Sinorhizobium meliloti USDA1199	Isolate	Nodule
521	2960660292	Sinorhizobium meliloti USDA1883	Isolate	Nodule
522	2960667422	Sinorhizobium meliloti USDA1170	Isolate	Nodule
523	2960674078	Sinorhizobium meliloti USDA1666	Isolate	Nodule
524	2960680706	Sinorhizobium medicae USDA1150	Isolate	Nodule
525	2960687367	Sinorhizobium meliloti USDA1462	Isolate	Nodule
526	2960693952	Sinorhizobium medicae USDA1630	Isolate	Nodule
527	2961127735	Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1	Isolate	Nodule
528	2961136820	Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1	Isolate	Nodule
529	2961170736	Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1	Isolate	Nodule
530	2961183825	Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1	Isolate	Nodule
531	2963644680	Mesorhizobium japonicum R7A	Isolate	Nodule
532	2964607997	Sinorhizobium meliloti USDA1212	Isolate	Nodule
533	2964615318	Sinorhizobium meliloti USDA1248	Isolate	Nodule
534	2964621998	Sinorhizobium meliloti USDA1235	Isolate	Nodule
535	2964628898	Sinorhizobium meliloti USDA1191	Isolate	Nodule
536	2964636051	Sinorhizobium meliloti USDA1594	Isolate	Nodule
537	2964643177	Sinorhizobium meliloti USDA1760	Isolate	Nodule
538	2964649959	Sinorhizobium meliloti USDA1591	Isolate	Nodule
539	2964656573	Sinorhizobium meliloti USDA1308	Isolate	Nodule
540	2964663802	Sinorhizobium meliloti USDA1688	Isolate	Nodule
541	2964670856	Sinorhizobium meliloti USDA1211	Isolate	Nodule
542	2964678106	Sinorhizobium meliloti USDA1210	Isolate	Nodule
543	2964685014	Sinorhizobium meliloti USDA1232	Isolate	Nodule
544	2964691889	Sinorhizobium meliloti USDA1379	Isolate	Nodule
545	2964698721	Sinorhizobium meliloti USDA1656	Isolate	Nodule
546	2964705432	Sinorhizobium meliloti USDA1614	Isolate	Nodule
547	2964712639	Sinorhizobium meliloti USDA1616	Isolate	Nodule
548	2964719344	Sinorhizobium meliloti USDA1456	Isolate	Nodule
549	2965025482	Mesorhizobium sp. Primo-A	Isolate	Nodule
550	2965032056	Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1	Isolate	Nodule
551	2965040258	Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1	Isolate	Nodule
552	2965047637	Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1	Isolate	Nodule
553	2965089291	Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1	Isolate	Nodule
554	2965102966	Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1	Isolate	Nodule
555	2965110997	Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1	Isolate	Nodule
556	2967664464	Sinorhizobium meliloti USDA1208	Isolate	Nodule
557	2967671571	Sinorhizobium meliloti USDA1496	Isolate	Nodule
558	2967678726	Sinorhizobium meliloti USDA1467	Isolate	Nodule
559	2967686174	Sinorhizobium medicae USDA1641	Isolate	Nodule
560	2967693043	Sinorhizobium meliloti USDA1183	Isolate	Nodule
561	2967699805	Sinorhizobium meliloti USDA1695	Isolate	Nodule
562	2967706974	Sinorhizobium meliloti USDA1206	Isolate	Nodule
563	2967714385	Sinorhizobium meliloti USDA1023	Isolate	Nodule
564	2967721400	Sinorhizobium meliloti USDA1742	Isolate	Nodule
565	2967728569	Sinorhizobium medicae USDA1607	Isolate	Nodule
566	2967735183	Sinorhizobium meliloti USDA1710	Isolate	Nodule
567	2967742019	Sinorhizobium meliloti USDA1676	Isolate	Nodule
568	2967748971	Sinorhizobium meliloti USDA1024A	Isolate	Nodule
569	2967755722	Sinorhizobium meliloti USDA1302	Isolate	Nodule
570	2967762386	Sinorhizobium meliloti USDA1397	Isolate	Nodule
571	2967775926	Sinorhizobium meliloti USDA1678	Isolate	Nodule
572	2967996073	Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1	Isolate	Nodule
573	2968003550	Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1	Isolate	Nodule
574	2968016561	Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1	Isolate	Nodule
575	2968083720	Mesorhizobium erdmanii Opo-242	Isolate	Unclassified
576	2968138860	Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1	Isolate	Nodule
577	2970019648	Sinorhizobium meliloti USDA1603	Isolate	Nodule
578	2970026789	Sinorhizobium medicae USDA1611	Isolate	Nodule
579	2970033650	Sinorhizobium meliloti USDA1565	Isolate	Nodule
580	2970040964	Sinorhizobium meliloti USDA1501	Isolate	Nodule
581	2970047711	Sinorhizobium meliloti USDA1793	Isolate	Nodule
582	2970054988	Sinorhizobium meliloti USDA1031	Isolate	Nodule
583	2970061556	Sinorhizobium meliloti USDA1810	Isolate	Nodule
584	2970068827	Sinorhizobium meliloti USDA1227	Isolate	Nodule
585	2970076120	Sinorhizobium meliloti USDA1706	Isolate	Nodule
586	2970082768	Sinorhizobium meliloti USDA1803	Isolate	Nodule
587	2970088815	Sinorhizobium meliloti USDA1819	Isolate	Nodule
588	2970095765	Sinorhizobium meliloti USDA1225	Isolate	Nodule
589	2970102677	Sinorhizobium meliloti USDA1325	Isolate	Nodule
590	2970109326	Sinorhizobium meliloti USDA1186	Isolate	Nodule
591	2970116247	Sinorhizobium meliloti USDA1566	Isolate	Nodule
592	2970122695	Sinorhizobium medicae 3082	Isolate	Nodule
593	2970129317	Sinorhizobium meliloti USDA1008	Isolate	Nodule
594	2970136068	Sinorhizobium meliloti USDA1699	Isolate	Nodule
595	2970143518	Sinorhizobium medicae USDA1652	Isolate	Nodule
596	2970149975	Sinorhizobium meliloti USDA1215	Isolate	Nodule
597	2970156795	Sinorhizobium meliloti USDA1491	Isolate	Nodule
598	2970164137	Sinorhizobium meliloti USDA1018	Isolate	Nodule
599	2970170962	Sinorhizobium meliloti USDA1571	Isolate	Nodule
600	2970177841	Sinorhizobium meliloti USDA1533	Isolate	Nodule
601	2970184632	Sinorhizobium meliloti USDA1593	Isolate	Nodule
602	2970191845	Sinorhizobium meliloti USDA1187	Isolate	Nodule
603	2970469710	Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1	Isolate	Nodule
604	2970489779	Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1	Isolate	Nodule
605	2970503327	Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1	Isolate	Nodule
606	2970510686	Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0	Isolate	Nodule
607	2970524798	Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1	Isolate	Nodule
608	2970532167	Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1	Isolate	Nodule
609	2970540015	Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1	Isolate	Nodule
610	2970547951	Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1	Isolate	Nodule
611	2970593180	Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1	Isolate	Nodule
612	2970619444	Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1	Isolate	Nodule
613	2970627176	Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1	Isolate	Nodule
614	2977516862	Sinorhizobium meliloti USDA1791	Isolate	Nodule
615	2977523885	Sinorhizobium meliloti USDA1777	Isolate	Nodule
616	2977530762	Sinorhizobium medicae USDA1606	Isolate	Nodule
617	2977537788	Sinorhizobium meliloti USDA1184	Isolate	Nodule
618	2977544691	Sinorhizobium medicae USDA1631	Isolate	Nodule
619	2977551784	Sinorhizobium meliloti USDA1035	Isolate	Nodule
620	2977565890	Sinorhizobium meliloti USDA1617	Isolate	Nodule
621	2977572785	Sinorhizobium meliloti USDA1767	Isolate	Nodule
622	2977579622	Sinorhizobium meliloti USDA1161	Isolate	Nodule
623	2977821940	Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1	Isolate	Nodule
624	2977828996	Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1	Isolate	Nodule
625	2977851361	Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1	Isolate	Nodule
626	2977864932	Mesorhizobium tamadayense DSM 28320	Isolate	Nodule
627	2977872689	Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1	Isolate	Nodule
628	2977898635	Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1	Isolate	Nodule
629	2977907340	Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1	Isolate	Nodule
630	2977915119	Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1	Isolate	Nodule
631	2977922695	Mesorhizobium sp. WSM4305	Isolate	Unclassified
632	2977935797	Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1	Isolate	Nodule
633	2977950692	Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1	Isolate	Nodule
634	2977957713	Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1	Isolate	Nodule
635	2977986579	Mesorhizobium intechi BD68	Isolate	Unclassified
636	2979100975	Agrobacterium pusense SORGH_AS 755	Isolate	Unclassified
637	2979764755	Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1	Isolate	Nodule
638	2979772303	Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1	Isolate	Nodule
639	2979793036	Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1	Isolate	Nodule
640	2979808191	Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1	Isolate	Nodule
641	2984509177	Agrobacterium pusense SORGH_AS260	Isolate	Aerial Root
642	2984518228	Agrobacterium pusense SORGH_AS285	Isolate	Aerial Root
643	2984537506	Agrobacterium sp. SORGH_AS440	Isolate	Aerial Root
644	2984601300	Rhizobium pusense SORGH_AS1083	Isolate	Aerial Root
645	2987645492	Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1	Isolate	Nodule
646	2987652177	Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1	Isolate	Nodule
647	2987666974	Mesorhizobium sp. WSM4306	Isolate	Unclassified
648	2987673487	Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1	Isolate	Nodule
649	2989776772	Rhizobium glycinendophyticum CL12	Isolate	Unclassified
650	2995392953	Martelella limonii NBRC 109441	Isolate	Unclassified
651	2996310559	Mesorhizobium zhangyense CGMCC 1.15528	Isolate	Unclassified
652	2996336353	Mesorhizobium sp. YM1C-6-2	Isolate	Unclassified
653	2996348954	Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1	Isolate	Nodule
654	2996386984	Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0	Isolate	Nodule
655	2996887358	Rhizobium sp. R711	Isolate	Nodule
656	2996893221	Rhizobium sp. R635	Isolate	Nodule
657	3000135777	Unclassified bacterium M00.F.Ca.ET.205.01.1.1	Isolate	Unclassified
658	3003930520	Sinorhizobium sp. BG8	Isolate	Unclassified
659	3004167301	Mesorhizobium loti 582	Isolate	Unclassified
660	3004195979	Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1	Isolate	Nodule
661	3004211236	Mesorhizobium sp. WSM4307	Isolate	Unclassified
662	3004218560	Mesorhizobium sp. WSM4315	Isolate	Unclassified
663	3004232784	Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1	Isolate	Nodule
664	3004239961	Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1	Isolate	Nodule
665	3004248173	Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1	Isolate	Nodule
666	3004268573	Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1	Isolate	Nodule
667	3004275668	Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1	Isolate	Nodule
668	3004289098	Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1	Isolate	Nodule
669	3004334049	Mesorhizobium huakuii 583	Isolate	Unclassified
670	3005409236	Rhizobium sp. P32RR-XVIII	Isolate	Rhizosphere
671	3005416602	Rhizobium sp. P40RR-XXII	Isolate	Rhizosphere
672	3005445848	Rhizobium sp. WYJ-E13	Isolate	Unclassified
673	3005452660	Rhizobium grahamii BG7	Isolate	Unclassified
674	3300000532	Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled	Metagenome	Rhizosphere
675	3300001915	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7	Metagenome	Rhizosphere
676	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
677	3300002704	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB	Metagenome	Unclassified
678	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
679	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
680	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
681	3300002739	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA	Metagenome	Endosphere
682	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
683	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
684	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
685	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
686	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
687	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
688	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
689	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
690	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
691	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
692	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
693	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
694	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
695	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
696	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
697	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
698	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
699	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
700	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
701	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
702	3300003856	Agave microbial communities from Guanajuato, Mexico - At.Am.rz	Metagenome	Rhizosphere
703	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
704	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
705	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
706	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
707	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
708	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
709	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
710	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
711	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
712	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
713	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
714	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
715	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
716	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
717	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
718	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
719	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
720	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
721	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
722	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
723	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
724	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
725	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
726	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
727	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
728	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
729	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
730	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
731	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
732	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
733	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
734	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
735	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
736	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
737	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
738	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
739	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
740	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
741	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
742	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
743	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
744	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
745	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
746	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
747	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
748	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
749	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
750	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
751	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
752	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
753	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
754	3300009765	Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule	Metagenome	Nodule
755	3300009766	Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule	Metagenome	Nodule
756	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
757	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
758	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
759	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
760	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
761	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
762	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
763	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
764	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
765	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
766	3300015690	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05	Metagenome	Rhizosphere
767	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
768	3300021320	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3	Metagenome	Nodule
769	3300021321	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1	Metagenome	Nodule
770	3300021327	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2	Metagenome	Nodule
771	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
772	3300022739	Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules	Metagenome	Nodule
773	3300022740	Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules	Metagenome	Nodule
774	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
775	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
776	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
777	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
778	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
779	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
780	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
781	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
782	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
783	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
784	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
785	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
786	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
787	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
788	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
789	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
790	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
791	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
792	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
793	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
794	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
795	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
796	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
797	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
798	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
799	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
800	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
801	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
802	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
803	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
804	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
805	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
806	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
807	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
808	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
809	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
810	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
811	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
812	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
813	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
814	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
815	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
816	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
817	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
818	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
819	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
820	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
821	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
822	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
823	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
824	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
825	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
826	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
827	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
828	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
829	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
830	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
831	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
832	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
833	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
834	3300027512	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2)	Metagenome	Rhizosphere
835	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
836	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
837	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
838	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
839	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
840	3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Metagenome	Rhizosphere
841	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
842	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
843	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
844	3300028653	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG	Metagenome	Rhizosphere
845	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
846	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
847	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
848	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
849	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
850	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
851	3300030744	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7	Metagenome	Rhizosphere
852	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
853	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
854	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
855	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
856	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
857	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
858	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
859	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
860	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
861	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
862	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
863	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
864	3300031967	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules	Metagenome	Nodule
865	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
866	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
867	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
868	3300033430	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules	Metagenome	Nodule
869	3300033464	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules	Metagenome	Nodule
870	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
871	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
872	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
873	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
874	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
875	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
876	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
877	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
878	3300036459	Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
879	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
880	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
881	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
882	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
883	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
884	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
885	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
886	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
887	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
888	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
889	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
890	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
891	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
892	3300041458	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG	Metagenome	Rhizoplane
893	3300041491	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG	Metagenome	Unclassified
894	3300041492	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG	Metagenome	Unclassified
895	3300041496	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG	Metagenome	Unclassified
896	3300041498	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG	Metagenome	Unclassified
897	3300041503	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG	Metagenome	Unclassified
898	3300041504	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaT	Metatranscriptome	Unclassified
899	3300041505	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG	Metagenome	Unclassified
900	3300041507	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG	Metagenome	Unclassified
901	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
902	3300041510	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT	Metatranscriptome	Unclassified
903	3300041511	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG	Metagenome	Unclassified
904	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
905	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
906	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
907	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
908	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
909	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
910	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
911	3300042993	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372	Metagenome	Rhizosphere
912	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
913	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
914	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
915	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
916	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
917	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
918	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
919	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
920	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
921	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
922	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
923	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
924	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
925	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
926	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
927	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
928	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
929	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
930	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
931	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
932	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
933	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
934	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
935	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
936	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
937	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
938	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
939	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
940	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
941	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
942	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
943	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
944	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
945	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
946	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
947	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
948	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
949	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
950	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
951	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
952	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
953	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
954	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
955	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
956	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
957	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
958	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
959	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
960	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
961	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
962	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
963	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
964	3300048090	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere	Metagenome	Rhizosphere
965	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
966	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
967	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
968	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
969	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
970	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
971	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
972	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
973	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
974	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
975	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
976	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
977	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
978	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
979	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
980	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
981	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
982	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
983	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
984	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
985	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
986	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
987	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
988	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
989	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
990	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
991	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
992	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
993	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
994	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
995	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
996	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
997	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
998	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
999	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
1000	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
1001	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
1002	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
1003	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
1004	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
1005	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
1006	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
1007	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
1008	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
1009	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
1010	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
1011	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
1012	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
1013	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
1014	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
1015	3300049671	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought	Metagenome	Rhizosphere
1016	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
1017	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
1018	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
1019	3300049758	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought	Metagenome	Rhizosphere
1020	3300049776	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought	Metagenome	Rhizosphere
1021	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
1022	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
1023	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
1024	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
1025	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
1026	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
1027	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
1028	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
1029	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
1030	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
1031	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
1032	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
1033	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
1034	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
1035	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
1036	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
1037	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
1038	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
1039	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
1040	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
1041	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
1042	3300053097	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere	Metagenome	Endosphere
1043	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
1044	3300053107	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere	Metagenome	Endosphere
1045	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
1046	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
1047	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
1048	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
1049	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
1050	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
1051	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
1052	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
1053	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
1054	3300053137	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere	Metagenome	Endosphere
1055	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
1056	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
1057	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
1058	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
1059	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
1060	3300053155	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere	Metagenome	Endosphere
1061	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
1062	3300053157	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere	Metagenome	Endosphere
1063	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
1064	3300053159	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere	Metagenome	Endosphere
1065	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
1066	3300053163	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere	Metagenome	Endosphere
1067	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
1068	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
1069	3300053725	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere	Metagenome	Endosphere
1070	3300053727	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere	Metagenome	Endosphere
1071	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
1072	3300053731	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere	Metagenome	Endosphere
1073	3300053735	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere	Metagenome	Endosphere
1074	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
1075	3300055283	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere	Metagenome	Endosphere
1076	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
1077	637000159	Mesorhizobium japonicum MAFF 303099	Isolate	Unclassified
1078	639633055	Rhizobium leguminosarum bv. viciae 3841	Isolate	Unclassified
1079	643692032	Sinorhizobium fredii NGR234	Isolate	Nodule
1080	648276728	Sinorhizobium meliloti BL225C	Isolate	Nodule
1081	649633066	Mesorhizobium ciceri bv. biserrulae WSM1271	Isolate	Nodule
1082	8002285264	Aminobacter anthyllidis LMG 26462	Isolate	Nodule
1083	8002745576	Marinomonas spartinae USM8	Isolate	Rhizosphere
1084	8003992118	Sinorhizobium meliloti RRI128	Isolate	Nodule
1085	8003999396	Sinorhizobium medicae WSM1115	Isolate	Nodule
1086	8004300914	Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1	Isolate	Nodule
1087	8004361976	Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1	Isolate	Nodule
1088	8004374579	Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1	Isolate	Nodule
1089	8004395343	Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1	Isolate	Nodule
1090	8004633249	Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1	Isolate	Nodule
1091	8004695233	Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1	Isolate	Nodule
1092	8004727605	Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1	Isolate	Nodule
1093	8005246636	Rhizobium wuzhouense W44	Isolate	Rhizosphere
1094	8005258706	Rhizobium sp. R693	Isolate	Nodule
1095	8005275841	Rhizobium sp. N4311	Isolate	Nodule
1096	8005282627	Rhizobium phaseoli NC1	Isolate	Nodule
1097	8005289223	Rhizobium bangladeshense 1002	Isolate	Nodule
1098	8005301065	Rhizobium bangladeshense 1017	Isolate	Nodule
1099	8005307578	Rhizobium leguminosarum bv. phaseoli LCS0306	Isolate	Unclassified
1100	8005314921	Rhizobium sp. P28RR-XV	Isolate	Rhizosphere
1101	8005321885	Rhizobium sp. R72	Isolate	Nodule
1102	8005376324	Rhizobium changzhiense WYCCWR 11279	Isolate	Nodule
1103	8005382845	Rhizobium sp. R634	Isolate	Nodule
1104	8005395548	Rhizobium sp. R339	Isolate	Nodule
1105	8005430974	Rhizobium phaseoli Y20	Isolate	Nodule
1106	8005460587	Rhizobium leguminosarum bv. viciae 248	Isolate	Nodule
1107	8005484373	Rhizobium tropici SARCC-755	Isolate	Nodule
1108	8005497431	Rhizobium phaseoli CCGM8	Isolate	Unclassified
1109	8005542996	Rhizobium grahamii CCGM3	Isolate	Unclassified
1110	8005556819	Rhizobium sp. WYCCWR 11128	Isolate	Nodule
1111	8005563573	Rhizobium sp. WYCCWR 11152	Isolate	Nodule
1112	8005570704	Rhizobium anhuiense bv. trifolii WYCCWR10015	Isolate	Nodule
1113	8005619151	Rhizobium phaseoli CCGM2	Isolate	Unclassified
1114	8005626139	Rhizobium phaseoli Y18	Isolate	Nodule
1115	8005645114	Rhizobium tropici IGFRI Rhizo-19	Isolate	Rhizosphere
1116	8005658619	Rhizobium terrae CC-HIH110	Isolate	Unclassified
1117	8005668836	Rhizobium phaseoli CCGM9	Isolate	Unclassified
1118	8005682033	Rhizobium dioscoreae S-93	Isolate	Unclassified
1119	8005688590	Rhizobium bangladeshense 1024	Isolate	Nodule
1120	8005695170	Rhizobium sp. RMa-01	Isolate	Unclassified
1121	8018127388	Rhizobium aegyptiacum 950	Isolate	Nodule
1122	8018150411	Rhizobium straminoryzae SM12	Isolate	Rhizosphere
1123	8018163183	Rhizobium sp. WYCCWR 11146	Isolate	Nodule
1124	8018176218	Rhizobium sp. N122	Isolate	Nodule
1125	8023680758	Rhizobium leguminosarum SARCC-132	Isolate	Nodule
1126	8024479707	Rhizobium leguminosarum Tri-43	Isolate	Nodule
1127	8024486573	Rhizobium tubonense CCBAU 85046	Isolate	Nodule
1128	8024501048	Rhizobium sp. H4	Isolate	Nodule
1129	8049293176	Ensifer alkalisoli YIC4027	Isolate	Nodule
1130	8054460903	Agrobacterium vaccinii B7.6	Isolate	Unclassified
1131	8054558443	Rhizobium alarense TRM95111	Isolate	Nodule
1132	8056375014	Rhizobium redzepovicii 18T	Isolate	Nodule
1133	8056382006	Rhizobium croatiense 13T	Isolate	Nodule
1134	8056875544	Rhizobium halophilum TRM95001	Isolate	Rhizosphere
1135	8057874678	Rhizobium acaciae 1AS12	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	52.05
Metatranscriptomes	0.19
Isolates	47.76

Biome Distribution

Category	Percentage (%)
Aerial Root	0.25
Bulb	0
Endosphere	15.82
Nodule	38.5
Rhizoplane	1.83
Rhizosphere	30.37
Stem	0
Stem Tuber	0
Unclassified	13.23

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	RicEn_C4912	2010549000	Bacteria	1275
2	CNAas_1002352	3300000532	Bacteria	1356
3	JGI24741J21665_1010483	3300001915	Bacteria	1657
4	JGI24740J21852_10000703	3300001979	Bacteria	14504
5	JGI24740J21852_10009728	3300001979	Bacteria	3744
6	JGI25155J39150_1000273	3300002704	Bacteria	18797
7	JGI25156J39149_1000662	3300002705	Bacteria	18797
8	JGI25162J39368_1002191	3300002737	Bacteria	8061
9	JGI25162J39368_1002562	3300002737	Bacteria	6890
10	JGI25154J39366_1002486	3300002738	Bacteria	4729
11	JGI25158J39367_1004214	3300002739	Bacteria	2168
12	JGI25157J39369_1000673	3300002741	Bacteria	18797
13	JGI25157J39369_1001242	3300002741	Bacteria	10519
14	JGI25152J39213_1002945	3300002773	Bacteria	6063
15	JGI25152J39213_1006947	3300002773	Bacteria	2990
16	JGI25152J39213_1008257	3300002773	Bacteria	2601
17	JGI25152J39213_1008380	3300002773	Bacteria	2570
18	JGI25150J39212_1000637	3300002774	Bacteria	13252
19	JGI25150J39212_1009662	3300002774	Bacteria	1826
20	JGI25159J45721_1000012	3300002987	Bacteria	149808
21	JGI25159J45721_1001145	3300002987	Bacteria	11323
22	JGI25151J46595_10005842	3300003187	Bacteria	6295
23	JGI25151J46595_10006178	3300003187	Bacteria	6063
24	JGI25151J46595_10007882	3300003187	Bacteria	5172
25	JGI25151J46595_10021436	3300003187	Bacteria	2703
26	JGI25151J46595_10033787	3300003187	Bacteria	1963
27	JGI25406J46586_10030531	3300003203	Bacteria	2027
28	JGI25165J46597_1000159	3300003214	Bacteria	108186
29	JGI25165J46597_1002527	3300003214	Bacteria	5749
30	JGI25165J46597_1004759	3300003214	Bacteria	2801
31	JGI25153J46596_10014615	3300003215	Bacteria	3251
32	JGI25153J46596_10022835	3300003215	Bacteria	2295
33	JGI25153J46596_10026584	3300003215	Bacteria	2045
34	JGI25153J46596_10029492	3300003215	Bacteria	1882
35	rootL2_10044709	3300003322	Bacteria	2990
36	JGI25160J50197_1000042	3300003354	Bacteria	149808
37	JGI25160J50197_1001903	3300003354	Bacteria	9995
38	JGI25160J50197_1006677	3300003354	Bacteria	4638
39	JGI25160J50197_1020398	3300003354	Bacteria	1999
40	JGI25161J50226_1000254	3300003374	Bacteria	31906
41	JGI25161J50226_1001676	3300003374	Bacteria	6354
42	JGI25161J50226_1005321	3300003374	Bacteria	2517
43	Ga0055542_1000406	3300003762	Bacteria	42163
44	Ga0055529_1007925	3300003763	Bacteria	1426
45	Ga0055526_1010920	3300003771	Bacteria	4160
46	Ga0055526_1012870	3300003771	Bacteria	3598
47	Ga0055526_1022337	3300003771	Bacteria	2155
48	Ga0055526_1033237	3300003771	Bacteria	1436
49	Ga0055524_1007866	3300003775	Bacteria	4484
50	Ga0055524_1020299	3300003775	Bacteria	2242
51	Ga0055536_1006416	3300003781	Bacteria	5500
52	Ga0055536_1009167	3300003781	Bacteria	4137
53	Ga0055528_1005164	3300003790	Bacteria	6136
54	Ga0055528_1025167	3300003790	Bacteria	1758
55	Ga0055528_1025283	3300003790	Bacteria	1748
56	Ga0055530_10010936	3300003791	Bacteria	3300
57	Ga0055540_1003660	3300003792	Bacteria	7318
58	Ga0055540_1016534	3300003792	Bacteria	2096
59	Ga0055540_1020166	3300003792	Bacteria	1772
60	Ga0055540_1024167	3300003792	Bacteria	1513
61	Ga0055540_1024907	3300003792	Bacteria	1476
62	Ga0055531_10004968	3300003794	Bacteria	7894
63	Ga0058692_1005295	3300003856	Bacteria	3697
64	Ga0055543_1000452	3300004625	Bacteria	24678
65	Ga0055543_1001301	3300004625	Bacteria	10257
66	Ga0055543_1009836	3300004625	Bacteria	2033
67	Ga0065165_1000174	3300005262	Bacteria	113769
68	Ga0065165_1004983	3300005262	Bacteria	7788
69	Ga0070676_10093126	3300005328	Bacteria	1849
70	Ga0070670_100093133	3300005331	Bacteria	2591
71	Ga0068869_100068930	3300005334	Bacteria	2614
72	Ga0068869_100250977	3300005334	Bacteria	1413
73	Ga0070661_100257297	3300005344	Bacteria	1349
74	Ga0070668_100226837	3300005347	Bacteria	1543
75	Ga0070671_100047237	3300005355	Bacteria	3580
76	Ga0070671_100140014	3300005355	Bacteria	2041
77	Ga0070674_100050824	3300005356	Bacteria	2854
78	Ga0070674_100267794	3300005356	Bacteria	1349
79	Ga0070674_100340804	3300005356	Bacteria	1207
80	Ga0070709_10004617	3300005434	Bacteria	7437
81	Ga0070713_100007893	3300005436	Bacteria	7511
82	Ga0070694_100163776	3300005444	Bacteria	1634
83	Ga0068867_100076848	3300005459	Bacteria	2508
84	Ga0070706_100591057	3300005467	Bacteria	1032
85	Ga0070672_100105698	3300005543	Bacteria	2289
86	Ga0070665_100093846	3300005548	Bacteria	3006
87	Ga0070665_100115749	3300005548	Bacteria	2684
88	Ga0070665_100131057	3300005548	Bacteria	2509
89	Ga0070665_100274521	3300005548	Bacteria	1687
90	Ga0070665_100298520	3300005548	Bacteria	1613
91	Ga0070665_100680164	3300005548	Bacteria	1042
92	Ga0068855_100155768	3300005563	Bacteria	2596
93	Ga0068856_100045280	3300005614	Bacteria	4331
94	Ga0068852_100266950	3300005616	Bacteria	1645
95	Ga0068852_100437349	3300005616	Bacteria	1293
96	Ga0068859_100048231	3300005617	Bacteria	4279
97	Ga0068859_100113250	3300005617	Bacteria	2776
98	Ga0068864_100011632	3300005618	Bacteria	7268
99	Ga0068860_100000927	3300005843	Bacteria	32568
100	Ga0068862_100157180	3300005844	Bacteria	2027
101	Ga0081540_1027674	3300005983	Bacteria	3205
102	Ga0081540_1046881	3300005983	Bacteria	2178
103	Ga0081540_1055027	3300005983	Bacteria	1940
104	Ga0081539_10001054	3300005985	Bacteria	50478
105	Ga0081539_10029967	3300005985	Bacteria	3388
106	Ga0075365_10005631	3300006038	Bacteria	6781
107	Ga0075365_10031322	3300006038	Bacteria	3411
108	Ga0075365_10066437	3300006038	Bacteria	2419
109	Ga0075365_10104888	3300006038	Bacteria	1939
110	Ga0075365_10154525	3300006038	Bacteria	1597
111	Ga0075365_10217163	3300006038	Bacteria	1341
112	Ga0075368_10006442	3300006042	Bacteria	4101
113	Ga0075368_10084225	3300006042	Bacteria	1296
114	Ga0075364_10009362	3300006051	Bacteria	5872
115	Ga0075364_10018176	3300006051	Bacteria	4399
116	Ga0075364_10077755	3300006051	Bacteria	2191
117	Ga0070716_100091198	3300006173	Bacteria	1845
118	Ga0075362_10015302	3300006177	Bacteria	3118
119	Ga0075362_10015521	3300006177	Bacteria	3099
120	Ga0075362_10022032	3300006177	Bacteria	2680
121	Ga0075362_10035051	3300006177	Bacteria	2190
122	Ga0075367_10026621	3300006178	Bacteria	3282
123	Ga0075367_10097117	3300006178	Bacteria	1797
124	Ga0075367_10111627	3300006178	Bacteria	1678
125	Ga0075369_10000668	3300006186	Bacteria	10918
126	Ga0075369_10006990	3300006186	Bacteria	4284
127	Ga0075369_10051626	3300006186	Bacteria	1780
128	Ga0075366_10040314	3300006195	Bacteria	2762
129	Ga0075366_10049961	3300006195	Bacteria	2483
130	Ga0075370_10049591	3300006353	Bacteria	2380
131	Ga0075370_10058080	3300006353	Bacteria	2200
132	Ga0075370_10136209	3300006353	Bacteria	1435
133	Ga0075370_10164781	3300006353	Bacteria	1302
134	Ga0075428_100067899	3300006844	Bacteria	3901
135	Ga0075428_100173592	3300006844	Bacteria	2335
136	Ga0068865_100132912	3300006881	Bacteria	1866
137	Ga0068865_100246968	3300006881	Bacteria	1407
138	Ga0097620_100048229	3300006931	Bacteria	4279
139	Ga0097620_100113243	3300006931	Bacteria	2776
140	Ga0079104_1009534	3300006946	Bacteria	3278
141	Ga0079104_1022168	3300006946	Bacteria	1714
142	Ga0099826_10060404	3300006948	Bacteria	2470
143	Ga0099826_10124522	3300006948	Bacteria	1513
144	Ga0105250_10076812	3300009092	Bacteria	1352
145	Ga0105240_10004516	3300009093	Bacteria	21155
146	Ga0111539_10192773	3300009094	Bacteria	2377
147	Ga0105245_10320136	3300009098	Bacteria	1527
148	Ga0105245_10376938	3300009098	Bacteria	1412
149	Ga0105247_10018564	3300009101	Bacteria	4172
150	Ga0105247_10037583	3300009101	Bacteria	2954
151	Ga0105247_10048918	3300009101	Bacteria	2598
152	Ga0105243_10101857	3300009148	Bacteria	2385
153	Ga0105241_10070701	3300009174	Bacteria	2708
154	Ga0105242_10051691	3300009176	Bacteria	3350
155	Ga0105248_10015246	3300009177	Bacteria	8470
156	Ga0105237_10043232	3300009545	Bacteria	4540
157	Ga0105238_10014647	3300009551	Bacteria	7930
158	Ga0105238_10098109	3300009551	Bacteria	2914
159	Ga0105249_10001311	3300009553	Bacteria	21783
160	Ga0123341_1011836	3300009765	Bacteria	7925
161	Ga0123342_1030016	3300009766	Bacteria	2769
162	Ga0105239_10007703	3300010375	Bacteria	12329
163	Ga0105239_10016746	3300010375	Bacteria	8102
164	Ga0105239_10059758	3300010375	Bacteria	4183
165	Ga0105239_10366017	3300010375	Bacteria	1629
166	Ga0157373_10071779	3300013100	Bacteria	2445
167	Ga0157371_10127135	3300013102	Bacteria	1813
168	Ga0157370_10011226	3300013104	Bacteria	9392
169	Ga0157369_10020309	3300013105	Bacteria	7424
170	Ga0157378_10170177	3300013297	Bacteria	2043
171	Ga0157378_10418540	3300013297	Bacteria	1324
172	Ga0157372_10046289	3300013307	Bacteria	4829
173	Ga0157375_10090529	3300013308	Bacteria	3118
174	Ga0163163_10314037	3300014325	Bacteria	1620
175	Ga0182007_10005179	3300015262	Bacteria	5764
176	Ga0182007_10053383	3300015262	Bacteria	1330
177	Ga0183363_1026	3300015690	Bacteria	53052
178	Ga0163161_10204118	3300017792	Bacteria	1524
179	Ga0214544_1013008	3300021320	Bacteria	10420
180	Ga0214542_1000006	3300021321	Bacteria	345164
181	Ga0214542_1008463	3300021321	Bacteria	16929
182	Ga0214543_1000032	3300021327	Bacteria	200766
183	Ga0214543_1020751	3300021327	Bacteria	5185
184	Ga0213876_10001150	3300021384	Bacteria	16749
185	Ga0213876_10005117	3300021384	Bacteria	7233
186	Ga0228711_1000015	3300022739	Bacteria	126974
187	Ga0228710_1000015	3300022740	Bacteria	133640
188	Ga0209435_100024	3300025206	Bacteria	199665
189	Ga0209436_100075	3300025208	Bacteria	50427
190	Ga0209436_100252	3300025208	Bacteria	24622
191	Ga0209437_100023	3300025233	Bacteria	614195
192	Ga0209437_100609	3300025233	Bacteria	22063
193	Ga0209437_102950	3300025233	Bacteria	3162
194	Ga0207425_1000567	3300025245	Bacteria	21746
195	Ga0207425_1006449	3300025245	Bacteria	3206
196	Ga0207425_1007876	3300025245	Bacteria	2774
197	Ga0207425_1008348	3300025245	Bacteria	2658
198	Ga0209646_1000064	3300025246	Bacteria	246524
199	Ga0209646_1011617	3300025246	Bacteria	1361
200	Ga0209026_1000025	3300025250	Bacteria	352548
201	Ga0209026_1000053	3300025250	Bacteria	246524
202	Ga0209677_100439	3300025253	Bacteria	24301
203	Ga0209677_102953	3300025253	Bacteria	5928
204	Ga0209148_1000181	3300025254	Bacteria	124691
205	Ga0209148_1014287	3300025254	Bacteria	1406
206	Ga0209759_1000042	3300025256	Bacteria	246524
207	Ga0209759_1000226	3300025256	Bacteria	84383
208	Ga0209759_1010246	3300025256	Bacteria	2760
209	Ga0209129_1002235	3300025258	Bacteria	9693
210	Ga0209129_1003292	3300025258	Bacteria	7142
211	Ga0209129_1007578	3300025258	Bacteria	3198
212	Ga0209129_1007589	3300025258	Bacteria	3194
213	Ga0209129_1007828	3300025258	Bacteria	3090
214	Ga0209129_1012878	3300025258	Bacteria	1881
215	Ga0209129_1014003	3300025258	Bacteria	1729
216	Ga0209233_1000127	3300025261	Bacteria	213026
217	Ga0209233_1002121	3300025261	Bacteria	7475
218	Ga0209233_1002441	3300025261	Bacteria	6853
219	Ga0209233_1010162	3300025261	Bacteria	2833
220	Ga0209455_1000127	3300025272	Bacteria	162518
221	Ga0209455_1002309	3300025272	Bacteria	7470
222	Ga0209455_1007778	3300025272	Bacteria	2987
223	Ga0209673_1001500	3300025273	Bacteria	21619
224	Ga0209673_1001698	3300025273	Bacteria	18700
225	Ga0209673_1003618	3300025273	Bacteria	8944
226	Ga0209673_1004602	3300025273	Bacteria	7313
227	Ga0209673_1014346	3300025273	Bacteria	3068
228	Ga0209673_1020125	3300025273	Bacteria	2372
229	Ga0209130_1000006	3300025284	Bacteria	596528
230	Ga0209130_1000075	3300025284	Bacteria	171698
231	Ga0209130_1019377	3300025284	Bacteria	1578
232	Ga0209676_1002745	3300025292	Bacteria	11797
233	Ga0209676_1009621	3300025292	Bacteria	4144
234	Ga0209676_1016764	3300025292	Bacteria	2628
235	Ga0209676_1018524	3300025292	Bacteria	2427
236	Ga0209025_1000747	3300025294	Bacteria	54721
237	Ga0209025_1002179	3300025294	Bacteria	21746
238	Ga0209025_1003076	3300025294	Bacteria	16378
239	Ga0209025_1005530	3300025294	Bacteria	10256
240	Ga0209025_1019872	3300025294	Bacteria	3709
241	Ga0209025_1023458	3300025294	Bacteria	3222
242	Ga0209025_1031705	3300025294	Bacteria	2493
243	Ga0209025_1033504	3300025294	Bacteria	2371
244	Ga0209564_1000278	3300025295	Bacteria	105405
245	Ga0209564_1003938	3300025295	Bacteria	9477
246	Ga0209564_1010354	3300025295	Bacteria	4306
247	Ga0209564_1016961	3300025295	Bacteria	2868
248	Ga0209564_1017385	3300025295	Bacteria	2806
249	Ga0209758_1000642	3300025297	Bacteria	53219
250	Ga0209758_1003235	3300025297	Bacteria	15130
251	Ga0209758_1009036	3300025297	Bacteria	6296
252	Ga0209758_1017526	3300025297	Bacteria	3559
253	Ga0209758_1019294	3300025297	Bacteria	3293
254	Ga0209758_1021798	3300025297	Bacteria	2968
255	Ga0209758_1021923	3300025297	Bacteria	2953
256	Ga0209758_1023223	3300025297	Bacteria	2812
257	Ga0209758_1030545	3300025297	Bacteria	2230
258	Ga0209758_1033698	3300025297	Bacteria	2051
259	Ga0209050_1005758	3300025298	Bacteria	7640
260	Ga0209050_1005977	3300025298	Bacteria	7391
261	Ga0209050_1015065	3300025298	Bacteria	3279
262	Ga0209050_1023578	3300025298	Bacteria	2159
263	Ga0209256_1000411	3300025299	Bacteria	67351
264	Ga0209256_1002419	3300025299	Bacteria	15300
265	Ga0209256_1005294	3300025299	Bacteria	7513
266	Ga0209256_1014210	3300025299	Bacteria	2885
267	Ga0209256_1021555	3300025299	Bacteria	1974
268	Ga0207426_1000163	3300025302	Bacteria	171698
269	Ga0207426_1000231	3300025302	Bacteria	128171
270	Ga0207426_1003737	3300025302	Bacteria	7949
271	Ga0207426_1006348	3300025302	Bacteria	5162
272	Ga0209051_1000032	3300025303	Bacteria	383445
273	Ga0209051_1001154	3300025303	Bacteria	24022
274	Ga0209051_1011120	3300025303	Bacteria	4472
275	Ga0209051_1012613	3300025303	Bacteria	4077
276	Ga0209051_1025517	3300025303	Bacteria	2402
277	Ga0209051_1037321	3300025303	Bacteria	1783
278	Ga0209051_1041852	3300025303	Bacteria	1625
279	Ga0209051_1056288	3300025303	Bacteria	1269
280	Ga0209257_1000589	3300025304	Bacteria	60641
281	Ga0209257_1003204	3300025304	Bacteria	14482
282	Ga0209257_1005128	3300025304	Bacteria	9479
283	Ga0209257_1005658	3300025304	Bacteria	8632
284	Ga0209257_1011112	3300025304	Bacteria	4399
285	Ga0207697_10029535	3300025315	Bacteria	2243
286	Ga0207710_10003531	3300025900	Bacteria	6948
287	Ga0207710_10007520	3300025900	Bacteria	4614
288	Ga0207688_10159661	3300025901	Bacteria	1336
289	Ga0207680_10148438	3300025903	Bacteria	1561
290	Ga0207699_10004446	3300025906	Bacteria	6705
291	Ga0207645_10082613	3300025907	Bacteria	2059
292	Ga0207645_10234607	3300025907	Bacteria	1211
293	Ga0207654_10046931	3300025911	Bacteria	2465
294	Ga0207654_10216210	3300025911	Bacteria	1269
295	Ga0207695_10003483	3300025913	Bacteria	22133
296	Ga0207671_10008330	3300025914	Bacteria	8809
297	Ga0207693_10133277	3300025915	Bacteria	1953
298	Ga0207663_10093421	3300025916	Bacteria	2002
299	Ga0207657_10045524	3300025919	Bacteria	3850
300	Ga0207649_10188183	3300025920	Bacteria	1450
301	Ga0207646_10016329	3300025922	Bacteria	6969
302	Ga0207681_10119334	3300025923	Bacteria	1932
303	Ga0207694_10081635	3300025924	Bacteria	2540
304	Ga0207650_10082327	3300025925	Bacteria	2443
305	Ga0207687_10252560	3300025927	Bacteria	1402
306	Ga0207669_10016207	3300025937	Bacteria	3781
307	Ga0207669_10117072	3300025937	Bacteria	1800
308	Ga0207669_10191291	3300025937	Bacteria	1476
309	Ga0207704_10207739	3300025938	Bacteria	1438
310	Ga0207665_10120201	3300025939	Bacteria	1855
311	Ga0207691_10151262	3300025940	Bacteria	2041
312	Ga0207691_10163496	3300025940	Bacteria	1951
313	Ga0207711_10041196	3300025941	Bacteria	3932
314	Ga0207689_10021634	3300025942	Bacteria	5408
315	Ga0207667_10134541	3300025949	Bacteria	2546
316	Ga0207712_10109830	3300025961	Bacteria	2066
317	Ga0207712_10351818	3300025961	Bacteria	1225
318	Ga0207668_10339729	3300025972	Bacteria	1252
319	Ga0207639_10078250	3300026041	Bacteria	2610
320	Ga0207639_10099348	3300026041	Bacteria	2348
321	Ga0207678_10118061	3300026067	Bacteria	2264
322	Ga0207678_10453947	3300026067	Bacteria	1114
323	Ga0207708_10161214	3300026075	Bacteria	1771
324	Ga0207702_10035796	3300026078	Bacteria	4151
325	Ga0207648_10039191	3300026089	Bacteria	4166
326	Ga0207648_10096649	3300026089	Bacteria	2585
327	Ga0207648_10291852	3300026089	Bacteria	1460
328	Ga0207674_10522641	3300026116	Bacteria	1146
329	Ga0207675_100043535	3300026118	Bacteria	4192
330	Ga0207675_100277694	3300026118	Bacteria	1627
331	Ga0207698_10068317	3300026142	Bacteria	2806
332	Ga0209281_1001101	3300027111	Bacteria	19712
333	Ga0209281_1001121	3300027111	Bacteria	19243
334	Ga0209371_1001144	3300027312	Bacteria	19422
335	Ga0209371_1008348	3300027312	Bacteria	3456
336	Ga0209179_1001475	3300027512	Bacteria	2895
337	Ga0209282_1000054	3300027666	Bacteria	101427
338	Ga0209282_1021670	3300027666	Bacteria	4060
339	Ga0209813_10052872	3300027866	Bacteria	1275
340	Ga0207428_10170923	3300027907	Bacteria	1646
341	Ga0268266_10124377	3300028379	Bacteria	2299
342	Ga0268266_10222683	3300028379	Bacteria	1735
343	Ga0268266_10405774	3300028379	Bacteria	1289
344	Ga0268264_10000050	3300028381	Bacteria	323697
345	Ga0268264_10192216	3300028381	Bacteria	1862
346	Ga0268264_10579533	3300028381	Bacteria	1104
347	Ga0265326_10001007	3300028558	Bacteria	10104
348	Ga0265319_1002047	3300028563	Bacteria	11343
349	Ga0265334_10001575	3300028573	Bacteria	10985
350	Ga0265318_10001829	3300028577	Bacteria	12050
351	Ga0265323_10000558	3300028653	Bacteria	20601
352	Ga0265336_10000168	3300028666	Bacteria	45878
353	Ga0307515_10000569	3300028794	Bacteria	87068
354	Ga0307515_10002598	3300028794	Bacteria	38928
355	Ga0307515_10132913	3300028794	Bacteria	2726
356	Ga0307515_10140200	3300028794	Bacteria	2599
357	Ga0265338_10000318	3300028800	Bacteria	87296
358	Ga0265324_10002656	3300029957	Bacteria	8946
359	Ga0268256_1000978	3300030500	Bacteria	19422
360	Ga0268256_1004043	3300030500	Bacteria	6301
361	Ga0307511_10053472	3300030521	Bacteria	3200
362	Ga0307511_10136759	3300030521	Bacteria	1456
363	Ga0316181_1102431	3300030744	Bacteria	1253
364	Ga0265331_10033146	3300031250	Bacteria	2555
365	Ga0265331_10104894	3300031250	Bacteria	1299
366	Ga0265327_10119320	3300031251	Bacteria	1252
367	Ga0307513_10006680	3300031456	Bacteria	15048
368	Ga0307513_10073589	3300031456	Bacteria	3557
369	Ga0307408_100566936	3300031548	Bacteria	1004
370	Ga0307508_10000199	3300031616	Bacteria	72296
371	Ga0307508_10256949	3300031616	Bacteria	1342
372	Ga0265314_10021788	3300031711	Bacteria	4920
373	Ga0316576_10038517	3300031727	Bacteria	3429
374	Ga0307516_10002704	3300031730	Bacteria	23386
375	Ga0307516_10037642	3300031730	Bacteria	4834
376	Ga0307516_10136021	3300031730	Bacteria	2232
377	Ga0307405_10025534	3300031731	Bacteria	3394
378	Ga0307410_10354384	3300031852	Bacteria	1173
379	Ga0307407_10268805	3300031903	Bacteria	1176
380	Ga0307412_10002486	3300031911	Bacteria	10262
381	Ga0315914_1000013	3300031967	Bacteria	133640
382	Ga0307414_10130890	3300032004	Unclassified	1947
383	Ga0307414_10154144	3300032004	Bacteria	1816
384	Ga0307411_10019865	3300032005	Bacteria	3892
385	Ga0307510_10000403	3300033180	Bacteria	41043
386	Ga0315913_1000097	3300033430	Bacteria	51051
387	Ga0315915_1000001	3300033464	Bacteria	481518
388	Ga0373923_0160127	3300035111	Bacteria	1027
389	Ga0373936_0025121	3300035113	Bacteria	2328
390	Ga0373939_0090162	3300035114	Bacteria	1035
391	Ga0373960_0025413	3300035121	Bacteria	1610
392	Ga0373943_0028308	3300035170	Bacteria	2640
393	Ga0373931_0000221	3300035691	Bacteria	24293
394	Ga0373935_0072091	3300035692	Bacteria	2230
395	Ga0373927_0000055	3300035695	Bacteria	81098
396	Ga0373927_0055787	3300035695	Bacteria	2554
397	Ga0373927_0074288	3300035695	Bacteria	2201
398	Ga0372808_000221	3300036459	Bacteria	3698
399	Ga0316582_0015018	3300036647	Bacteria	4413
400	Ga0316582_0215490	3300036647	Bacteria	1312
401	Ga0316584_0030616	3300036712	Bacteria	3975
402	Ga0316584_0140521	3300036712	Bacteria	1801
403	Ga0373925_0020042	3300037068	Bacteria	4866
404	Ga0395905_0000130	3300037471	Bacteria	123719
405	Ga0395905_0216461	3300037471	Bacteria	1793
406	Ga0395905_0266143	3300037471	Bacteria	1600
407	Ga0436364_0503752	3300037853	Bacteria	2673
408	Ga0395901_0002399	3300038443	Bacteria	19045
409	Ga0400483_010277	3300039062	Bacteria	1264
410	Ga0436365_1151503	3300039437	Bacteria	7638
411	Ga0436360_0308336	3300039438	Bacteria	1045
412	Ga0436361_0364845	3300039447	Bacteria	2640
413	Ga0436361_0957424	3300039447	Bacteria	3196
414	Ga0436361_1094242	3300039447	Bacteria	1031
415	Ga0436362_0911672	3300039453	Bacteria	2727
416	Ga0439436_0003987	3300041404	Bacteria	4526
417	Ga0439465_0009859	3300041413	Bacteria	3008
418	Ga0451798_0815533	3300041458	Bacteria	3758
419	Ga0451833_1077262	3300041491	Unclassified	1337
420	Ga0451835_1216947	3300041492	Bacteria	1587
421	Ga0451839_0890023	3300041496	Bacteria	1714
422	Ga0451841_0731336	3300041498	Bacteria	10317
423	Ga0451847_0318036	3300041503	Bacteria	2748
424	Ga0451848_02693	3300041504	Bacteria	2164
425	Ga0451849_0204578	3300041505	Bacteria	5683
426	Ga0451849_1026049	3300041505	Bacteria	1016
427	Ga0451851_0020457	3300041507	Bacteria	1828
428	Ga0451843_0149897	3300041509	Bacteria	1686
429	Ga0451854_00651	3300041510	Bacteria	2923
430	Ga0451855_0842450	3300041511	Bacteria	2022
431	Ga0451853_0993938	3300041512	Bacteria	1778
432	Ga0451853_1862219	3300041512	Bacteria	2724
433	Ga0439431_0024822	3300041997	Bacteria	1461
434	Ga0439449_0007016	3300042007	Bacteria	4291
435	Ga0439462_0018013	3300042015	Bacteria	1833
436	Ga0439434_0008118	3300042435	Bacteria	3078
437	Ga0450918_001395	3300042531	Bacteria	4822
438	Ga0451577_0001192	3300042876	Bacteria	36448
439	Ga0439440_0051669	3300042993	Bacteria	1029
440	Ga0466966_0118019	3300044684	Bacteria	1632
441	Ga0466961_0204005	3300044693	Bacteria	1222
442	Ga0453684_0001264	3300044712	Bacteria	76025
443	Ga0466968_0020639	3300044735	Bacteria	2661
444	Ga0451576_0002274	3300045051	Bacteria	29318
445	Ga0451576_0179735	3300045051	Bacteria	2209
446	Ga0451576_0504577	3300045051	Bacteria	1271
447	Ga0495627_049537	3300046453	Bacteria	1268
448	Ga0495590_0007845	3300046457	Bacteria	4097
449	Ga0495629_0023093	3300046459	Bacteria	4432
450	Ga0495629_0134240	3300046459	Bacteria	1723
451	Ga0495638_0009494	3300046460	Bacteria	6822
452	Ga0495638_0010819	3300046460	Bacteria	6308
453	Ga0495638_0013734	3300046460	Bacteria	5502
454	Ga0495651_0078574	3300046462	Bacteria	2496
455	Ga0495580_0145772	3300046472	Bacteria	1641
456	Ga0495605_0009156	3300046474	Bacteria	5570
457	Ga0495605_0009836	3300046474	Bacteria	5364
458	Ga0495639_0026397	3300046475	Bacteria	2567
459	Ga0495639_0042970	3300046475	Bacteria	2040
460	Ga0495662_0033627	3300046476	Bacteria	2477
461	Ga0495664_0165499	3300046477	Bacteria	1342
462	Ga0495584_0063507	3300046491	Bacteria	1856
463	Ga0495584_0142848	3300046491	Bacteria	1215
464	Ga0495585_0032615	3300046492	Bacteria	2950
465	Ga0495585_0121994	3300046492	Bacteria	1378
466	Ga0495585_0150217	3300046492	Bacteria	1215
467	Ga0495596_0109008	3300046500	Bacteria	1075
468	Ga0495607_0030397	3300046501	Bacteria	3317
469	Ga0495583_0011364	3300046506	Bacteria	5116
470	Ga0495583_0014128	3300046506	Bacteria	4418
471	Ga0495606_0002223	3300046507	Bacteria	23149
472	Ga0495606_0046547	3300046507	Bacteria	2866
473	Ga0495606_0120570	3300046507	Bacteria	1570
474	Ga0495610_0021848	3300046512	Bacteria	3511
475	Ga0495610_0035844	3300046512	Bacteria	2541
476	Ga0495616_0014226	3300046513	Bacteria	4463
477	Ga0495616_0039130	3300046513	Bacteria	2430
478	Ga0495620_0012741	3300046515	Bacteria	4326
479	Ga0495620_0022973	3300046515	Bacteria	2991
480	Ga0495620_0051399	3300046515	Bacteria	1754
481	Ga0495631_0010594	3300046518	Bacteria	4559
482	Ga0495632_0010710	3300046519	Bacteria	5404
483	Ga0495632_0021029	3300046519	Bacteria	3523
484	Ga0495632_0041687	3300046519	Bacteria	2305
485	Ga0495643_0015880	3300046522	Bacteria	4434
486	Ga0495643_0027080	3300046522	Bacteria	3226
487	Ga0495643_0048510	3300046522	Bacteria	2294
488	Ga0495643_0074119	3300046522	Bacteria	1783
489	Ga0495643_0130322	3300046522	Bacteria	1263
490	Ga0495648_0036942	3300046524	Bacteria	3144
491	Ga0495648_0097724	3300046524	Bacteria	1628
492	Ga0495654_0091985	3300046530	Bacteria	1406
493	Ga0495609_0037782	3300046538	Bacteria	2178
494	Ga0495597_0011373	3300046542	Bacteria	4316
495	Ga0495597_0019974	3300046542	Bacteria	3127
496	Ga0495597_0034962	3300046542	Bacteria	2269
497	Ga0495622_0014987	3300046557	Bacteria	3604
498	Ga0495622_0120165	3300046557	Bacteria	1200
499	Ga0495633_0011231	3300046558	Bacteria	4842
500	Ga0495633_0038748	3300046558	Bacteria	2275
501	Ga0495633_0039443	3300046558	Bacteria	2254
502	Ga0495633_0051187	3300046558	Bacteria	1946
503	Ga0495633_0072217	3300046558	Bacteria	1609
504	Ga0495668_0021461	3300046616	Bacteria	3702
505	Ga0495668_0033331	3300046616	Bacteria	2894
506	Ga0495668_0039193	3300046616	Bacteria	2646
507	Ga0495668_0057259	3300046616	Bacteria	2151
508	Ga0495625_0019055	3300046660	Bacteria	5339
509	Ga0495625_0024082	3300046660	Bacteria	4640
510	Ga0495625_0026988	3300046660	Bacteria	4330
511	Ga0495625_0103751	3300046660	Bacteria	1949
512	Ga0495625_0144715	3300046660	Bacteria	1601
513	Ga0495635_0097865	3300046663	Bacteria	2006
514	Ga0495588_0139412	3300046674	Bacteria	1280
515	Ga0495657_0086760	3300046675	Bacteria	2015
516	Ga0495657_0139585	3300046675	Bacteria	1511
517	Ga0495658_0043848	3300046683	Bacteria	2504
518	Ga0495624_0059359	3300046690	Bacteria	2401
519	Ga0495649_0014824	3300046694	Bacteria	4453
520	Ga0495589_0149880	3300046794	Bacteria	1114
521	Ga0495600_0172317	3300046809	Bacteria	1397
522	Ga0495660_0017304	3300046810	Bacteria	4151
523	Ga0495660_0024291	3300046810	Bacteria	3452
524	Ga0495581_0090768	3300047315	Bacteria	1772
525	Ga0495581_0141439	3300047315	Bacteria	1403
526	Ga0495604_0000886	3300047317	Bacteria	24880
527	Ga0495604_0156699	3300047317	Bacteria	1612
528	Ga0495672_0055833	3300047320	Bacteria	2302
529	Ga0495676_0249289	3300047321	Bacteria	1212
530	Ga0495683_0021267	3300047323	Bacteria	3344
531	Ga0495687_012435	3300047443	Bacteria	4501
532	Ga0495687_021942	3300047443	Bacteria	3076
533	Ga0495687_041417	3300047443	Bacteria	2021
534	Ga0495687_092179	3300047443	Bacteria	1157
535	Ga0495681_0058668	3300047470	Bacteria	1782
536	Ga0495686_0000301	3300047472	Bacteria	84924
537	Ga0495686_0023397	3300047472	Bacteria	4075
538	Ga0495686_0030457	3300047472	Bacteria	3504
539	Ga0495686_0041683	3300047472	Bacteria	2922
540	Ga0495686_0056257	3300047472	Bacteria	2458
541	Ga0495686_0150894	3300047472	Bacteria	1364
542	Ga0495615_0002843	3300048090	Bacteria	2826
543	Ga0495626_0023525	3300048091	Bacteria	3033
544	Ga0496100_0029263	3300048903	Bacteria	3405
545	Ga0496100_0207323	3300048903	Bacteria	1432
546	Ga0496101_0032258	3300048904	Bacteria	3685
547	Ga0496102_0003637	3300048905	Bacteria	13037
548	Ga0496103_0048096	3300048906	Bacteria	2635
549	Ga0496104_0139418	3300048907	Bacteria	2330
550	Ga0496105_0003045	3300048908	Bacteria	12322
551	Ga0496106_0001404	3300048909	Bacteria	18059
552	Ga0496106_0006866	3300048909	Bacteria	8425
553	Ga0496106_0014220	3300048909	Bacteria	5877
554	Ga0496108_0110211	3300048911	Bacteria	2353
555	Ga0496109_0006604	3300048912	Bacteria	9767
556	Ga0496110_0001819	3300048913	Bacteria	15723
557	Ga0496111_0025285	3300048914	Bacteria	4189
558	Ga0496111_0088444	3300048914	Bacteria	2269
559	Ga0496112_0003238	3300048915	Bacteria	13412
560	Ga0496112_0115630	3300048915	Bacteria	2653
561	Ga0496113_0012993	3300048916	Bacteria	5618
562	Ga0496113_0035262	3300048916	Bacteria	3658
563	Ga0496114_0081749	3300048917	Bacteria	2729
564	Ga0496115_0015090	3300048918	Bacteria	5854
565	Ga0496116_0011007	3300048919	Bacteria	7528
566	Ga0496116_0032696	3300048919	Bacteria	3703
567	Ga0496116_0078596	3300048919	Bacteria	2056
568	Ga0496116_0089817	3300048919	Bacteria	1872
569	Ga0496116_0170069	3300048919	Bacteria	1182
570	Ga0496117_0013389	3300048920	Bacteria	7158
571	Ga0496117_0021122	3300048920	Bacteria	5283
572	Ga0496117_0042492	3300048920	Bacteria	3316
573	Ga0496117_0231245	3300048920	Bacteria	1022
574	Ga0496118_0015132	3300048921	Bacteria	7163
575	Ga0496118_0027353	3300048921	Bacteria	4829
576	Ga0496118_0043988	3300048921	Bacteria	3502
577	Ga0496118_0136142	3300048921	Bacteria	1567
578	Ga0496119_0011770	3300048922	Bacteria	7192
579	Ga0496119_0036408	3300048922	Bacteria	3212
580	Ga0496119_0103674	3300048922	Bacteria	1593
581	Ga0496119_0198018	3300048922	Bacteria	1041
582	Ga0496120_0008307	3300048923	Bacteria	7565
583	Ga0496121_0003794	3300048924	Bacteria	21073
584	Ga0496121_0004275	3300048924	Bacteria	19384
585	Ga0496121_0005974	3300048924	Bacteria	15380
586	Ga0496121_0008110	3300048924	Bacteria	12491
587	Ga0496121_0013490	3300048924	Bacteria	8771
588	Ga0496121_0023302	3300048924	Bacteria	5968
589	Ga0496121_0107039	3300048924	Bacteria	2142
590	Ga0496121_0220036	3300048924	Bacteria	1338
591	Ga0496121_0230729	3300048924	Bacteria	1297
592	Ga0496122_0002690	3300048925	Bacteria	24724
593	Ga0496122_0013515	3300048925	Bacteria	7985
594	Ga0496122_0044513	3300048925	Bacteria	3461
595	Ga0496122_0062644	3300048925	Bacteria	2721
596	Ga0496122_0132578	3300048925	Bacteria	1579
597	Ga0496123_0000054	3300048926	Bacteria	234046
598	Ga0496123_0042198	3300048926	Bacteria	3152
599	Ga0496123_0064136	3300048926	Bacteria	2342
600	Ga0496123_0074983	3300048926	Bacteria	2090
601	Ga0496123_0088538	3300048926	Bacteria	1848
602	Ga0496124_0001147	3300048927	Bacteria	41534
603	Ga0496124_0017858	3300048927	Bacteria	6668
604	Ga0496124_0022174	3300048927	Bacteria	5829
605	Ga0496124_0025435	3300048927	Bacteria	5361
606	Ga0496124_0029566	3300048927	Bacteria	4879
607	Ga0496124_0127084	3300048927	Bacteria	2029
608	Ga0496124_0147032	3300048927	Bacteria	1853
609	Ga0496124_0248242	3300048927	Bacteria	1318
610	Ga0496124_0263634	3300048927	Bacteria	1266
611	Ga0496125_0019659	3300048928	Bacteria	6360
612	Ga0496125_0053604	3300048928	Bacteria	3304
613	Ga0496125_0112966	3300048928	Bacteria	1961
614	Ga0496125_0114094	3300048928	Bacteria	1947
615	Ga0496126_0000081	3300048929	Bacteria	218818
616	Ga0496126_0014738	3300048929	Bacteria	7888
617	Ga0496126_0018709	3300048929	Bacteria	6855
618	Ga0496126_0027219	3300048929	Bacteria	5465
619	Ga0496126_0074024	3300048929	Bacteria	3025
620	Ga0496126_0103562	3300048929	Bacteria	2487
621	Ga0496126_0109986	3300048929	Bacteria	2401
622	Ga0496126_0111105	3300048929	Bacteria	2387
623	Ga0496126_0128495	3300048929	Bacteria	2191
624	Ga0496126_0192716	3300048929	Bacteria	1725
625	Ga0496126_0451732	3300048929	Bacteria	1034
626	Ga0495678_027130	3300049459	Bacteria	2433
627	Ga0495678_068638	3300049459	Bacteria	1306
628	Ga0495682_0024585	3300049460	Bacteria	2245
629	Ga0501031_0024558	3300049568	Bacteria	3929
630	Ga0501032_0006279	3300049569	Bacteria	8753
631	Ga0501032_0013495	3300049569	Bacteria	5809
632	Ga0501032_0054621	3300049569	Bacteria	2688
633	Ga0501033_0005198	3300049570	Bacteria	10340
634	Ga0501033_0007763	3300049570	Bacteria	8313
635	Ga0501033_0013268	3300049570	Bacteria	6278
636	Ga0501033_0058135	3300049570	Bacteria	2857
637	Ga0501034_0004317	3300049571	Bacteria	15851
638	Ga0501034_0024242	3300049571	Bacteria	6170
639	Ga0501034_0112206	3300049571	Bacteria	2716
640	Ga0501034_0174558	3300049571	Bacteria	2115
641	Ga0501036_0001934	3300049572	Bacteria	16085
642	Ga0501036_0021763	3300049572	Bacteria	5390
643	Ga0501036_0028446	3300049572	Bacteria	4723
644	Ga0501036_0036579	3300049572	Bacteria	4155
645	Ga0501036_0294473	3300049572	Bacteria	1357
646	Ga0501037_0000616	3300049573	Bacteria	27595
647	Ga0501037_0034094	3300049573	Bacteria	3758
648	Ga0501037_0045952	3300049573	Bacteria	3204
649	Ga0501037_0048112	3300049573	Bacteria	3125
650	Ga0501037_0174246	3300049573	Bacteria	1528
651	Ga0501038_0004291	3300049574	Bacteria	13257
652	Ga0501038_0014087	3300049574	Bacteria	7284
653	Ga0501038_0064206	3300049574	Bacteria	3132
654	Ga0501038_0069348	3300049574	Bacteria	2995
655	Ga0501038_0100997	3300049574	Bacteria	2402
656	Ga0501039_0001064	3300049575	Bacteria	20105
657	Ga0501039_0016772	3300049575	Bacteria	5613
658	Ga0501039_0031181	3300049575	Bacteria	4109
659	Ga0501041_0294246	3300049577	Bacteria	1023
660	Ga0501043_0000107	3300049579	Bacteria	77469
661	Ga0501043_0000437	3300049579	Bacteria	37578
662	Ga0501043_0022247	3300049579	Bacteria	4973
663	Ga0501043_0033981	3300049579	Bacteria	4011
664	Ga0501043_0071488	3300049579	Bacteria	2725
665	Ga0501043_0169439	3300049579	Bacteria	1704
666	Ga0501043_0404937	3300049579	Bacteria	1030
667	Ga0501046_0000935	3300049580	Bacteria	28596
668	Ga0501046_0001272	3300049580	Bacteria	24426
669	Ga0501046_0025745	3300049580	Bacteria	4811
670	Ga0501047_0001090	3300049581	Bacteria	27064
671	Ga0501047_0002658	3300049581	Bacteria	17000
672	Ga0501047_0016172	3300049581	Bacteria	7118
673	Ga0501047_0018682	3300049581	Bacteria	6648
674	Ga0501047_0048280	3300049581	Bacteria	4110
675	Ga0501047_0050894	3300049581	Bacteria	4000
676	Ga0501047_0284382	3300049581	Bacteria	1498
677	Ga0501047_0338205	3300049581	Bacteria	1343
678	Ga0501048_0001620	3300049582	Bacteria	17135
679	Ga0501048_0023225	3300049582	Bacteria	4535
680	Ga0501048_0078251	3300049582	Bacteria	2333
681	Ga0501048_0122796	3300049582	Bacteria	1835
682	Ga0501048_0415899	3300049582	Bacteria	962
683	Ga0501067_0005687	3300049583	Bacteria	6922
684	Ga0501067_0007257	3300049583	Bacteria	6154
685	Ga0501067_0032314	3300049583	Bacteria	2905
686	Ga0501067_0032615	3300049583	Bacteria	2891
687	Ga0501068_0002694	3300049584	Bacteria	9417
688	Ga0501068_0013753	3300049584	Bacteria	4611
689	Ga0501068_0015059	3300049584	Bacteria	4434
690	Ga0501068_0020203	3300049584	Bacteria	3878
691	Ga0501069_0000039	3300049585	Bacteria	82361
692	Ga0501069_0012395	3300049585	Bacteria	4531
693	Ga0501069_0017259	3300049585	Bacteria	3883
694	Ga0501069_0138095	3300049585	Bacteria	1397
695	Ga0501070_0000132	3300049586	Bacteria	67092
696	Ga0501070_0000299	3300049586	Bacteria	46014
697	Ga0501070_0001955	3300049586	Bacteria	18181
698	Ga0501070_0002117	3300049586	Bacteria	17410
699	Ga0501070_0014323	3300049586	Bacteria	6675
700	Ga0501070_0020275	3300049586	Bacteria	5576
701	Ga0501070_0228472	3300049586	Bacteria	1525
702	Ga0501071_0017388	3300049587	Bacteria	4959
703	Ga0501072_0051877	3300049588	Bacteria	3229
704	Ga0501072_0075205	3300049588	Bacteria	2671
705	Ga0501073_0001958	3300049589	Bacteria	15350
706	Ga0501073_0028377	3300049589	Bacteria	3999
707	Ga0501073_0182954	3300049589	Bacteria	1450
708	Ga0501074_0000740	3300049590	Bacteria	20523
709	Ga0501074_0001123	3300049590	Bacteria	17513
710	Ga0501238_015232	3300049671	Bacteria	1059
711	Ga0501079_0430781	3300049741	Bacteria	1035
712	Ga0501080_0000293	3300049742	Bacteria	37962
713	Ga0501080_0001676	3300049742	Bacteria	18865
714	Ga0501080_0003023	3300049742	Bacteria	14830
715	Ga0501080_0033974	3300049742	Bacteria	4761
716	Ga0501080_0044767	3300049742	Bacteria	4119
717	Ga0501080_0072137	3300049742	Bacteria	3213
718	Ga0501080_0185789	3300049742	Bacteria	1911
719	Ga0501083_0001983	3300049744	Bacteria	14079
720	Ga0501083_0002416	3300049744	Bacteria	12766
721	Ga0501083_0012147	3300049744	Bacteria	6028
722	Ga0501083_0023073	3300049744	Bacteria	4318
723	Ga0501083_0032153	3300049744	Bacteria	3599
724	Ga0501241_015744	3300049758	Bacteria	1377
725	Ga0501280_005926	3300049776	Bacteria	1736
726	Ga0501035_0000055	3300049822	Bacteria	139471
727	Ga0501035_0000807	3300049822	Bacteria	33393
728	Ga0501035_0004901	3300049822	Bacteria	12699
729	Ga0501035_0011374	3300049822	Bacteria	8249
730	Ga0501035_0014088	3300049822	Bacteria	7376
731	Ga0501035_0019785	3300049822	Bacteria	6185
732	Ga0501035_0051897	3300049822	Bacteria	3670
733	Ga0501035_0072490	3300049822	Bacteria	3048
734	Ga0501044_0000071	3300049823	Bacteria	124531
735	Ga0501044_0009546	3300049823	Bacteria	10562
736	Ga0501044_0023294	3300049823	Bacteria	6587
737	Ga0501044_0060853	3300049823	Bacteria	3864
738	Ga0501044_0069729	3300049823	Bacteria	3578
739	Ga0501044_0090336	3300049823	Bacteria	3090
740	Ga0501044_0092873	3300049823	Bacteria	3043
741	Ga0501044_0101208	3300049823	Bacteria	2899
742	nmdc:mga03683_35965_c1	3300050489	Bacteria	2012
743	nmdc:mga03683_40167_c1	3300050489	Bacteria	1918
744	nmdc:mga03n38_33261_c1	3300050490	Bacteria	2192
745	nmdc:mga00v17_112919_c1	3300050491	Bacteria	1725
746	nmdc:mga00v17_129309_c1	3300050491	Bacteria	1613
747	nmdc:mga0yw44_126470_c1	3300050492	Bacteria	1651
748	nmdc:mga0yw44_25445_c1	3300050492	Bacteria	3365
749	nmdc:mga0yw44_63178_c1	3300050492	Bacteria	2276
750	nmdc:mga0yw44_64429_c1	3300050492	Bacteria	2256
751	nmdc:mga0yw44_7481_c1	3300050492	Bacteria	5379
752	nmdc:mga0k408_221248_c1	3300050493	Bacteria	1130
753	nmdc:mga0k408_221672_c1	3300050493	Bacteria	1129
754	nmdc:mga0k408_24176_c1	3300050493	Bacteria	3433
755	nmdc:mga06z11_61262_c1	3300050494	Bacteria	1962
756	nmdc:mga06z11_75728_c1	3300050494	Bacteria	1793
757	nmdc:mga06z11_90677_c1	3300050494	Bacteria	1658
758	nmdc:mga04h51_96604_c1	3300050495	Bacteria	1071
759	nmdc:mga07m45_39259_c1	3300050496	Bacteria	2645
760	nmdc:mga07m45_93979_c1	3300050496	Bacteria	1719
761	nmdc:mga05p37_523187_c1	3300050507	Bacteria	1356
762	nmdc:mga05p37_563061_c1	3300050507	Bacteria	1294
763	nmdc:mga0qj67_287882_c1	3300050509	Bacteria	1331
764	nmdc:mga0sz30_14806_c1	3300050516	Bacteria	3077
765	nmdc:mga0sz30_16549_c2	3300050516	Bacteria	2465
766	nmdc:mga0sz30_37124_c1	3300050516	Bacteria	2038
767	Ga0500610_0033228	3300053079	Bacteria	2631
768	Ga0500610_0085782	3300053079	Bacteria	1639
769	Ga0500635_0001263	3300053080	Bacteria	6038
770	Ga0495655_0014458	3300053083	Bacteria	1655
771	Ga0495619_0128060	3300053085	Bacteria	1743
772	Ga0500643_034012	3300053087	Bacteria	1538
773	Ga0500644_0029809	3300053088	Bacteria	1720
774	Ga0500646_0059021	3300053090	Bacteria	1124
775	Ga0500566_0007888	3300053094	Bacteria	6303
776	Ga0500648_067214	3300053097	Bacteria	2029
777	Ga0500555_003111	3300053103	Bacteria	4735
778	Ga0500560_011220	3300053107	Bacteria	2278
779	Ga0500569_031723	3300053109	Bacteria	1488
780	Ga0500572_068582	3300053111	Bacteria	1092
781	Ga0500595_000266	3300053119	Bacteria	34654
782	Ga0500595_008461	3300053119	Bacteria	4199
783	Ga0500595_023903	3300053119	Bacteria	2141
784	Ga0500595_059930	3300053119	Bacteria	1153
785	Ga0500607_101943	3300053121	Bacteria	1424
786	Ga0500607_135057	3300053121	Bacteria	1170
787	Ga0500618_021382	3300053125	Bacteria	1579
788	Ga0500642_0044937	3300053130	Bacteria	1925
789	Ga0500655_020370	3300053133	Bacteria	1238
790	Ga0500658_0035897	3300053134	Bacteria	1964
791	Ga0500559_0002203	3300053136	Bacteria	10300
792	Ga0500559_0007890	3300053136	Bacteria	4697
793	Ga0500561_0008757	3300053137	Bacteria	2028
794	Ga0500568_0000156	3300053139	Bacteria	59014
795	Ga0500568_0042209	3300053139	Bacteria	1828
796	Ga0500568_0082455	3300053139	Bacteria	1220
797	Ga0500573_0033993	3300053140	Bacteria	2940
798	Ga0500590_006071	3300053148	Bacteria	5858
799	Ga0500590_075323	3300053148	Bacteria	1669
800	Ga0500604_0033665	3300053151	Bacteria	1517
801	Ga0500616_0000245	3300053153	Bacteria	84999
802	Ga0500616_0000884	3300053153	Bacteria	33039
803	Ga0500616_0009830	3300053153	Bacteria	5767
804	Ga0500616_0044974	3300053153	Bacteria	2354
805	Ga0500620_000234	3300053155	Bacteria	11002
806	Ga0500622_0004653	3300053156	Bacteria	8498
807	Ga0500622_0005524	3300053156	Bacteria	7568
808	Ga0500624_002493	3300053157	Bacteria	2491
809	Ga0500627_0065472	3300053158	Bacteria	1603
810	Ga0500630_137071	3300053159	Bacteria	1059
811	Ga0500638_030414	3300053162	Bacteria	2600
812	Ga0500638_120571	3300053162	Bacteria	1201
813	Ga0500639_004632	3300053163	Bacteria	6991
814	Ga0500636_0000009	3300053177	Bacteria	155504
815	Ga0500636_0027700	3300053177	Bacteria	3346
816	Ga0500636_0075824	3300053177	Bacteria	1945
817	Ga0500637_0039571	3300053178	Bacteria	2660
818	Ga0500576_042052	3300053725	Bacteria	2054
819	Ga0500611_026737	3300053727	Bacteria	1156
820	Ga0500611_037468	3300053727	Bacteria	1044
821	Ga0500645_018345	3300053730	Bacteria	2186
822	Ga0500609_010534	3300053731	Bacteria	1245
823	Ga0500596_000883	3300053735	Bacteria	5979
824	Ga0501084_0000766	3300054114	Bacteria	24488
825	Ga0501084_0102458	3300054114	Bacteria	2404
826	Ga0500661_004850	3300055283	Bacteria	2516
827	Ga0501082_0023367	3300060353	Bacteria	5332
828	Ga0501082_0026105	3300060353	Bacteria	5034
829	Ga0501082_0286274	3300060353	Bacteria	1434

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300009148	Ga0105243_10101857	Ga0105243_101018574	243
2	3300009177	Ga0105248_10015246	Ga0105248_100152468	243
3	3300046558	Ga0495633_0011231	Ga0495633_0011231_4043_4831	261
4	3300041505	Ga0451849_1026049	Ga0451849_1026049_47_853	267
5	iso_pu_bacteria	2924710171	2924714175	272
6	iso_pu_bacteria	2970619444	2970621792	273
7	3300044735	Ga0466968_0020639	Ga0466968_0020639_313_1140	275
8	iso_pu_bacteria	2979772303	2979779580	275
9	iso_pu_bacteria	2906427513	2906427563	278
10	iso_pu_bacteria	2965032056	2965039298	278
11	3300048922	Ga0496119_0198018	Ga0496119_0198018_176_1018	279
12	iso_pu_bacteria	2977915119	2977916444	280
13	iso_pu_bacteria	2516653046	2516892522	290
14	iso_pu_bacteria	2551306086	2551691740	290
15	iso_pu_bacteria	2551306089	2551714832	290
16	iso_pu_bacteria	2551306091	2551728440	290
17	iso_pu_bacteria	2551306092	2551734725	290
18	iso_pu_bacteria	2855825444	2855831592	290
19	iso_pu_bacteria	2889010040	2889013672	290
20	iso_pu_bacteria	2916000859	2916002943	290
21	iso_pu_bacteria	2916014648	2916018807	290
22	iso_pu_bacteria	2916021584	2916026415	290
23	iso_pu_bacteria	2916035215	2916041628	290
24	iso_pu_bacteria	2921208531	2921209563	290
25	iso_pu_bacteria	2921237296	2921237906	290
26	iso_pu_bacteria	2921244191	2921248040	290
27	iso_pu_bacteria	2921282425	2921285941	290
28	iso_pu_bacteria	2921296804	2921303810	290
29	iso_pu_bacteria	2924179722	2924184617	290
30	iso_pu_bacteria	2924193448	2924194860	290
31	iso_pu_bacteria	2924207177	2924213707	290
32	iso_pu_bacteria	2924228884	2924233710	290
33	iso_pu_bacteria	2937002841	2937008119	290
34	iso_pu_bacteria	2937009748	2937016113	290
35	iso_pu_bacteria	2937016420	2937019567	290
36	iso_pu_bacteria	2937071275	2937076520	290
37	iso_pu_bacteria	2937119839	2937125659	290
38	iso_pu_bacteria	2937126314	2937129936	290
39	iso_pu_bacteria	2957382221	2957385744	290
40	iso_pu_bacteria	2957402308	2957406473	290
41	iso_pu_bacteria	2957408893	2957413674	290
42	iso_pu_bacteria	2957415311	2957418200	290
43	iso_pu_bacteria	2957450854	2957453230	290
44	iso_pu_bacteria	2957457609	2957464230	290
45	iso_pu_bacteria	2957464669	2957468148	290
46	iso_pu_bacteria	2957491536	2957496706	290
47	iso_pu_bacteria	2960584000	2960584809	290
48	iso_pu_bacteria	2960597568	2960603526	290
49	iso_pu_bacteria	2960603979	2960608967	290
50	iso_pu_bacteria	2960667422	2960673516	290
51	iso_pu_bacteria	2960674078	2960677327	290
52	iso_pu_bacteria	2964621998	2964626416	290
53	iso_pu_bacteria	2964636051	2964641185	290
54	iso_pu_bacteria	2964643177	2964647032	290
55	iso_pu_bacteria	2964663802	2964670550	290
56	iso_pu_bacteria	2964670856	2964678035	290
57	iso_pu_bacteria	2964685014	2964685708	290
58	iso_pu_bacteria	2964691889	2964692412	290
59	iso_pu_bacteria	2964698721	2964703393	290
60	iso_pu_bacteria	2964705432	2964710588	290
61	iso_pu_bacteria	2964712639	2964717105	290
62	iso_pu_bacteria	2967671571	2967672253	290
63	iso_pu_bacteria	2967699805	2967702463	290
64	iso_pu_bacteria	2967742019	2967745192	290
65	iso_pu_bacteria	2967748971	2967755112	290
66	iso_pu_bacteria	2970061556	2970062560	290
67	iso_pu_bacteria	2970076120	2970079514	290
68	iso_pu_bacteria	2970088815	2970091771	290
69	iso_pu_bacteria	2970095765	2970097277	290
70	iso_pu_bacteria	2970164137	2970167574	290
71	iso_pu_bacteria	2970170962	2970177760	290
72	iso_pu_bacteria	2977523885	2977530189	290
73	iso_pu_bacteria	2977537788	2977541414	290
74	iso_pu_bacteria	2977565890	2977569796	290
75	iso_pu_bacteria	2987652177	2987658689	290
76	iso_pu_bacteria	648276728	648741471	290
77	3300037471	Ga0395905_0216461	Ga0395905_0216461_746_1621	291
78	3300046522	Ga0495643_0027080	Ga0495643_0027080_1637_2512	291
79	3300047472	Ga0495686_0030457	Ga0495686_0030457_585_1460	291
80	3300053727	Ga0500611_037468	Ga0500611_037468_128_1003	291
81	iso_pu_bacteria	2508501122	2509112828	291
82	iso_pu_bacteria	2509276019	2509374233	291
83	iso_pu_bacteria	2510065057	2510308703	291
84	iso_pu_bacteria	2511231052	2511501239	291
85	iso_pu_bacteria	2512047086	2512532666	291
86	iso_pu_bacteria	2512875026	2512972005	291
87	iso_pu_bacteria	2513237086	2513588054	291
88	iso_pu_bacteria	2513237089	2513607220	291
89	iso_pu_bacteria	2513237091	2513620923	291
90	iso_pu_bacteria	2513237140	2513886960	291
91	iso_pu_bacteria	2513237143	2513907194	291
92	iso_pu_bacteria	2513237156	2513988332	291
93	iso_pu_bacteria	2513237160	2514009045	291
94	iso_pu_bacteria	2515154107	2515613504	291
95	iso_pu_bacteria	2517487022	2517569335	291
96	iso_pu_bacteria	2524023207	2524454482	291
97	iso_pu_bacteria	2551306084	2551676566	291
98	iso_pu_bacteria	2551306085	2551689507	291
99	iso_pu_bacteria	2551306087	2551699350	291
100	iso_pu_bacteria	2551306090	2551719201	291
101	iso_pu_bacteria	2551306093	2551740570	291
102	iso_pu_bacteria	2558860100	2558863258	291
103	iso_pu_bacteria	2802428858	2802719348	291
104	iso_pu_bacteria	2802428859	2802723091	291
105	iso_pu_bacteria	2802428860	2802734883	291
106	iso_pu_bacteria	2802428861	2802741378	291
107	iso_pu_bacteria	2802428862	2802745077	291
108	iso_pu_bacteria	2802428863	2802751512	291
109	iso_pu_bacteria	2838074704	2838081144	291
110	iso_pu_bacteria	2850079185	2850080708	291
111	iso_pu_bacteria	2855839649	2855840710	291
112	iso_pu_bacteria	2858800743	2858801238	291
113	iso_pu_bacteria	2869278585	2869278927	291
114	iso_pu_bacteria	2894817345	2894819242	291
115	iso_pu_bacteria	2896384573	2896386861	291
116	iso_pu_bacteria	2915980308	2915985699	291
117	iso_pu_bacteria	2915986958	2915991770	291
118	iso_pu_bacteria	2915993759	2915994262	291
119	iso_pu_bacteria	2916007675	2916008321	291
120	iso_pu_bacteria	2916028427	2916028787	291
121	iso_pu_bacteria	2916041962	2916048641	291
122	iso_pu_bacteria	2916048683	2916054734	291
123	iso_pu_bacteria	2916055098	2916061382	291
124	iso_pu_bacteria	2916061851	2916065859	291
125	iso_pu_bacteria	2916068649	2916070042	291
126	iso_pu_bacteria	2916076590	2916078700	291
127	iso_pu_bacteria	2919679072	2919681719	291
128	iso_pu_bacteria	2920760137	2920765447	291
129	iso_pu_bacteria	2921201388	2921205000	291
130	iso_pu_bacteria	2921250672	2921256447	291
131	iso_pu_bacteria	2921257292	2921263936	291
132	iso_pu_bacteria	2921263974	2921270692	291
133	iso_pu_bacteria	2921289301	2921290221	291
134	iso_pu_bacteria	2924150972	2924151419	291
135	iso_pu_bacteria	2924158325	2924165017	291
136	iso_pu_bacteria	2924165586	2924166729	291
137	iso_pu_bacteria	2924172951	2924173387	291
138	iso_pu_bacteria	2924186466	2924187417	291
139	iso_pu_bacteria	2924214083	2924220250	291
140	iso_pu_bacteria	2924221636	2924222638	291
141	iso_pu_bacteria	2936996657	2937000837	291
142	iso_pu_bacteria	2937023124	2937028795	291
143	iso_pu_bacteria	2937029754	2937034954	291
144	iso_pu_bacteria	2937036028	2937040759	291
145	iso_pu_bacteria	2937042894	2937045346	291
146	iso_pu_bacteria	2937049772	2937050581	291
147	iso_pu_bacteria	2937056579	2937060836	291
148	iso_pu_bacteria	2937063883	2937069330	291
149	iso_pu_bacteria	2937078374	2937079376	291
150	iso_pu_bacteria	2937084907	2937088481	291
151	iso_pu_bacteria	2937091812	2937096864	291
152	iso_pu_bacteria	2937098957	2937104523	291
153	iso_pu_bacteria	2937106411	2937107772	291
154	iso_pu_bacteria	2937113482	2937118927	291
155	iso_pu_bacteria	2957375807	2957377163	291
156	iso_pu_bacteria	2957388812	2957388867	291
157	iso_pu_bacteria	2957395598	2957396208	291
158	iso_pu_bacteria	2957422303	2957425746	291
159	iso_pu_bacteria	2957430029	2957437112	291
160	iso_pu_bacteria	2957437181	2957440533	291
161	iso_pu_bacteria	2957443900	2957445095	291
162	iso_pu_bacteria	2957471148	2957473296	291
163	iso_pu_bacteria	2957478035	2957484382	291
164	iso_pu_bacteria	2957484790	2957485491	291
165	iso_pu_bacteria	2957498199	2957498754	291
166	iso_pu_bacteria	2957505466	2957506278	291
167	iso_pu_bacteria	2958041894	2958058366	291
168	iso_pu_bacteria	2960591022	2960593492	291
169	iso_pu_bacteria	2960610863	2960617117	291
170	iso_pu_bacteria	2960617483	2960623317	291
171	iso_pu_bacteria	2960624210	2960624987	291
172	iso_pu_bacteria	2960631154	2960633884	291
173	iso_pu_bacteria	2960637947	2960638743	291
174	iso_pu_bacteria	2960645483	2960646255	291
175	iso_pu_bacteria	2960652885	2960656330	291
176	iso_pu_bacteria	2960660292	2960667055	291
177	iso_pu_bacteria	2960680706	2960685079	291
178	iso_pu_bacteria	2960687367	2960693867	291
179	iso_pu_bacteria	2960693952	2960694292	291
180	iso_pu_bacteria	2964607997	2964611311	291
181	iso_pu_bacteria	2964615318	2964621947	291
182	iso_pu_bacteria	2964628898	2964629633	291
183	iso_pu_bacteria	2964649959	2964652814	291
184	iso_pu_bacteria	2964656573	2964661980	291
185	iso_pu_bacteria	2964678106	2964679068	291
186	iso_pu_bacteria	2964719344	2964720223	291
187	iso_pu_bacteria	2967664464	2967666178	291
188	iso_pu_bacteria	2967678726	2967683441	291
189	iso_pu_bacteria	2967686174	2967688604	291
190	iso_pu_bacteria	2967693043	2967694529	291
191	iso_pu_bacteria	2967706974	2967708794	291
192	iso_pu_bacteria	2967714385	2967718810	291
193	iso_pu_bacteria	2967721400	2967726204	291
194	iso_pu_bacteria	2967728569	2967729683	291
195	iso_pu_bacteria	2967735183	2967739576	291
196	iso_pu_bacteria	2967755722	2967761986	291
197	iso_pu_bacteria	2967762386	2967766772	291
198	iso_pu_bacteria	2967775926	2967779681	291
199	iso_pu_bacteria	2970019648	2970022717	291
200	iso_pu_bacteria	2970026789	2970027192	291
201	iso_pu_bacteria	2970033650	2970036719	291
202	iso_pu_bacteria	2970040964	2970047703	291
203	iso_pu_bacteria	2970047711	2970051762	291
204	iso_pu_bacteria	2970054988	2970060965	291
205	iso_pu_bacteria	2970068827	2970069337	291
206	iso_pu_bacteria	2970082768	2970086645	291
207	iso_pu_bacteria	2970102677	2970108585	291
208	iso_pu_bacteria	2970109326	2970115884	291
209	iso_pu_bacteria	2970116247	2970120749	291
210	iso_pu_bacteria	2970122695	2970123201	291
211	iso_pu_bacteria	2970129317	2970129781	291
212	iso_pu_bacteria	2970136068	2970137087	291
213	iso_pu_bacteria	2970143518	2970149779	291
214	iso_pu_bacteria	2970149975	2970156654	291
215	iso_pu_bacteria	2970156795	2970157852	291
216	iso_pu_bacteria	2970177841	2970178699	291
217	iso_pu_bacteria	2970184632	2970190714	291
218	iso_pu_bacteria	2970191845	2970198872	291
219	iso_pu_bacteria	2970593180	2970593521	291
220	iso_pu_bacteria	2977516862	2977520534	291
221	iso_pu_bacteria	2977530762	2977532313	291
222	iso_pu_bacteria	2977544691	2977551453	291
223	iso_pu_bacteria	2977551784	2977557532	291
224	iso_pu_bacteria	2977572785	2977579473	291
225	iso_pu_bacteria	2977579622	2977583910	291
226	iso_pu_bacteria	8003992118	8003993209	291
227	iso_pu_bacteria	8003999396	8004000466	291
228	3300005434	Ga0070709_10004617	Ga0070709_100046174	292
229	3300005436	Ga0070713_100007893	Ga0070713_1000078933	292
230	3300036647	Ga0316582_0015018	Ga0316582_0015018_205_1086	292
231	3300045051	Ga0451576_0002274	Ga0451576_0002274_12968_13852	292
232	3300048915	Ga0496112_0115630	Ga0496112_0115630_391_1272	292
233	iso_pu_bacteria	2512875016	2512931563	292
234	iso_pu_bacteria	2512875024	2512959397	292
235	iso_pu_bacteria	2513237305	2514419682	292
236	iso_pu_bacteria	2523231067	2523468303	292
237	iso_pu_bacteria	2721755686	2723575314	292
238	iso_pu_bacteria	2738543031	2739348106	292
239	iso_pu_bacteria	2874123672	2874130541	292
240	iso_pu_bacteria	2876363079	2876368545	292
241	iso_pu_bacteria	2891048133	2891048611	292
242	iso_pu_bacteria	2899803654	2899806446	292
243	iso_pu_bacteria	2903448605	2903451249	292
244	iso_pu_bacteria	2903521522	2903527544	292
245	iso_pu_bacteria	2903528002	2903533998	292
246	iso_pu_bacteria	2924762789	2924765048	292
247	iso_pu_bacteria	2937822353	2937824380	292
248	iso_pu_bacteria	2937848649	2937851885	292
249	iso_pu_bacteria	2963644680	2963647648	292
250	iso_pu_bacteria	2968083720	2968090279	292
251	iso_pu_bacteria	2977922695	2977924157	292
252	iso_pu_bacteria	2977986579	2977991741	292
253	iso_pu_bacteria	2987666974	2987667954	292
254	iso_pu_bacteria	2995392953	2995394296	292
255	iso_pu_bacteria	3000135777	3000140738	292
256	iso_pu_bacteria	3004211236	3004215892	292
257	iso_pu_bacteria	3004218560	3004221942	292
258	iso_pu_bacteria	637000159	637074662	292
259	3300005334	Ga0068869_100068930	Ga0068869_1000689302	293
260	3300005347	Ga0070668_100226837	Ga0070668_1002268372	293
261	3300005548	Ga0070665_100093846	Ga0070665_1000938463	293
262	3300025937	Ga0207669_10117072	Ga0207669_101170723	293
263	3300025942	Ga0207689_10021634	Ga0207689_100216345	293
264	3300025972	Ga0207668_10339729	Ga0207668_103397291	293
265	3300026089	Ga0207648_10291852	Ga0207648_102918523	293
266	3300037471	Ga0395905_0000130	Ga0395905_0000130_97896_98825	293
267	3300044693	Ga0466961_0204005	Ga0466961_0204005_183_1073	293
268	iso_pu_bacteria	2503198000	2503201467	293
269	iso_pu_bacteria	2508501123	2509113071	293
270	iso_pu_bacteria	2509276018	2509367892	293
271	iso_pu_bacteria	2509276021	2509387469	293
272	iso_pu_bacteria	2509276022	2509396244	293
273	iso_pu_bacteria	2509276033	2509442859	293
274	iso_pu_bacteria	2510065019	2510132518	293
275	iso_pu_bacteria	2510461069	2510839948	293
276	iso_pu_bacteria	2510461076	2510893153	293
277	iso_pu_bacteria	2510461076	2510898887	293
278	iso_pu_bacteria	2510917022	2511136940	293
279	iso_pu_bacteria	2510917026	2511172655	293
280	iso_pu_bacteria	2510917028	2511183268	293
281	iso_pu_bacteria	2510917030	2511195767	293
282	iso_pu_bacteria	2513237084	2513574229	293
283	iso_pu_bacteria	2513237085	2513581622	293
284	iso_pu_bacteria	2513237088	2513600686	293
285	iso_pu_bacteria	2513237093	2513636523	293
286	iso_pu_bacteria	2513237093	2513636601	293
287	iso_pu_bacteria	2513237103	2513711203	293
288	iso_pu_bacteria	2513237103	2513714125	293
289	iso_pu_bacteria	2513237138	2513871055	293
290	iso_pu_bacteria	2513237146	2513930394	293
291	iso_pu_bacteria	2513237159	2514000960	293
292	iso_pu_bacteria	2513237162	2514024836	293
293	iso_pu_bacteria	2513237162	2514024842	293
294	iso_pu_bacteria	2513237164	2514033547	293
295	iso_pu_bacteria	2515075009	2515111508	293
296	iso_pu_bacteria	2515154113	2515638910	293
297	iso_pu_bacteria	2515154113	2515639114	293
298	iso_pu_bacteria	2515154114	2515646847	293
299	iso_pu_bacteria	2515154114	2515647025	293
300	iso_pu_bacteria	2515154116	2515661889	293
301	iso_pu_bacteria	2515154116	2515661928	293
302	iso_pu_bacteria	2515154134	2515744622	293
303	iso_pu_bacteria	2516143018	2516209119	293
304	iso_pu_bacteria	2516653077	2517040154	293
305	iso_pu_bacteria	2516653077	2517041103	293
306	iso_pu_bacteria	2516653085	2517075696	293
307	iso_pu_bacteria	2517093000	2517094285	293
308	iso_pu_bacteria	2517093000	2517099706	293
309	iso_pu_bacteria	2517287029	2517406087	293
310	iso_pu_bacteria	2519899620	2520375145	293
311	iso_pu_bacteria	2524023209	2524463171	293
312	iso_pu_bacteria	2529292951	2530643671	293
313	iso_pu_bacteria	2534681796	2535515838	293
314	iso_pu_bacteria	2582581283	2585169852	293
315	iso_pu_bacteria	2582581294	2585205954	293
316	iso_pu_bacteria	2582581298	2585227522	293
317	iso_pu_bacteria	2582581299	2585233887	293
318	iso_pu_bacteria	2582581304	2585259639	293
319	iso_pu_bacteria	2582581306	2585264445	293
320	iso_pu_bacteria	2582581307	2585273034	293
321	iso_pu_bacteria	2582581308	2585283688	293
322	iso_pu_bacteria	2582581315	2585327610	293
323	iso_pu_bacteria	2582581315	2585329214	293
324	iso_pu_bacteria	2582581316	2585336704	293
325	iso_pu_bacteria	2582581865	2585389809	293
326	iso_pu_bacteria	2582581866	2585398296	293
327	iso_pu_bacteria	2582581867	2585403159	293
328	iso_pu_bacteria	2582581867	2585405387	293
329	iso_pu_bacteria	2585427526	2585530374	293
330	iso_pu_bacteria	2585427527	2585537277	293
331	iso_pu_bacteria	2585427528	2585543842	293
332	iso_pu_bacteria	2585427529	2585550943	293
333	iso_pu_bacteria	2585427530	2585557952	293
334	iso_pu_bacteria	2585427531	2585558007	293
335	iso_pu_bacteria	2585427590	2585823981	293
336	iso_pu_bacteria	2585427590	2585825266	293
337	iso_pu_bacteria	2585427593	2585842195	293
338	iso_pu_bacteria	2585427594	2585848088	293
339	iso_pu_bacteria	2585427608	2585897435	293
340	iso_pu_bacteria	2585427609	2585904955	293
341	iso_pu_bacteria	2585427633	2585996139	293
342	iso_pu_bacteria	2585427634	2586000755	293
343	iso_pu_bacteria	2585428125	2587979929	293
344	iso_pu_bacteria	2588253730	2588517402	293
345	iso_pu_bacteria	2599185156	2599333539	293
346	iso_pu_bacteria	2599185170	2599418349	293
347	iso_pu_bacteria	2599185352	2600194507	293
348	iso_pu_bacteria	2615840624	2616298301	293
349	iso_pu_bacteria	2615840626	2616313112	293
350	iso_pu_bacteria	2615840698	2616551826	293
351	iso_pu_bacteria	2617270742	2617385510	293
352	iso_pu_bacteria	2643221558	2643810152	293
353	iso_pu_bacteria	2643221568	2643854598	293
354	iso_pu_bacteria	2643221599	2644005210	293
355	iso_pu_bacteria	2643221607	2644050064	293
356	iso_pu_bacteria	2643221618	2644106241	293
357	iso_pu_bacteria	2643221626	2644146795	293
358	iso_pu_bacteria	2643221634	2644191268	293
359	iso_pu_bacteria	2643221636	2644203824	293
360	iso_pu_bacteria	2643221643	2644238992	293
361	iso_pu_bacteria	2643221653	2644297044	293
362	iso_pu_bacteria	2643221655	2644310852	293
363	iso_pu_bacteria	2643221659	2644334363	293
364	iso_pu_bacteria	2643221686	2644482978	293
365	iso_pu_bacteria	2643221689	2644497082	293
366	iso_pu_bacteria	2643221698	2644545432	293
367	iso_pu_bacteria	2643221712	2644616686	293
368	iso_pu_bacteria	2643221719	2644655297	293
369	iso_pu_bacteria	2643221723	2644672462	293
370	iso_pu_bacteria	2657244999	2657686454	293
371	iso_pu_bacteria	2667528174	2671114791	293
372	iso_pu_bacteria	2687453392	2688598379	293
373	iso_pu_bacteria	2690316117	2692316564	293
374	iso_pu_bacteria	2718217927	2719385087	293
375	iso_pu_bacteria	2718217997	2719664846	293
376	iso_pu_bacteria	2718218009	2719731242	293
377	iso_pu_bacteria	2718218199	2720491266	293
378	iso_pu_bacteria	2718218232	2720612626	293
379	iso_pu_bacteria	2718218233	2720619464	293
380	iso_pu_bacteria	2718218235	2720630920	293
381	iso_pu_bacteria	2718218269	2720774558	293
382	iso_pu_bacteria	2718218363	2721146587	293
383	iso_pu_bacteria	2718218365	2721158112	293
384	iso_pu_bacteria	2718218366	2721163466	293
385	iso_pu_bacteria	2718218423	2721398807	293
386	iso_pu_bacteria	2721755514	2722839636	293
387	iso_pu_bacteria	2721755556	2723026283	293
388	iso_pu_bacteria	2721755684	2723559826	293
389	iso_pu_bacteria	2721755685	2723566446	293
390	iso_pu_bacteria	2721755809	2724037620	293
391	iso_pu_bacteria	2721755810	2724043998	293
392	iso_pu_bacteria	2721755819	2724089165	293
393	iso_pu_bacteria	2721755822	2724103711	293
394	iso_pu_bacteria	2721755823	2724109549	293
395	iso_pu_bacteria	2724679232	2725946119	293
396	iso_pu_bacteria	2728369352	2730107219	293
397	iso_pu_bacteria	2728369365	2730163730	293
398	iso_pu_bacteria	2728369397	2730297744	293
399	iso_pu_bacteria	2738541293	2738805867	293
400	iso_pu_bacteria	2738541317	2738948536	293
401	iso_pu_bacteria	2738541333	2739039075	293
402	iso_pu_bacteria	2738543024	2739308124	293
403	iso_pu_bacteria	2756170246	2756672540	293
404	iso_pu_bacteria	2765235802	2765466699	293
405	iso_pu_bacteria	2765235942	2766063740	293
406	iso_pu_bacteria	2767802442	2770198434	293
407	iso_pu_bacteria	2775506902	2776269241	293
408	iso_pu_bacteria	2775506904	2776283620	293
409	iso_pu_bacteria	2775507266	2778177839	293
410	iso_pu_bacteria	2791355082	2792579715	293
411	iso_pu_bacteria	2791355091	2792624940	293
412	iso_pu_bacteria	2791355092	2792630941	293
413	iso_pu_bacteria	2791355094	2792643999	293
414	iso_pu_bacteria	2791355253	2793280745	293
415	iso_pu_bacteria	2791355256	2793299840	293
416	iso_pu_bacteria	2791355259	2793318770	293
417	iso_pu_bacteria	2791355260	2793325429	293
418	iso_pu_bacteria	2791355261	2793331871	293
419	iso_pu_bacteria	2791355262	2793338296	293
420	iso_pu_bacteria	2791355263	2793345021	293
421	iso_pu_bacteria	2791355264	2793351230	293
422	iso_pu_bacteria	2791355265	2793357552	293
423	iso_pu_bacteria	2791355266	2793364328	293
424	iso_pu_bacteria	2791355267	2793371297	293
425	iso_pu_bacteria	2802429268	2804751658	293
426	iso_pu_bacteria	2802429605	2805931992	293
427	iso_pu_bacteria	2802429606	2805938213	293
428	iso_pu_bacteria	2802429633	2806049703	293
429	iso_pu_bacteria	2802429634	2806056601	293
430	iso_pu_bacteria	2802429635	2806063854	293
431	iso_pu_bacteria	2802429636	2806071149	293
432	iso_pu_bacteria	2802429637	2806078027	293
433	iso_pu_bacteria	2818991439	2819562501	293
434	iso_pu_bacteria	2818991448	2819610742	293
435	iso_pu_bacteria	2818991453	2819638392	293
436	iso_pu_bacteria	2837651117	2837653672	293
437	iso_pu_bacteria	2838016132	2838017514	293
438	iso_pu_bacteria	2838022645	2838022918	293
439	iso_pu_bacteria	2838029111	2838032415	293
440	iso_pu_bacteria	2838035591	2838042716	293
441	iso_pu_bacteria	2838042994	2838046161	293
442	iso_pu_bacteria	2838048938	2838049004	293
443	iso_pu_bacteria	2838061910	2838063565	293
444	iso_pu_bacteria	2838068647	2838072782	293
445	iso_pu_bacteria	2838661181	2838662959	293
446	iso_pu_bacteria	2838668709	2838675173	293
447	iso_pu_bacteria	2838675328	2838675914	293
448	iso_pu_bacteria	2838680041	2838681560	293
449	iso_pu_bacteria	2838686498	2838692751	293
450	iso_pu_bacteria	2838694306	2838694405	293
451	iso_pu_bacteria	2838701080	2838707523	293
452	iso_pu_bacteria	2838707686	2838707783	293
453	iso_pu_bacteria	2838714209	2838714796	293
454	iso_pu_bacteria	2838719591	2838721403	293
455	iso_pu_bacteria	2838724970	2838725556	293
456	iso_pu_bacteria	2838729681	2838735063	293
457	iso_pu_bacteria	2838742623	2838747578	293
458	iso_pu_bacteria	2839993093	2839997724	293
459	iso_pu_bacteria	2840764183	2840769918	293
460	iso_pu_bacteria	2841734538	2841739131	293
461	iso_pu_bacteria	2841846520	2841848369	293
462	iso_pu_bacteria	2841851746	2841857299	293
463	iso_pu_bacteria	2841864319	2841865250	293
464	iso_pu_bacteria	2842077413	2842080986	293
465	iso_pu_bacteria	2842110456	2842117539	293
466	iso_pu_bacteria	2842118031	2842121605	293
467	iso_pu_bacteria	2842124991	2842125601	293
468	iso_pu_bacteria	2842130223	2842130809	293
469	iso_pu_bacteria	2842146304	2842152101	293
470	iso_pu_bacteria	2842152218	2842154021	293
471	iso_pu_bacteria	2842156927	2842163243	293
472	iso_pu_bacteria	2842163707	2842170427	293
473	iso_pu_bacteria	2842170452	2842171040	293
474	iso_pu_bacteria	2842175837	2842177641	293
475	iso_pu_bacteria	2842180545	2842186857	293
476	iso_pu_bacteria	2842187318	2842187905	293
477	iso_pu_bacteria	2842192696	2842197610	293
478	iso_pu_bacteria	2842198810	2842199347	293
479	iso_pu_bacteria	2842205361	2842210131	293
480	iso_pu_bacteria	2842211629	2842212216	293
481	iso_pu_bacteria	2842217011	2842221709	293
482	iso_pu_bacteria	2842217011	2842224233	293
483	iso_pu_bacteria	2842224351	2842226165	293
484	iso_pu_bacteria	2842229732	2842234863	293
485	iso_pu_bacteria	2842237096	2842237194	293
486	iso_pu_bacteria	2842243621	2842248928	293
487	iso_pu_bacteria	2842250916	2842257334	293
488	iso_pu_bacteria	2842257432	2842262782	293
489	iso_pu_bacteria	2842264693	2842270785	293
490	iso_pu_bacteria	2842271015	2842277220	293
491	iso_pu_bacteria	2842278818	2842283585	293
492	iso_pu_bacteria	2842285085	2842286907	293
493	iso_pu_bacteria	2842291075	2842294642	293
494	iso_pu_bacteria	2842298080	2842303903	293
495	iso_pu_bacteria	2842304105	2842309164	293
496	iso_pu_bacteria	2842304105	2842310982	293
497	iso_pu_bacteria	2842311132	2842317500	293
498	iso_pu_bacteria	2842317721	2842324292	293
499	iso_pu_bacteria	2842341865	2842343372	293
500	iso_pu_bacteria	2842357229	2842363435	293
501	iso_pu_bacteria	2842363717	2842365488	293
502	iso_pu_bacteria	2842370503	2842372023	293
503	iso_pu_bacteria	2842377471	2842381040	293
504	iso_pu_bacteria	2842384541	2842388111	293
505	iso_pu_bacteria	2842395702	2842402282	293
506	iso_pu_bacteria	2842402390	2842404175	293
507	iso_pu_bacteria	2842409023	2842411140	293
508	iso_pu_bacteria	2842415677	2842417404	293
509	iso_pu_bacteria	2842422224	2842426533	293
510	iso_pu_bacteria	2842428310	2842434669	293
511	iso_pu_bacteria	2842434925	2842441028	293
512	iso_pu_bacteria	2842441272	2842447658	293
513	iso_pu_bacteria	2842447887	2842454366	293
514	iso_pu_bacteria	2842462802	2842468999	293
515	iso_pu_bacteria	2842469257	2842475586	293
516	iso_pu_bacteria	2842475841	2842478956	293
517	iso_pu_bacteria	2842482326	2842483088	293
518	iso_pu_bacteria	2842489311	2842495167	293
519	iso_pu_bacteria	2842495871	2842502513	293
520	iso_pu_bacteria	2842502639	2842506324	293
521	iso_pu_bacteria	2842509118	2842509959	293
522	iso_pu_bacteria	2842521101	2842527596	293
523	iso_pu_bacteria	2842922631	2842925053	293
524	iso_pu_bacteria	2844002411	2844007499	293
525	iso_pu_bacteria	2844009547	2844013632	293
526	iso_pu_bacteria	2844163670	2844165992	293
527	iso_pu_bacteria	2844454524	2844454902	293
528	iso_pu_bacteria	2847417321	2847418368	293
529	iso_pu_bacteria	2848992105	2848993349	293
530	iso_pu_bacteria	2852387548	2852389332	293
531	iso_pu_bacteria	2854896431	2854899187	293
532	iso_pu_bacteria	2854916844	2854918789	293
533	iso_pu_bacteria	2855872281	2855877482	293
534	iso_pu_bacteria	2856320880	2856327546	293
535	iso_pu_bacteria	2856334872	2856340381	293
536	iso_pu_bacteria	2856349417	2856350897	293
537	iso_pu_bacteria	2856356410	2856363619	293
538	iso_pu_bacteria	2857367948	2857372766	293
539	iso_pu_bacteria	2857516855	2857521631	293
540	iso_pu_bacteria	2869162929	2869167426	293
541	iso_pu_bacteria	2869169390	2869175545	293
542	iso_pu_bacteria	2869234852	2869238234	293
543	iso_pu_bacteria	2869242130	2869246227	293
544	iso_pu_bacteria	2869249662	2869253299	293
545	iso_pu_bacteria	2869256925	2869260817	293
546	iso_pu_bacteria	2869264136	2869268790	293
547	iso_pu_bacteria	2869271264	2869276464	293
548	iso_pu_bacteria	2869278585	2869280435	293
549	iso_pu_bacteria	2871435913	2871439523	293
550	iso_pu_bacteria	2871451962	2871459510	293
551	iso_pu_bacteria	2871459585	2871466800	293
552	iso_pu_bacteria	2871466892	2871468285	293
553	iso_pu_bacteria	2871474448	2871475484	293
554	iso_pu_bacteria	2871481445	2871481805	293
555	iso_pu_bacteria	2871488783	2871494603	293
556	iso_pu_bacteria	2874109183	2874113431	293
557	iso_pu_bacteria	2874116593	2874123011	293
558	iso_pu_bacteria	2874123672	2874123946	293
559	iso_pu_bacteria	2874131515	2874137879	293
560	iso_pu_bacteria	2874139085	2874144153	293
561	iso_pu_bacteria	2874162495	2874164492	293
562	iso_pu_bacteria	2876386047	2876390868	293
563	iso_pu_bacteria	2876399893	2876403661	293
564	iso_pu_bacteria	2876406927	2876409160	293
565	iso_pu_bacteria	2876420981	2876426905	293
566	iso_pu_bacteria	2878738818	2878745148	293
567	iso_pu_bacteria	2878753008	2878758815	293
568	iso_pu_bacteria	2878774303	2878775677	293
569	iso_pu_bacteria	2878781027	2878781641	293
570	iso_pu_bacteria	2878788777	2878789633	293
571	iso_pu_bacteria	2881155292	2881161743	293
572	iso_pu_bacteria	2881161766	2881167467	293
573	iso_pu_bacteria	2881845957	2881851272	293
574	iso_pu_bacteria	2881853255	2881855597	293
575	iso_pu_bacteria	2881861095	2881863468	293
576	iso_pu_bacteria	2882912400	2882918509	293
577	iso_pu_bacteria	2885312484	2885318044	293
578	iso_pu_bacteria	2885318864	2885320656	293
579	iso_pu_bacteria	2885342637	2885345312	293
580	iso_pu_bacteria	2885350715	2885357478	293
581	iso_pu_bacteria	2888337043	2888339359	293
582	iso_pu_bacteria	2888343758	2888346735	293
583	iso_pu_bacteria	2889010040	2889010634	293
584	iso_pu_bacteria	2894652903	2894656832	293
585	iso_pu_bacteria	2899275550	2899277779	293
586	iso_pu_bacteria	2903492973	2903503946	293
587	iso_pu_bacteria	2903513507	2903517182	293
588	iso_pu_bacteria	2904578770	2904581791	293
589	iso_pu_bacteria	2906363423	2906367936	293
590	iso_pu_bacteria	2906370794	2906373024	293
591	iso_pu_bacteria	2906378014	2906386388	293
592	iso_pu_bacteria	2906386501	2906388810	293
593	iso_pu_bacteria	2906393657	2906398050	293
594	iso_pu_bacteria	2906401398	2906401750	293
595	iso_pu_bacteria	2906408224	2906408836	293
596	iso_pu_bacteria	2913295892	2913301808	293
597	iso_pu_bacteria	2913308742	2913313496	293
598	iso_pu_bacteria	2919100787	2919104060	293
599	iso_pu_bacteria	2919114240	2919114886	293
600	iso_pu_bacteria	2919119836	2919123458	293
601	iso_pu_bacteria	2919166419	2919168935	293
602	iso_pu_bacteria	2919171160	2919174759	293
603	iso_pu_bacteria	2919408235	2919409542	293
604	iso_pu_bacteria	2920822456	2920822629	293
605	iso_pu_bacteria	2922151315	2922153394	293
606	iso_pu_bacteria	2922172374	2922175302	293
607	iso_pu_bacteria	2922178524	2922180965	293
608	iso_pu_bacteria	2923556063	2923559379	293
609	iso_pu_bacteria	2923556063	2923562779	293
610	iso_pu_bacteria	2924718760	2924725241	293
611	iso_pu_bacteria	2924733363	2924735871	293
612	iso_pu_bacteria	2924741084	2924747359	293
613	iso_pu_bacteria	2924748358	2924748360	293
614	iso_pu_bacteria	2924754689	2924758954	293
615	iso_pu_bacteria	2924776078	2924783285	293
616	iso_pu_bacteria	2924784321	2924789017	293
617	iso_pu_bacteria	2926754445	2926755851	293
618	iso_pu_bacteria	2928521798	2928526755	293
619	iso_pu_bacteria	2933006813	2933008666	293
620	iso_pu_bacteria	2933570622	2933575734	293
621	iso_pu_bacteria	2933570622	2933577477	293
622	iso_pu_bacteria	2933586486	2933593636	293
623	iso_pu_bacteria	2933594066	2933596732	293
624	iso_pu_bacteria	2933599457	2933603711	293
625	iso_pu_bacteria	2935894831	2935894928	293
626	iso_pu_bacteria	2935901341	2935908459	293
627	iso_pu_bacteria	2936367885	2936373489	293
628	iso_pu_bacteria	2936375103	2936379994	293
629	iso_pu_bacteria	2936381700	2936388316	293
630	iso_pu_bacteria	2937836603	2937839318	293
631	iso_pu_bacteria	2937843397	2937845348	293
632	iso_pu_bacteria	2937861824	2937865643	293
633	iso_pu_bacteria	2937868953	2937873308	293
634	iso_pu_bacteria	2937877337	2937882188	293
635	iso_pu_bacteria	2937972304	2937978649	293
636	iso_pu_bacteria	2937980651	2937984244	293
637	iso_pu_bacteria	2941499720	2941503892	293
638	iso_pu_bacteria	2954011201	2954011607	293
639	iso_pu_bacteria	2958034702	2958036305	293
640	iso_pu_bacteria	2958041894	2958045669	293
641	iso_pu_bacteria	2958064165	2958064436	293
642	iso_pu_bacteria	2958071322	2958072054	293
643	iso_pu_bacteria	2958084443	2958089310	293
644	iso_pu_bacteria	2958092219	2958092971	293
645	iso_pu_bacteria	2958108152	2958110080	293
646	iso_pu_bacteria	2958122699	2958124377	293
647	iso_pu_bacteria	2958144490	2958147339	293
648	iso_pu_bacteria	2958158011	2958161502	293
649	iso_pu_bacteria	2961127735	2961132660	293
650	iso_pu_bacteria	2961136820	2961141219	293
651	iso_pu_bacteria	2961170736	2961176107	293
652	iso_pu_bacteria	2961183825	2961184341	293
653	iso_pu_bacteria	2965025482	2965031822	293
654	iso_pu_bacteria	2965040258	2965044685	293
655	iso_pu_bacteria	2965047637	2965049686	293
656	iso_pu_bacteria	2965089291	2965093411	293
657	iso_pu_bacteria	2965102966	2965108911	293
658	iso_pu_bacteria	2965110997	2965118440	293
659	iso_pu_bacteria	2967996073	2968001994	293
660	iso_pu_bacteria	2968003550	2968008982	293
661	iso_pu_bacteria	2968016561	2968018516	293
662	iso_pu_bacteria	2968138860	2968139023	293
663	iso_pu_bacteria	2970469710	2970471311	293
664	iso_pu_bacteria	2970489779	2970492949	293
665	iso_pu_bacteria	2970503327	2970508773	293
666	iso_pu_bacteria	2970510686	2970517403	293
667	iso_pu_bacteria	2970524798	2970528518	293
668	iso_pu_bacteria	2970532167	2970534593	293
669	iso_pu_bacteria	2970540015	2970540479	293
670	iso_pu_bacteria	2970547951	2970548938	293
671	iso_pu_bacteria	2970593180	2970595032	293
672	iso_pu_bacteria	2970627176	2970627515	293
673	iso_pu_bacteria	2977821940	2977827355	293
674	iso_pu_bacteria	2977828996	2977833700	293
675	iso_pu_bacteria	2977851361	2977855849	293
676	iso_pu_bacteria	2977864932	2977867144	293
677	iso_pu_bacteria	2977872689	2977873294	293
678	iso_pu_bacteria	2977898635	2977900944	293
679	iso_pu_bacteria	2977907340	2977909239	293
680	iso_pu_bacteria	2977935797	2977936083	293
681	iso_pu_bacteria	2977950692	2977954858	293
682	iso_pu_bacteria	2977957713	2977964187	293
683	iso_pu_bacteria	2979100975	2979103799	293
684	iso_pu_bacteria	2979764755	2979768140	293
685	iso_pu_bacteria	2979793036	2979794094	293
686	iso_pu_bacteria	2979808191	2979811579	293
687	iso_pu_bacteria	2984509177	2984511635	293
688	iso_pu_bacteria	2984518228	2984522004	293
689	iso_pu_bacteria	2984537506	2984541302	293
690	iso_pu_bacteria	2984601300	2984603580	293
691	iso_pu_bacteria	2987645492	2987649575	293
692	iso_pu_bacteria	2987652177	2987657271	293
693	iso_pu_bacteria	2987673487	2987680845	293
694	iso_pu_bacteria	2989776772	2989777975	293
695	iso_pu_bacteria	2996310559	2996316246	293
696	iso_pu_bacteria	2996336353	2996338481	293
697	iso_pu_bacteria	2996348954	2996350102	293
698	iso_pu_bacteria	2996386984	2996392280	293
699	iso_pu_bacteria	2996887358	2996888814	293
700	iso_pu_bacteria	2996893221	2996898851	293
701	iso_pu_bacteria	3003930520	3003933045	293
702	iso_pu_bacteria	3004167301	3004168828	293
703	iso_pu_bacteria	3004195979	3004201260	293
704	iso_pu_bacteria	3004232784	3004237081	293
705	iso_pu_bacteria	3004239961	3004243333	293
706	iso_pu_bacteria	3004248173	3004251527	293
707	iso_pu_bacteria	3004268573	3004274869	293
708	iso_pu_bacteria	3004275668	3004276801	293
709	iso_pu_bacteria	3004289098	3004296153	293
710	iso_pu_bacteria	3004334049	3004334428	293
711	iso_pu_bacteria	3005409236	3005412726	293
712	iso_pu_bacteria	3005416602	3005417869	293
713	iso_pu_bacteria	3005445848	3005446962	293
714	iso_pu_bacteria	3005452660	3005453594	293
715	iso_pu_bacteria	639633055	639644877	293
716	iso_pu_bacteria	639633055	639647642	293
717	iso_pu_bacteria	643692032	643825379	293
718	iso_pu_bacteria	649633066	649872907	293
719	iso_pu_bacteria	8002285264	8002286692	293
720	iso_pu_bacteria	8004300914	8004300976	293
721	iso_pu_bacteria	8004361976	8004362219	293
722	iso_pu_bacteria	8004374579	8004380336	293
723	iso_pu_bacteria	8004395343	8004400157	293
724	iso_pu_bacteria	8004633249	8004638646	293
725	iso_pu_bacteria	8004695233	8004699068	293
726	iso_pu_bacteria	8004727605	8004731907	293
727	iso_pu_bacteria	8005246636	8005246787	293
728	iso_pu_bacteria	8005258706	8005260085	293
729	iso_pu_bacteria	8005275841	8005279858	293
730	iso_pu_bacteria	8005282627	8005287653	293
731	iso_pu_bacteria	8005289223	8005293003	293
732	iso_pu_bacteria	8005301065	8005304815	293
733	iso_pu_bacteria	8005307578	8005308605	293
734	iso_pu_bacteria	8005314921	8005316481	293
735	iso_pu_bacteria	8005321885	8005323341	293
736	iso_pu_bacteria	8005376324	8005376392	293
737	iso_pu_bacteria	8005382845	8005385778	293
738	iso_pu_bacteria	8005395548	8005400542	293
739	iso_pu_bacteria	8005430974	8005436426	293
740	iso_pu_bacteria	8005460587	8005462156	293
741	iso_pu_bacteria	8005484373	8005487222	293
742	iso_pu_bacteria	8005497431	8005499575	293
743	iso_pu_bacteria	8005542996	8005544473	293
744	iso_pu_bacteria	8005556819	8005559763	293
745	iso_pu_bacteria	8005563573	8005566537	293
746	iso_pu_bacteria	8005563573	8005567651	293
747	iso_pu_bacteria	8005570704	8005570830	293
748	iso_pu_bacteria	8005619151	8005620755	293
749	iso_pu_bacteria	8005626139	8005626883	293
750	iso_pu_bacteria	8005645114	8005647427	293
751	iso_pu_bacteria	8005658619	8005662623	293
752	iso_pu_bacteria	8005668836	8005670992	293
753	iso_pu_bacteria	8005682033	8005686598	293
754	iso_pu_bacteria	8005688590	8005691240	293
755	iso_pu_bacteria	8005695170	8005698553	293
756	iso_pu_bacteria	8018127388	8018131547	293
757	iso_pu_bacteria	8018150411	8018153961	293
758	iso_pu_bacteria	8018163183	8018169272	293
759	iso_pu_bacteria	8018176218	8018180171	293
760	iso_pu_bacteria	8023680758	8023681952	293
761	iso_pu_bacteria	8024479707	8024483655	293
762	iso_pu_bacteria	8024486573	8024487213	293
763	iso_pu_bacteria	8024501048	8024503036	293
764	iso_pu_bacteria	8049293176	8049294261	293
765	iso_pu_bacteria	8054460903	8054461982	293
766	iso_pu_bacteria	8054558443	8054560940	293
767	iso_pu_bacteria	8056375014	8056380948	293
768	iso_pu_bacteria	8056382006	8056384526	293
769	iso_pu_bacteria	8056875544	8056878677	293
770	iso_pu_bacteria	8057874678	8057876528	293
771	iso_pu_bacteria	8057874678	8057878967	293
772	3300003792	Ga0055540_1003660	Ga0055540_10036609	294
773	3300005618	Ga0068864_100011632	Ga0068864_1000116325	294
774	3300006946	Ga0079104_1009534	Ga0079104_10095344	294
775	3300009101	Ga0105247_10037583	Ga0105247_100375832	294
776	3300009553	Ga0105249_10001311	Ga0105249_100013115	294
777	3300013102	Ga0157371_10127135	Ga0157371_101271352	294
778	3300025298	Ga0209050_1005977	Ga0209050_10059777	294
779	3300025303	Ga0209051_1000032	Ga0209051_100003254	294
780	3300025304	Ga0209257_1005128	Ga0209257_10051285	294
781	3300025900	Ga0207710_10003531	Ga0207710_100035315	294
782	3300025907	Ga0207645_10234607	Ga0207645_102346072	294
783	3300025923	Ga0207681_10119334	Ga0207681_101193342	294
784	3300027111	Ga0209281_1001121	Ga0209281_100112114	294
785	3300028381	Ga0268264_10192216	Ga0268264_101922162	294
786	3300045051	Ga0451576_0504577	Ga0451576_0504577_128_1021	294
787	3300049577	Ga0501041_0294246	Ga0501041_0294246_54_944	294
788	3300050493	nmdc:mga0k408_221248_c1	nmdc:mga0k408_221248_c1_124_1017	294
789	iso_pu_bacteria	2671180139	2671693874	294
790	iso_pu_bacteria	2884634485	2884635723	294
791	iso_pu_bacteria	8002745576	8002746748	294
792	3300003203	JGI25406J46586_10030531	JGI25406J46586_100305313	295
793	3300005548	Ga0070665_100131057	Ga0070665_1001310572	295
794	3300005983	Ga0081540_1046881	Ga0081540_10468811	295
795	3300005985	Ga0081539_10001054	Ga0081539_100010543	295
796	3300006946	Ga0079104_1022168	Ga0079104_10221681	295
797	3300021321	Ga0214542_1008463	Ga0214542_10084632	295
798	3300021327	Ga0214543_1020751	Ga0214543_10207518	295
799	3300022739	Ga0228711_1000015	Ga0228711_100001556	295
800	3300022740	Ga0228710_1000015	Ga0228710_100001592	295
801	3300025253	Ga0209677_100439	Ga0209677_10043915	295
802	3300027111	Ga0209281_1001101	Ga0209281_100110115	295
803	3300027666	Ga0209282_1000054	Ga0209282_100005477	295
804	3300028379	Ga0268266_10124377	Ga0268266_101243772	295
805	3300031251	Ga0265327_10119320	Ga0265327_101193201	295
806	3300031548	Ga0307408_100566936	Ga0307408_1005669361	295
807	3300031852	Ga0307410_10354384	Ga0307410_103543841	295
808	3300031967	Ga0315914_1000013	Ga0315914_100001356	295
809	3300033430	Ga0315913_1000097	Ga0315913_100009756	295
810	3300033464	Ga0315915_1000001	Ga0315915_100000156	295
811	3300042007	Ga0439449_0007016	Ga0439449_0007016_1209_2102	295
812	3300046460	Ga0495638_0009494	Ga0495638_0009494_5047_5934	295
813	3300046558	Ga0495633_0072217	Ga0495633_0072217_109_999	295
814	3300047320	Ga0495672_0055833	Ga0495672_0055833_177_1082	295
815	3300047472	Ga0495686_0150894	Ga0495686_0150894_288_1175	295
816	3300049570	Ga0501033_0007763	Ga0501033_0007763_6295_7182	295
817	3300049822	Ga0501035_0004901	Ga0501035_0004901_6139_7026	295
818	3300053121	Ga0500607_101943	Ga0500607_101943_511_1398	295
819	3300053139	Ga0500568_0000156	Ga0500568_0000156_31315_32220	295
820	3300053151	Ga0500604_0033665	Ga0500604_0033665_569_1456	295
821	3300053153	Ga0500616_0000245	Ga0500616_0000245_37763_38668	295
822	3300053158	Ga0500627_0065472	Ga0500627_0065472_178_1065	295
823	iso_pu_bacteria	2874168670	2874174132	295
824	iso_pu_bacteria	2911138879	2911140775	295
825	iso_pu_bacteria	2937822353	2937826841	295
826	3300006038	Ga0075365_10104888	Ga0075365_101048882	296
827	3300006186	Ga0075369_10051626	Ga0075369_100516262	296
828	3300006195	Ga0075366_10049961	Ga0075366_100499612	296
829	3300013105	Ga0157369_10020309	Ga0157369_100203095	296
830	3300015262	Ga0182007_10053383	Ga0182007_100533832	296
831	3300017792	Ga0163161_10204118	Ga0163161_102041182	296
832	3300025922	Ga0207646_10016329	Ga0207646_100163296	296
833	3300025937	Ga0207669_10016207	Ga0207669_100162072	296
834	3300025940	Ga0207691_10151262	Ga0207691_101512623	296
835	3300025961	Ga0207712_10109830	Ga0207712_101098302	296
836	3300031250	Ga0265331_10033146	Ga0265331_100331462	296
837	3300031711	Ga0265314_10021788	Ga0265314_100217881	296
838	3300031730	Ga0307516_10037642	Ga0307516_100376424	296
839	3300031730	Ga0307516_10136021	Ga0307516_101360211	296
840	3300038443	Ga0395901_0002399	Ga0395901_0002399_1976_2869	296
841	3300046542	Ga0495597_0019974	Ga0495597_0019974_2123_3013	296
842	3300046809	Ga0495600_0172317	Ga0495600_0172317_398_1291	296
843	3300047443	Ga0495687_041417	Ga0495687_041417_276_1166	296
844	3300048925	Ga0496122_0132578	Ga0496122_0132578_456_1349	296
845	3300048927	Ga0496124_0263634	Ga0496124_0263634_344_1237	296
846	3300048929	Ga0496126_0000081	Ga0496126_0000081_120011_120904	296
847	3300048929	Ga0496126_0018709	Ga0496126_0018709_5556_6446	296
848	3300048929	Ga0496126_0111105	Ga0496126_0111105_393_1286	296
849	3300049573	Ga0501037_0048112	Ga0501037_0048112_1742_2638	296
850	3300049574	Ga0501038_0004291	Ga0501038_0004291_10724_11638	296
851	3300049574	Ga0501038_0014087	Ga0501038_0014087_952_1848	296
852	3300049575	Ga0501039_0016772	Ga0501039_0016772_174_1070	296
853	3300049580	Ga0501046_0000935	Ga0501046_0000935_1112_2026	296
854	3300049581	Ga0501047_0050894	Ga0501047_0050894_3009_3923	296
855	3300049582	Ga0501048_0078251	Ga0501048_0078251_856_1752	296
856	3300049583	Ga0501067_0007257	Ga0501067_0007257_5210_6124	296
857	3300049583	Ga0501067_0032615	Ga0501067_0032615_538_1434	296
858	3300049584	Ga0501068_0020203	Ga0501068_0020203_369_1283	296
859	3300049586	Ga0501070_0001955	Ga0501070_0001955_7248_8162	296
860	3300049588	Ga0501072_0051877	Ga0501072_0051877_1128_2024	296
861	3300049589	Ga0501073_0028377	Ga0501073_0028377_2728_3624	296
862	3300049590	Ga0501074_0000740	Ga0501074_0000740_7797_8711	296
863	3300049742	Ga0501080_0033974	Ga0501080_0033974_3797_4711	296
864	3300049744	Ga0501083_0001983	Ga0501083_0001983_10358_11254	296
865	3300049744	Ga0501083_0012147	Ga0501083_0012147_4181_5095	296
866	3300049822	Ga0501035_0014088	Ga0501035_0014088_6369_7283	296
867	3300049823	Ga0501044_0023294	Ga0501044_0023294_4181_5095	296
868	3300050489	nmdc:mga03683_40167_c1	nmdc:mga03683_40167_c1_936_1826	296
869	3300050491	nmdc:mga00v17_129309_c1	nmdc:mga00v17_129309_c1_338_1228	296
870	3300050493	nmdc:mga0k408_221672_c1	nmdc:mga0k408_221672_c1_195_1085	296
871	3300050494	nmdc:mga06z11_90677_c1	nmdc:mga06z11_90677_c1_352_1242	296
872	3300050507	nmdc:mga05p37_563061_c1	nmdc:mga05p37_563061_c1_154_1044	296
873	3300053079	Ga0500610_0085782	Ga0500610_0085782_634_1524	296
874	3300053083	Ga0495655_0014458	Ga0495655_0014458_659_1549	296
875	3300053155	Ga0500620_000234	Ga0500620_000234_4644_5534	296
876	3300053177	Ga0500636_0000009	Ga0500636_0000009_96438_97331	296
877	3300054114	Ga0501084_0102458	Ga0501084_0102458_416_1312	296
878	3300060353	Ga0501082_0286274	Ga0501082_0286274_443_1357	296
879	2010549000	RicEn_C4912	RicEn_87630	297
880	3300000532	CNAas_1002352	CNAas_10023522	297
881	3300001915	JGI24741J21665_1010483	JGI24741J21665_10104832	297
882	3300001979	JGI24740J21852_10000703	JGI24740J21852_100007033	297
883	3300001979	JGI24740J21852_10009728	JGI24740J21852_100097282	297
884	3300002704	JGI25155J39150_1000273	JGI25155J39150_100027315	297
885	3300002705	JGI25156J39149_1000662	JGI25156J39149_100066215	297
886	3300002737	JGI25162J39368_1002191	JGI25162J39368_10021913	297
887	3300002737	JGI25162J39368_1002562	JGI25162J39368_10025628	297
888	3300002738	JGI25154J39366_1002486	JGI25154J39366_10024867	297
889	3300002739	JGI25158J39367_1004214	JGI25158J39367_10042143	297
890	3300002741	JGI25157J39369_1000673	JGI25157J39369_100067315	297
891	3300002741	JGI25157J39369_1001242	JGI25157J39369_10012422	297
892	3300002773	JGI25152J39213_1002945	JGI25152J39213_10029457	297
893	3300002773	JGI25152J39213_1006947	JGI25152J39213_10069474	297
894	3300002773	JGI25152J39213_1008257	JGI25152J39213_10082575	297
895	3300002773	JGI25152J39213_1008380	JGI25152J39213_10083803	297
896	3300002774	JGI25150J39212_1000637	JGI25150J39212_10006373	297
897	3300002774	JGI25150J39212_1009662	JGI25150J39212_10096622	297
898	3300002987	JGI25159J45721_1000012	JGI25159J45721_100001268	297
899	3300002987	JGI25159J45721_1001145	JGI25159J45721_10011454	297
900	3300003187	JGI25151J46595_10005842	JGI25151J46595_100058427	297
901	3300003187	JGI25151J46595_10006178	JGI25151J46595_100061783	297
902	3300003187	JGI25151J46595_10007882	JGI25151J46595_100078824	297
903	3300003187	JGI25151J46595_10021436	JGI25151J46595_100214364	297
904	3300003187	JGI25151J46595_10033787	JGI25151J46595_100337871	297
905	3300003214	JGI25165J46597_1000159	JGI25165J46597_100015924	297
906	3300003214	JGI25165J46597_1002527	JGI25165J46597_10025277	297
907	3300003214	JGI25165J46597_1004759	JGI25165J46597_10047592	297
908	3300003215	JGI25153J46596_10014615	JGI25153J46596_100146153	297
909	3300003215	JGI25153J46596_10022835	JGI25153J46596_100228352	297
910	3300003215	JGI25153J46596_10026584	JGI25153J46596_100265843	297
911	3300003215	JGI25153J46596_10029492	JGI25153J46596_100294922	297
912	3300003322	rootL2_10044709	rootL2_100447092	297
913	3300003354	JGI25160J50197_1000042	JGI25160J50197_100004285	297
914	3300003354	JGI25160J50197_1001903	JGI25160J50197_10019032	297
915	3300003354	JGI25160J50197_1006677	JGI25160J50197_10066776	297
916	3300003354	JGI25160J50197_1020398	JGI25160J50197_10203982	297
917	3300003374	JGI25161J50226_1000254	JGI25161J50226_100025422	297
918	3300003374	JGI25161J50226_1001676	JGI25161J50226_100167610	297
919	3300003374	JGI25161J50226_1005321	JGI25161J50226_10053213	297
920	3300003762	Ga0055542_1000406	Ga0055542_100040622	297
921	3300003763	Ga0055529_1007925	Ga0055529_10079252	297
922	3300003771	Ga0055526_1010920	Ga0055526_10109204	297
923	3300003771	Ga0055526_1012870	Ga0055526_10128703	297
924	3300003771	Ga0055526_1022337	Ga0055526_10223371	297
925	3300003771	Ga0055526_1033237	Ga0055526_10332372	297
926	3300003775	Ga0055524_1007866	Ga0055524_10078664	297
927	3300003775	Ga0055524_1020299	Ga0055524_10202993	297
928	3300003781	Ga0055536_1006416	Ga0055536_10064163	297
929	3300003781	Ga0055536_1009167	Ga0055536_10091676	297
930	3300003790	Ga0055528_1005164	Ga0055528_10051644	297
931	3300003790	Ga0055528_1025167	Ga0055528_10251672	297
932	3300003790	Ga0055528_1025283	Ga0055528_10252832	297
933	3300003791	Ga0055530_10010936	Ga0055530_100109362	297
934	3300003792	Ga0055540_1016534	Ga0055540_10165343	297
935	3300003792	Ga0055540_1020166	Ga0055540_10201662	297
936	3300003792	Ga0055540_1024167	Ga0055540_10241672	297
937	3300003792	Ga0055540_1024907	Ga0055540_10249071	297
938	3300003794	Ga0055531_10004968	Ga0055531_1000496810	297
939	3300003856	Ga0058692_1005295	Ga0058692_10052952	297
940	3300004625	Ga0055543_1000452	Ga0055543_100045216	297
941	3300004625	Ga0055543_1001301	Ga0055543_100130111	297
942	3300004625	Ga0055543_1009836	Ga0055543_10098362	297
943	3300005262	Ga0065165_1000174	Ga0065165_100017468	297
944	3300005262	Ga0065165_1004983	Ga0065165_10049831	297
945	3300005328	Ga0070676_10093126	Ga0070676_100931262	297
946	3300005331	Ga0070670_100093133	Ga0070670_1000931333	297
947	3300005334	Ga0068869_100250977	Ga0068869_1002509771	297
948	3300005344	Ga0070661_100257297	Ga0070661_1002572972	297
949	3300005355	Ga0070671_100047237	Ga0070671_1000472376	297
950	3300005355	Ga0070671_100140014	Ga0070671_1001400142	297
951	3300005356	Ga0070674_100050824	Ga0070674_1000508244	297
952	3300005356	Ga0070674_100267794	Ga0070674_1002677942	297
953	3300005356	Ga0070674_100340804	Ga0070674_1003408042	297
954	3300005444	Ga0070694_100163776	Ga0070694_1001637761	297
955	3300005459	Ga0068867_100076848	Ga0068867_1000768482	297
956	3300005467	Ga0070706_100591057	Ga0070706_1005910571	297
957	3300005543	Ga0070672_100105698	Ga0070672_1001056983	297
958	3300005548	Ga0070665_100115749	Ga0070665_1001157491	297
959	3300005548	Ga0070665_100274521	Ga0070665_1002745212	297
960	3300005548	Ga0070665_100298520	Ga0070665_1002985202	297
961	3300005548	Ga0070665_100680164	Ga0070665_1006801641	297
962	3300005563	Ga0068855_100155768	Ga0068855_1001557682	297
963	3300005614	Ga0068856_100045280	Ga0068856_1000452803	297
964	3300005616	Ga0068852_100266950	Ga0068852_1002669502	297
965	3300005616	Ga0068852_100437349	Ga0068852_1004373492	297
966	3300005617	Ga0068859_100048231	Ga0068859_1000482313	297
967	3300005617	Ga0068859_100113250	Ga0068859_1001132504	297
968	3300005843	Ga0068860_100000927	Ga0068860_10000092733	297
969	3300005844	Ga0068862_100157180	Ga0068862_1001571802	297
970	3300005983	Ga0081540_1027674	Ga0081540_10276742	297
971	3300005983	Ga0081540_1055027	Ga0081540_10550272	297
972	3300005985	Ga0081539_10029967	Ga0081539_100299672	297
973	3300006038	Ga0075365_10005631	Ga0075365_100056316	297
974	3300006038	Ga0075365_10031322	Ga0075365_100313225	297
975	3300006038	Ga0075365_10066437	Ga0075365_100664372	297
976	3300006038	Ga0075365_10154525	Ga0075365_101545251	297
977	3300006038	Ga0075365_10217163	Ga0075365_102171632	297
978	3300006042	Ga0075368_10006442	Ga0075368_100064425	297
979	3300006042	Ga0075368_10084225	Ga0075368_100842251	297
980	3300006051	Ga0075364_10009362	Ga0075364_100093621	297
981	3300006051	Ga0075364_10018176	Ga0075364_100181764	297
982	3300006051	Ga0075364_10077755	Ga0075364_100777552	297
983	3300006173	Ga0070716_100091198	Ga0070716_1000911982	297
984	3300006177	Ga0075362_10015302	Ga0075362_100153022	297
985	3300006177	Ga0075362_10015521	Ga0075362_100155211	297
986	3300006177	Ga0075362_10022032	Ga0075362_100220323	297
987	3300006177	Ga0075362_10035051	Ga0075362_100350512	297
988	3300006178	Ga0075367_10026621	Ga0075367_100266215	297
989	3300006178	Ga0075367_10097117	Ga0075367_100971172	297
990	3300006178	Ga0075367_10111627	Ga0075367_101116272	297
991	3300006186	Ga0075369_10000668	Ga0075369_100006682	297
992	3300006186	Ga0075369_10006990	Ga0075369_100069907	297
993	3300006195	Ga0075366_10040314	Ga0075366_100403144	297
994	3300006353	Ga0075370_10049591	Ga0075370_100495914	297
995	3300006353	Ga0075370_10058080	Ga0075370_100580801	297
996	3300006353	Ga0075370_10136209	Ga0075370_101362091	297
997	3300006353	Ga0075370_10164781	Ga0075370_101647812	297
998	3300006844	Ga0075428_100067899	Ga0075428_1000678994	297
999	3300006844	Ga0075428_100173592	Ga0075428_1001735922	297
1000	3300006881	Ga0068865_100132912	Ga0068865_1001329122	297
1001	3300006881	Ga0068865_100246968	Ga0068865_1002469682	297
1002	3300006931	Ga0097620_100048229	Ga0097620_1000482293	297
1003	3300006931	Ga0097620_100113243	Ga0097620_1001132434	297
1004	3300006948	Ga0099826_10060404	Ga0099826_100604042	297
1005	3300006948	Ga0099826_10124522	Ga0099826_101245222	297
1006	3300009092	Ga0105250_10076812	Ga0105250_100768122	297
1007	3300009093	Ga0105240_10004516	Ga0105240_100045164	297
1008	3300009094	Ga0111539_10192773	Ga0111539_101927732	297
1009	3300009098	Ga0105245_10320136	Ga0105245_103201362	297
1010	3300009098	Ga0105245_10376938	Ga0105245_103769381	297
1011	3300009101	Ga0105247_10018564	Ga0105247_100185644	297
1012	3300009101	Ga0105247_10048918	Ga0105247_100489183	297
1013	3300009174	Ga0105241_10070701	Ga0105241_100707013	297
1014	3300009176	Ga0105242_10051691	Ga0105242_100516913	297
1015	3300009545	Ga0105237_10043232	Ga0105237_100432325	297
1016	3300009551	Ga0105238_10014647	Ga0105238_100146477	297
1017	3300009551	Ga0105238_10098109	Ga0105238_100981092	297
1018	3300009765	Ga0123341_1011836	Ga0123341_10118369	297
1019	3300009766	Ga0123342_1030016	Ga0123342_10300162	297
1020	3300010375	Ga0105239_10007703	Ga0105239_100077036	297
1021	3300010375	Ga0105239_10016746	Ga0105239_100167463	297
1022	3300010375	Ga0105239_10059758	Ga0105239_100597582	297
1023	3300010375	Ga0105239_10366017	Ga0105239_103660172	297
1024	3300013100	Ga0157373_10071779	Ga0157373_100717792	297
1025	3300013104	Ga0157370_10011226	Ga0157370_100112268	297
1026	3300013297	Ga0157378_10170177	Ga0157378_101701772	297
1027	3300013297	Ga0157378_10418540	Ga0157378_104185401	297
1028	3300013307	Ga0157372_10046289	Ga0157372_100462895	297
1029	3300013308	Ga0157375_10090529	Ga0157375_100905292	297
1030	3300014325	Ga0163163_10314037	Ga0163163_103140372	297
1031	3300015262	Ga0182007_10005179	Ga0182007_100051791	297
1032	3300015690	Ga0183363_1026	Ga0183363_102647	297
1033	3300021320	Ga0214544_1013008	Ga0214544_10130089	297
1034	3300021321	Ga0214542_1000006	Ga0214542_1000006324	297
1035	3300021327	Ga0214543_1000032	Ga0214543_1000032203	297
1036	3300021384	Ga0213876_10001150	Ga0213876_100011509	297
1037	3300021384	Ga0213876_10005117	Ga0213876_100051173	297
1038	3300025206	Ga0209435_100024	Ga0209435_100024168	297
1039	3300025208	Ga0209436_100075	Ga0209436_10007535	297
1040	3300025208	Ga0209436_100252	Ga0209436_10025219	297
1041	3300025233	Ga0209437_100023	Ga0209437_100023511	297
1042	3300025233	Ga0209437_100609	Ga0209437_10060917	297
1043	3300025233	Ga0209437_102950	Ga0209437_1029503	297
1044	3300025245	Ga0207425_1000567	Ga0207425_10005674	297
1045	3300025245	Ga0207425_1006449	Ga0207425_10064493	297
1046	3300025245	Ga0207425_1007876	Ga0207425_10078764	297
1047	3300025245	Ga0207425_1008348	Ga0207425_10083483	297
1048	3300025246	Ga0209646_1000064	Ga0209646_1000064168	297
1049	3300025246	Ga0209646_1011617	Ga0209646_10116172	297
1050	3300025250	Ga0209026_1000025	Ga0209026_100002572	297
1051	3300025250	Ga0209026_1000053	Ga0209026_1000053168	297
1052	3300025253	Ga0209677_102953	Ga0209677_1029538	297
1053	3300025254	Ga0209148_1000181	Ga0209148_100018131	297
1054	3300025254	Ga0209148_1014287	Ga0209148_10142872	297
1055	3300025256	Ga0209759_1000042	Ga0209759_1000042168	297
1056	3300025256	Ga0209759_1000226	Ga0209759_100022630	297
1057	3300025256	Ga0209759_1010246	Ga0209759_10102462	297
1058	3300025258	Ga0209129_1002235	Ga0209129_100223510	297
1059	3300025258	Ga0209129_1003292	Ga0209129_10032927	297
1060	3300025258	Ga0209129_1007578	Ga0209129_10075784	297
1061	3300025258	Ga0209129_1007589	Ga0209129_10075895	297
1062	3300025258	Ga0209129_1007828	Ga0209129_10078282	297
1063	3300025258	Ga0209129_1012878	Ga0209129_10128782	297
1064	3300025258	Ga0209129_1014003	Ga0209129_10140032	297
1065	3300025261	Ga0209233_1000127	Ga0209233_1000127197	297
1066	3300025261	Ga0209233_1002121	Ga0209233_10021214	297
1067	3300025261	Ga0209233_1002441	Ga0209233_10024417	297
1068	3300025261	Ga0209233_1010162	Ga0209233_10101623	297
1069	3300025272	Ga0209455_1000127	Ga0209455_100012731	297
1070	3300025272	Ga0209455_1002309	Ga0209455_10023094	297
1071	3300025272	Ga0209455_1007778	Ga0209455_10077781	297
1072	3300025273	Ga0209673_1001500	Ga0209673_100150019	297
1073	3300025273	Ga0209673_1001698	Ga0209673_100169815	297
1074	3300025273	Ga0209673_1003618	Ga0209673_10036189	297
1075	3300025273	Ga0209673_1004602	Ga0209673_10046022	297
1076	3300025273	Ga0209673_1014346	Ga0209673_10143463	297
1077	3300025273	Ga0209673_1020125	Ga0209673_10201253	297
1078	3300025284	Ga0209130_1000006	Ga0209130_1000006316	297
1079	3300025284	Ga0209130_1000075	Ga0209130_100007587	297
1080	3300025284	Ga0209130_1019377	Ga0209130_10193772	297
1081	3300025292	Ga0209676_1002745	Ga0209676_10027455	297
1082	3300025292	Ga0209676_1009621	Ga0209676_10096213	297
1083	3300025292	Ga0209676_1016764	Ga0209676_10167644	297
1084	3300025292	Ga0209676_1018524	Ga0209676_10185243	297
1085	3300025294	Ga0209025_1000747	Ga0209025_100074723	297
1086	3300025294	Ga0209025_1002179	Ga0209025_100217918	297
1087	3300025294	Ga0209025_1003076	Ga0209025_10030763	297
1088	3300025294	Ga0209025_1005530	Ga0209025_100553011	297
1089	3300025294	Ga0209025_1019872	Ga0209025_10198722	297
1090	3300025294	Ga0209025_1023458	Ga0209025_10234584	297
1091	3300025294	Ga0209025_1031705	Ga0209025_10317052	297
1092	3300025294	Ga0209025_1033504	Ga0209025_10335043	297
1093	3300025295	Ga0209564_1000278	Ga0209564_100027815	297
1094	3300025295	Ga0209564_1003938	Ga0209564_10039389	297
1095	3300025295	Ga0209564_1010354	Ga0209564_10103544	297
1096	3300025295	Ga0209564_1016961	Ga0209564_10169612	297
1097	3300025295	Ga0209564_1017385	Ga0209564_10173852	297
1098	3300025297	Ga0209758_1000642	Ga0209758_100064218	297
1099	3300025297	Ga0209758_1003235	Ga0209758_10032355	297
1100	3300025297	Ga0209758_1009036	Ga0209758_10090367	297
1101	3300025297	Ga0209758_1017526	Ga0209758_10175264	297
1102	3300025297	Ga0209758_1019294	Ga0209758_10192943	297
1103	3300025297	Ga0209758_1021798	Ga0209758_10217984	297
1104	3300025297	Ga0209758_1021923	Ga0209758_10219233	297
1105	3300025297	Ga0209758_1023223	Ga0209758_10232232	297
1106	3300025297	Ga0209758_1030545	Ga0209758_10305451	297
1107	3300025297	Ga0209758_1033698	Ga0209758_10336982	297
1108	3300025298	Ga0209050_1005758	Ga0209050_10057589	297
1109	3300025298	Ga0209050_1015065	Ga0209050_10150654	297
1110	3300025298	Ga0209050_1023578	Ga0209050_10235782	297
1111	3300025299	Ga0209256_1000411	Ga0209256_100041157	297
1112	3300025299	Ga0209256_1002419	Ga0209256_100241911	297
1113	3300025299	Ga0209256_1005294	Ga0209256_10052944	297
1114	3300025299	Ga0209256_1014210	Ga0209256_10142104	297
1115	3300025299	Ga0209256_1021555	Ga0209256_10215552	297
1116	3300025302	Ga0207426_1000163	Ga0207426_100016387	297
1117	3300025302	Ga0207426_1000231	Ga0207426_1000231106	297
1118	3300025302	Ga0207426_1003737	Ga0207426_10037373	297
1119	3300025302	Ga0207426_1006348	Ga0207426_10063482	297
1120	3300025303	Ga0209051_1001154	Ga0209051_100115410	297
1121	3300025303	Ga0209051_1011120	Ga0209051_10111203	297
1122	3300025303	Ga0209051_1012613	Ga0209051_10126133	297
1123	3300025303	Ga0209051_1025517	Ga0209051_10255172	297
1124	3300025303	Ga0209051_1037321	Ga0209051_10373213	297
1125	3300025303	Ga0209051_1041852	Ga0209051_10418523	297
1126	3300025303	Ga0209051_1056288	Ga0209051_10562881	297
1127	3300025304	Ga0209257_1000589	Ga0209257_10005899	297
1128	3300025304	Ga0209257_1003204	Ga0209257_100320410	297
1129	3300025304	Ga0209257_1005658	Ga0209257_10056587	297
1130	3300025304	Ga0209257_1011112	Ga0209257_10111123	297
1131	3300025315	Ga0207697_10029535	Ga0207697_100295352	297
1132	3300025900	Ga0207710_10007520	Ga0207710_100075203	297
1133	3300025901	Ga0207688_10159661	Ga0207688_101596612	297
1134	3300025903	Ga0207680_10148438	Ga0207680_101484382	297
1135	3300025906	Ga0207699_10004446	Ga0207699_100044466	297
1136	3300025907	Ga0207645_10082613	Ga0207645_100826132	297
1137	3300025911	Ga0207654_10046931	Ga0207654_100469313	297
1138	3300025911	Ga0207654_10216210	Ga0207654_102162102	297
1139	3300025913	Ga0207695_10003483	Ga0207695_100034834	297
1140	3300025914	Ga0207671_10008330	Ga0207671_1000833011	297
1141	3300025915	Ga0207693_10133277	Ga0207693_101332772	297
1142	3300025916	Ga0207663_10093421	Ga0207663_100934212	297
1143	3300025919	Ga0207657_10045524	Ga0207657_100455242	297
1144	3300025920	Ga0207649_10188183	Ga0207649_101881832	297
1145	3300025924	Ga0207694_10081635	Ga0207694_100816352	297
1146	3300025925	Ga0207650_10082327	Ga0207650_100823273	297
1147	3300025927	Ga0207687_10252560	Ga0207687_102525601	297
1148	3300025937	Ga0207669_10191291	Ga0207669_101912912	297
1149	3300025938	Ga0207704_10207739	Ga0207704_102077391	297
1150	3300025939	Ga0207665_10120201	Ga0207665_101202012	297
1151	3300025940	Ga0207691_10163496	Ga0207691_101634962	297
1152	3300025941	Ga0207711_10041196	Ga0207711_100411965	297
1153	3300025949	Ga0207667_10134541	Ga0207667_101345411	297
1154	3300025961	Ga0207712_10351818	Ga0207712_103518182	297
1155	3300026041	Ga0207639_10078250	Ga0207639_100782503	297
1156	3300026041	Ga0207639_10099348	Ga0207639_100993482	297
1157	3300026067	Ga0207678_10118061	Ga0207678_101180612	297
1158	3300026067	Ga0207678_10453947	Ga0207678_104539471	297
1159	3300026075	Ga0207708_10161214	Ga0207708_101612142	297
1160	3300026078	Ga0207702_10035796	Ga0207702_100357964	297
1161	3300026089	Ga0207648_10039191	Ga0207648_100391915	297
1162	3300026089	Ga0207648_10096649	Ga0207648_100966493	297
1163	3300026116	Ga0207674_10522641	Ga0207674_105226411	297
1164	3300026118	Ga0207675_100043535	Ga0207675_1000435353	297
1165	3300026118	Ga0207675_100277694	Ga0207675_1002776942	297
1166	3300026142	Ga0207698_10068317	Ga0207698_100683173	297
1167	3300027312	Ga0209371_1001144	Ga0209371_100114417	297
1168	3300027312	Ga0209371_1008348	Ga0209371_10083483	297
1169	3300027512	Ga0209179_1001475	Ga0209179_10014753	297
1170	3300027666	Ga0209282_1021670	Ga0209282_10216702	297
1171	3300027866	Ga0209813_10052872	Ga0209813_100528721	297
1172	3300027907	Ga0207428_10170923	Ga0207428_101709231	297
1173	3300028379	Ga0268266_10222683	Ga0268266_102226832	297
1174	3300028379	Ga0268266_10405774	Ga0268266_104057742	297
1175	3300028381	Ga0268264_10000050	Ga0268264_10000050209	297
1176	3300028381	Ga0268264_10579533	Ga0268264_105795331	297
1177	3300028558	Ga0265326_10001007	Ga0265326_100010074	297
1178	3300028563	Ga0265319_1002047	Ga0265319_10020473	297
1179	3300028573	Ga0265334_10001575	Ga0265334_100015759	297
1180	3300028577	Ga0265318_10001829	Ga0265318_100018296	297
1181	3300028653	Ga0265323_10000558	Ga0265323_1000055812	297
1182	3300028666	Ga0265336_10000168	Ga0265336_1000016845	297
1183	3300028794	Ga0307515_10000569	Ga0307515_100005694	297
1184	3300028794	Ga0307515_10002598	Ga0307515_1000259831	297
1185	3300028794	Ga0307515_10132913	Ga0307515_101329135	297
1186	3300028794	Ga0307515_10140200	Ga0307515_101402003	297
1187	3300028800	Ga0265338_10000318	Ga0265338_1000031848	297
1188	3300029957	Ga0265324_10002656	Ga0265324_100026564	297
1189	3300030500	Ga0268256_1000978	Ga0268256_100097817	297
1190	3300030500	Ga0268256_1004043	Ga0268256_10040433	297
1191	3300030521	Ga0307511_10053472	Ga0307511_100534723	297
1192	3300030521	Ga0307511_10136759	Ga0307511_101367592	297
1193	3300030744	Ga0316181_1102431	Ga0316181_11024312	297
1194	3300031250	Ga0265331_10104894	Ga0265331_101048941	297
1195	3300031456	Ga0307513_10006680	Ga0307513_100066809	297
1196	3300031456	Ga0307513_10073589	Ga0307513_100735892	297
1197	3300031616	Ga0307508_10000199	Ga0307508_1000019933	297
1198	3300031616	Ga0307508_10256949	Ga0307508_102569492	297
1199	3300031727	Ga0316576_10038517	Ga0316576_100385172	297
1200	3300031730	Ga0307516_10002704	Ga0307516_1000270426	297
1201	3300031731	Ga0307405_10025534	Ga0307405_100255345	297
1202	3300031903	Ga0307407_10268805	Ga0307407_102688051	297
1203	3300031911	Ga0307412_10002486	Ga0307412_100024865	297
1204	3300032004	Ga0307414_10130890	Ga0307414_101308901	297
1205	3300032004	Ga0307414_10154144	Ga0307414_101541442	297
1206	3300032005	Ga0307411_10019865	Ga0307411_100198653	297
1207	3300033180	Ga0307510_10000403	Ga0307510_1000040327	297
1208	3300035111	Ga0373923_0160127	Ga0373923_0160127_83_982	297
1209	3300035113	Ga0373936_0025121	Ga0373936_0025121_855_1754	297
1210	3300035114	Ga0373939_0090162	Ga0373939_0090162_24_923	297
1211	3300035121	Ga0373960_0025413	Ga0373960_0025413_662_1561	297
1212	3300035170	Ga0373943_0028308	Ga0373943_0028308_243_1139	297
1213	3300035691	Ga0373931_0000221	Ga0373931_0000221_3532_4431	297
1214	3300035692	Ga0373935_0072091	Ga0373935_0072091_1199_2098	297
1215	3300035695	Ga0373927_0000055	Ga0373927_0000055_30535_31434	297
1216	3300035695	Ga0373927_0055787	Ga0373927_0055787_493_1392	297
1217	3300035695	Ga0373927_0074288	Ga0373927_0074288_1282_2181	297
1218	3300036459	Ga0372808_000221	Ga0372808_000221_1947_2846	297
1219	3300036647	Ga0316582_0215490	Ga0316582_0215490_233_1135	297
1220	3300036712	Ga0316584_0030616	Ga0316584_0030616_507_1409	297
1221	3300036712	Ga0316584_0140521	Ga0316584_0140521_286_1182	297
1222	3300037068	Ga0373925_0020042	Ga0373925_0020042_2839_3738	297
1223	3300037471	Ga0395905_0266143	Ga0395905_0266143_18_926	297
1224	3300037853	Ga0436364_0503752	Ga0436364_0503752_1603_2508	297
1225	3300039062	Ga0400483_010277	Ga0400483_010277_228_1130	297
1226	3300039437	Ga0436365_1151503	Ga0436365_1151503_503_1399	297
1227	3300039438	Ga0436360_0308336	Ga0436360_0308336_94_990	297
1228	3300039447	Ga0436361_0364845	Ga0436361_0364845_1218_2117	297
1229	3300039447	Ga0436361_0957424	Ga0436361_0957424_1311_2228	297
1230	3300039447	Ga0436361_1094242	Ga0436361_1094242_70_966	297
1231	3300039453	Ga0436362_0911672	Ga0436362_0911672_72_992	297
1232	3300041404	Ga0439436_0003987	Ga0439436_0003987_3291_4184	297
1233	3300041413	Ga0439465_0009859	Ga0439465_0009859_1273_2166	297
1234	3300041458	Ga0451798_0815533	Ga0451798_0815533_2304_3197	297
1235	3300041491	Ga0451833_1077262	Ga0451833_1077262_111_1028	297
1236	3300041492	Ga0451835_1216947	Ga0451835_1216947_244_1137	297
1237	3300041496	Ga0451839_0890023	Ga0451839_0890023_641_1534	297
1238	3300041498	Ga0451841_0731336	Ga0451841_0731336_3978_4874	297
1239	3300041503	Ga0451847_0318036	Ga0451847_0318036_664_1560	297
1240	3300041504	Ga0451848_02693	Ga0451848_02693_311_1204	297
1241	3300041505	Ga0451849_0204578	Ga0451849_0204578_746_1642	297
1242	3300041507	Ga0451851_0020457	Ga0451851_0020457_163_1056	297
1243	3300041509	Ga0451843_0149897	Ga0451843_0149897_650_1543	297
1244	3300041510	Ga0451854_00651	Ga0451854_00651_719_1612	297
1245	3300041511	Ga0451855_0842450	Ga0451855_0842450_480_1373	297
1246	3300041512	Ga0451853_0993938	Ga0451853_0993938_85_981	297
1247	3300041512	Ga0451853_1862219	Ga0451853_1862219_1687_2580	297
1248	3300041997	Ga0439431_0024822	Ga0439431_0024822_377_1276	297
1249	3300042015	Ga0439462_0018013	Ga0439462_0018013_909_1802	297
1250	3300042435	Ga0439434_0008118	Ga0439434_0008118_1620_2513	297
1251	3300042531	Ga0450918_001395	Ga0450918_001395_2864_3757	297
1252	3300042876	Ga0451577_0001192	Ga0451577_0001192_24976_25878	297
1253	3300042993	Ga0439440_0051669	Ga0439440_0051669_63_962	297
1254	3300044684	Ga0466966_0118019	Ga0466966_0118019_339_1247	297
1255	3300044712	Ga0453684_0001264	Ga0453684_0001264_33389_34291	297
1256	3300045051	Ga0451576_0179735	Ga0451576_0179735_518_1420	297
1257	3300046453	Ga0495627_049537	Ga0495627_049537_281_1180	297
1258	3300046457	Ga0495590_0007845	Ga0495590_0007845_3016_3915	297
1259	3300046459	Ga0495629_0023093	Ga0495629_0023093_2316_3209	297
1260	3300046459	Ga0495629_0134240	Ga0495629_0134240_608_1501	297
1261	3300046460	Ga0495638_0010819	Ga0495638_0010819_5123_6016	297
1262	3300046460	Ga0495638_0013734	Ga0495638_0013734_541_1434	297
1263	3300046462	Ga0495651_0078574	Ga0495651_0078574_149_1042	297
1264	3300046472	Ga0495580_0145772	Ga0495580_0145772_233_1132	297
1265	3300046474	Ga0495605_0009156	Ga0495605_0009156_226_1125	297
1266	3300046474	Ga0495605_0009836	Ga0495605_0009836_3009_3902	297
1267	3300046475	Ga0495639_0026397	Ga0495639_0026397_445_1344	297
1268	3300046475	Ga0495639_0042970	Ga0495639_0042970_486_1385	297
1269	3300046476	Ga0495662_0033627	Ga0495662_0033627_425_1318	297
1270	3300046477	Ga0495664_0165499	Ga0495664_0165499_77_973	297
1271	3300046491	Ga0495584_0063507	Ga0495584_0063507_442_1341	297
1272	3300046491	Ga0495584_0142848	Ga0495584_0142848_139_1035	297
1273	3300046492	Ga0495585_0032615	Ga0495585_0032615_1232_2125	297
1274	3300046492	Ga0495585_0121994	Ga0495585_0121994_204_1097	297
1275	3300046492	Ga0495585_0150217	Ga0495585_0150217_232_1125	297
1276	3300046500	Ga0495596_0109008	Ga0495596_0109008_22_918	297
1277	3300046501	Ga0495607_0030397	Ga0495607_0030397_1211_2107	297
1278	3300046506	Ga0495583_0011364	Ga0495583_0011364_3782_4675	297
1279	3300046506	Ga0495583_0014128	Ga0495583_0014128_1708_2604	297
1280	3300046507	Ga0495606_0002223	Ga0495606_0002223_7403_8299	297
1281	3300046507	Ga0495606_0046547	Ga0495606_0046547_1466_2359	297
1282	3300046507	Ga0495606_0120570	Ga0495606_0120570_409_1308	297
1283	3300046512	Ga0495610_0021848	Ga0495610_0021848_2030_2929	297
1284	3300046512	Ga0495610_0035844	Ga0495610_0035844_348_1241	297
1285	3300046513	Ga0495616_0014226	Ga0495616_0014226_1886_2782	297
1286	3300046513	Ga0495616_0039130	Ga0495616_0039130_1517_2416	297
1287	3300046515	Ga0495620_0012741	Ga0495620_0012741_1686_2582	297
1288	3300046515	Ga0495620_0022973	Ga0495620_0022973_1466_2359	297
1289	3300046515	Ga0495620_0051399	Ga0495620_0051399_419_1312	297
1290	3300046518	Ga0495631_0010594	Ga0495631_0010594_1689_2582	297
1291	3300046519	Ga0495632_0010710	Ga0495632_0010710_2902_3795	297
1292	3300046519	Ga0495632_0021029	Ga0495632_0021029_1031_1927	297
1293	3300046519	Ga0495632_0041687	Ga0495632_0041687_719_1612	297
1294	3300046522	Ga0495643_0015880	Ga0495643_0015880_1887_2783	297
1295	3300046522	Ga0495643_0048510	Ga0495643_0048510_1323_2222	297
1296	3300046522	Ga0495643_0074119	Ga0495643_0074119_770_1663	297
1297	3300046522	Ga0495643_0130322	Ga0495643_0130322_259_1155	297
1298	3300046524	Ga0495648_0036942	Ga0495648_0036942_1281_2174	297
1299	3300046524	Ga0495648_0097724	Ga0495648_0097724_344_1237	297
1300	3300046530	Ga0495654_0091985	Ga0495654_0091985_342_1241	297
1301	3300046538	Ga0495609_0037782	Ga0495609_0037782_463_1362	297
1302	3300046542	Ga0495597_0011373	Ga0495597_0011373_2180_3079	297
1303	3300046542	Ga0495597_0034962	Ga0495597_0034962_12_908	297
1304	3300046557	Ga0495622_0014987	Ga0495622_0014987_660_1553	297
1305	3300046557	Ga0495622_0120165	Ga0495622_0120165_263_1156	297
1306	3300046558	Ga0495633_0038748	Ga0495633_0038748_720_1613	297
1307	3300046558	Ga0495633_0039443	Ga0495633_0039443_107_1000	297
1308	3300046558	Ga0495633_0051187	Ga0495633_0051187_33_932	297
1309	3300046616	Ga0495668_0021461	Ga0495668_0021461_1322_2221	297
1310	3300046616	Ga0495668_0033331	Ga0495668_0033331_1668_2561	297
1311	3300046616	Ga0495668_0039193	Ga0495668_0039193_1522_2418	297
1312	3300046616	Ga0495668_0057259	Ga0495668_0057259_273_1166	297
1313	3300046660	Ga0495625_0019055	Ga0495625_0019055_4181_5074	297
1314	3300046660	Ga0495625_0024082	Ga0495625_0024082_548_1444	297
1315	3300046660	Ga0495625_0026988	Ga0495625_0026988_1682_2578	297
1316	3300046660	Ga0495625_0103751	Ga0495625_0103751_636_1529	297
1317	3300046660	Ga0495625_0144715	Ga0495625_0144715_250_1143	297
1318	3300046663	Ga0495635_0097865	Ga0495635_0097865_273_1166	297
1319	3300046674	Ga0495588_0139412	Ga0495588_0139412_67_966	297
1320	3300046675	Ga0495657_0086760	Ga0495657_0086760_516_1409	297
1321	3300046675	Ga0495657_0139585	Ga0495657_0139585_597_1490	297
1322	3300046683	Ga0495658_0043848	Ga0495658_0043848_1469_2368	297
1323	3300046690	Ga0495624_0059359	Ga0495624_0059359_285_1178	297
1324	3300046694	Ga0495649_0014824	Ga0495649_0014824_1662_2558	297
1325	3300046794	Ga0495589_0149880	Ga0495589_0149880_31_924	297
1326	3300046810	Ga0495660_0017304	Ga0495660_0017304_1686_2582	297
1327	3300046810	Ga0495660_0024291	Ga0495660_0024291_1303_2196	297
1328	3300047315	Ga0495581_0090768	Ga0495581_0090768_227_1126	297
1329	3300047315	Ga0495581_0141439	Ga0495581_0141439_385_1284	297
1330	3300047317	Ga0495604_0000886	Ga0495604_0000886_22413_23306	297
1331	3300047317	Ga0495604_0156699	Ga0495604_0156699_639_1532	297
1332	3300047321	Ga0495676_0249289	Ga0495676_0249289_38_937	297
1333	3300047323	Ga0495683_0021267	Ga0495683_0021267_904_1800	297
1334	3300047443	Ga0495687_012435	Ga0495687_012435_1896_2792	297
1335	3300047443	Ga0495687_021942	Ga0495687_021942_348_1244	297
1336	3300047443	Ga0495687_092179	Ga0495687_092179_53_946	297
1337	3300047470	Ga0495681_0058668	Ga0495681_0058668_231_1130	297
1338	3300047472	Ga0495686_0000301	Ga0495686_0000301_5338_6234	297
1339	3300047472	Ga0495686_0023397	Ga0495686_0023397_1420_2316	297
1340	3300047472	Ga0495686_0041683	Ga0495686_0041683_1413_2309	297
1341	3300047472	Ga0495686_0056257	Ga0495686_0056257_637_1530	297
1342	3300048090	Ga0495615_0002843	Ga0495615_0002843_1777_2670	297
1343	3300048091	Ga0495626_0023525	Ga0495626_0023525_1562_2458	297
1344	3300048903	Ga0496100_0029263	Ga0496100_0029263_385_1284	297
1345	3300048903	Ga0496100_0207323	Ga0496100_0207323_433_1332	297
1346	3300048904	Ga0496101_0032258	Ga0496101_0032258_1161_2060	297
1347	3300048905	Ga0496102_0003637	Ga0496102_0003637_4987_5886	297
1348	3300048906	Ga0496103_0048096	Ga0496103_0048096_591_1490	297
1349	3300048907	Ga0496104_0139418	Ga0496104_0139418_934_1833	297
1350	3300048908	Ga0496105_0003045	Ga0496105_0003045_3491_4390	297
1351	3300048909	Ga0496106_0001404	Ga0496106_0001404_6130_7026	297
1352	3300048909	Ga0496106_0006866	Ga0496106_0006866_3907_4806	297
1353	3300048909	Ga0496106_0014220	Ga0496106_0014220_1626_2519	297
1354	3300048911	Ga0496108_0110211	Ga0496108_0110211_866_1765	297
1355	3300048912	Ga0496109_0006604	Ga0496109_0006604_4858_5757	297
1356	3300048913	Ga0496110_0001819	Ga0496110_0001819_12030_12929	297
1357	3300048914	Ga0496111_0025285	Ga0496111_0025285_1614_2513	297
1358	3300048914	Ga0496111_0088444	Ga0496111_0088444_906_1799	297
1359	3300048915	Ga0496112_0003238	Ga0496112_0003238_1431_2330	297
1360	3300048916	Ga0496113_0012993	Ga0496113_0012993_1187_2086	297
1361	3300048916	Ga0496113_0035262	Ga0496113_0035262_1239_2135	297
1362	3300048917	Ga0496114_0081749	Ga0496114_0081749_1176_2075	297
1363	3300048918	Ga0496115_0015090	Ga0496115_0015090_3381_4280	297
1364	3300048919	Ga0496116_0011007	Ga0496116_0011007_1984_2877	297
1365	3300048919	Ga0496116_0032696	Ga0496116_0032696_2390_3283	297
1366	3300048919	Ga0496116_0078596	Ga0496116_0078596_927_1835	297
1367	3300048919	Ga0496116_0089817	Ga0496116_0089817_247_1140	297
1368	3300048919	Ga0496116_0170069	Ga0496116_0170069_51_944	297
1369	3300048920	Ga0496117_0013389	Ga0496117_0013389_1390_2283	297
1370	3300048920	Ga0496117_0021122	Ga0496117_0021122_4243_5136	297
1371	3300048920	Ga0496117_0042492	Ga0496117_0042492_2164_3057	297
1372	3300048920	Ga0496117_0231245	Ga0496117_0231245_31_930	297
1373	3300048921	Ga0496118_0015132	Ga0496118_0015132_4881_5774	297
1374	3300048921	Ga0496118_0027353	Ga0496118_0027353_1069_1968	297
1375	3300048921	Ga0496118_0043988	Ga0496118_0043988_2279_3172	297
1376	3300048921	Ga0496118_0136142	Ga0496118_0136142_66_959	297
1377	3300048922	Ga0496119_0011770	Ga0496119_0011770_1395_2288	297
1378	3300048922	Ga0496119_0036408	Ga0496119_0036408_1768_2661	297
1379	3300048922	Ga0496119_0103674	Ga0496119_0103674_61_957	297
1380	3300048923	Ga0496120_0008307	Ga0496120_0008307_5283_6176	297
1381	3300048924	Ga0496121_0003794	Ga0496121_0003794_4903_5796	297
1382	3300048924	Ga0496121_0004275	Ga0496121_0004275_7991_8887	297
1383	3300048924	Ga0496121_0005974	Ga0496121_0005974_14097_14993	297
1384	3300048924	Ga0496121_0008110	Ga0496121_0008110_11473_12369	297
1385	3300048924	Ga0496121_0013490	Ga0496121_0013490_1093_1992	297
1386	3300048924	Ga0496121_0023302	Ga0496121_0023302_927_1835	297
1387	3300048924	Ga0496121_0107039	Ga0496121_0107039_1099_2007	297
1388	3300048924	Ga0496121_0220036	Ga0496121_0220036_86_979	297
1389	3300048924	Ga0496121_0230729	Ga0496121_0230729_333_1241	297
1390	3300048925	Ga0496122_0002690	Ga0496122_0002690_7626_8519	297
1391	3300048925	Ga0496122_0013515	Ga0496122_0013515_4596_5504	297
1392	3300048925	Ga0496122_0044513	Ga0496122_0044513_2342_3235	297
1393	3300048925	Ga0496122_0062644	Ga0496122_0062644_1092_1997	297
1394	3300048926	Ga0496123_0000054	Ga0496123_0000054_41198_42091	297
1395	3300048926	Ga0496123_0042198	Ga0496123_0042198_2094_3002	297
1396	3300048926	Ga0496123_0064136	Ga0496123_0064136_1403_2296	297
1397	3300048926	Ga0496123_0074983	Ga0496123_0074983_1032_1940	297
1398	3300048926	Ga0496123_0088538	Ga0496123_0088538_574_1482	297
1399	3300048927	Ga0496124_0001147	Ga0496124_0001147_7327_8223	297
1400	3300048927	Ga0496124_0017858	Ga0496124_0017858_4552_5445	297
1401	3300048927	Ga0496124_0022174	Ga0496124_0022174_504_1415	297
1402	3300048927	Ga0496124_0025435	Ga0496124_0025435_927_1835	297
1403	3300048927	Ga0496124_0029566	Ga0496124_0029566_3740_4633	297
1404	3300048927	Ga0496124_0127084	Ga0496124_0127084_683_1576	297
1405	3300048927	Ga0496124_0147032	Ga0496124_0147032_617_1525	297
1406	3300048927	Ga0496124_0248242	Ga0496124_0248242_397_1296	297
1407	3300048928	Ga0496125_0019659	Ga0496125_0019659_3521_4429	297
1408	3300048928	Ga0496125_0053604	Ga0496125_0053604_1783_2676	297
1409	3300048928	Ga0496125_0112966	Ga0496125_0112966_236_1129	297
1410	3300048928	Ga0496125_0114094	Ga0496125_0114094_161_1057	297
1411	3300048929	Ga0496126_0014738	Ga0496126_0014738_6126_7022	297
1412	3300048929	Ga0496126_0027219	Ga0496126_0027219_3552_4460	297
1413	3300048929	Ga0496126_0074024	Ga0496126_0074024_49_942	297
1414	3300048929	Ga0496126_0103562	Ga0496126_0103562_435_1328	297
1415	3300048929	Ga0496126_0109986	Ga0496126_0109986_74_973	297
1416	3300048929	Ga0496126_0128495	Ga0496126_0128495_389_1285	297
1417	3300048929	Ga0496126_0192716	Ga0496126_0192716_155_1054	297
1418	3300048929	Ga0496126_0451732	Ga0496126_0451732_31_924	297
1419	3300049459	Ga0495678_027130	Ga0495678_027130_1249_2145	297
1420	3300049459	Ga0495678_068638	Ga0495678_068638_366_1265	297
1421	3300049460	Ga0495682_0024585	Ga0495682_0024585_683_1579	297
1422	3300049568	Ga0501031_0024558	Ga0501031_0024558_1966_2886	297
1423	3300049569	Ga0501032_0006279	Ga0501032_0006279_5644_6540	297
1424	3300049569	Ga0501032_0013495	Ga0501032_0013495_3561_4460	297
1425	3300049569	Ga0501032_0054621	Ga0501032_0054621_1388_2308	297
1426	3300049570	Ga0501033_0005198	Ga0501033_0005198_7545_8441	297
1427	3300049570	Ga0501033_0013268	Ga0501033_0013268_1407_2312	297
1428	3300049570	Ga0501033_0058135	Ga0501033_0058135_1909_2805	297
1429	3300049571	Ga0501034_0004317	Ga0501034_0004317_4890_5789	297
1430	3300049571	Ga0501034_0024242	Ga0501034_0024242_1255_2154	297
1431	3300049571	Ga0501034_0112206	Ga0501034_0112206_541_1437	297
1432	3300049571	Ga0501034_0174558	Ga0501034_0174558_379_1278	297
1433	3300049572	Ga0501036_0001934	Ga0501036_0001934_1169_2068	297
1434	3300049572	Ga0501036_0021763	Ga0501036_0021763_4249_5169	297
1435	3300049572	Ga0501036_0028446	Ga0501036_0028446_769_1707	297
1436	3300049572	Ga0501036_0036579	Ga0501036_0036579_1975_2871	297
1437	3300049572	Ga0501036_0294473	Ga0501036_0294473_286_1179	297
1438	3300049573	Ga0501037_0000616	Ga0501037_0000616_20898_21794	297
1439	3300049573	Ga0501037_0034094	Ga0501037_0034094_723_1622	297
1440	3300049573	Ga0501037_0045952	Ga0501037_0045952_2099_2995	297
1441	3300049573	Ga0501037_0174246	Ga0501037_0174246_500_1405	297
1442	3300049574	Ga0501038_0064206	Ga0501038_0064206_2162_3100	297
1443	3300049574	Ga0501038_0069348	Ga0501038_0069348_1473_2369	297
1444	3300049574	Ga0501038_0100997	Ga0501038_0100997_340_1236	297
1445	3300049575	Ga0501039_0001064	Ga0501039_0001064_18056_18955	297
1446	3300049575	Ga0501039_0031181	Ga0501039_0031181_3017_3955	297
1447	3300049579	Ga0501043_0000107	Ga0501043_0000107_55189_56085	297
1448	3300049579	Ga0501043_0000437	Ga0501043_0000437_21213_22112	297
1449	3300049579	Ga0501043_0022247	Ga0501043_0022247_192_1091	297
1450	3300049579	Ga0501043_0033981	Ga0501043_0033981_2162_3100	297
1451	3300049579	Ga0501043_0071488	Ga0501043_0071488_61_957	297
1452	3300049579	Ga0501043_0169439	Ga0501043_0169439_14_910	297
1453	3300049579	Ga0501043_0404937	Ga0501043_0404937_59_976	297
1454	3300049580	Ga0501046_0001272	Ga0501046_0001272_15834_16733	297
1455	3300049580	Ga0501046_0025745	Ga0501046_0025745_2025_2963	297
1456	3300049581	Ga0501047_0001090	Ga0501047_0001090_21640_22539	297
1457	3300049581	Ga0501047_0002658	Ga0501047_0002658_11202_12101	297
1458	3300049581	Ga0501047_0016172	Ga0501047_0016172_5080_5976	297
1459	3300049581	Ga0501047_0018682	Ga0501047_0018682_3578_4483	297
1460	3300049581	Ga0501047_0048280	Ga0501047_0048280_156_1055	297
1461	3300049581	Ga0501047_0284382	Ga0501047_0284382_104_1000	297
1462	3300049581	Ga0501047_0338205	Ga0501047_0338205_271_1176	297
1463	3300049582	Ga0501048_0001620	Ga0501048_0001620_10918_11856	297
1464	3300049582	Ga0501048_0023225	Ga0501048_0023225_275_1174	297
1465	3300049582	Ga0501048_0122796	Ga0501048_0122796_40_939	297
1466	3300049582	Ga0501048_0415899	Ga0501048_0415899_42_938	297
1467	3300049583	Ga0501067_0005687	Ga0501067_0005687_4543_5442	297
1468	3300049583	Ga0501067_0032314	Ga0501067_0032314_1285_2184	297
1469	3300049584	Ga0501068_0002694	Ga0501068_0002694_1423_2322	297
1470	3300049584	Ga0501068_0013753	Ga0501068_0013753_2062_2958	297
1471	3300049584	Ga0501068_0015059	Ga0501068_0015059_2290_3228	297
1472	3300049585	Ga0501069_0000039	Ga0501069_0000039_53772_54668	297
1473	3300049585	Ga0501069_0012395	Ga0501069_0012395_2406_3305	297
1474	3300049585	Ga0501069_0017259	Ga0501069_0017259_2729_3628	297
1475	3300049585	Ga0501069_0138095	Ga0501069_0138095_214_1110	297
1476	3300049586	Ga0501070_0000132	Ga0501070_0000132_20414_21310	297
1477	3300049586	Ga0501070_0000299	Ga0501070_0000299_36322_37227	297
1478	3300049586	Ga0501070_0002117	Ga0501070_0002117_15935_16831	297
1479	3300049586	Ga0501070_0014323	Ga0501070_0014323_4600_5517	297
1480	3300049586	Ga0501070_0020275	Ga0501070_0020275_3016_3954	297
1481	3300049586	Ga0501070_0228472	Ga0501070_0228472_608_1504	297
1482	3300049587	Ga0501071_0017388	Ga0501071_0017388_2159_3097	297
1483	3300049588	Ga0501072_0075205	Ga0501072_0075205_1169_2068	297
1484	3300049589	Ga0501073_0001958	Ga0501073_0001958_920_1819	297
1485	3300049589	Ga0501073_0182954	Ga0501073_0182954_149_1069	297
1486	3300049590	Ga0501074_0001123	Ga0501074_0001123_10739_11635	297
1487	3300049671	Ga0501238_015232	Ga0501238_015232_84_977	297
1488	3300049741	Ga0501079_0430781	Ga0501079_0430781_90_989	297
1489	3300049742	Ga0501080_0000293	Ga0501080_0000293_8893_9792	297
1490	3300049742	Ga0501080_0001676	Ga0501080_0001676_9570_10475	297
1491	3300049742	Ga0501080_0003023	Ga0501080_0003023_11171_12067	297
1492	3300049742	Ga0501080_0044767	Ga0501080_0044767_287_1225	297
1493	3300049742	Ga0501080_0072137	Ga0501080_0072137_1149_2045	297
1494	3300049742	Ga0501080_0185789	Ga0501080_0185789_406_1323	297
1495	3300049744	Ga0501083_0002416	Ga0501083_0002416_6326_7222	297
1496	3300049744	Ga0501083_0023073	Ga0501083_0023073_2225_3124	297
1497	3300049744	Ga0501083_0032153	Ga0501083_0032153_651_1544	297
1498	3300049758	Ga0501241_015744	Ga0501241_015744_455_1348	297
1499	3300049776	Ga0501280_005926	Ga0501280_005926_137_1030	297
1500	3300049822	Ga0501035_0000055	Ga0501035_0000055_116335_117231	297
1501	3300049822	Ga0501035_0000807	Ga0501035_0000807_23050_23946	297
1502	3300049822	Ga0501035_0011374	Ga0501035_0011374_249_1148	297
1503	3300049822	Ga0501035_0019785	Ga0501035_0019785_2261_3166	297
1504	3300049822	Ga0501035_0051897	Ga0501035_0051897_941_1837	297
1505	3300049822	Ga0501035_0072490	Ga0501035_0072490_625_1521	297
1506	3300049823	Ga0501044_0000071	Ga0501044_0000071_19444_20340	297
1507	3300049823	Ga0501044_0009546	Ga0501044_0009546_4890_5789	297
1508	3300049823	Ga0501044_0060853	Ga0501044_0060853_765_1703	297
1509	3300049823	Ga0501044_0069729	Ga0501044_0069729_119_1036	297
1510	3300049823	Ga0501044_0090336	Ga0501044_0090336_699_1595	297
1511	3300049823	Ga0501044_0092873	Ga0501044_0092873_1999_2895	297
1512	3300049823	Ga0501044_0101208	Ga0501044_0101208_1682_2587	297
1513	3300050489	nmdc:mga03683_35965_c1	nmdc:mga03683_35965_c1_644_1537	297
1514	3300050490	nmdc:mga03n38_33261_c1	nmdc:mga03n38_33261_c1_836_1744	297
1515	3300050491	nmdc:mga00v17_112919_c1	nmdc:mga00v17_112919_c1_537_1445	297
1516	3300050492	nmdc:mga0yw44_126470_c1	nmdc:mga0yw44_126470_c1_714_1610	297
1517	3300050492	nmdc:mga0yw44_25445_c1	nmdc:mga0yw44_25445_c1_1815_2711	297
1518	3300050492	nmdc:mga0yw44_63178_c1	nmdc:mga0yw44_63178_c1_606_1499	297
1519	3300050492	nmdc:mga0yw44_64429_c1	nmdc:mga0yw44_64429_c1_154_1062	297
1520	3300050492	nmdc:mga0yw44_7481_c1	nmdc:mga0yw44_7481_c1_191_1087	297
1521	3300050493	nmdc:mga0k408_24176_c1	nmdc:mga0k408_24176_c1_504_1397	297
1522	3300050494	nmdc:mga06z11_61262_c1	nmdc:mga06z11_61262_c1_429_1322	297
1523	3300050494	nmdc:mga06z11_75728_c1	nmdc:mga06z11_75728_c1_323_1216	297
1524	3300050495	nmdc:mga04h51_96604_c1	nmdc:mga04h51_96604_c1_43_942	297
1525	3300050496	nmdc:mga07m45_39259_c1	nmdc:mga07m45_39259_c1_899_1792	297
1526	3300050496	nmdc:mga07m45_93979_c1	nmdc:mga07m45_93979_c1_90_998	297
1527	3300050507	nmdc:mga05p37_523187_c1	nmdc:mga05p37_523187_c1_82_981	297
1528	3300050509	nmdc:mga0qj67_287882_c1	nmdc:mga0qj67_287882_c1_287_1180	297
1529	3300050516	nmdc:mga0sz30_14806_c1	nmdc:mga0sz30_14806_c1_887_1783	297
1530	3300050516	nmdc:mga0sz30_16549_c2	nmdc:mga0sz30_16549_c2_1485_2378	297
1531	3300050516	nmdc:mga0sz30_37124_c1	nmdc:mga0sz30_37124_c1_282_1190	297
1532	3300053079	Ga0500610_0033228	Ga0500610_0033228_579_1472	297
1533	3300053080	Ga0500635_0001263	Ga0500635_0001263_1535_2434	297
1534	3300053085	Ga0495619_0128060	Ga0495619_0128060_445_1344	297
1535	3300053087	Ga0500643_034012	Ga0500643_034012_182_1075	297
1536	3300053088	Ga0500644_0029809	Ga0500644_0029809_495_1394	297
1537	3300053090	Ga0500646_0059021	Ga0500646_0059021_205_1104	297
1538	3300053094	Ga0500566_0007888	Ga0500566_0007888_2069_2968	297
1539	3300053097	Ga0500648_067214	Ga0500648_067214_532_1428	297
1540	3300053103	Ga0500555_003111	Ga0500555_003111_167_1066	297
1541	3300053107	Ga0500560_011220	Ga0500560_011220_428_1321	297
1542	3300053109	Ga0500569_031723	Ga0500569_031723_303_1196	297
1543	3300053111	Ga0500572_068582	Ga0500572_068582_67_963	297
1544	3300053119	Ga0500595_000266	Ga0500595_000266_30604_31503	297
1545	3300053119	Ga0500595_008461	Ga0500595_008461_557_1456	297
1546	3300053119	Ga0500595_023903	Ga0500595_023903_332_1228	297
1547	3300053119	Ga0500595_059930	Ga0500595_059930_162_1058	297
1548	3300053121	Ga0500607_135057	Ga0500607_135057_49_942	297
1549	3300053125	Ga0500618_021382	Ga0500618_021382_663_1556	297
1550	3300053130	Ga0500642_0044937	Ga0500642_0044937_462_1361	297
1551	3300053133	Ga0500655_020370	Ga0500655_020370_299_1198	297
1552	3300053134	Ga0500658_0035897	Ga0500658_0035897_636_1529	297
1553	3300053136	Ga0500559_0002203	Ga0500559_0002203_5038_5949	297
1554	3300053136	Ga0500559_0007890	Ga0500559_0007890_566_1459	297
1555	3300053137	Ga0500561_0008757	Ga0500561_0008757_977_1876	297
1556	3300053139	Ga0500568_0042209	Ga0500568_0042209_293_1186	297
1557	3300053139	Ga0500568_0082455	Ga0500568_0082455_31_930	297
1558	3300053140	Ga0500573_0033993	Ga0500573_0033993_1118_2014	297
1559	3300053148	Ga0500590_006071	Ga0500590_006071_4065_4958	297
1560	3300053148	Ga0500590_075323	Ga0500590_075323_712_1605	297
1561	3300053153	Ga0500616_0000884	Ga0500616_0000884_8073_8966	297
1562	3300053153	Ga0500616_0009830	Ga0500616_0009830_294_1187	297
1563	3300053153	Ga0500616_0044974	Ga0500616_0044974_826_1719	297
1564	3300053156	Ga0500622_0004653	Ga0500622_0004653_4022_4915	297
1565	3300053156	Ga0500622_0005524	Ga0500622_0005524_4592_5485	297
1566	3300053157	Ga0500624_002493	Ga0500624_002493_267_1160	297
1567	3300053159	Ga0500630_137071	Ga0500630_137071_10_909	297
1568	3300053162	Ga0500638_030414	Ga0500638_030414_1223_2122	297
1569	3300053162	Ga0500638_120571	Ga0500638_120571_178_1074	297
1570	3300053163	Ga0500639_004632	Ga0500639_004632_4915_5814	297
1571	3300053177	Ga0500636_0027700	Ga0500636_0027700_2046_2942	297
1572	3300053177	Ga0500636_0075824	Ga0500636_0075824_821_1714	297
1573	3300053178	Ga0500637_0039571	Ga0500637_0039571_1092_1991	297
1574	3300053725	Ga0500576_042052	Ga0500576_042052_740_1648	297
1575	3300053727	Ga0500611_026737	Ga0500611_026737_26_925	297
1576	3300053730	Ga0500645_018345	Ga0500645_018345_422_1321	297
1577	3300053731	Ga0500609_010534	Ga0500609_010534_302_1201	297
1578	3300053735	Ga0500596_000883	Ga0500596_000883_1435_2346	297
1579	3300054114	Ga0501084_0000766	Ga0501084_0000766_15589_16488	297
1580	3300055283	Ga0500661_004850	Ga0500661_004850_1442_2341	297
1581	3300060353	Ga0501082_0023367	Ga0501082_0023367_2077_2976	297
1582	3300060353	Ga0501082_0026105	Ga0501082_0026105_3297_4196	297
1583	iso_pu_bacteria	2600255279	2601613144	297
1584	iso_pu_bacteria	2600255308	2601749926	297
1585	iso_pu_bacteria	2643221629	2644164561	297
1586	iso_pu_bacteria	2643221662	2644346168	297
1587	iso_pu_bacteria	2874168670	2874174772	297

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07993

NAD_binding_4

Male sterility protein

73

221

0.84 PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

22

263

0.81 PF01370

Epimerase

NAD dependent epimerase/dehydratase family

21

257

0.75 PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

22

196

0.65 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6jkg-assembly1.cif.gz_B	the nad+-free form of human nsdhl	0.8385	1	183
6jkg-assembly1.cif.gz_A	the nad+-free form of human nsdhl	0.8206	2	183
3m2p-assembly1.cif.gz_B	the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus	0.799	2	294
3m2p-assembly2.cif.gz_F	the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus	0.7923	2	294
3m2p-assembly3.cif.gz_E	the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus	0.7913	2	294

ID	Description	Score	Start	End	Superfamily
4id9A01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9035	5	289	3.40.50.720
4id9A01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.8952	5	289	3.40.50.720
3aw9B01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.8571	4	239	3.40.50.720
af_A0A1D6MTK5_41_178_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.8563	1	125	3.40.50.720
4zrnB01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.8508	4	238	3.40.50.720

ID	Description	Score	Start	End
AF-A0A519DYC5-F1-model_v4	deleted	0.9858	1	288
AF-A0A4R1X945-F1-model_v4	UDP-glucose 4-epimerase	0.9842	1	297
AF-A0A059WZ36-F1-model_v4	NAD dependent epimerase/dehydratase family	0.984	140	297
AF-A0A4R1X945-F1-model_v4	UDP-glucose 4-epimerase	0.9809	1	297
AF-A0A2G2DE46-F1-model_v4	Nucleoside-diphosphate-sugar epimerase	0.9806	4	296

Feature Viewer

pLDDT	pTM	Quality
93.12	0.92	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F494919

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF07993

NAD_binding_4

Male sterility protein

73

221

0.84

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

22

263

0.81

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

21

257

0.75

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

22

196

0.65

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map