F494802

General Info

Members Datasets Scaffolds Average Seq Length
1568 720 1344 430

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_1260219|Ga0436365_1260219_567_1952
Length 461
Sequence MTPAARLSAAIEVIDTIEAQRSPAAQALKEWGTSHRFAGSGDRAAIAGLVWDVLRRRASSAWVMDDDAPRSRVLGMLKVERGLDAEAIAALCDGGRFAPGPLTEAEHGALATRSPADAPAPIAGDYPEWLDPYLAKVFGEDRAAEAAAMASRAPLDLRVNTLKAKREKVLASLKHLGAHETPWSPMGLRIELGADAKNPGVHAEEDFIKGLVEVQDEGSQLAALFSAAKPGEQVIDLCAGAGGKTLALAAMMQGKGRLIATDHDKRQLVPIHQRLSRAGVHNAEVRTPKGEAETLSDIKASADLVLIDAPCTGTGTWRRNPDAKWRMRPGALEIRVKDQIEVLDRAAAMVKPGGRIAYITCSVLPEENSEQVRAFVARHPAFAIASPGETVGVLWDKADAFAEAALRLPEGWLMTPRRTGTDGFFVAILRRTSRSAPQTTLIVSRGTSPSPARRRGQAGAN

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
3 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
4 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
5 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
6 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
7 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
10 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
11 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
12 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
13 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
14 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
15 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
16 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
17 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
18 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
19 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
20 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
21 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
22 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
23 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
24 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
25 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
26 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
27 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
28 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
29 2643221651 Afipia sp. Root123D2 Isolate Unclassified
30 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
31 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
32 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
33 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
34 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
35 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
36 2791355199
37 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
38 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
39 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
40 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
41 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
42 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
43 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
44 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
45 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
46 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
47 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
48 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
49 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
50 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
51 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
52 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
53 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
54 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
55 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
56 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
57 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
58 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
59 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
60 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
61 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
62 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
63 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
64 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
65 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
66 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
67 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
68 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
69 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
70 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
71 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
72 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
73 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
74 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
75 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
76 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
77 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
78 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
79 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
80 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
81 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
82 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
83 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
84 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
85 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
86 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
87 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
88 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
89 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
90 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
91 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
92 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
93 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
94 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
95 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
96 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
97 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
98 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
99 2904699407
100 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
101 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
102 2906610324
103 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
104 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
105 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
106 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
107 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
108 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
109 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
110 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
111 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
112 2922368715
113 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
114 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
115 2922425934
116 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
117 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
118 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
119 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
120 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
121 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
122 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
123 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
124 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
125 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
126 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
127 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
128 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
129 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
130 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
131 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
132 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
133 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
134 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
135 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
136 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
137 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
138 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
139 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
140 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
141 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
142 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
143 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
144 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
145 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
146 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
147 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
148 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
149 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
150 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
151 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
152 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
153 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
154 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
155 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
156 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
157 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
158 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
159 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
160 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
161 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
162 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
163 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
164 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
165 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
166 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
167 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
168 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
169 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
170 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
171 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
172 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
173 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
174 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
175 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
176 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
177 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
178 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
179 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
180 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
181 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
182 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
183 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
184 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
185 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
186 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
187 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
188 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
189 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
190 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
191 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
192 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
193 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
194 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
195 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
196 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
197 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
198 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
199 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
200 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
201 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
202 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
203 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
204 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
205 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
206 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
207 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
208 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
209 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
210 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
211 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
212 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
213 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
214 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
215 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
216 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
217 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
218 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
219 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
220 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
221 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
222 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
223 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
224 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
225 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
226 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
227 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
228 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
229 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
230 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
231 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
232 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
233 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
234 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
235 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
236 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
237 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
238 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
239 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
240 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
241 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
242 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
243 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
244 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
245 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
246 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
247 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
248 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
249 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
250 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
251 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
252 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
253 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
254 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
255 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
256 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
257 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
258 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
259 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
260 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
261 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
262 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
263 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
264 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
265 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
266 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
267 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
268 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
269 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
270 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
271 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
272 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
273 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
274 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
275 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
276 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
277 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
278 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
279 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
280 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
281 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
282 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
283 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
284 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
285 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
286 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
287 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
288 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
289 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
290 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
291 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
292 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
293 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
294 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
295 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
296 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
297 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
298 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
299 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
300 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
301 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
302 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
303 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
304 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
305 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
306 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
307 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
308 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
309 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
310 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
311 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
312 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
313 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
314 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
315 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
316 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
317 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
318 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
319 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
320 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
321 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
322 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
323 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
324 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
325 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
326 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
327 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
328 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
329 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
330 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
331 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
332 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
333 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
334 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
335 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
336 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
337 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
338 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
339 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
341 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
342 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
343 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
344 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
345 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
346 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
347 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
400 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
402 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
403 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
404 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
405 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
406 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
407 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
408 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
409 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
410 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
411 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
412 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
413 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
414 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
415 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
416 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
417 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
418 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
419 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
420 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
421 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
422 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
423 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
424 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
425 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
426 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
427 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
428 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
429 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
430 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
431 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
432 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
433 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
434 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
435 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
436 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
437 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
438 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
439 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
440 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
441 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
442 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
443 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
444 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
445 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
446 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
447 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
448 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
449 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
450 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
451 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
452 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
453 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
454 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
455 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
456 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
457 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
458 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
459 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
460 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
461 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
462 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
463 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
464 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
465 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
466 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
467 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
468 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
469 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
470 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
471 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
472 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
473 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
474 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
475 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
476 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
477 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
478 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
479 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
480 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
481 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
482 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
483 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
484 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
485 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
486 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
487 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
488 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
489 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
490 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
491 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
492 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
493 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
494 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
495 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
496 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
497 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
498 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
499 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
500 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
501 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
502 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
503 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
504 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
505 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
506 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
507 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
508 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
509 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
510 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
511 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
512 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
513 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
514 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
515 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
516 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
517 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
518 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
519 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
520 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
521 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
522 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
523 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
524 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
525 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
526 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
527 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
528 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
529 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
530 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
531 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
532 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
533 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
534 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
535 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
536 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
537 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
538 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
539 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
540 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
541 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
542 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
543 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
544 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
545 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
546 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
547 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
548 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
549 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
550 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
551 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
552 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
553 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
554 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
555 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
556 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
557 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
558 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
559 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
560 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
561 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
562 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
563 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
564 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
565 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
566 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
567 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
568 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
569 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
570 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
571 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
572 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
573 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
574 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
575 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
576 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
577 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
578 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
579 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
580 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
581 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
582 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
583 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
584 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
585 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
586 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
587 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
588 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
589 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
590 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
591 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
592 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
593 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
594 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
595 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
596 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
597 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
598 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
599 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
600 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
601 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
602 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
603 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
604 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
605 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
606 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
607 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
608 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
609 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
610 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
611 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
612 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
613 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
614 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
615 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
616 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
617 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
618 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
619 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
620 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
621 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
622 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
623 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
624 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
625 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
626 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
627 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
628 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
629 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
630 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
631 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
632 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
633 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
634 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
635 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
636 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
637 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
638 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
639 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
640 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
641 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
642 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
643 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
644 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
645 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
646 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
647 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
648 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
649 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
650 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
651 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
652 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
653 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
654 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
655 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
656 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
657 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
658 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
659 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
660 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
661 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
662 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
663 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
664 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
665 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
666 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
667 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
668 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
669 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
670 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
671 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
672 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
673 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
674 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
675 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
676 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
677 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
678 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
679 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
680 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
681 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
682 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
683 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
684 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
685 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
686 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
687 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
688 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
689 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
690 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
691 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
692 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
693 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
694 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
695 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
696 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
697 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
698 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
699 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
700 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
701 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
702 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
703 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
704 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
705 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
706 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
707 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
708 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
709 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
710 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
711 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
712 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
713 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
714 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
715 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
716 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
717 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
718 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
719 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
720 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.92
Metatranscriptomes 0.06
Isolates 14.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.48
Nodule 11.42
Rhizoplane 6.06
Rhizosphere 66.65
Stem 0
Stem Tuber 0
Unclassified 7.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214745197 2209111006 Bacteria 17059
2 ARcpr5oldR_c000160 3300000041 Bacteria 11755
3 ARSoilYngRDRAFT_c00063 3300000042 Bacteria 17542
4 ARcpr5yngRDRAFT_c000034 3300000043 Bacteria 21574
5 ARSoilOldRDRAFT_c000147 3300000044 Bacteria 11995
6 JGI24737J22298_10000521 3300001990 Bacteria 13498
7 JGI24750J21931_1000637 3300002070 Bacteria 5248
8 JGI24035J26624_1000503 3300002126 Bacteria 3639
9 JGI24742J22300_10001833 3300002244 Bacteria 3386
10 JGI24751J29686_10009828 3300002459 Bacteria 1971
11 JGI25406J46586_10000047 3300003203 Bacteria 54770
12 JGI25153J46596_10000740 3300003215 Bacteria 20002
13 JGI25153J46596_10003653 3300003215 Bacteria 8519
14 JGI25160J50197_1001080 3300003354 Bacteria 13978
15 Ga0055531_10003612 3300003794 Bacteria 9778
16 Ga0065165_1025653 3300005262 Bacteria 1955
17 Ga0065712_10001661 3300005290 Bacteria 8971
18 Ga0065715_10004531 3300005293 Bacteria 5629
19 Ga0065715_10090446 3300005293 Bacteria 6991
20 Ga0070658_10059686 3300005327 Bacteria 3106
21 Ga0070658_10098944 3300005327 Bacteria 2410
22 Ga0070676_10000905 3300005328 Bacteria 14682
23 Ga0070683_100022201 3300005329 Bacteria 5669
24 Ga0070683_100089578 3300005329 Bacteria 2887
25 Ga0070690_100002135 3300005330 Bacteria 10564
26 Ga0070690_100004750 3300005330 Bacteria 7581
27 Ga0070670_100077822 3300005331 Bacteria 2849
28 Ga0070670_100096468 3300005331 Bacteria 2544
29 Ga0070677_10006219 3300005333 Bacteria 3964
30 Ga0068869_100008696 3300005334 Bacteria 6558
31 Ga0068869_100028213 3300005334 Bacteria 3921
32 Ga0070666_10005333 3300005335 Bacteria 7881
33 Ga0070666_10007448 3300005335 Bacteria 6748
34 Ga0070680_100011041 3300005336 Bacteria 6980
35 Ga0070680_100018350 3300005336 Bacteria 5526
36 Ga0070680_100162923 3300005336 Bacteria 1874
37 Ga0070682_100002763 3300005337 Bacteria 9720
38 Ga0070682_100028035 3300005337 Bacteria 3385
39 Ga0070682_100032890 3300005337 Bacteria 3147
40 Ga0068868_100009579 3300005338 Bacteria 6982
41 Ga0068868_100018639 3300005338 Bacteria 5193
42 Ga0068868_100031028 3300005338 Bacteria 4102
43 Ga0068868_100276285 3300005338 Bacteria 1420
44 Ga0070660_100000985 3300005339 Bacteria 19067
45 Ga0070660_100026110 3300005339 Bacteria 4347
46 Ga0070660_100035104 3300005339 Bacteria 3794
47 Ga0070660_100049723 3300005339 Bacteria 3224
48 Ga0070689_100010818 3300005340 Bacteria 6520
49 Ga0070689_100049462 3300005340 Bacteria 3246
50 Ga0070689_100067341 3300005340 Bacteria 2791
51 Ga0070689_100092019 3300005340 Bacteria 2392
52 Ga0070689_100109297 3300005340 Bacteria 2198
53 Ga0070691_10000060 3300005341 Bacteria 30257
54 Ga0070687_100001608 3300005343 Bacteria 8043
55 Ga0070687_100087956 3300005343 Bacteria 1712
56 Ga0070661_100024705 3300005344 Bacteria 4311
57 Ga0070661_100141724 3300005344 Bacteria 1812
58 Ga0070692_10002122 3300005345 Bacteria 7584
59 Ga0070692_10019414 3300005345 Bacteria 3280
60 Ga0070668_100004462 3300005347 Bacteria 10383
61 Ga0070668_100020450 3300005347 Bacteria 4995
62 Ga0070669_100001173 3300005353 Bacteria 19124
63 Ga0070675_100008084 3300005354 Bacteria 8154
64 Ga0070675_100025493 3300005354 Bacteria 4739
65 Ga0070675_100073782 3300005354 Bacteria 2833
66 Ga0070671_100000349 3300005355 Bacteria 31741
67 Ga0070671_100098641 3300005355 Bacteria 2451
68 Ga0070671_100201469 3300005355 Bacteria 1688
69 Ga0070674_100013947 3300005356 Bacteria 4983
70 Ga0070674_100032577 3300005356 Bacteria 3462
71 Ga0070674_100047762 3300005356 Bacteria 2935
72 Ga0070674_100064813 3300005356 Bacteria 2562
73 Ga0070673_100007101 3300005364 Bacteria 7355
74 Ga0070673_100055829 3300005364 Bacteria 3113
75 Ga0070673_100153399 3300005364 Bacteria 1953
76 Ga0070688_100000475 3300005365 Bacteria 20349
77 Ga0070688_100005391 3300005365 Bacteria 6731
78 Ga0070688_100013195 3300005365 Bacteria 4653
79 Ga0070659_100006503 3300005366 Bacteria 8436
80 Ga0070667_100000810 3300005367 Bacteria 29225
81 Ga0070667_100009653 3300005367 Bacteria 8006
82 Ga0070667_100015010 3300005367 Bacteria 6400
83 Ga0070667_100148326 3300005367 Bacteria 2058
84 Ga0070703_10007949 3300005406 Bacteria 2983
85 Ga0070709_10011165 3300005434 Bacteria 4996
86 Ga0070709_10021489 3300005434 Bacteria 3759
87 Ga0070709_10029765 3300005434 Bacteria 3270
88 Ga0070709_10068774 3300005434 Bacteria 2279
89 Ga0070714_100048569 3300005435 Bacteria 3610
90 Ga0070714_100051098 3300005435 Bacteria 3524
91 Ga0070714_100102147 3300005435 Bacteria 2527
92 Ga0070714_100111893 3300005435 Bacteria 2419
93 Ga0070714_100257729 3300005435 Bacteria 1614
94 Ga0070713_100012585 3300005436 Bacteria 6213
95 Ga0070713_100028354 3300005436 Bacteria 4421
96 Ga0070713_100029886 3300005436 Bacteria 4321
97 Ga0070713_100046807 3300005436 Bacteria 3551
98 Ga0070710_10001849 3300005437 Bacteria 9973
99 Ga0070710_10127488 3300005437 Bacteria 1548
100 Ga0070701_10005299 3300005438 Bacteria 5311
101 Ga0070701_10009325 3300005438 Bacteria 4295
102 Ga0070711_100020708 3300005439 Bacteria 4242
103 Ga0070711_100063443 3300005439 Bacteria 2579
104 Ga0070705_100015365 3300005440 Bacteria 3957
105 Ga0070700_100000664 3300005441 Bacteria 17024
106 Ga0070700_100032022 3300005441 Bacteria 3157
107 Ga0070700_100070960 3300005441 Bacteria 2222
108 Ga0070700_100116164 3300005441 Bacteria 1786
109 Ga0070694_100005788 3300005444 Bacteria 7498
110 Ga0070663_100003715 3300005455 Bacteria 8849
111 Ga0070663_100025035 3300005455 Bacteria 4025
112 Ga0070663_100034160 3300005455 Bacteria 3520
113 Ga0070663_100105892 3300005455 Bacteria 2106
114 Ga0070678_100003479 3300005456 Bacteria 8774
115 Ga0070678_100033155 3300005456 Bacteria 3582
116 Ga0070678_100038499 3300005456 Bacteria 3367
117 Ga0070678_100046523 3300005456 Bacteria 3111
118 Ga0070662_100005798 3300005457 Bacteria 7916
119 Ga0070662_100007680 3300005457 Bacteria 6996
120 Ga0070662_100086845 3300005457 Bacteria 2340
121 Ga0070681_10015477 3300005458 Bacteria 7595
122 Ga0070681_10021129 3300005458 Bacteria 6522
123 Ga0070681_10040444 3300005458 Bacteria 4671
124 Ga0070681_10115998 3300005458 Bacteria 2615
125 Ga0070681_10258209 3300005458 Bacteria 1654
126 Ga0068867_100002762 3300005459 Bacteria 12366
127 Ga0068867_100110168 3300005459 Bacteria 2114
128 Ga0068867_100118206 3300005459 Bacteria 2045
129 Ga0070685_10004766 3300005466 Bacteria 6867
130 Ga0070685_10009588 3300005466 Bacteria 5007
131 Ga0070679_100015288 3300005530 Bacteria 7374
132 Ga0070679_100029125 3300005530 Bacteria 5446
133 Ga0070679_100050504 3300005530 Bacteria 4143
134 Ga0070679_100062725 3300005530 Bacteria 3705
135 Ga0070679_100141517 3300005530 Bacteria 2385
136 Ga0070679_100148690 3300005530 Bacteria 2320
137 Ga0070679_100161968 3300005530 Bacteria 2211
138 Ga0070679_100188559 3300005530 Bacteria 2032
139 Ga0070684_100000464 3300005535 Bacteria 27749
140 Ga0070684_100010906 3300005535 Bacteria 7221
141 Ga0070684_100012560 3300005535 Bacteria 6794
142 Ga0070684_100026872 3300005535 Bacteria 4852
143 Ga0070697_100086517 3300005536 Bacteria 2586
144 Ga0068853_100003829 3300005539 Bacteria 11523
145 Ga0068853_100025347 3300005539 Bacteria 4976
146 Ga0068853_100073806 3300005539 Bacteria 2975
147 Ga0068853_100095505 3300005539 Bacteria 2621
148 Ga0070672_100145150 3300005543 Bacteria 1960
149 Ga0070672_100148853 3300005543 Bacteria 1936
150 Ga0070686_100001439 3300005544 Bacteria 13446
151 Ga0070686_100016485 3300005544 Bacteria 4300
152 Ga0070686_100044137 3300005544 Bacteria 2800
153 Ga0070686_100048141 3300005544 Bacteria 2700
154 Ga0070686_100063471 3300005544 Bacteria 2393
155 Ga0070695_100001320 3300005545 Bacteria 13725
156 Ga0070695_100001619 3300005545 Bacteria 12621
157 Ga0070695_100008441 3300005545 Bacteria 6112
158 Ga0070696_100011085 3300005546 Bacteria 6033
159 Ga0070693_100000266 3300005547 Bacteria 24669
160 Ga0070665_100083382 3300005548 Bacteria 3201
161 Ga0070665_100104524 3300005548 Bacteria 2834
162 Ga0070665_100147673 3300005548 Bacteria 2354
163 Ga0070665_100221489 3300005548 Bacteria 1892
164 Ga0070704_100001701 3300005549 Bacteria 11987
165 Ga0070704_100002112 3300005549 Bacteria 11059
166 Ga0068855_100034429 3300005563 Bacteria 6041
167 Ga0068855_100034770 3300005563 Bacteria 6006
168 Ga0068855_100059531 3300005563 Bacteria 4468
169 Ga0068855_100160757 3300005563 Bacteria 2549
170 Ga0068855_100208295 3300005563 Bacteria 2199
171 Ga0068855_100209137 3300005563 Bacteria 2193
172 Ga0068855_100277971 3300005563 Bacteria 1860
173 Ga0070664_100012689 3300005564 Bacteria 6860
174 Ga0070664_100155908 3300005564 Bacteria 2018
175 Ga0068857_100006833 3300005577 Bacteria 9820
176 Ga0068857_100049167 3300005577 Bacteria 3742
177 Ga0068854_100005898 3300005578 Bacteria 7758
178 Ga0068854_100024241 3300005578 Bacteria 4152
179 Ga0068856_100000020 3300005614 Bacteria 146775
180 Ga0068856_100149477 3300005614 Bacteria 2344
181 Ga0070702_100004216 3300005615 Bacteria 6541
182 Ga0068852_100005120 3300005616 Bacteria 9342
183 Ga0068852_100007306 3300005616 Bacteria 8056
184 Ga0068852_100015569 3300005616 Bacteria 5905
185 Ga0068852_100015717 3300005616 Bacteria 5882
186 Ga0068852_100042670 3300005616 Bacteria 3841
187 Ga0068852_100081153 3300005616 Bacteria 2878
188 Ga0068859_100013817 3300005617 Bacteria 8096
189 Ga0068859_100037907 3300005617 Bacteria 4837
190 Ga0068859_100046985 3300005617 Bacteria 4336
191 Ga0068859_100077641 3300005617 Bacteria 3361
192 Ga0068864_100019484 3300005618 Bacteria 5673
193 Ga0068864_100046630 3300005618 Bacteria 3719
194 Ga0068864_100129170 3300005618 Bacteria 2268
195 Ga0068864_100262673 3300005618 Bacteria 1606
196 Ga0068866_10000694 3300005718 Bacteria 15306
197 Ga0068866_10029627 3300005718 Bacteria 2619
198 Ga0068861_100013181 3300005719 Bacteria 5783
199 Ga0068861_100023990 3300005719 Bacteria 4406
200 Ga0068861_100110233 3300005719 Bacteria 2204
201 Ga0068870_10009104 3300005840 Bacteria 4499
202 Ga0068863_100001201 3300005841 Bacteria 25868
203 Ga0068863_100007995 3300005841 Bacteria 10337
204 Ga0068863_100076014 3300005841 Bacteria 3177
205 Ga0068858_100016234 3300005842 Bacteria 6995
206 Ga0068858_100023790 3300005842 Bacteria 5708
207 Ga0068858_100051014 3300005842 Bacteria 3828
208 Ga0068858_100067510 3300005842 Bacteria 3313
209 Ga0068860_100001359 3300005843 Bacteria 26585
210 Ga0068860_100001708 3300005843 Bacteria 23464
211 Ga0068860_100024209 3300005843 Bacteria 5870
212 Ga0068860_100081370 3300005843 Bacteria 3080
213 Ga0068860_100132560 3300005843 Bacteria 2392
214 Ga0068862_100005931 3300005844 Bacteria 10175
215 Ga0068862_100042098 3300005844 Bacteria 3889
216 Ga0068862_100058981 3300005844 Bacteria 3294
217 Ga0081455_10000009 3300005937 Bacteria 249885
218 Ga0081455_10006680 3300005937 Bacteria 12325
219 Ga0081455_10030306 3300005937 Bacteria 4916
220 Ga0081455_10096354 3300005937 Bacteria 2386
221 Ga0081540_1000143 3300005983 Bacteria 74581
222 Ga0081540_1002154 3300005983 Bacteria 16364
223 Ga0081540_1002625 3300005983 Bacteria 14612
224 Ga0081540_1003015 3300005983 Bacteria 13484
225 Ga0081540_1005422 3300005983 Bacteria 9519
226 Ga0081540_1006906 3300005983 Bacteria 8187
227 Ga0081540_1011009 3300005983 Bacteria 6074
228 Ga0081540_1016111 3300005983 Bacteria 4699
229 Ga0081540_1023632 3300005983 Bacteria 3589
230 Ga0081540_1028760 3300005983 Bacteria 3113
231 Ga0081539_10000140 3300005985 Bacteria 166746
232 Ga0081539_10002339 3300005985 Bacteria 27248
233 Ga0081539_10018773 3300005985 Bacteria 4774
234 Ga0070717_10001862 3300006028 Bacteria 14744
235 Ga0070717_10045194 3300006028 Bacteria 3600
236 Ga0075365_10041177 3300006038 Bacteria 3017
237 Ga0075365_10127397 3300006038 Bacteria 1760
238 Ga0075368_10014162 3300006042 Bacteria 2941
239 Ga0075363_100004915 3300006048 Bacteria 5910
240 Ga0075363_100046915 3300006048 Bacteria 2293
241 Ga0075364_10024537 3300006051 Bacteria 3830
242 Ga0070715_10003038 3300006163 Bacteria 5257
243 Ga0070715_10012125 3300006163 Bacteria 3125
244 Ga0070715_10065946 3300006163 Bacteria 1604
245 Ga0070716_100003599 3300006173 Bacteria 7323
246 Ga0070712_100004909 3300006175 Bacteria 8269
247 Ga0070712_100027618 3300006175 Bacteria 3790
248 Ga0070712_100029025 3300006175 Bacteria 3706
249 Ga0070712_100048375 3300006175 Bacteria 2947
250 Ga0070712_100061706 3300006175 Bacteria 2649
251 Ga0070712_100220162 3300006175 Bacteria 1502
252 Ga0075362_10003689 3300006177 Bacteria 5406
253 Ga0075362_10025532 3300006177 Bacteria 2517
254 Ga0075362_10036285 3300006177 Bacteria 2156
255 Ga0075367_10005474 3300006178 Bacteria 6311
256 Ga0075367_10018220 3300006178 Bacteria 3870
257 Ga0075367_10026576 3300006178 Bacteria 3285
258 Ga0075369_10045777 3300006186 Bacteria 1882
259 Ga0075366_10059614 3300006195 Bacteria 2267
260 Ga0097621_100001359 3300006237 Bacteria 16830
261 Ga0097621_100085119 3300006237 Bacteria 2636
262 Ga0075370_10047579 3300006353 Bacteria 2429
263 Ga0075370_10075879 3300006353 Bacteria 1927
264 Ga0075370_10103009 3300006353 Bacteria 1653
265 Ga0068871_100003508 3300006358 Bacteria 10795
266 Ga0068871_100081780 3300006358 Bacteria 2677
267 Ga0075430_100000244 3300006846 Bacteria 37691
268 Ga0075434_100026091 3300006871 Bacteria 5722
269 Ga0075434_100097339 3300006871 Bacteria 2947
270 Ga0068865_100001830 3300006881 Bacteria 12495
271 Ga0068865_100025798 3300006881 Bacteria 3870
272 Ga0068865_100079400 3300006881 Bacteria 2350
273 Ga0075436_100004211 3300006914 Bacteria 9869
274 Ga0075436_100031832 3300006914 Bacteria 3634
275 Ga0097620_100013818 3300006931 Bacteria 8096
276 Ga0097620_100037906 3300006931 Bacteria 4837
277 Ga0097620_100046986 3300006931 Bacteria 4336
278 Ga0097620_100077644 3300006931 Bacteria 3361
279 Ga0099824_1007930 3300006942 Bacteria 13807
280 Ga0099824_1015115 3300006942 Bacteria 7438
281 Ga0075435_100013273 3300007076 Bacteria 6121
282 Ga0075435_100191542 3300007076 Bacteria 1731
283 Ga0099795_10025171 3300007788 Bacteria 1993
284 Ga0105250_10045953 3300009092 Bacteria 1751
285 Ga0105240_10017915 3300009093 Bacteria 9527
286 Ga0105240_10038025 3300009093 Bacteria 6178
287 Ga0105240_10045568 3300009093 Bacteria 5562
288 Ga0105240_10047264 3300009093 Bacteria 5446
289 Ga0105240_10073684 3300009093 Bacteria 4216
290 Ga0105240_10173056 3300009093 Bacteria 2555
291 Ga0105240_10275619 3300009093 Bacteria 1935
292 Ga0111539_10000173 3300009094 Bacteria 74781
293 Ga0111539_10018558 3300009094 Bacteria 8616
294 Ga0111539_10078446 3300009094 Bacteria 3885
295 Ga0111539_10084268 3300009094 Bacteria 3738
296 Ga0111539_10087823 3300009094 Bacteria 3653
297 Ga0111539_10186184 3300009094 Bacteria 2424
298 Ga0105245_10003312 3300009098 Bacteria 14462
299 Ga0105245_10021446 3300009098 Bacteria 5668
300 Ga0105245_10106651 3300009098 Bacteria 2600
301 Ga0105247_10024725 3300009101 Bacteria 3621
302 Ga0105247_10026306 3300009101 Bacteria 3512
303 Ga0114129_10187696 3300009147 Bacteria 2809
304 Ga0114129_10354797 3300009147 Bacteria 1942
305 Ga0105243_10011575 3300009148 Bacteria 6675
306 Ga0105243_10130437 3300009148 Bacteria 2132
307 Ga0105241_10009656 3300009174 Bacteria 7091
308 Ga0105241_10126238 3300009174 Bacteria 2066
309 Ga0105242_10000399 3300009176 Bacteria 34466
310 Ga0105242_10033580 3300009176 Bacteria 4109
311 Ga0105242_10163493 3300009176 Unclassified 1950
312 Ga0105248_10013945 3300009177 Bacteria 8843
313 Ga0105248_10032551 3300009177 Bacteria 5827
314 Ga0105248_10235723 3300009177 Bacteria 2060
315 Ga0105248_10241572 3300009177 Bacteria 2033
316 Ga0105248_10283693 3300009177 Bacteria 1864
317 Ga0105237_10034867 3300009545 Bacteria 5092
318 Ga0105237_10062673 3300009545 Bacteria 3718
319 Ga0105237_10184625 3300009545 Bacteria 2086
320 Ga0105237_10386896 3300009545 Bacteria 1404
321 Ga0105238_10008599 3300009551 Bacteria 10215
322 Ga0105238_10018493 3300009551 Bacteria 7090
323 Ga0105238_10072194 3300009551 Bacteria 3448
324 Ga0105238_10082718 3300009551 Bacteria 3200
325 Ga0105238_10145210 3300009551 Bacteria 2349
326 Ga0105249_10029823 3300009553 Bacteria 4928
327 Ga0105239_10067902 3300010375 Bacteria 3917
328 Ga0105239_10080663 3300010375 Bacteria 3580
329 Ga0105239_10082676 3300010375 Bacteria 3537
330 Ga0105239_10108616 3300010375 Bacteria 3074
331 Ga0105239_10201369 3300010375 Bacteria 2230
332 Ga0105239_10279979 3300010375 Bacteria 1877
333 Ga0105246_10000033 3300011119 Bacteria 50575
334 Ga0105246_10023862 3300011119 Bacteria 3964
335 Ga0157373_10005894 3300013100 Bacteria 9167
336 Ga0157371_10031668 3300013102 Bacteria 3811
337 Ga0157370_10128904 3300013104 Bacteria 2360
338 Ga0157370_10186971 3300013104 Bacteria 1923
339 Ga0157369_10010862 3300013105 Bacteria 10373
340 Ga0157369_10088464 3300013105 Bacteria 3306
341 Ga0157369_10097519 3300013105 Bacteria 3136
342 Ga0157374_10018913 3300013296 Bacteria 6090
343 Ga0157374_10087148 3300013296 Bacteria 2971
344 Ga0157378_10009284 3300013297 Bacteria 8568
345 Ga0157378_10057957 3300013297 Bacteria 3454
346 Ga0157378_10073594 3300013297 Bacteria 3072
347 Ga0163162_10007926 3300013306 Bacteria 10355
348 Ga0163162_10049822 3300013306 Bacteria 4199
349 Ga0163162_10126869 3300013306 Bacteria 2658
350 Ga0163162_10312021 3300013306 Bacteria 1705
351 Ga0157372_10001162 3300013307 Bacteria 28497
352 Ga0157372_10067851 3300013307 Bacteria 4009
353 Ga0157372_10154780 3300013307 Bacteria 2647
354 Ga0157375_10018904 3300013308 Bacteria 6255
355 Ga0157375_10021748 3300013308 Bacteria 5889
356 Ga0157375_10033246 3300013308 Bacteria 4898
357 Ga0157375_10141304 3300013308 Bacteria 2535
358 Ga0157375_10321881 3300013308 Bacteria 1711
359 Ga0163163_10001787 3300014325 Bacteria 18120
360 Ga0163163_10060072 3300014325 Bacteria 3763
361 Ga0163163_10098726 3300014325 Bacteria 2941
362 Ga0163163_10152441 3300014325 Bacteria 2355
363 Ga0157380_10064729 3300014326 Bacteria 2936
364 Ga0157377_10000740 3300014745 Bacteria 13498
365 Ga0157377_10024449 3300014745 Bacteria 3211
366 Ga0157379_10003378 3300014968 Bacteria 13509
367 Ga0157379_10097715 3300014968 Bacteria 2636
368 Ga0157376_10005599 3300014969 Bacteria 8786
369 Ga0157376_10229775 3300014969 Bacteria 1723
370 Ga0163161_10008117 3300017792 Bacteria 7261
371 Ga0163161_10008394 3300017792 Bacteria 7148
372 Ga0206356_10558017 3300020070 Bacteria 1731
373 Ga0214544_1000002 3300021320 Bacteria 753857
374 Ga0214542_1000001 3300021321 Bacteria 1018696
375 Ga0214545_1000001 3300021324 Bacteria 1092817
376 Ga0214543_1000001 3300021327 Bacteria 776921
377 Ga0213872_10023205 3300021361 Bacteria 2855
378 Ga0213876_10009439 3300021384 Bacteria 5251
379 Ga0213876_10056797 3300021384 Bacteria 2066
380 Ga0213875_10000007 3300021388 Bacteria 562717
381 Ga0209677_102829 3300025253 Bacteria 6135
382 Ga0209148_1000428 3300025254 Bacteria 46613
383 Ga0209233_1000804 3300025261 Bacteria 14031
384 Ga0209233_1006202 3300025261 Bacteria 3874
385 Ga0209233_1008608 3300025261 Bacteria 3145
386 Ga0207666_1000006 3300025271 Bacteria 51882
387 Ga0207666_1001276 3300025271 Bacteria 2975
388 Ga0209455_1002286 3300025272 Bacteria 7540
389 Ga0207673_1000712 3300025290 Bacteria 3559
390 Ga0209564_1001578 3300025295 Bacteria 22285
391 Ga0209564_1003479 3300025295 Bacteria 10734
392 Ga0209564_1026529 3300025295 Bacteria 1910
393 Ga0209758_1000140 3300025297 Bacteria 174267
394 Ga0209758_1000321 3300025297 Bacteria 92591
395 Ga0209758_1001092 3300025297 Bacteria 35145
396 Ga0209758_1001514 3300025297 Bacteria 26963
397 Ga0209758_1001968 3300025297 Bacteria 22196
398 Ga0209758_1002659 3300025297 Bacteria 17684
399 Ga0209758_1003492 3300025297 Bacteria 14221
400 Ga0209758_1008964 3300025297 Bacteria 6338
401 Ga0209758_1017349 3300025297 Bacteria 3592
402 Ga0209256_1005434 3300025299 Bacteria 7340
403 Ga0207426_1000278 3300025302 Bacteria 105775
404 Ga0207426_1000378 3300025302 Bacteria 76958
405 Ga0207426_1002170 3300025302 Bacteria 13286
406 Ga0207426_1018412 3300025302 Bacteria 2460
407 Ga0207426_1023520 3300025302 Bacteria 2101
408 Ga0209257_1000522 3300025304 Bacteria 66723
409 Ga0207697_10000009 3300025315 Bacteria 67526
410 Ga0207697_10004408 3300025315 Bacteria 6729
411 Ga0207656_10012199 3300025321 Bacteria 3262
412 Ga0207653_10036515 3300025885 Bacteria 1601
413 Ga0207682_10000301 3300025893 Bacteria 22279
414 Ga0207692_10000849 3300025898 Bacteria 10974
415 Ga0207692_10006397 3300025898 Bacteria 4775
416 Ga0207692_10017678 3300025898 Bacteria 3184
417 Ga0207692_10034555 3300025898 Bacteria 2448
418 Ga0207642_10043027 3300025899 Bacteria 1989
419 Ga0207710_10018364 3300025900 Bacteria 2974
420 Ga0207688_10000012 3300025901 Bacteria 60353
421 Ga0207688_10000263 3300025901 Bacteria 23901
422 Ga0207688_10041797 3300025901 Bacteria 2551
423 Ga0207680_10007512 3300025903 Bacteria 5322
424 Ga0207680_10020383 3300025903 Bacteria 3567
425 Ga0207680_10029543 3300025903 Bacteria 3081
426 Ga0207647_10002921 3300025904 Bacteria 12870
427 Ga0207647_10006251 3300025904 Bacteria 8674
428 Ga0207647_10033866 3300025904 Bacteria 3267
429 Ga0207685_10004719 3300025905 Bacteria 3504
430 Ga0207699_10007610 3300025906 Bacteria 5303
431 Ga0207699_10017739 3300025906 Bacteria 3756
432 Ga0207699_10025811 3300025906 Bacteria 3231
433 Ga0207645_10000124 3300025907 Bacteria 58746
434 Ga0207645_10022280 3300025907 Bacteria 4123
435 Ga0207645_10056703 3300025907 Bacteria 2501
436 Ga0207645_10086454 3300025907 Bacteria 2015
437 Ga0207643_10000046 3300025908 Bacteria 80736
438 Ga0207643_10000889 3300025908 Bacteria 18002
439 Ga0207705_10075165 3300025909 Bacteria 2453
440 Ga0207705_10115555 3300025909 Bacteria 1986
441 Ga0207684_10003987 3300025910 Bacteria 14129
442 Ga0207684_10133715 3300025910 Bacteria 2129
443 Ga0207654_10004889 3300025911 Bacteria 6780
444 Ga0207654_10015528 3300025911 Bacteria 3953
445 Ga0207707_10009522 3300025912 Bacteria 8427
446 Ga0207707_10011411 3300025912 Bacteria 7738
447 Ga0207707_10024737 3300025912 Bacteria 5253
448 Ga0207707_10027011 3300025912 Bacteria 5017
449 Ga0207707_10033774 3300025912 Bacteria 4477
450 Ga0207707_10059952 3300025912 Bacteria 3311
451 Ga0207707_10294682 3300025912 Bacteria 1403
452 Ga0207695_10000008 3300025913 Bacteria 1058268
453 Ga0207695_10008039 3300025913 Bacteria 13279
454 Ga0207695_10081943 3300025913 Bacteria 3264
455 Ga0207695_10120229 3300025913 Bacteria 2596
456 Ga0207671_10007118 3300025914 Bacteria 9772
457 Ga0207671_10044503 3300025914 Bacteria 3283
458 Ga0207671_10120545 3300025914 Bacteria 2005
459 Ga0207693_10001080 3300025915 Bacteria 24461
460 Ga0207693_10001875 3300025915 Bacteria 18415
461 Ga0207693_10007332 3300025915 Bacteria 9072
462 Ga0207693_10018304 3300025915 Bacteria 5582
463 Ga0207693_10050341 3300025915 Bacteria 3272
464 Ga0207693_10055325 3300025915 Bacteria 3113
465 Ga0207693_10174151 3300025915 Bacteria 1694
466 Ga0207663_10000347 3300025916 Bacteria 20128
467 Ga0207663_10010022 3300025916 Bacteria 5022
468 Ga0207663_10021116 3300025916 Bacteria 3701
469 Ga0207663_10143834 3300025916 Bacteria 1665
470 Ga0207660_10071085 3300025917 Bacteria 2531
471 Ga0207660_10109729 3300025917 Bacteria 2074
472 Ga0207660_10133279 3300025917 Bacteria 1893
473 Ga0207660_10160578 3300025917 Bacteria 1733
474 Ga0207662_10000154 3300025918 Bacteria 32501
475 Ga0207662_10000222 3300025918 Bacteria 26332
476 Ga0207662_10032507 3300025918 Bacteria 3038
477 Ga0207662_10144063 3300025918 Bacteria 1511
478 Ga0207657_10000162 3300025919 Bacteria 68121
479 Ga0207657_10030200 3300025919 Bacteria 4922
480 Ga0207657_10060302 3300025919 Bacteria 3256
481 Ga0207657_10071568 3300025919 Bacteria 2936
482 Ga0207657_10152882 3300025919 Bacteria 1879
483 Ga0207649_10000798 3300025920 Bacteria 20284
484 Ga0207652_10021470 3300025921 Bacteria 5329
485 Ga0207652_10045919 3300025921 Bacteria 3725
486 Ga0207652_10117589 3300025921 Bacteria 2362
487 Ga0207652_10122151 3300025921 Bacteria 2318
488 Ga0207652_10308076 3300025921 Bacteria 1429
489 Ga0207681_10007488 3300025923 Bacteria 6687
490 Ga0207681_10094623 3300025923 Bacteria 2141
491 Ga0207694_10018170 3300025924 Bacteria 5317
492 Ga0207694_10048738 3300025924 Bacteria 3278
493 Ga0207650_10054665 3300025925 Bacteria 2963
494 Ga0207659_10000762 3300025926 Bacteria 19116
495 Ga0207659_10140306 3300025926 Bacteria 1875
496 Ga0207659_10199744 3300025926 Bacteria 1596
497 Ga0207687_10008325 3300025927 Bacteria 6787
498 Ga0207687_10023134 3300025927 Bacteria 4140
499 Ga0207687_10131080 3300025927 Bacteria 1890
500 Ga0207700_10000290 3300025928 Bacteria 29736
501 Ga0207700_10078975 3300025928 Bacteria 2561
502 Ga0207700_10082443 3300025928 Bacteria 2515
503 Ga0207700_10102014 3300025928 Bacteria 2290
504 Ga0207700_10178814 3300025928 Bacteria 1775
505 Ga0207664_10010393 3300025929 Bacteria 6574
506 Ga0207664_10011397 3300025929 Bacteria 6318
507 Ga0207664_10029434 3300025929 Bacteria 4183
508 Ga0207664_10096420 3300025929 Bacteria 2434
509 Ga0207664_10097259 3300025929 Bacteria 2425
510 Ga0207644_10024576 3300025931 Bacteria 4137
511 Ga0207644_10056409 3300025931 Bacteria 2835
512 Ga0207690_10006396 3300025932 Bacteria 6981
513 Ga0207690_10100607 3300025932 Bacteria 2063
514 Ga0207706_10000929 3300025933 Bacteria 30046
515 Ga0207706_10020484 3300025933 Bacteria 5944
516 Ga0207706_10155385 3300025933 Bacteria 2012
517 Ga0207686_10084159 3300025934 Bacteria 2083
518 Ga0207686_10090123 3300025934 Bacteria 2023
519 Ga0207709_10000256 3300025935 Bacteria 63853
520 Ga0207709_10106054 3300025935 Bacteria 1869
521 Ga0207670_10003293 3300025936 Bacteria 8558
522 Ga0207670_10010584 3300025936 Bacteria 5320
523 Ga0207670_10020290 3300025936 Bacteria 4081
524 Ga0207670_10066843 3300025936 Bacteria 2471
525 Ga0207669_10001769 3300025937 Bacteria 9164
526 Ga0207669_10045983 3300025937 Bacteria 2576
527 Ga0207669_10051306 3300025937 Bacteria 2471
528 Ga0207669_10078648 3300025937 Bacteria 2102
529 Ga0207669_10096367 3300025937 Bacteria 1942
530 Ga0207669_10109797 3300025937 Bacteria 1845
531 Ga0207704_10021960 3300025938 Bacteria 3410
532 Ga0207704_10037137 3300025938 Bacteria 2811
533 Ga0207665_10000719 3300025939 Bacteria 22485
534 Ga0207665_10043622 3300025939 Bacteria 2999
535 Ga0207665_10105306 3300025939 Bacteria 1975
536 Ga0207691_10006340 3300025940 Bacteria 11426
537 Ga0207691_10006425 3300025940 Bacteria 11355
538 Ga0207691_10015435 3300025940 Bacteria 7265
539 Ga0207691_10118759 3300025940 Bacteria 2346
540 Ga0207711_10036622 3300025941 Bacteria 4164
541 Ga0207711_10053917 3300025941 Bacteria 3449
542 Ga0207711_10182249 3300025941 Bacteria 1910
543 Ga0207689_10000109 3300025942 Bacteria 67941
544 Ga0207689_10031109 3300025942 Bacteria 4446
545 Ga0207689_10051147 3300025942 Bacteria 3406
546 Ga0207689_10052656 3300025942 Bacteria 3353
547 Ga0207661_10001655 3300025944 Bacteria 15191
548 Ga0207661_10006709 3300025944 Bacteria 8143
549 Ga0207661_10093766 3300025944 Bacteria 2506
550 Ga0207661_10096435 3300025944 Bacteria 2474
551 Ga0207661_10115604 3300025944 Bacteria 2276
552 Ga0207661_10148070 3300025944 Bacteria 2027
553 Ga0207679_10000763 3300025945 Bacteria 21224
554 Ga0207679_10027676 3300025945 Bacteria 3924
555 Ga0207679_10039187 3300025945 Bacteria 3382
556 Ga0207679_10210571 3300025945 Bacteria 1630
557 Ga0207667_10021843 3300025949 Bacteria 7083
558 Ga0207667_10034067 3300025949 Bacteria 5471
559 Ga0207667_10109822 3300025949 Bacteria 2845
560 Ga0207667_10119538 3300025949 Bacteria 2715
561 Ga0207667_10123233 3300025949 Bacteria 2671
562 Ga0207667_10164754 3300025949 Bacteria 2279
563 Ga0207667_10170068 3300025949 Bacteria 2240
564 Ga0207651_10000900 3300025960 Bacteria 13066
565 Ga0207651_10004250 3300025960 Bacteria 7184
566 Ga0207651_10130307 3300025960 Bacteria 1924
567 Ga0207712_10010883 3300025961 Bacteria 5790
568 Ga0207712_10022037 3300025961 Bacteria 4190
569 Ga0207712_10030069 3300025961 Bacteria 3650
570 Ga0207712_10040854 3300025961 Bacteria 3186
571 Ga0207668_10015835 3300025972 Bacteria 4694
572 Ga0207668_10030283 3300025972 Bacteria 3555
573 Ga0207640_10004377 3300025981 Bacteria 7650
574 Ga0207658_10018594 3300025986 Bacteria 4802
575 Ga0207658_10034145 3300025986 Bacteria 3633
576 Ga0207677_10007601 3300026023 Bacteria 6012
577 Ga0207677_10010239 3300026023 Bacteria 5300
578 Ga0207677_10011127 3300026023 Bacteria 5117
579 Ga0207703_10012561 3300026035 Bacteria 6602
580 Ga0207703_10013883 3300026035 Bacteria 6279
581 Ga0207703_10028301 3300026035 Bacteria 4417
582 Ga0207703_10060311 3300026035 Bacteria 3102
583 Ga0207639_10039190 3300026041 Bacteria 3529
584 Ga0207639_10053845 3300026041 Bacteria 3072
585 Ga0207639_10195327 3300026041 Bacteria 1731
586 Ga0207678_10004447 3300026067 Bacteria 12606
587 Ga0207678_10006545 3300026067 Bacteria 10328
588 Ga0207678_10008261 3300026067 Bacteria 9171
589 Ga0207678_10029694 3300026067 Bacteria 4773
590 Ga0207678_10034437 3300026067 Bacteria 4411
591 Ga0207678_10056317 3300026067 Bacteria 3384
592 Ga0207708_10000098 3300026075 Bacteria 67005
593 Ga0207708_10002092 3300026075 Bacteria 14690
594 Ga0207708_10006322 3300026075 Bacteria 8779
595 Ga0207708_10012533 3300026075 Bacteria 6321
596 Ga0207708_10109972 3300026075 Bacteria 2138
597 Ga0207702_10000002 3300026078 Bacteria 491507
598 Ga0207702_10002142 3300026078 Bacteria 18978
599 Ga0207702_10114296 3300026078 Bacteria 2405
600 Ga0207702_10115998 3300026078 Bacteria 2389
601 Ga0207641_10038224 3300026088 Bacteria 4011
602 Ga0207641_10135346 3300026088 Bacteria 2217
603 Ga0207641_10150619 3300026088 Bacteria 2106
604 Ga0207648_10001639 3300026089 Bacteria 24530
605 Ga0207648_10002003 3300026089 Bacteria 22234
606 Ga0207648_10010667 3300026089 Bacteria 8687
607 Ga0207648_10059959 3300026089 Bacteria 3318
608 Ga0207676_10017955 3300026095 Bacteria 5133
609 Ga0207676_10031583 3300026095 Bacteria 3983
610 Ga0207676_10095444 3300026095 Bacteria 2452
611 Ga0207674_10000420 3300026116 Bacteria 55287
612 Ga0207674_10003611 3300026116 Bacteria 18863
613 Ga0207674_10033144 3300026116 Bacteria 5409
614 Ga0207674_10044894 3300026116 Bacteria 4550
615 Ga0207675_100002543 3300026118 Bacteria 18056
616 Ga0207675_100008008 3300026118 Bacteria 9959
617 Ga0207675_100124538 3300026118 Bacteria 2441
618 Ga0207675_100196290 3300026118 Bacteria 1937
619 Ga0207683_10000004 3300026121 Bacteria 188086
620 Ga0207683_10001293 3300026121 Bacteria 22621
621 Ga0207683_10015556 3300026121 Bacteria 6478
622 Ga0207683_10020374 3300026121 Bacteria 5672
623 Ga0207683_10035723 3300026121 Bacteria 4323
624 Ga0207698_10004120 3300026142 Bacteria 8830
625 Ga0207698_10017188 3300026142 Bacteria 4900
626 Ga0209389_1000032 3300027296 Bacteria 134064
627 Ga0209389_1000995 3300027296 Bacteria 18828
628 Ga0209589_1000001 3300027357 Bacteria 794224
629 Ga0209589_1000211 3300027357 Bacteria 69316
630 Ga0209489_100001 3300027361 Bacteria 794224
631 Ga0209489_100006 3300027361 Bacteria 475698
632 Ga0209489_111765 3300027361 Bacteria 8620
633 Ga0209700_100001 3300027363 Bacteria 794224
634 Ga0209700_100005 3300027363 Bacteria 573969
635 Ga0209966_1001208 3300027695 Bacteria 4603
636 Ga0209998_10002107 3300027717 Bacteria 4636
637 Ga0209998_10003369 3300027717 Bacteria 3507
638 Ga0209974_10009223 3300027876 Bacteria 3349
639 Ga0207428_10000303 3300027907 Bacteria 65124
640 Ga0207428_10019216 3300027907 Bacteria 5826
641 Ga0268266_10044379 3300028379 Bacteria 3800
642 Ga0268266_10047490 3300028379 Bacteria 3678
643 Ga0268266_10056381 3300028379 Bacteria 3380
644 Ga0268265_10012335 3300028380 Bacteria 5790
645 Ga0268264_10000149 3300028381 Bacteria 163972
646 Ga0268264_10073523 3300028381 Bacteria 2902
647 Ga0268264_10102135 3300028381 Bacteria 2495
648 Ga0268264_10198647 3300028381 Bacteria 1833
649 Ga0268264_10226639 3300028381 Bacteria 1723
650 Ga0265337_1000539 3300028556 Bacteria 20178
651 Ga0265334_10045848 3300028573 Bacteria 1692
652 Ga0265318_10012129 3300028577 Bacteria 3679
653 Ga0265336_10013212 3300028666 Bacteria 2756
654 Ga0307517_10000249 3300028786 Bacteria 91911
655 Ga0307515_10050561 3300028794 Bacteria 6221
656 Ga0265338_10000665 3300028800 Bacteria 59449
657 Ga0265338_10010360 3300028800 Bacteria 10945
658 Ga0265338_10085175 3300028800 Bacteria 2635
659 Ga0265330_10012435 3300031235 Bacteria 3979
660 Ga0265332_10001409 3300031238 Bacteria 13560
661 Ga0265320_10011080 3300031240 Bacteria 5323
662 Ga0265325_10000603 3300031241 Bacteria 26174
663 Ga0265325_10008234 3300031241 Bacteria 6166
664 Ga0265325_10055536 3300031241 Bacteria 2024
665 Ga0265340_10011380 3300031247 Bacteria 4727
666 Ga0265340_10011777 3300031247 Bacteria 4640
667 Ga0265340_10023020 3300031247 Bacteria 3179
668 Ga0265339_10000465 3300031249 Bacteria 31657
669 Ga0265339_10016860 3300031249 Bacteria 4341
670 Ga0265339_10036117 3300031249 Bacteria 2767
671 Ga0265339_10048704 3300031249 Bacteria 2323
672 Ga0265339_10086086 3300031249 Bacteria 1654
673 Ga0265331_10025769 3300031250 Bacteria 2965
674 Ga0265331_10029591 3300031250 Bacteria 2731
675 Ga0307509_10004311 3300031507 Bacteria 20669
676 Ga0307408_100024489 3300031548 Bacteria 4123
677 Ga0265313_10000006 3300031595 Bacteria 183184
678 Ga0265313_10010630 3300031595 Bacteria 5796
679 Ga0307508_10000018 3300031616 Bacteria 202701
680 Ga0307508_10109943 3300031616 Bacteria 2355
681 Ga0265314_10002127 3300031711 Bacteria 20778
682 Ga0265314_10019317 3300031711 Bacteria 5282
683 Ga0265342_10001132 3300031712 Bacteria 25514
684 Ga0265342_10002171 3300031712 Bacteria 17254
685 Ga0265342_10094300 3300031712 Bacteria 1713
686 Ga0316576_10157855 3300031727 Bacteria 1710
687 Ga0307516_10011365 3300031730 Bacteria 9683
688 Ga0307516_10153301 3300031730 Bacteria 2062
689 Ga0307410_10176024 3300031852 Bacteria 1616
690 Ga0307412_10058553 3300031911 Bacteria 2578
691 Ga0307412_10135882 3300031911 Bacteria 1794
692 Ga0307416_100142142 3300032002 Bacteria 2184
693 Ga0307411_10187957 3300032005 Bacteria 1574
694 Ga0307507_10022838 3300033179 Bacteria 6892
695 Ga0307510_10013733 3300033180 Bacteria 9600
696 Ga0307510_10033134 3300033180 Bacteria 5807
697 Ga0307510_10048914 3300033180 Bacteria 4504
698 Ga0315911_1000006 3300033442 Bacteria 414563
699 Ga0316215_1003036 3300033544 Bacteria 1594
700 Ga0373958_0001300 3300034819 Bacteria 3339
701 Ga0373938_0000022 3300034957 Bacteria 20030
702 Ga0373929_0000472 3300035085 Bacteria 7704
703 Ga0373934_0005378 3300035086 Bacteria 4741
704 Ga0373940_0000137 3300035088 Bacteria 9375
705 Ga0373949_0000261 3300035090 Bacteria 19624
706 Ga0373951_0002760 3300035091 Bacteria 4393
707 Ga0373952_0003517 3300035092 Bacteria 2825
708 Ga0373932_0002247 3300035112 Bacteria 4945
709 Ga0373939_0000463 3300035114 Bacteria 10276
710 Ga0373939_0003813 3300035114 Bacteria 3553
711 Ga0373941_0000221 3300035115 Bacteria 10967
712 Ga0373941_0000589 3300035115 Bacteria 7345
713 Ga0373945_0015340 3300035116 Bacteria 2576
714 Ga0373953_0040881 3300035117 Bacteria 1843
715 Ga0373954_0003471 3300035118 Bacteria 6687
716 Ga0373954_0054642 3300035118 Bacteria 1878
717 Ga0373956_0002490 3300035119 Bacteria 7496
718 Ga0373956_0024869 3300035119 Bacteria 2585
719 Ga0373957_0009403 3300035120 Bacteria 3198
720 Ga0373960_0000800 3300035121 Bacteria 6614
721 Ga0373960_0002104 3300035121 Bacteria 4482
722 Ga0373943_0000061 3300035170 Bacteria 37449
723 Ga0373943_0022381 3300035170 Bacteria 2928
724 Ga0373946_0025537 3300035171 Bacteria 2324
725 Ga0373955_0013625 3300035172 Bacteria 3938
726 Ga0373955_0020458 3300035172 Bacteria 3327
727 Ga0373942_0006530 3300035207 Bacteria 2695
728 Ga0373961_0005825 3300035241 Bacteria 2960
729 Ga0373961_0008356 3300035241 Bacteria 2517
730 Ga0373962_0003673 3300035242 Bacteria 3691
731 Ga0373962_0013120 3300035242 Bacteria 2094
732 Ga0373924_0008696 3300035410 Bacteria 3701
733 Ga0373924_0011814 3300035410 Bacteria 3250
734 Ga0373931_0000750 3300035691 Bacteria 13546
735 Ga0373935_0001116 3300035692 Bacteria 14637
736 Ga0373935_0015189 3300035692 Bacteria 4651
737 Ga0373935_0068802 3300035692 Bacteria 2279
738 Ga0373935_0105033 3300035692 Bacteria 1867
739 Ga0373927_0000275 3300035695 Bacteria 40382
740 Ga0373927_0001437 3300035695 Bacteria 17974
741 Ga0373927_0004277 3300035695 Bacteria 10020
742 Ga0373927_0020807 3300035695 Bacteria 4300
743 Ga0373927_0053127 3300035695 Bacteria 2620
744 Ga0373927_0059425 3300035695 Bacteria 2472
745 Ga0373933_0001880 3300035724 Bacteria 12123
746 Ga0373933_0003392 3300035724 Bacteria 8881
747 Ga0373933_0053271 3300035724 Bacteria 2423
748 Ga0373933_0081011 3300035724 Bacteria 1991
749 Ga0373947_0000187 3300035725 Bacteria 34086
750 Ga0373947_0003173 3300035725 Bacteria 9781
751 Ga0373947_0028877 3300035725 Bacteria 3253
752 Ga0373947_0084669 3300035725 Bacteria 1968
753 Ga0373937_0016414 3300036401 Bacteria 6577
754 Ga0373937_0020656 3300036401 Bacteria 5905
755 Ga0373937_0065794 3300036401 Bacteria 3337
756 Ga0373925_0000791 3300037068 Bacteria 29167
757 Ga0373925_0006458 3300037068 Bacteria 8624
758 Ga0373925_0021188 3300037068 Bacteria 4736
759 Ga0373925_0075820 3300037068 Bacteria 2549
760 Ga0373925_0083593 3300037068 Bacteria 2432
761 Ga0373925_0133663 3300037068 Bacteria 1936
762 Ga0373925_0145606 3300037068 Bacteria 1857
763 Ga0395899_0007661 3300037312 Bacteria 8324
764 Ga0395899_0048874 3300037312 Bacteria 3146
765 Ga0395900_0002820 3300037418 Bacteria 18968
766 Ga0395900_0132770 3300037418 Bacteria 2551
767 Ga0395900_0183877 3300037418 Bacteria 2122
768 Ga0395900_0224298 3300037418 Bacteria 1893
769 Ga0395900_0504171 3300037418 Bacteria 1160
770 Ga0395898_0035823 3300037466 Bacteria 4932
771 Ga0395898_0037214 3300037466 Bacteria 4829
772 Ga0395898_0114923 3300037466 Bacteria 2579
773 Ga0395898_0116527 3300037466 Bacteria 2560
774 Ga0395898_0256323 3300037466 Bacteria 1668
775 Ga0395905_0013848 3300037471 Bacteria 7715
776 Ga0436364_0009242 3300037853 Bacteria 1668
777 Ga0436364_0565423 3300037853 Bacteria 13235
778 Ga0436364_1381345 3300037853 Bacteria 2017
779 Ga0395901_0073052 3300038443 Bacteria 3577
780 Ga0395901_0102522 3300038443 Bacteria 3003
781 Ga0395901_0206396 3300038443 Bacteria 2058
782 Ga0395901_0217750 3300038443 Bacteria 1996
783 Ga0395901_0281687 3300038443 Bacteria 1727
784 Ga0436365_0244105 3300039437 Bacteria 7287
785 Ga0436365_0552397 3300039437 Bacteria 18046
786 Ga0436365_0712843 3300039437 Bacteria 3690
787 Ga0436365_1260219 3300039437 Bacteria 4209
788 Ga0436361_0476110 3300039447 Bacteria 14479
789 Ga0436363_0312479 3300039450 Bacteria 6730
790 Ga0436363_1211778 3300039450 Bacteria 5063
791 Ga0466972_0000160 3300044658 Bacteria 54154
792 Ga0466972_0041245 3300044658 Bacteria 2248
793 Ga0453683_0000499 3300044673 Bacteria 44878
794 Ga0466965_0068895 3300044683 Bacteria 1777
795 Ga0466966_0000669 3300044684 Bacteria 21779
796 Ga0466961_0000208 3300044693 Bacteria 39439
797 Ga0466961_0049061 3300044693 Bacteria 2699
798 Ga0466963_0051971 3300044694 Bacteria 2718
799 Ga0466957_0304793 3300044842 Bacteria 1071
800 Ga0466960_0004027 3300044901 Bacteria 5712
801 Ga0466959_0000832 3300045049 Bacteria 18217
802 Ga0466959_0065541 3300045049 Bacteria 2636
803 Ga0466967_0007808 3300045976 Bacteria 7773
804 Ga0495592_0002109 3300046454 Bacteria 14021
805 Ga0495592_0010077 3300046454 Bacteria 7118
806 Ga0495603_0001086 3300046455 Bacteria 15788
807 Ga0495603_0005459 3300046455 Bacteria 7590
808 Ga0495603_0012614 3300046455 Bacteria 5113
809 Ga0495603_0025716 3300046455 Bacteria 3559
810 Ga0495629_0000329 3300046459 Bacteria 40545
811 Ga0495629_0000726 3300046459 Bacteria 26748
812 Ga0495629_0008557 3300046459 Bacteria 7535
813 Ga0495629_0073225 3300046459 Bacteria 2392
814 Ga0495629_0145998 3300046459 Bacteria 1645
815 Ga0495638_0078657 3300046460 Bacteria 2006
816 Ga0495641_0000747 3300046461 Bacteria 27535
817 Ga0495641_0009078 3300046461 Bacteria 5957
818 Ga0495651_0000528 3300046462 Bacteria 29605
819 Ga0495651_0001234 3300046462 Bacteria 19776
820 Ga0495653_0000358 3300046463 Bacteria 36893
821 Ga0495653_0024434 3300046463 Bacteria 4870
822 Ga0495653_0120003 3300046463 Bacteria 1875
823 Ga0495582_0000416 3300046473 Bacteria 23251
824 Ga0495582_0018577 3300046473 Bacteria 3801
825 Ga0495582_0039151 3300046473 Bacteria 2610
826 Ga0495605_0058321 3300046474 Bacteria 1856
827 Ga0495605_0077055 3300046474 Bacteria 1565
828 Ga0495639_0000165 3300046475 Bacteria 34551
829 Ga0495639_0042460 3300046475 Bacteria 2051
830 Ga0495662_0000066 3300046476 Bacteria 36870
831 Ga0495662_0007797 3300046476 Bacteria 5271
832 Ga0495662_0055096 3300046476 Bacteria 1921
833 Ga0495664_0000510 3300046477 Bacteria 19398
834 Ga0495664_0003203 3300046477 Bacteria 8886
835 Ga0495664_0025954 3300046477 Bacteria 3411
836 Ga0495585_0050021 3300046492 Bacteria 2319
837 Ga0495594_0000441 3300046499 Bacteria 20981
838 Ga0495594_0104469 3300046499 Bacteria 1595
839 Ga0495607_0055693 3300046501 Bacteria 2274
840 Ga0495606_0001663 3300046507 Bacteria 28893
841 Ga0495606_0045553 3300046507 Bacteria 2905
842 Ga0495608_0002274 3300046511 Bacteria 13858
843 Ga0495608_0002377 3300046511 Bacteria 13537
844 Ga0495608_0025275 3300046511 Bacteria 4054
845 Ga0495608_0041729 3300046511 Bacteria 3069
846 Ga0495618_0002751 3300046514 Bacteria 11183
847 Ga0495618_0020274 3300046514 Bacteria 4093
848 Ga0495620_0049417 3300046515 Bacteria 1800
849 Ga0495628_0019406 3300046516 Bacteria 5622
850 Ga0495628_0020389 3300046516 Bacteria 5469
851 Ga0495628_0022251 3300046516 Bacteria 5209
852 Ga0495628_0146998 3300046516 Bacteria 1796
853 Ga0495630_0008582 3300046517 Bacteria 7332
854 Ga0495631_0019145 3300046518 Bacteria 3213
855 Ga0495642_0056699 3300046528 Bacteria 1619
856 Ga0495652_0002427 3300046529 Bacteria 19218
857 Ga0495652_0005186 3300046529 Bacteria 12313
858 Ga0495652_0020974 3300046529 Bacteria 5807
859 Ga0495652_0066937 3300046529 Bacteria 3012
860 Ga0495665_0000802 3300046531 Bacteria 16451
861 Ga0495665_0001233 3300046531 Bacteria 13656
862 Ga0495640_0003534 3300046533 Bacteria 12566
863 Ga0495640_0009403 3300046533 Bacteria 7612
864 Ga0495640_0027787 3300046533 Bacteria 4077
865 Ga0495640_0065735 3300046533 Bacteria 2448
866 Ga0495586_0014173 3300046535 Bacteria 4237
867 Ga0495586_0099032 3300046535 Bacteria 1617
868 Ga0495587_0001337 3300046536 Bacteria 16369
869 Ga0495587_0024608 3300046536 Bacteria 3688
870 Ga0495587_0030214 3300046536 Bacteria 3286
871 Ga0495609_0071603 3300046538 Bacteria 1523
872 Ga0495645_0008975 3300046543 Bacteria 6983
873 Ga0495645_0034306 3300046543 Bacteria 3702
874 Ga0495645_0050362 3300046543 Bacteria 3032
875 Ga0495645_0112011 3300046543 Bacteria 1930
876 Ga0495622_0004915 3300046557 Bacteria 6190
877 Ga0495622_0019370 3300046557 Bacteria 3168
878 Ga0495622_0032366 3300046557 Bacteria 2442
879 Ga0495667_0002234 3300046559 Bacteria 12951
880 Ga0495667_0060233 3300046559 Bacteria 2490
881 Ga0495634_0002191 3300046642 Bacteria 16415
882 Ga0495634_0002979 3300046642 Bacteria 13815
883 Ga0495634_0015120 3300046642 Bacteria 5547
884 Ga0495625_0048927 3300046660 Bacteria 3041
885 Ga0495625_0086437 3300046660 Bacteria 2175
886 Ga0495635_0000527 3300046663 Bacteria 24259
887 Ga0495635_0001696 3300046663 Bacteria 14837
888 Ga0495635_0002022 3300046663 Bacteria 13767
889 Ga0495635_0031514 3300046663 Bacteria 3680
890 Ga0495635_0088227 3300046663 Bacteria 2122
891 Ga0495635_0138618 3300046663 Bacteria 1657
892 Ga0495659_0044852 3300046664 Bacteria 1591
893 Ga0495588_0055784 3300046674 Bacteria 2039
894 Ga0495657_0001550 3300046675 Bacteria 19763
895 Ga0495657_0007232 3300046675 Bacteria 8604
896 Ga0495657_0053087 3300046675 Bacteria 2714
897 Ga0495599_0002310 3300046678 Bacteria 11080
898 Ga0495599_0013701 3300046678 Bacteria 5012
899 Ga0495599_0097191 3300046678 Bacteria 1836
900 Ga0495599_0133702 3300046678 Bacteria 1540
901 Ga0495623_0003518 3300046679 Bacteria 10364
902 Ga0495646_0017484 3300046680 Bacteria 4549
903 Ga0495646_0022612 3300046680 Bacteria 3965
904 Ga0495646_0044539 3300046680 Bacteria 2713
905 Ga0495646_0057438 3300046680 Bacteria 2329
906 Ga0495646_0067909 3300046680 Bacteria 2106
907 Ga0495646_0101890 3300046680 Bacteria 1645
908 Ga0495647_0001835 3300046681 Bacteria 6580
909 Ga0495647_0002668 3300046681 Bacteria 5665
910 Ga0495647_0004959 3300046681 Bacteria 4358
911 Ga0495658_0004889 3300046683 Bacteria 6576
912 Ga0495658_0027133 3300046683 Bacteria 3078
913 Ga0495658_0109867 3300046683 Bacteria 1657
914 Ga0495613_0002281 3300046689 Bacteria 14509
915 Ga0495613_0003015 3300046689 Bacteria 12608
916 Ga0495613_0016014 3300046689 Bacteria 5582
917 Ga0495624_0005449 3300046690 Bacteria 9169
918 Ga0495624_0006912 3300046690 Bacteria 8002
919 Ga0495624_0030168 3300046690 Bacteria 3533
920 Ga0495624_0055194 3300046690 Bacteria 2503
921 Ga0495670_0044264 3300046691 Bacteria 2222
922 Ga0495589_0040148 3300046794 Bacteria 2338
923 Ga0495600_0001526 3300046809 Bacteria 12864
924 Ga0495600_0001732 3300046809 Bacteria 12197
925 Ga0495600_0034421 3300046809 Bacteria 3288
926 Ga0495600_0079095 3300046809 Bacteria 2147
927 Ga0495581_0000530 3300047315 Bacteria 19591
928 Ga0495581_0014680 3300047315 Bacteria 4543
929 Ga0495604_0002815 3300047317 Bacteria 13967
930 Ga0495604_0165071 3300047317 Bacteria 1562
931 Ga0495674_0000138 3300047319 Bacteria 55916
932 Ga0495674_0001486 3300047319 Bacteria 22968
933 Ga0495674_0069326 3300047319 Bacteria 3049
934 Ga0495674_0090443 3300047319 Bacteria 2615
935 Ga0495674_0119459 3300047319 Bacteria 2228
936 Ga0495674_0273753 3300047319 Bacteria 1385
937 Ga0495672_0019216 3300047320 Bacteria 4512
938 Ga0495672_0034108 3300047320 Bacteria 3147
939 Ga0495672_0046474 3300047320 Bacteria 2589
940 Ga0495676_0045353 3300047321 Bacteria 3579
941 Ga0495676_0095528 3300047321 Bacteria 2211
942 Ga0495680_0011728 3300047322 Bacteria 7741
943 Ga0495680_0061251 3300047322 Bacteria 2896
944 Ga0495680_0085190 3300047322 Bacteria 2380
945 Ga0495680_0130739 3300047322 Bacteria 1845
946 Ga0495683_0027742 3300047323 Bacteria 2895
947 Ga0495687_014951 3300047443 Bacteria 3967
948 Ga0495675_0012926 3300047444 Bacteria 5261
949 Ga0495675_0017016 3300047444 Bacteria 4603
950 Ga0495675_0087339 3300047444 Bacteria 1959
951 Ga0495684_0001215 3300047471 Bacteria 20690
952 Ga0495684_0019302 3300047471 Bacteria 5246
953 Ga0495684_0027385 3300047471 Bacteria 4376
954 Ga0495684_0032837 3300047471 Bacteria 3987
955 Ga0495684_0114104 3300047471 Bacteria 2037
956 Ga0495686_0193125 3300047472 Bacteria 1172
957 Ga0495593_0000345 3300047673 Bacteria 25682
958 Ga0495602_0012463 3300048088 Bacteria 8737
959 Ga0495602_0053861 3300048088 Bacteria 3558
960 Ga0495614_0023407 3300048089 Bacteria 2665
961 Ga0495615_0013853 3300048090 Bacteria 1693
962 Ga0495615_0022097 3300048090 Bacteria 1443
963 Ga0496100_0007042 3300048903 Bacteria 6170
964 Ga0496100_0054311 3300048903 Bacteria 2612
965 Ga0496100_0061728 3300048903 Bacteria 2470
966 Ga0496101_0001619 3300048904 Bacteria 13525
967 Ga0496101_0004213 3300048904 Bacteria 9009
968 Ga0496101_0068477 3300048904 Bacteria 2595
969 Ga0496101_0138739 3300048904 Bacteria 1852
970 Ga0496101_0221241 3300048904 Bacteria 1469
971 Ga0496102_0006904 3300048905 Bacteria 9684
972 Ga0496102_0023343 3300048905 Bacteria 5492
973 Ga0496103_0003429 3300048906 Bacteria 9692
974 Ga0496103_0062407 3300048906 Bacteria 2319
975 Ga0496103_0072235 3300048906 Bacteria 2161
976 Ga0496104_0006123 3300048907 Bacteria 10560
977 Ga0496104_0009040 3300048907 Bacteria 8859
978 Ga0496104_0067046 3300048907 Bacteria 3409
979 Ga0496104_0068763 3300048907 Bacteria 3365
980 Ga0496104_0149939 3300048907 Bacteria 2239
981 Ga0496105_0004225 3300048908 Bacteria 10790
982 Ga0496105_0035275 3300048908 Bacteria 4116
983 Ga0496105_0036082 3300048908 Bacteria 4071
984 Ga0496105_0039020 3300048908 Bacteria 3913
985 Ga0496105_0046279 3300048908 Bacteria 3591
986 Ga0496106_0000587 3300048909 Bacteria 25963
987 Ga0496106_0004983 3300048909 Bacteria 9830
988 Ga0496106_0012623 3300048909 Bacteria 6241
989 Ga0496106_0018998 3300048909 Bacteria 5093
990 Ga0496106_0059119 3300048909 Bacteria 2903
991 Ga0496106_0113223 3300048909 Bacteria 2114
992 Ga0496107_0002981 3300048910 Bacteria 11211
993 Ga0496107_0008057 3300048910 Bacteria 7275
994 Ga0496107_0037062 3300048910 Bacteria 3499
995 Ga0496108_0000517 3300048911 Bacteria 30206
996 Ga0496108_0005354 3300048911 Bacteria 10373
997 Ga0496108_0008243 3300048911 Bacteria 8457
998 Ga0496108_0014716 3300048911 Bacteria 6385
999 Ga0496108_0021192 3300048911 Bacteria 5341
1000 Ga0496108_0024182 3300048911 Bacteria 5001
1001 Ga0496108_0056517 3300048911 Bacteria 3297
1002 Ga0496109_0001287 3300048912 Bacteria 20815
1003 Ga0496109_0001899 3300048912 Bacteria 17343
1004 Ga0496109_0003767 3300048912 Bacteria 12667
1005 Ga0496109_0015266 3300048912 Bacteria 6687
1006 Ga0496109_0022363 3300048912 Bacteria 5600
1007 Ga0496109_0033944 3300048912 Bacteria 4592
1008 Ga0496109_0042157 3300048912 Bacteria 4133
1009 Ga0496109_0049200 3300048912 Bacteria 3837
1010 Ga0496109_0080204 3300048912 Bacteria 3007
1011 Ga0496109_0134155 3300048912 Bacteria 2312
1012 Ga0496109_0168887 3300048912 Bacteria 2052
1013 Ga0496109_0275439 3300048912 Bacteria 1585
1014 Ga0496109_0318284 3300048912 Bacteria 1468
1015 Ga0496110_0001638 3300048913 Bacteria 16435
1016 Ga0496110_0018515 3300048913 Bacteria 5840
1017 Ga0496110_0035267 3300048913 Bacteria 4339
1018 Ga0496110_0051151 3300048913 Bacteria 3630
1019 Ga0496110_0114130 3300048913 Bacteria 2430
1020 Ga0496110_0139915 3300048913 Bacteria 2188
1021 Ga0496110_0165008 3300048913 Bacteria 2008
1022 Ga0496110_0257807 3300048913 Bacteria 1587
1023 Ga0496110_0398155 3300048913 Bacteria 1255
1024 Ga0496111_0001713 3300048914 Bacteria 12814
1025 Ga0496111_0003286 3300048914 Bacteria 9989
1026 Ga0496111_0105893 3300048914 Bacteria 2070
1027 Ga0496111_0108437 3300048914 Bacteria 2044
1028 Ga0496111_0123339 3300048914 Bacteria 1914
1029 Ga0496112_0000004 3300048915 Bacteria 553294
1030 Ga0496112_0004435 3300048915 Bacteria 11889
1031 Ga0496112_0017567 3300048915 Bacteria 6724
1032 Ga0496112_0022393 3300048915 Bacteria 6023
1033 Ga0496112_0033460 3300048915 Bacteria 4997
1034 Ga0496112_0034589 3300048915 Bacteria 4917
1035 Ga0496112_0037988 3300048915 Bacteria 4701
1036 Ga0496112_0048275 3300048915 Bacteria 4174
1037 Ga0496112_0058807 3300048915 Bacteria 3786
1038 Ga0496112_0060042 3300048915 Bacteria 3746
1039 Ga0496112_0176529 3300048915 Bacteria 2101
1040 Ga0496113_0002800 3300048916 Bacteria 10265
1041 Ga0496113_0006800 3300048916 Bacteria 7289
1042 Ga0496113_0014818 3300048916 Bacteria 5334
1043 Ga0496113_0033117 3300048916 Bacteria 3760
1044 Ga0496113_0060308 3300048916 Bacteria 2859
1045 Ga0496114_0008606 3300048917 Bacteria 8086
1046 Ga0496114_0011846 3300048917 Bacteria 6977
1047 Ga0496114_0039109 3300048917 Bacteria 3925
1048 Ga0496114_0083373 3300048917 Bacteria 2705
1049 Ga0496114_0378579 3300048917 Bacteria 1253
1050 Ga0496115_0002504 3300048918 Bacteria 13204
1051 Ga0496115_0006400 3300048918 Bacteria 8627
1052 Ga0496115_0021895 3300048918 Bacteria 4943
1053 Ga0496115_0053770 3300048918 Bacteria 3232
1054 Ga0496115_0061200 3300048918 Bacteria 3035
1055 Ga0496115_0271458 3300048918 Bacteria 1393
1056 Ga0496116_0028721 3300048919 Bacteria 4023
1057 Ga0496117_0071071 3300048920 Bacteria 2334
1058 Ga0496118_0039892 3300048921 Bacteria 3741
1059 Ga0496119_0016774 3300048922 Bacteria 5548
1060 Ga0496119_0048622 3300048922 Bacteria 2629
1061 Ga0496120_0041707 3300048923 Bacteria 2686
1062 Ga0496120_0065797 3300048923 Bacteria 2007
1063 Ga0496121_0000458 3300048924 Bacteria 80207
1064 Ga0496121_0001749 3300048924 Bacteria 35439
1065 Ga0496121_0002564 3300048924 Bacteria 27512
1066 Ga0496121_0004375 3300048924 Bacteria 19087
1067 Ga0496121_0009926 3300048924 Bacteria 10838
1068 Ga0496121_0017689 3300048924 Bacteria 7256
1069 Ga0496121_0044385 3300048924 Bacteria 3835
1070 Ga0496121_0070359 3300048924 Bacteria 2819
1071 Ga0496121_0074115 3300048924 Bacteria 2724
1072 Ga0496121_0132223 3300048924 Bacteria 1865
1073 Ga0496121_0197402 3300048924 Bacteria 1437
1074 Ga0496122_0017860 3300048925 Bacteria 6593
1075 Ga0496122_0058303 3300048925 Bacteria 2860
1076 Ga0496123_0088166 3300048926 Bacteria 1854
1077 Ga0496124_0010603 3300048927 Bacteria 9314
1078 Ga0496125_0000951 3300048928 Bacteria 45511
1079 Ga0496125_0001462 3300048928 Bacteria 34212
1080 Ga0496125_0002254 3300048928 Bacteria 25623
1081 Ga0496125_0095051 3300048928 Bacteria 2218
1082 Ga0496126_0018663 3300048929 Bacteria 6864
1083 Ga0496126_0025235 3300048929 Bacteria 5722
1084 Ga0496126_0040762 3300048929 Bacteria 4303
1085 Ga0496126_0046444 3300048929 Bacteria 3983
1086 Ga0496126_0098652 3300048929 Bacteria 2559
1087 Ga0496126_0100548 3300048929 Bacteria 2530
1088 Ga0496126_0120639 3300048929 Bacteria 2274
1089 Ga0496126_0171016 3300048929 Bacteria 1851
1090 Ga0501031_0004867 3300049568 Bacteria 8730
1091 Ga0501031_0029474 3300049568 Bacteria 3579
1092 Ga0501031_0036678 3300049568 Bacteria 3198
1093 Ga0501031_0055369 3300049568 Bacteria 2584
1094 Ga0501032_0001822 3300049569 Bacteria 16845
1095 Ga0501032_0006705 3300049569 Bacteria 8452
1096 Ga0501032_0061313 3300049569 Bacteria 2521
1097 Ga0501032_0071711 3300049569 Bacteria 2308
1098 Ga0501033_0000827 3300049570 Bacteria 28243
1099 Ga0501033_0001583 3300049570 Bacteria 20018
1100 Ga0501033_0014098 3300049570 Bacteria 6078
1101 Ga0501033_0016530 3300049570 Bacteria 5585
1102 Ga0501033_0137995 3300049570 Bacteria 1764
1103 Ga0501034_0000032 3300049571 Bacteria 243763
1104 Ga0501034_0002449 3300049571 Bacteria 22384
1105 Ga0501034_0063969 3300049571 Bacteria 3693
1106 Ga0501034_0077338 3300049571 Bacteria 3333
1107 Ga0501034_0125024 3300049571 Bacteria 2557
1108 Ga0501034_0126594 3300049571 Bacteria 2539
1109 Ga0501034_0161501 3300049571 Bacteria 2211
1110 Ga0501034_0348099 3300049571 Bacteria 1410
1111 Ga0501036_0000149 3300049572 Bacteria 45598
1112 Ga0501036_0000674 3300049572 Bacteria 25113
1113 Ga0501036_0004945 3300049572 Bacteria 10773
1114 Ga0501036_0037467 3300049572 Bacteria 4102
1115 Ga0501036_0051485 3300049572 Bacteria 3486
1116 Ga0501036_0063926 3300049572 Bacteria 3115
1117 Ga0501036_0164909 3300049572 Bacteria 1868
1118 Ga0501037_0000153 3300049573 Bacteria 64239
1119 Ga0501037_0000888 3300049573 Bacteria 22320
1120 Ga0501037_0007710 3300049573 Bacteria 7879
1121 Ga0501037_0017413 3300049573 Bacteria 5291
1122 Ga0501037_0023391 3300049573 Bacteria 4569
1123 Ga0501037_0025967 3300049573 Bacteria 4327
1124 Ga0501037_0051032 3300049573 Bacteria 3025
1125 Ga0501037_0116080 3300049573 Bacteria 1926
1126 Ga0501038_0000138 3300049574 Bacteria 62493
1127 Ga0501038_0001121 3300049574 Bacteria 24319
1128 Ga0501038_0009574 3300049574 Bacteria 8887
1129 Ga0501038_0032799 3300049574 Bacteria 4578
1130 Ga0501038_0044769 3300049574 Bacteria 3843
1131 Ga0501038_0086561 3300049574 Bacteria 2632
1132 Ga0501038_0125019 3300049574 Bacteria 2117
1133 Ga0501039_0000842 3300049575 Bacteria 22166
1134 Ga0501039_0003466 3300049575 Bacteria 11782
1135 Ga0501039_0151491 3300049575 Bacteria 1822
1136 Ga0501039_0158354 3300049575 Bacteria 1779
1137 Ga0501042_0001932 3300049578 Bacteria 12476
1138 Ga0501042_0075397 3300049578 Bacteria 2414
1139 Ga0501043_0006630 3300049579 Bacteria 9261
1140 Ga0501043_0008464 3300049579 Bacteria 8098
1141 Ga0501043_0018007 3300049579 Bacteria 5540
1142 Ga0501043_0019806 3300049579 Bacteria 5283
1143 Ga0501043_0045301 3300049579 Bacteria 3459
1144 Ga0501043_0094042 3300049579 Bacteria 2356
1145 Ga0501043_0098002 3300049579 Bacteria 2304
1146 Ga0501043_0158632 3300049579 Bacteria 1768
1147 Ga0501046_0021327 3300049580 Bacteria 5347
1148 Ga0501046_0029266 3300049580 Bacteria 4478
1149 Ga0501046_0062318 3300049580 Bacteria 2914
1150 Ga0501046_0079255 3300049580 Bacteria 2539
1151 Ga0501046_0177177 3300049580 Bacteria 1596
1152 Ga0501047_0000010 3300049581 Bacteria 429357
1153 Ga0501047_0001785 3300049581 Bacteria 20809
1154 Ga0501047_0004062 3300049581 Bacteria 13761
1155 Ga0501047_0012519 3300049581 Bacteria 8035
1156 Ga0501047_0048611 3300049581 Bacteria 4096
1157 Ga0501047_0119186 3300049581 Bacteria 2521
1158 Ga0501047_0127100 3300049581 Bacteria 2429
1159 Ga0501047_0141576 3300049581 Bacteria 2283
1160 Ga0501047_0201508 3300049581 Bacteria 1851
1161 Ga0501047_0250797 3300049581 Bacteria 1618
1162 Ga0501048_0000396 3300049582 Bacteria 30302
1163 Ga0501048_0000653 3300049582 Bacteria 24953
1164 Ga0501067_0019432 3300049583 Bacteria 3761
1165 Ga0501067_0037938 3300049583 Bacteria 2676
1166 Ga0501067_0085856 3300049583 Bacteria 1746
1167 Ga0501068_0004084 3300049584 Bacteria 7922
1168 Ga0501068_0020465 3300049584 Bacteria 3854
1169 Ga0501068_0024884 3300049584 Bacteria 3518
1170 Ga0501068_0031994 3300049584 Bacteria 3126
1171 Ga0501068_0052257 3300049584 Bacteria 2472
1172 Ga0501068_0083832 3300049584 Bacteria 1960
1173 Ga0501069_0005888 3300049585 Bacteria 6388
1174 Ga0501070_0002230 3300049586 Bacteria 17026
1175 Ga0501070_0029990 3300049586 Bacteria 4557
1176 Ga0501070_0031212 3300049586 Bacteria 4463
1177 Ga0501070_0038371 3300049586 Bacteria 3996
1178 Ga0501070_0041037 3300049586 Bacteria 3856
1179 Ga0501070_0060813 3300049586 Bacteria 3130
1180 Ga0501070_0086286 3300049586 Bacteria 2598
1181 Ga0501071_0026342 3300049587 Bacteria 4080
1182 Ga0501072_0001051 3300049588 Bacteria 20459
1183 Ga0501072_0002565 3300049588 Bacteria 13617
1184 Ga0501072_0066504 3300049588 Bacteria 2843
1185 Ga0501072_0149988 3300049588 Bacteria 1859
1186 Ga0501073_0000221 3300049589 Bacteria 37338
1187 Ga0501073_0030234 3300049589 Bacteria 3868
1188 Ga0501073_0035819 3300049589 Bacteria 3526
1189 Ga0501073_0050655 3300049589 Bacteria 2910
1190 Ga0501073_0050877 3300049589 Bacteria 2902
1191 Ga0501073_0060342 3300049589 Bacteria 2647
1192 Ga0501073_0082683 3300049589 Bacteria 2234
1193 Ga0501073_0173309 3300049589 Bacteria 1493
1194 Ga0501074_0015795 3300049590 Bacteria 5489
1195 Ga0501074_0018904 3300049590 Bacteria 5004
1196 Ga0501074_0054256 3300049590 Bacteria 2890
1197 Ga0501076_0126782 3300049592 Bacteria 2069
1198 Ga0501077_0046592 3300049593 Bacteria 2754
1199 Ga0501079_0050115 3300049741 Bacteria 3223
1200 Ga0501080_0003063 3300049742 Bacteria 14759
1201 Ga0501080_0011359 3300049742 Bacteria 8154
1202 Ga0501080_0026159 3300049742 Bacteria 5420
1203 Ga0501080_0067483 3300049742 Bacteria 3326
1204 Ga0501080_0071767 3300049742 Bacteria 3221
1205 Ga0501080_0092246 3300049742 Bacteria 2813
1206 Ga0501080_0452977 3300049742 Bacteria 1150
1207 Ga0501083_0001423 3300049744 Bacteria 16322
1208 Ga0501083_0008402 3300049744 Bacteria 7299
1209 Ga0501083_0025847 3300049744 Bacteria 4064
1210 Ga0501083_0035733 3300049744 Bacteria 3393
1211 Ga0501083_0089514 3300049744 Bacteria 2033
1212 Ga0501035_0001426 3300049822 Bacteria 24484
1213 Ga0501035_0004322 3300049822 Bacteria 13496
1214 Ga0501035_0007645 3300049822 Bacteria 10098
1215 Ga0501035_0012953 3300049822 Bacteria 7697
1216 Ga0501035_0045651 3300049822 Bacteria 3941
1217 Ga0501035_0059092 3300049822 Bacteria 3414
1218 Ga0501035_0065875 3300049822 Bacteria 3215
1219 Ga0501035_0145794 3300049822 Bacteria 2056
1220 Ga0501035_0163108 3300049822 Bacteria 1928
1221 Ga0501035_0208445 3300049822 Bacteria 1673
1222 Ga0501044_0000369 3300049823 Bacteria 56363
1223 Ga0501044_0013258 3300049823 Bacteria 8923
1224 Ga0501044_0013456 3300049823 Bacteria 8849
1225 Ga0501044_0018430 3300049823 Bacteria 7479
1226 Ga0501044_0075210 3300049823 Bacteria 3429
1227 Ga0501044_0136215 3300049823 Bacteria 2447
1228 Ga0501045_0064688 3300049824 Bacteria 2685
1229 Ga0501045_0081311 3300049824 Bacteria 2389
1230 Ga0501045_0092737 3300049824 Bacteria 2234
1231 nmdc:mga03n38_6896_c1 3300050490 Bacteria 3985
1232 nmdc:mga00v17_9599_c1 3300050491 Bacteria 5244
1233 nmdc:mga0yw44_1008_c1 3300050492 Bacteria 10779
1234 nmdc:mga0yw44_27628_c1 3300050492 Bacteria 3253
1235 nmdc:mga0yw44_4407_c1 3300050492 Bacteria 6449
1236 nmdc:mga0yw44_7568_c1 3300050492 Bacteria 5352
1237 nmdc:mga0k408_41747_c1 3300050493 Bacteria 2641
1238 nmdc:mga0k408_71478_c1 3300050493 Bacteria 2025
1239 nmdc:mga06z11_23196_c1 3300050494 Bacteria 2911
1240 nmdc:mga06z11_5654_c1 3300050494 Bacteria 5036
1241 nmdc:mga04h51_53107_c1 3300050495 Bacteria 1366
1242 nmdc:mga07m45_1367_c1 3300050496 Bacteria 11128
1243 nmdc:mga08y16_172_c1 3300050511 Bacteria 56716
1244 nmdc:mga08y16_55900_c1 3300050511 Bacteria 4124
1245 nmdc:mga0n895_24014_c1 3300050512 Bacteria 5739
1246 nmdc:mga0rr50_180782_c1 3300050513 Bacteria 1724
1247 nmdc:mga08x19_4_c2 3300050514 Bacteria 202063
1248 nmdc:mga08x19_89926_c1 3300050514 Bacteria 2025
1249 nmdc:mga0sz30_8294_c1 3300050516 Bacteria 3919
1250 Ga0495601_0002574 3300053077 Bacteria 10312
1251 Ga0495601_0015114 3300053077 Bacteria 4662
1252 Ga0495601_0036761 3300053077 Bacteria 3060
1253 Ga0495601_0047852 3300053077 Bacteria 2693
1254 Ga0495601_0054332 3300053077 Bacteria 2534
1255 Ga0495612_0004857 3300053078 Bacteria 5566
1256 Ga0495612_0085424 3300053078 Bacteria 1330
1257 Ga0500610_0142077 3300053079 Bacteria 1211
1258 Ga0500635_0027246 3300053080 Bacteria 1815
1259 Ga0495655_0001288 3300053083 Bacteria 3860
1260 Ga0495595_0025302 3300053084 Bacteria 2629
1261 Ga0495595_0100767 3300053084 Bacteria 1394
1262 Ga0495619_0000609 3300053085 Bacteria 23652
1263 Ga0495619_0000757 3300053085 Bacteria 21079
1264 Ga0495619_0000799 3300053085 Bacteria 20602
1265 Ga0495619_0001114 3300053085 Bacteria 17646
1266 Ga0495619_0026157 3300053085 Bacteria 3753
1267 Ga0495619_0048425 3300053085 Bacteria 2800
1268 Ga0500643_000032 3300053087 Bacteria 200350
1269 Ga0500644_0000786 3300053088 Bacteria 10824
1270 Ga0500647_0023164 3300053091 Bacteria 2911
1271 Ga0500583_0048761 3300053092 Bacteria 1956
1272 Ga0500651_0027621 3300053093 Bacteria 3569
1273 Ga0500566_0000006 3300053094 Bacteria 153632
1274 Ga0500566_0002123 3300053094 Bacteria 11677
1275 Ga0500566_0011398 3300053094 Bacteria 5236
1276 Ga0500566_0017517 3300053094 Bacteria 4210
1277 Ga0500640_003111 3300053095 Bacteria 5688
1278 Ga0500641_0011598 3300053096 Bacteria 3201
1279 Ga0500650_0000167 3300053098 Bacteria 16961
1280 Ga0500555_002027 3300053103 Bacteria 5966
1281 Ga0500556_0000030 3300053104 Bacteria 165098
1282 Ga0500557_000004 3300053105 Bacteria 202318
1283 Ga0500572_000870 3300053111 Bacteria 9372
1284 Ga0500572_001481 3300053111 Bacteria 6343
1285 Ga0500595_000002 3300053119 Bacteria 1074388
1286 Ga0500595_000306 3300053119 Bacteria 32239
1287 Ga0500595_001964 3300053119 Bacteria 10563
1288 Ga0500595_002618 3300053119 Bacteria 8762
1289 Ga0500595_006167 3300053119 Bacteria 5129
1290 Ga0500595_007411 3300053119 Bacteria 4553
1291 Ga0500595_009208 3300053119 Bacteria 3996
1292 Ga0500595_030128 3300053119 Bacteria 1832
1293 Ga0500595_033571 3300053119 Bacteria 1702
1294 Ga0500595_038239 3300053119 Bacteria 1560
1295 Ga0500608_010820 3300053122 Bacteria 3933
1296 Ga0500608_066101 3300053122 Bacteria 1724
1297 Ga0500614_000745 3300053123 Bacteria 8292
1298 Ga0500642_0000080 3300053130 Bacteria 52024
1299 Ga0500642_0000302 3300053130 Bacteria 17637
1300 Ga0500652_000003 3300053131 Bacteria 221528
1301 Ga0500652_001787 3300053131 Bacteria 6519
1302 Ga0500652_007383 3300053131 Bacteria 3597
1303 Ga0500655_011446 3300053133 Bacteria 1608
1304 Ga0500559_0000714 3300053136 Bacteria 21826
1305 Ga0500559_0002857 3300053136 Bacteria 8726
1306 Ga0500559_0004788 3300053136 Bacteria 6337
1307 Ga0500568_0000001 3300053139 Bacteria 988705
1308 Ga0500568_0000978 3300053139 Bacteria 19672
1309 Ga0500568_0012491 3300053139 Bacteria 3903
1310 Ga0500577_0000263 3300053142 Bacteria 13754
1311 Ga0500586_001063 3300053145 Bacteria 5668
1312 Ga0500590_082201 3300053148 Bacteria 1580
1313 Ga0500603_000163 3300053150 Bacteria 16654
1314 Ga0500603_000339 3300053150 Bacteria 12234
1315 Ga0500616_0000002 3300053153 Bacteria 1611257
1316 Ga0500616_0000252 3300053153 Bacteria 83060
1317 Ga0500616_0000696 3300053153 Bacteria 39234
1318 Ga0500616_0004537 3300053153 Bacteria 9843
1319 Ga0500616_0012792 3300053153 Bacteria 4899
1320 Ga0500616_0016773 3300053153 Bacteria 4163
1321 Ga0500622_0003870 3300053156 Bacteria 9716
1322 Ga0500630_000788 3300053159 Bacteria 14585
1323 Ga0500633_0016195 3300053160 Bacteria 2158
1324 Ga0500638_084353 3300053162 Bacteria 1505
1325 Ga0500639_000765 3300053163 Bacteria 16347
1326 Ga0500636_0000066 3300053177 Bacteria 51367
1327 Ga0500636_0013143 3300053177 Bacteria 4858
1328 Ga0500636_0015097 3300053177 Bacteria 4546
1329 Ga0500636_0036362 3300053177 Bacteria 2915
1330 Ga0500637_0003078 3300053178 Bacteria 7601
1331 Ga0500637_0009851 3300053178 Bacteria 4886
1332 Ga0500637_0074348 3300053178 Bacteria 1958
1333 Ga0500625_043521 3300053729 Bacteria 2104
1334 Ga0500645_000385 3300053730 Bacteria 30984
1335 Ga0500596_004638 3300053735 Bacteria 2503
1336 Ga0500596_005269 3300053735 Bacteria 2296
1337 Ga0500596_005521 3300053735 Bacteria 2213
1338 Ga0500599_001124 3300053736 Bacteria 3028
1339 Ga0501084_0011449 3300054114 Bacteria 7345
1340 Ga0501084_0170783 3300054114 Bacteria 1835
1341 Ga0501084_0250095 3300054114 Bacteria 1496
1342 Ga0501082_0000183 3300060353 Bacteria 54241
1343 Ga0501082_0016777 3300060353 Bacteria 6306
1344 Ga0501082_0094903 3300060353 Bacteria 2578

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044842 Ga0466957_0304793 Ga0466957_0304793_18_1052 332
2 3300048904 Ga0496101_0138739 Ga0496101_0138739_786_1841 345
3 3300025937 Ga0207669_10096367 Ga0207669_100963672 354
4 3300053079 Ga0500610_0142077 Ga0500610_0142077_12_1085 357
5 3300047444 Ga0495675_0087339 Ga0495675_0087339_25_1107 358
6 3300048090 Ga0495615_0022097 Ga0495615_0022097_330_1412 358
7 3300048929 Ga0496126_0098652 Ga0496126_0098652_43_1245 360
8 3300046543 Ga0495645_0050362 Ga0495645_0050362_1834_2955 361
9 3300035116 Ga0373945_0015340 Ga0373945_0015340_1455_2564 369
10 3300046474 Ga0495605_0077055 Ga0495605_0077055_82_1191 369
11 3300047472 Ga0495686_0193125 Ga0495686_0193125_12_1121 369
12 3300048924 Ga0496121_0074115 Ga0496121_0074115_10_1119 369
13 3300049571 Ga0501034_0125024 Ga0501034_0125024_1414_2523 369
14 3300049742 Ga0501080_0452977 Ga0501080_0452977_19_1131 369
15 3300053078 Ga0495612_0085424 Ga0495612_0085424_161_1270 369
16 3300005539 Ga0068853_100095505 Ga0068853_1000955053 370
17 3300007788 Ga0099795_10025171 Ga0099795_100251713 370
18 3300037418 Ga0395900_0504171 Ga0395900_0504171_33_1145 370
19 3300046492 Ga0495585_0050021 Ga0495585_0050021_1178_2296 370
20 3300048913 Ga0496110_0398155 Ga0496110_0398155_109_1221 370
21 3300048917 Ga0496114_0378579 Ga0496114_0378579_121_1233 370
22 3300048918 Ga0496115_0271458 Ga0496115_0271458_263_1375 370
23 3300049568 Ga0501031_0036678 Ga0501031_0036678_2067_3179 370
24 3300050495 nmdc:mga04h51_53107_c1 nmdc:mga04h51_53107_c1_23_1291 378
25 3300044694 Ga0466963_0051971 Ga0466963_0051971_1509_2702 385
26 3300006042 Ga0075368_10014162 Ga0075368_100141623 391
27 3300006177 Ga0075362_10025532 Ga0075362_100255323 391
28 3300006186 Ga0075369_10045777 Ga0075369_100457773 391
29 3300006195 Ga0075366_10059614 Ga0075366_100596144 391
30 3300050493 nmdc:mga0k408_71478_c1 nmdc:mga0k408_71478_c1_620_1927 391
31 3300050516 nmdc:mga0sz30_8294_c1 nmdc:mga0sz30_8294_c1_1066_2373 391
32 3300009098 Ga0105245_10021446 Ga0105245_100214465 393
33 3300025927 Ga0207687_10131080 Ga0207687_101310801 393
34 3300026023 Ga0207677_10011127 Ga0207677_100111271 393
35 3300010375 Ga0105239_10201369 Ga0105239_102013693 395
36 3300025917 Ga0207660_10109729 Ga0207660_101097292 402
37 3300049822 Ga0501035_0208445 Ga0501035_0208445_42_1337 403
38 3300005455 Ga0070663_100105892 Ga0070663_1001058922 405
39 3300005577 Ga0068857_100049167 Ga0068857_1000491673 405
40 3300005614 Ga0068856_100149477 Ga0068856_1001494771 405
41 3300009093 Ga0105240_10045568 Ga0105240_100455682 405
42 3300010375 Ga0105239_10067902 Ga0105239_100679024 405
43 3300025904 Ga0207647_10002921 Ga0207647_100029217 405
44 3300026116 Ga0207674_10003611 Ga0207674_1000361114 405
45 3300013306 Ga0163162_10312021 Ga0163162_103120212 407
46 3300049568 Ga0501031_0029474 Ga0501031_0029474_157_1455 407
47 3300049569 Ga0501032_0001822 Ga0501032_0001822_4116_5414 407
48 3300049571 Ga0501034_0002449 Ga0501034_0002449_4312_5610 407
49 3300049572 Ga0501036_0000149 Ga0501036_0000149_4749_6047 407
50 3300049573 Ga0501037_0000153 Ga0501037_0000153_60475_61773 407
51 3300049574 Ga0501038_0000138 Ga0501038_0000138_2701_3999 407
52 3300049575 Ga0501039_0000842 Ga0501039_0000842_17489_18787 407
53 3300049579 Ga0501043_0018007 Ga0501043_0018007_79_1377 407
54 3300049581 Ga0501047_0001785 Ga0501047_0001785_11964_13262 407
55 3300049582 Ga0501048_0000396 Ga0501048_0000396_2701_3999 407
56 3300049583 Ga0501067_0019432 Ga0501067_0019432_46_1344 407
57 3300049584 Ga0501068_0004084 Ga0501068_0004084_4075_5373 407
58 3300049585 Ga0501069_0005888 Ga0501069_0005888_2490_3788 407
59 3300049586 Ga0501070_0031212 Ga0501070_0031212_46_1344 407
60 3300049586 Ga0501070_0038371 Ga0501070_0038371_1013_2311 407
61 3300049588 Ga0501072_0002565 Ga0501072_0002565_6708_8006 407
62 3300049589 Ga0501073_0000221 Ga0501073_0000221_6089_7387 407
63 3300049590 Ga0501074_0018904 Ga0501074_0018904_531_1829 407
64 3300049741 Ga0501079_0050115 Ga0501079_0050115_952_2250 407
65 3300049742 Ga0501080_0011359 Ga0501080_0011359_2089_3387 407
66 3300049822 Ga0501035_0004322 Ga0501035_0004322_6174_7472 407
67 3300049823 Ga0501044_0000369 Ga0501044_0000369_4170_5468 407
68 3300054114 Ga0501084_0011449 Ga0501084_0011449_543_1841 407
69 3300060353 Ga0501082_0016777 Ga0501082_0016777_969_2267 407
70 3300060353 Ga0501082_0094903 Ga0501082_0094903_1025_2323 407
71 3300044673 Ga0453683_0000499 Ga0453683_0000499_13284_14603 409
72 3300045049 Ga0466959_0065541 Ga0466959_0065541_831_2129 410
73 3300049570 Ga0501033_0014098 Ga0501033_0014098_3826_5121 410
74 3300049581 Ga0501047_0012519 Ga0501047_0012519_3015_4310 410
75 3300049586 Ga0501070_0041037 Ga0501070_0041037_1813_3108 410
76 3300049822 Ga0501035_0045651 Ga0501035_0045651_84_1379 410
77 3300049823 Ga0501044_0013456 Ga0501044_0013456_4938_6233 410
78 3300036401 Ga0373937_0020656 Ga0373937_0020656_450_1751 411
79 3300046809 Ga0495600_0079095 Ga0495600_0079095_420_1721 411
80 3300047319 Ga0495674_0119459 Ga0495674_0119459_534_1835 411
81 3300048089 Ga0495614_0023407 Ga0495614_0023407_1413_2648 411
82 3300053077 Ga0495601_0015114 Ga0495601_0015114_14_1315 411
83 3300053085 Ga0495619_0000799 Ga0495619_0000799_12654_13955 411
84 3300028577 Ga0265318_10012129 Ga0265318_100121292 412
85 3300031240 Ga0265320_10011080 Ga0265320_100110803 412
86 3300031250 Ga0265331_10029591 Ga0265331_100295913 412
87 3300037853 Ga0436364_1381345 Ga0436364_1381345_550_1848 413
88 3300046455 Ga0495603_0012614 Ga0495603_0012614_522_1820 413
89 iso_pu_bacteria 8019597564 8019600623 413
90 3300005985 Ga0081539_10018773 Ga0081539_100187734 417
91 3300006942 Ga0099824_1015115 Ga0099824_10151156 417
92 3300027357 Ga0209589_1000001 Ga0209589_1000001146 417
93 3300027361 Ga0209489_100001 Ga0209489_100001146 417
94 3300027363 Ga0209700_100001 Ga0209700_100001146 417
95 3300005530 Ga0070679_100050504 Ga0070679_1000505042 418
96 3300025921 Ga0207652_10122151 Ga0207652_101221512 418
97 3300005356 Ga0070674_100032577 Ga0070674_1000325772 419
98 3300005434 Ga0070709_10068774 Ga0070709_100687741 419
99 3300005437 Ga0070710_10127488 Ga0070710_101274881 419
100 3300005614 Ga0068856_100000020 Ga0068856_10000002011 419
101 3300006175 Ga0070712_100048375 Ga0070712_1000483752 419
102 3300025898 Ga0207692_10006397 Ga0207692_100063974 419
103 3300025906 Ga0207699_10007610 Ga0207699_100076104 419
104 3300025907 Ga0207645_10086454 Ga0207645_100864542 419
105 3300025915 Ga0207693_10001875 Ga0207693_1000187514 419
106 3300025937 Ga0207669_10078648 Ga0207669_100786482 419
107 3300026078 Ga0207702_10002142 Ga0207702_1000214216 419
108 3300053119 Ga0500595_007411 Ga0500595_007411_1564_2868 419
109 3300053131 Ga0500652_000003 Ga0500652_000003_199731_201035 419
110 3300053177 Ga0500636_0013143 Ga0500636_0013143_1945_3249 419
111 iso_pu_bacteria 8019530166 8019534375 419
112 3300005327 Ga0070658_10059686 Ga0070658_100596862 420
113 3300005937 Ga0081455_10030306 Ga0081455_100303066 422
114 3300005983 Ga0081540_1016111 Ga0081540_10161115 423
115 3300005983 Ga0081540_1028760 Ga0081540_10287604 423
116 3300025302 Ga0207426_1023520 Ga0207426_10235203 423
117 3300053139 Ga0500568_0000001 Ga0500568_0000001_349871_351163 423
118 3300005983 Ga0081540_1003015 Ga0081540_10030155 424
119 3300049583 Ga0501067_0037938 Ga0501067_0037938_62_1360 424
120 3300005434 Ga0070709_10029765 Ga0070709_100297652 425
121 3300005458 Ga0070681_10021129 Ga0070681_100211297 425
122 3300005530 Ga0070679_100015288 Ga0070679_1000152882 425
123 3300005563 Ga0068855_100034770 Ga0068855_1000347707 425
124 3300009093 Ga0105240_10073684 Ga0105240_100736843 425
125 3300025912 Ga0207707_10009522 Ga0207707_100095223 425
126 3300025913 Ga0207695_10081943 Ga0207695_100819431 425
127 3300025917 Ga0207660_10160578 Ga0207660_101605781 425
128 3300025921 Ga0207652_10117589 Ga0207652_101175892 425
129 3300028573 Ga0265334_10045848 Ga0265334_100458482 425
130 3300028666 Ga0265336_10013212 Ga0265336_100132123 425
131 3300028800 Ga0265338_10000665 Ga0265338_1000066551 425
132 3300025900 Ga0207710_10018364 Ga0207710_100183642 426
133 3300048924 Ga0496121_0197402 Ga0496121_0197402_146_1426 426
134 3300005455 Ga0070663_100003715 Ga0070663_1000037157 427
135 3300005937 Ga0081455_10096354 Ga0081455_100963542 427
136 3300005983 Ga0081540_1011009 Ga0081540_10110097 427
137 3300006048 Ga0075363_100004915 Ga0075363_1000049156 427
138 3300006178 Ga0075367_10018220 Ga0075367_100182202 427
139 3300009551 Ga0105238_10072194 Ga0105238_100721942 427
140 3300026067 Ga0207678_10008261 Ga0207678_100082618 427
141 3300028379 Ga0268266_10056381 Ga0268266_100563813 427
142 3300048918 Ga0496115_0021895 Ga0496115_0021895_288_1589 427
143 3300050496 nmdc:mga07m45_1367_c1 nmdc:mga07m45_1367_c1_5147_6448 427
144 3300003215 JGI25153J46596_10000740 JGI25153J46596_1000074010 428
145 3300005983 Ga0081540_1002154 Ga0081540_10021546 428
146 3300005983 Ga0081540_1023632 Ga0081540_10236323 428
147 3300025297 Ga0209758_1001968 Ga0209758_100196810 428
148 iso_pu_bacteria 2507262055 2507508360 428
149 iso_pu_bacteria 2508501009 2508542435 428
150 iso_pu_bacteria 2508501042 2508691802 428
151 iso_pu_bacteria 2513237096 2513657925 428
152 iso_pu_bacteria 2513237101 2513692809 428
153 iso_pu_bacteria 2513237137 2513855623 428
154 iso_pu_bacteria 2513237145 2513919982 428
155 iso_pu_bacteria 2515154112 2515627138 428
156 iso_pu_bacteria 2517093001 2517102835 428
157 iso_pu_bacteria 2524023228 2524534263 428
158 iso_pu_bacteria 2528768022 2528853872 428
159 iso_pu_bacteria 2643221651 2644288843 428
160 iso_pu_bacteria 2667528175 2671120582 428
161 iso_pu_bacteria 2721755755 2723844833 428
162 iso_pu_bacteria 2728368998 2728753143 428
163 iso_pu_bacteria 2744054633 2745079652 428
164 iso_pu_bacteria 2791355197 2793068759 428
165 iso_pu_bacteria 2791355199 2793082294 428
166 iso_pu_bacteria 2824661429 2824668631 428
167 iso_pu_bacteria 2842038055 2842040027 428
168 iso_pu_bacteria 2842045827 2842047028 428
169 iso_pu_bacteria 2857509624 2857516649 428
170 iso_pu_bacteria 2874590934 2874598273 428
171 iso_pu_bacteria 2874604998 2874605455 428
172 iso_pu_bacteria 2874628541 2874632087 428
173 iso_pu_bacteria 2874645413 2874652671 428
174 iso_pu_bacteria 2876771140 2876778249 428
175 iso_pu_bacteria 2876808645 2876814391 428
176 iso_pu_bacteria 2876818435 2876825882 428
177 iso_pu_bacteria 2879074833 2879082043 428
178 iso_pu_bacteria 2879099564 2879104898 428
179 iso_pu_bacteria 2879110137 2879115768 428
180 iso_pu_bacteria 2879127579 2879135190 428
181 iso_pu_bacteria 2879142872 2879145451 428
182 iso_pu_bacteria 2881665667 2881673292 428
183 iso_pu_bacteria 2889033259 2889039539 428
184 iso_pu_bacteria 2903748898 2903754908 428
185 iso_pu_bacteria 2904690495 2904694762 428
186 iso_pu_bacteria 2906610324 2906617290 428
187 iso_pu_bacteria 2906635258 2906643315 428
188 iso_pu_bacteria 2906643746 2906645151 428
189 iso_pu_bacteria 2906660503 2906662555 428
190 iso_pu_bacteria 2908739725 2908742441 428
191 iso_pu_bacteria 2908756301 2908760084 428
192 iso_pu_bacteria 2922361189 2922365585 428
193 iso_pu_bacteria 2922368715 2922374651 428
194 iso_pu_bacteria 2922386360 2922391203 428
195 iso_pu_bacteria 2922425934 2922430534 428
196 iso_pu_bacteria 2932784394 2932788597 428
197 iso_pu_bacteria 2932809354 2932817181 428
198 iso_pu_bacteria 2932818245 2932825230 428
199 iso_pu_bacteria 2932828146 2932830246 428
200 iso_pu_bacteria 2935608549 2935609152 428
201 iso_pu_bacteria 2935616580 2935622528 428
202 iso_pu_bacteria 2935630451 2935631308 428
203 iso_pu_bacteria 2935638405 2935642133 428
204 iso_pu_bacteria 2935648319 2935651048 428
205 iso_pu_bacteria 2935656913 2935659229 428
206 iso_pu_bacteria 2935665750 2935672483 428
207 iso_pu_bacteria 2935675223 2935676053 428
208 iso_pu_bacteria 2935684952 2935686044 428
209 iso_pu_bacteria 2935694250 2935697711 428
210 iso_pu_bacteria 2935703347 2935705884 428
211 iso_pu_bacteria 2935713505 2935714596 428
212 iso_pu_bacteria 2935722832 2935725215 428
213 iso_pu_bacteria 2935732158 2935732425 428
214 iso_pu_bacteria 2935741537 2935741804 428
215 iso_pu_bacteria 2935750917 2935752009 428
216 iso_pu_bacteria 2935760218 2935765266 428
217 iso_pu_bacteria 2935801545 2935802881 428
218 iso_pu_bacteria 2935810662 2935813287 428
219 iso_pu_bacteria 2935819856 2935822312 428
220 iso_pu_bacteria 2935827899 2935830300 428
221 iso_pu_bacteria 2935837841 2935838197 428
222 iso_pu_bacteria 2935847175 2935847894 428
223 iso_pu_bacteria 2935855204 2935860777 428
224 iso_pu_bacteria 2935864058 2935872250 428
225 iso_pu_bacteria 2935873716 2935878695 428
226 iso_pu_bacteria 2935908558 2935908887 428
227 iso_pu_bacteria 2935916978 2935919606 428
228 iso_pu_bacteria 2935926038 2935926539 428
229 iso_pu_bacteria 2935934488 2935934989 428
230 iso_pu_bacteria 2935942939 2935943439 428
231 iso_pu_bacteria 2935951376 2935951877 428
232 iso_pu_bacteria 2935967501 2935968002 428
233 iso_pu_bacteria 2935975950 2935978631 428
234 iso_pu_bacteria 2935984226 2935987511 428
235 iso_pu_bacteria 2935992306 2935994909 428
236 iso_pu_bacteria 2936002035 2936003552 428
237 iso_pu_bacteria 2936011229 2936013644 428
238 iso_pu_bacteria 2936019824 2936022229 428
239 iso_pu_bacteria 2936028420 2936030675 428
240 iso_pu_bacteria 2936037263 2936042236 428
241 iso_pu_bacteria 2936046547 2936048488 428
242 iso_pu_bacteria 2936055302 2936058702 428
243 iso_pu_bacteria 2940556831 2940557188 428
244 iso_pu_bacteria 2941507105 2941510049 428
245 iso_pu_bacteria 2941515067 2941518864 428
246 iso_pu_bacteria 2941523033 2941525448 428
247 iso_pu_bacteria 2941538514 2941539136 428
248 iso_pu_bacteria 3005506211 3005510542 428
249 iso_pu_bacteria 8006933436 8006940438 428
250 iso_pu_bacteria 8006964411 8006967078 428
251 iso_pu_bacteria 8006973647 8006980127 428
252 iso_pu_bacteria 8006984368 8006988037 428
253 iso_pu_bacteria 8006994254 8006995763 428
254 iso_pu_bacteria 8016511872 8016522062 428
255 iso_pu_bacteria 8016630954 8016640087 428
256 iso_pu_bacteria 8017057580 8017063605 428
257 iso_pu_bacteria 8019555841 8019556341 428
258 iso_pu_bacteria 8019565922 8019568971 428
259 iso_pu_bacteria 8019576017 8019582929 428
260 iso_pu_bacteria 8019586578 8019590726 428
261 iso_pu_bacteria 8019608314 8019617922 428
262 iso_pu_bacteria 8019619141 8019628426 428
263 iso_pu_bacteria 8019638758 8019645523 428
264 iso_pu_bacteria 8019659431 8019662086 428
265 iso_pu_bacteria 8019668869 8019671605 428
266 iso_pu_bacteria 8019687851 8019690301 428
267 iso_pu_bacteria 8056673599 8056673620 428
268 iso_pu_bacteria 8056681323 8056687384 428
269 iso_pu_bacteria 8056689827 8056691291 428
270 3300035725 Ga0373947_0084669 Ga0373947_0084669_298_1602 429
271 3300039437 Ga0436365_0552397 Ga0436365_0552397_3760_5052 429
272 3300048904 Ga0496101_0221241 Ga0496101_0221241_143_1447 429
273 3300048907 Ga0496104_0006123 Ga0496104_0006123_7234_8538 429
274 3300048908 Ga0496105_0004225 Ga0496105_0004225_9188_10492 429
275 3300048911 Ga0496108_0021192 Ga0496108_0021192_3801_5105 429
276 3300048912 Ga0496109_0001287 Ga0496109_0001287_14119_15423 429
277 3300048913 Ga0496110_0114130 Ga0496110_0114130_697_2001 429
278 3300048914 Ga0496111_0123339 Ga0496111_0123339_558_1862 429
279 3300048915 Ga0496112_0017567 Ga0496112_0017567_3364_4668 429
280 3300048916 Ga0496113_0002800 Ga0496113_0002800_8324_9628 429
281 3300048918 Ga0496115_0061200 Ga0496115_0061200_1470_2774 429
282 3300053153 Ga0500616_0016773 Ga0500616_0016773_1684_2982 429
283 iso_pu_bacteria 2508501128 2509150486 429
284 iso_pu_bacteria 2511231028 2511399885 429
285 iso_pu_bacteria 2513237092 2513625090 429
286 iso_pu_bacteria 2513237095 2513645612 429
287 iso_pu_bacteria 2513237098 2513674458 429
288 iso_pu_bacteria 2513237102 2513706618 429
289 iso_pu_bacteria 2513237104 2513722595 429
290 iso_pu_bacteria 2513237139 2513872985 429
291 iso_pu_bacteria 2513237141 2513894740 429
292 iso_pu_bacteria 2513237161 2514013752 429
293 iso_pu_bacteria 2517572143 2517892163 429
294 iso_pu_bacteria 2524023205 2524437565 429
295 iso_pu_bacteria 2524023210 2524465733 429
296 iso_pu_bacteria 2602042107 2603859667 429
297 iso_pu_bacteria 2617270735 2617347156 429
298 iso_pu_bacteria 2617270741 2617375537 429
299 iso_pu_bacteria 2791355196 2793065480 429
300 iso_pu_bacteria 2802429603 2805915115 429
301 iso_pu_bacteria 2816332527 2818238658 429
302 iso_pu_bacteria 2824600985 2824604110 429
303 iso_pu_bacteria 2824609381 2824610379 429
304 iso_pu_bacteria 2824617872 2824617953 429
305 iso_pu_bacteria 2824626560 2824626621 429
306 iso_pu_bacteria 2824635225 2824638638 429
307 iso_pu_bacteria 2824644064 2824646106 429
308 iso_pu_bacteria 2824671348 2824672497 429
309 iso_pu_bacteria 2824679649 2824685881 429
310 iso_pu_bacteria 2824687955 2824688947 429
311 iso_pu_bacteria 2824714736 2824716292 429
312 iso_pu_bacteria 2824746037 2824746576 429
313 iso_pu_bacteria 2824753945 2824759517 429
314 iso_pu_bacteria 2824763712 2824771732 429
315 iso_pu_bacteria 2824773399 2824775416 429
316 iso_pu_bacteria 2838122688 2838123513 429
317 iso_pu_bacteria 2841941048 2841947711 429
318 iso_pu_bacteria 2841949485 2841949615 429
319 iso_pu_bacteria 2841957949 2841964204 429
320 iso_pu_bacteria 2841966195 2841971878 429
321 iso_pu_bacteria 2841974524 2841974779 429
322 iso_pu_bacteria 2841983080 2841983663 429
323 iso_pu_bacteria 2844315083 2844319277 429
324 iso_pu_bacteria 2847930680 2847936438 429
325 iso_pu_bacteria 2847939898 2847946787 429
326 iso_pu_bacteria 2849076700 2849079100 429
327 iso_pu_bacteria 2857524615 2857528935 429
328 iso_pu_bacteria 2874612657 2874619525 429
329 iso_pu_bacteria 2874620515 2874627580 429
330 iso_pu_bacteria 2876761206 2876764755 429
331 iso_pu_bacteria 2879083081 2879090220 429
332 iso_pu_bacteria 2881364244 2881368621 429
333 iso_pu_bacteria 2885366525 2885373551 429
334 iso_pu_bacteria 2885374607 2885382740 429
335 iso_pu_bacteria 2888378607 2888384294 429
336 iso_pu_bacteria 2888388044 2888393592 429
337 iso_pu_bacteria 2888419890 2888424754 429
338 iso_pu_bacteria 2893066018 2893070393 429
339 iso_pu_bacteria 2903727486 2903731117 429
340 iso_pu_bacteria 2903768456 2903771783 429
341 iso_pu_bacteria 2904666416 2904673100 429
342 iso_pu_bacteria 2904699407 2904702306 429
343 iso_pu_bacteria 2904711408 2904714905 429
344 iso_pu_bacteria 2906602504 2906607374 429
345 iso_pu_bacteria 2906626472 2906631141 429
346 iso_pu_bacteria 2908775508 2908780398 429
347 iso_pu_bacteria 2919073203 2919076335 429
348 iso_pu_bacteria 2922393267 2922400578 429
349 iso_pu_bacteria 2929615660 2929621745 429
350 iso_pu_bacteria 2929624759 2929629948 429
351 iso_pu_bacteria 2932794094 2932798131 429
352 iso_pu_bacteria 2932801729 2932807013 429
353 iso_pu_bacteria 2933577622 2933583979 429
354 iso_pu_bacteria 2935769743 2935771829 429
355 iso_pu_bacteria 2935777560 2935778731 429
356 iso_pu_bacteria 2935785616 2935788880 429
357 iso_pu_bacteria 2935793552 2935795320 429
358 iso_pu_bacteria 2935883170 2935886863 429
359 iso_pu_bacteria 2935959822 2935960636 429
360 iso_pu_bacteria 2941531003 2941533033 429
361 iso_pu_bacteria 3005474847 3005480446 429
362 iso_pu_bacteria 3005483717 3005484539 429
363 iso_pu_bacteria 3005587118 3005587822 429
364 iso_pu_bacteria 3005594810 3005599459 429
365 iso_pu_bacteria 3005710791 3005715119 429
366 iso_pu_bacteria 3005718088 3005722519 429
367 iso_pu_bacteria 8006926726 8006931345 429
368 iso_pu_bacteria 8016522445 8016529399 429
369 iso_pu_bacteria 8016530956 8016534609 429
370 iso_pu_bacteria 8016539877 8016547833 429
371 iso_pu_bacteria 8016548790 8016554304 429
372 iso_pu_bacteria 8016557553 8016562679 429
373 iso_pu_bacteria 8016566248 8016572955 429
374 iso_pu_bacteria 8016595262 8016600460 429
375 iso_pu_bacteria 8016603502 8016610283 429
376 iso_pu_bacteria 8016613128 8016614649 429
377 iso_pu_bacteria 8016622563 8016626345 429
378 iso_pu_bacteria 8019538911 8019545087 429
379 iso_pu_bacteria 8019547302 8019553434 429
380 iso_pu_bacteria 8019648815 8019658762 429
381 iso_pu_bacteria 8055742211 8055746089 429
382 iso_pu_bacteria 8056967851 8056968249 429
383 3300006175 Ga0070712_100004909 Ga0070712_1000049097 430
384 3300006175 Ga0070712_100061706 Ga0070712_1000617062 430
385 3300006353 Ga0075370_10047579 Ga0075370_100475792 430
386 3300025915 Ga0207693_10001080 Ga0207693_1000108019 430
387 3300031727 Ga0316576_10157855 Ga0316576_101578552 430
388 3300006051 Ga0075364_10024537 Ga0075364_100245374 431
389 3300006177 Ga0075362_10003689 Ga0075362_100036894 431
390 3300006178 Ga0075367_10005474 Ga0075367_100054744 431
391 3300006914 Ga0075436_100031832 Ga0075436_1000318324 431
392 3300009094 Ga0111539_10084268 Ga0111539_100842683 431
393 3300009147 Ga0114129_10187696 Ga0114129_101876961 431
394 3300031548 Ga0307408_100024489 Ga0307408_1000244892 431
395 3300031911 Ga0307412_10135882 Ga0307412_101358822 431
396 3300049574 Ga0501038_0044769 Ga0501038_0044769_293_1588 431
397 3300050490 nmdc:mga03n38_6896_c1 nmdc:mga03n38_6896_c1_1336_2637 431
398 3300050491 nmdc:mga00v17_9599_c1 nmdc:mga00v17_9599_c1_1596_2894 431
399 3300050492 nmdc:mga0yw44_27628_c1 nmdc:mga0yw44_27628_c1_1904_3202 431
400 3300050494 nmdc:mga06z11_5654_c1 nmdc:mga06z11_5654_c1_1241_2542 431
401 3300050511 nmdc:mga08y16_55900_c1 nmdc:mga08y16_55900_c1_1918_3219 431
402 3300050514 nmdc:mga08x19_89926_c1 nmdc:mga08x19_89926_c1_245_1543 431
403 3300003215 JGI25153J46596_10003653 JGI25153J46596_100036536 432
404 3300003354 JGI25160J50197_1001080 JGI25160J50197_100108015 432
405 3300005262 Ga0065165_1025653 Ga0065165_10256532 432
406 3300005330 Ga0070690_100004750 Ga0070690_1000047504 432
407 3300005331 Ga0070670_100077822 Ga0070670_1000778223 432
408 3300005331 Ga0070670_100096468 Ga0070670_1000964682 432
409 3300005334 Ga0068869_100028213 Ga0068869_1000282135 432
410 3300005337 Ga0070682_100032890 Ga0070682_1000328904 432
411 3300005338 Ga0068868_100009579 Ga0068868_1000095793 432
412 3300005338 Ga0068868_100276285 Ga0068868_1002762851 432
413 3300005340 Ga0070689_100067341 Ga0070689_1000673412 432
414 3300005340 Ga0070689_100092019 Ga0070689_1000920193 432
415 3300005340 Ga0070689_100109297 Ga0070689_1001092972 432
416 3300005344 Ga0070661_100141724 Ga0070661_1001417241 432
417 3300005347 Ga0070668_100020450 Ga0070668_1000204504 432
418 3300005354 Ga0070675_100073782 Ga0070675_1000737823 432
419 3300005355 Ga0070671_100098641 Ga0070671_1000986411 432
420 3300005356 Ga0070674_100047762 Ga0070674_1000477624 432
421 3300005364 Ga0070673_100055829 Ga0070673_1000558292 432
422 3300005365 Ga0070688_100005391 Ga0070688_1000053914 432
423 3300005367 Ga0070667_100009653 Ga0070667_1000096535 432
424 3300005367 Ga0070667_100148326 Ga0070667_1001483262 432
425 3300005434 Ga0070709_10021489 Ga0070709_100214892 432
426 3300005435 Ga0070714_100111893 Ga0070714_1001118932 432
427 3300005435 Ga0070714_100257729 Ga0070714_1002577291 432
428 3300005436 Ga0070713_100029886 Ga0070713_1000298864 432
429 3300005439 Ga0070711_100020708 Ga0070711_1000207084 432
430 3300005441 Ga0070700_100032022 Ga0070700_1000320223 432
431 3300005441 Ga0070700_100070960 Ga0070700_1000709602 432
432 3300005441 Ga0070700_100116164 Ga0070700_1001161642 432
433 3300005455 Ga0070663_100025035 Ga0070663_1000250351 432
434 3300005456 Ga0070678_100033155 Ga0070678_1000331555 432
435 3300005456 Ga0070678_100038499 Ga0070678_1000384994 432
436 3300005456 Ga0070678_100046523 Ga0070678_1000465233 432
437 3300005457 Ga0070662_100086845 Ga0070662_1000868452 432
438 3300005466 Ga0070685_10009588 Ga0070685_100095882 432
439 3300005530 Ga0070679_100148690 Ga0070679_1001486901 432
440 3300005539 Ga0068853_100073806 Ga0068853_1000738063 432
441 3300005543 Ga0070672_100145150 Ga0070672_1001451502 432
442 3300005543 Ga0070672_100148853 Ga0070672_1001488532 432
443 3300005544 Ga0070686_100044137 Ga0070686_1000441373 432
444 3300005545 Ga0070695_100001320 Ga0070695_1000013207 432
445 3300005548 Ga0070665_100083382 Ga0070665_1000833823 432
446 3300005548 Ga0070665_100104524 Ga0070665_1001045242 432
447 3300005548 Ga0070665_100221489 Ga0070665_1002214891 432
448 3300005563 Ga0068855_100160757 Ga0068855_1001607572 432
449 3300005616 Ga0068852_100015717 Ga0068852_1000157173 432
450 3300005617 Ga0068859_100046985 Ga0068859_1000469853 432
451 3300005618 Ga0068864_100046630 Ga0068864_1000466305 432
452 3300005618 Ga0068864_100262673 Ga0068864_1002626732 432
453 3300005718 Ga0068866_10029627 Ga0068866_100296273 432
454 3300005719 Ga0068861_100023990 Ga0068861_1000239903 432
455 3300005719 Ga0068861_100110233 Ga0068861_1001102332 432
456 3300005841 Ga0068863_100007995 Ga0068863_1000079956 432
457 3300005841 Ga0068863_100076014 Ga0068863_1000760144 432
458 3300005842 Ga0068858_100051014 Ga0068858_1000510144 432
459 3300005843 Ga0068860_100024209 Ga0068860_1000242093 432
460 3300005844 Ga0068862_100042098 Ga0068862_1000420983 432
461 3300005983 Ga0081540_1000143 Ga0081540_100014340 432
462 3300005983 Ga0081540_1002625 Ga0081540_10026251 432
463 3300005983 Ga0081540_1005422 Ga0081540_10054222 432
464 3300005983 Ga0081540_1006906 Ga0081540_10069069 432
465 3300006038 Ga0075365_10041177 Ga0075365_100411772 432
466 3300006038 Ga0075365_10127397 Ga0075365_101273972 432
467 3300006048 Ga0075363_100046915 Ga0075363_1000469152 432
468 3300006163 Ga0070715_10012125 Ga0070715_100121254 432
469 3300006175 Ga0070712_100029025 Ga0070712_1000290253 432
470 3300006177 Ga0075362_10036285 Ga0075362_100362852 432
471 3300006178 Ga0075367_10026576 Ga0075367_100265762 432
472 3300006237 Ga0097621_100085119 Ga0097621_1000851193 432
473 3300006353 Ga0075370_10075879 Ga0075370_100758792 432
474 3300006846 Ga0075430_100000244 Ga0075430_1000002444 432
475 3300006881 Ga0068865_100025798 Ga0068865_1000257983 432
476 3300006881 Ga0068865_100079400 Ga0068865_1000794003 432
477 3300006914 Ga0075436_100004211 Ga0075436_1000042113 432
478 3300006931 Ga0097620_100046986 Ga0097620_1000469863 432
479 3300006942 Ga0099824_1007930 Ga0099824_10079305 432
480 3300009094 Ga0111539_10186184 Ga0111539_101861842 432
481 3300009098 Ga0105245_10106651 Ga0105245_101066512 432
482 3300009101 Ga0105247_10026306 Ga0105247_100263065 432
483 3300009147 Ga0114129_10354797 Ga0114129_103547972 432
484 3300009148 Ga0105243_10130437 Ga0105243_101304371 432
485 3300009176 Ga0105242_10033580 Ga0105242_100335803 432
486 3300009177 Ga0105248_10013945 Ga0105248_100139454 432
487 3300009177 Ga0105248_10283693 Ga0105248_102836932 432
488 3300009545 Ga0105237_10062673 Ga0105237_100626734 432
489 3300009545 Ga0105237_10386896 Ga0105237_103868961 432
490 3300009551 Ga0105238_10018493 Ga0105238_100184933 432
491 3300009553 Ga0105249_10029823 Ga0105249_100298233 432
492 3300010375 Ga0105239_10080663 Ga0105239_100806632 432
493 3300013104 Ga0157370_10186971 Ga0157370_101869712 432
494 3300013105 Ga0157369_10010862 Ga0157369_100108628 432
495 3300013105 Ga0157369_10097519 Ga0157369_100975192 432
496 3300013296 Ga0157374_10018913 Ga0157374_100189133 432
497 3300013296 Ga0157374_10087148 Ga0157374_100871484 432
498 3300013297 Ga0157378_10057957 Ga0157378_100579574 432
499 3300013297 Ga0157378_10073594 Ga0157378_100735943 432
500 3300013306 Ga0163162_10126869 Ga0163162_101268692 432
501 3300013307 Ga0157372_10067851 Ga0157372_100678511 432
502 3300013308 Ga0157375_10321881 Ga0157375_103218812 432
503 3300014325 Ga0163163_10152441 Ga0163163_101524411 432
504 3300014326 Ga0157380_10064729 Ga0157380_100647293 432
505 3300014745 Ga0157377_10024449 Ga0157377_100244493 432
506 3300014968 Ga0157379_10097715 Ga0157379_100977151 432
507 3300017792 Ga0163161_10008394 Ga0163161_100083944 432
508 3300021361 Ga0213872_10023205 Ga0213872_100232052 432
509 3300025253 Ga0209677_102829 Ga0209677_1028295 432
510 3300025261 Ga0209233_1000804 Ga0209233_10008042 432
511 3300025297 Ga0209758_1002659 Ga0209758_10026591 432
512 3300025297 Ga0209758_1008964 Ga0209758_10089646 432
513 3300025297 Ga0209758_1017349 Ga0209758_10173493 432
514 3300025302 Ga0207426_1000278 Ga0207426_100027853 432
515 3300025302 Ga0207426_1000378 Ga0207426_100037898 432
516 3300025302 Ga0207426_1002170 Ga0207426_10021703 432
517 3300025302 Ga0207426_1018412 Ga0207426_10184122 432
518 3300025898 Ga0207692_10017678 Ga0207692_100176784 432
519 3300025899 Ga0207642_10043027 Ga0207642_100430272 432
520 3300025901 Ga0207688_10000263 Ga0207688_100002639 432
521 3300025903 Ga0207680_10020383 Ga0207680_100203832 432
522 3300025906 Ga0207699_10025811 Ga0207699_100258113 432
523 3300025907 Ga0207645_10022280 Ga0207645_100222802 432
524 3300025908 Ga0207643_10000889 Ga0207643_100008895 432
525 3300025909 Ga0207705_10075165 Ga0207705_100751652 432
526 3300025910 Ga0207684_10003987 Ga0207684_100039874 432
527 3300025911 Ga0207654_10015528 Ga0207654_100155284 432
528 3300025912 Ga0207707_10027011 Ga0207707_100270113 432
529 3300025914 Ga0207671_10044503 Ga0207671_100445033 432
530 3300025915 Ga0207693_10007332 Ga0207693_100073322 432
531 3300025915 Ga0207693_10174151 Ga0207693_101741512 432
532 3300025916 Ga0207663_10000347 Ga0207663_100003472 432
533 3300025916 Ga0207663_10143834 Ga0207663_101438342 432
534 3300025918 Ga0207662_10000154 Ga0207662_100001549 432
535 3300025926 Ga0207659_10140306 Ga0207659_101403062 432
536 3300025927 Ga0207687_10008325 Ga0207687_100083256 432
537 3300025928 Ga0207700_10078975 Ga0207700_100789752 432
538 3300025928 Ga0207700_10102014 Ga0207700_101020142 432
539 3300025928 Ga0207700_10178814 Ga0207700_101788142 432
540 3300025929 Ga0207664_10010393 Ga0207664_100103935 432
541 3300025929 Ga0207664_10096420 Ga0207664_100964202 432
542 3300025931 Ga0207644_10056409 Ga0207644_100564091 432
543 3300025932 Ga0207690_10100607 Ga0207690_101006072 432
544 3300025933 Ga0207706_10020484 Ga0207706_100204847 432
545 3300025934 Ga0207686_10090123 Ga0207686_100901232 432
546 3300025935 Ga0207709_10106054 Ga0207709_101060542 432
547 3300025936 Ga0207670_10020290 Ga0207670_100202903 432
548 3300025937 Ga0207669_10109797 Ga0207669_101097972 432
549 3300025938 Ga0207704_10037137 Ga0207704_100371373 432
550 3300025939 Ga0207665_10043622 Ga0207665_100436223 432
551 3300025939 Ga0207665_10105306 Ga0207665_101053061 432
552 3300025940 Ga0207691_10015435 Ga0207691_100154358 432
553 3300025940 Ga0207691_10118759 Ga0207691_101187592 432
554 3300025941 Ga0207711_10182249 Ga0207711_101822492 432
555 3300025942 Ga0207689_10051147 Ga0207689_100511473 432
556 3300025944 Ga0207661_10148070 Ga0207661_101480702 432
557 3300025945 Ga0207679_10039187 Ga0207679_100391871 432
558 3300025949 Ga0207667_10170068 Ga0207667_101700682 432
559 3300025960 Ga0207651_10000900 Ga0207651_100009007 432
560 3300025961 Ga0207712_10010883 Ga0207712_100108834 432
561 3300025972 Ga0207668_10030283 Ga0207668_100302833 432
562 3300025986 Ga0207658_10018594 Ga0207658_100185942 432
563 3300026023 Ga0207677_10010239 Ga0207677_100102394 432
564 3300026035 Ga0207703_10013883 Ga0207703_100138833 432
565 3300026041 Ga0207639_10195327 Ga0207639_101953272 432
566 3300026067 Ga0207678_10029694 Ga0207678_100296943 432
567 3300026067 Ga0207678_10034437 Ga0207678_100344376 432
568 3300026075 Ga0207708_10006322 Ga0207708_100063229 432
569 3300026075 Ga0207708_10012533 Ga0207708_100125334 432
570 3300026075 Ga0207708_10109972 Ga0207708_101099723 432
571 3300026078 Ga0207702_10115998 Ga0207702_101159983 432
572 3300026088 Ga0207641_10135346 Ga0207641_101353461 432
573 3300026089 Ga0207648_10001639 Ga0207648_100016397 432
574 3300026089 Ga0207648_10059959 Ga0207648_100599592 432
575 3300026095 Ga0207676_10031583 Ga0207676_100315832 432
576 3300026116 Ga0207674_10044894 Ga0207674_100448946 432
577 3300026118 Ga0207675_100008008 Ga0207675_1000080085 432
578 3300026118 Ga0207675_100124538 Ga0207675_1001245383 432
579 3300026118 Ga0207675_100196290 Ga0207675_1001962902 432
580 3300026121 Ga0207683_10015556 Ga0207683_100155567 432
581 3300026121 Ga0207683_10035723 Ga0207683_100357233 432
582 3300026142 Ga0207698_10004120 Ga0207698_100041208 432
583 3300027296 Ga0209389_1000032 Ga0209389_10000327 432
584 3300027296 Ga0209389_1000995 Ga0209389_100099514 432
585 3300027357 Ga0209589_1000211 Ga0209589_100021114 432
586 3300027361 Ga0209489_100006 Ga0209489_100006126 432
587 3300027361 Ga0209489_111765 Ga0209489_1117655 432
588 3300027363 Ga0209700_100005 Ga0209700_100005174 432
589 3300028379 Ga0268266_10044379 Ga0268266_100443792 432
590 3300028381 Ga0268264_10073523 Ga0268264_100735233 432
591 3300028381 Ga0268264_10226639 Ga0268264_102266392 432
592 3300028786 Ga0307517_10000249 Ga0307517_1000024941 432
593 3300028794 Ga0307515_10050561 Ga0307515_100505612 432
594 3300031238 Ga0265332_10001409 Ga0265332_100014092 432
595 3300031247 Ga0265340_10011380 Ga0265340_100113803 432
596 3300031247 Ga0265340_10011777 Ga0265340_100117775 432
597 3300031249 Ga0265339_10016860 Ga0265339_100168602 432
598 3300031249 Ga0265339_10048704 Ga0265339_100487042 432
599 3300031249 Ga0265339_10086086 Ga0265339_100860861 432
600 3300031250 Ga0265331_10025769 Ga0265331_100257692 432
601 3300031711 Ga0265314_10002127 Ga0265314_1000212710 432
602 3300031712 Ga0265342_10002171 Ga0265342_1000217110 432
603 3300031730 Ga0307516_10011365 Ga0307516_100113658 432
604 3300031730 Ga0307516_10153301 Ga0307516_101533012 432
605 3300031911 Ga0307412_10058553 Ga0307412_100585532 432
606 3300032002 Ga0307416_100142142 Ga0307416_1001421423 432
607 3300032005 Ga0307411_10187957 Ga0307411_101879572 432
608 3300033180 Ga0307510_10013733 Ga0307510_100137336 432
609 3300033180 Ga0307510_10033134 Ga0307510_100331341 432
610 3300033442 Ga0315911_1000006 Ga0315911_1000006250 432
611 3300033544 Ga0316215_1003036 Ga0316215_10030361 432
612 3300035119 Ga0373956_0024869 Ga0373956_0024869_441_1739 432
613 3300035170 Ga0373943_0022381 Ga0373943_0022381_492_1790 432
614 3300035172 Ga0373955_0013625 Ga0373955_0013625_1336_2634 432
615 3300035692 Ga0373935_0001116 Ga0373935_0001116_12134_13432 432
616 3300035695 Ga0373927_0001437 Ga0373927_0001437_10370_11668 432
617 3300035724 Ga0373933_0053271 Ga0373933_0053271_407_1705 432
618 3300035725 Ga0373947_0003173 Ga0373947_0003173_1408_2706 432
619 3300036401 Ga0373937_0065794 Ga0373937_0065794_1941_3239 432
620 3300037068 Ga0373925_0006458 Ga0373925_0006458_5066_6364 432
621 3300037068 Ga0373925_0075820 Ga0373925_0075820_1111_2409 432
622 3300037312 Ga0395899_0007661 Ga0395899_0007661_1950_3248 432
623 3300037418 Ga0395900_0002820 Ga0395900_0002820_12399_13697 432
624 3300037418 Ga0395900_0132770 Ga0395900_0132770_497_1795 432
625 3300037418 Ga0395900_0224298 Ga0395900_0224298_203_1501 432
626 3300037466 Ga0395898_0035823 Ga0395898_0035823_1937_3235 432
627 3300038443 Ga0395901_0073052 Ga0395901_0073052_313_1611 432
628 3300039447 Ga0436361_0476110 Ga0436361_0476110_2534_3841 432
629 3300046455 Ga0495603_0001086 Ga0495603_0001086_13738_15036 432
630 3300046459 Ga0495629_0000726 Ga0495629_0000726_7650_8948 432
631 3300046459 Ga0495629_0145998 Ga0495629_0145998_285_1583 432
632 3300046460 Ga0495638_0078657 Ga0495638_0078657_627_1925 432
633 3300046461 Ga0495641_0000747 Ga0495641_0000747_20390_21688 432
634 3300046463 Ga0495653_0120003 Ga0495653_0120003_462_1760 432
635 3300046473 Ga0495582_0000416 Ga0495582_0000416_15355_16653 432
636 3300046473 Ga0495582_0018577 Ga0495582_0018577_2320_3618 432
637 3300046474 Ga0495605_0058321 Ga0495605_0058321_32_1330 432
638 3300046475 Ga0495639_0000165 Ga0495639_0000165_17823_19121 432
639 3300046475 Ga0495639_0042460 Ga0495639_0042460_280_1578 432
640 3300046476 Ga0495662_0000066 Ga0495662_0000066_34693_35991 432
641 3300046477 Ga0495664_0025954 Ga0495664_0025954_61_1359 432
642 3300046499 Ga0495594_0000441 Ga0495594_0000441_9609_10907 432
643 3300046501 Ga0495607_0055693 Ga0495607_0055693_654_1952 432
644 3300046507 Ga0495606_0001663 Ga0495606_0001663_3020_4318 432
645 3300046511 Ga0495608_0002377 Ga0495608_0002377_2449_3750 432
646 3300046514 Ga0495618_0020274 Ga0495618_0020274_827_2128 432
647 3300046515 Ga0495620_0049417 Ga0495620_0049417_42_1340 432
648 3300046516 Ga0495628_0020389 Ga0495628_0020389_3250_4548 432
649 3300046516 Ga0495628_0146998 Ga0495628_0146998_99_1400 432
650 3300046517 Ga0495630_0008582 Ga0495630_0008582_2742_4040 432
651 3300046518 Ga0495631_0019145 Ga0495631_0019145_80_1378 432
652 3300046528 Ga0495642_0056699 Ga0495642_0056699_204_1502 432
653 3300046531 Ga0495665_0000802 Ga0495665_0000802_9611_10909 432
654 3300046533 Ga0495640_0003534 Ga0495640_0003534_2550_3848 432
655 3300046536 Ga0495587_0001337 Ga0495587_0001337_13961_15262 432
656 3300046543 Ga0495645_0034306 Ga0495645_0034306_1822_3120 432
657 3300046557 Ga0495622_0004915 Ga0495622_0004915_2614_3912 432
658 3300046642 Ga0495634_0002191 Ga0495634_0002191_12549_13847 432
659 3300046663 Ga0495635_0002022 Ga0495635_0002022_4233_5531 432
660 3300046664 Ga0495659_0044852 Ga0495659_0044852_231_1529 432
661 3300046674 Ga0495588_0055784 Ga0495588_0055784_425_1723 432
662 3300046678 Ga0495599_0013701 Ga0495599_0013701_2448_3749 432
663 3300046678 Ga0495599_0097191 Ga0495599_0097191_304_1602 432
664 3300046681 Ga0495647_0001835 Ga0495647_0001835_3439_4737 432
665 3300046683 Ga0495658_0004889 Ga0495658_0004889_2965_4263 432
666 3300046689 Ga0495613_0016014 Ga0495613_0016014_1057_2355 432
667 3300046690 Ga0495624_0055194 Ga0495624_0055194_167_1465 432
668 3300046794 Ga0495589_0040148 Ga0495589_0040148_305_1603 432
669 3300046809 Ga0495600_0034421 Ga0495600_0034421_1018_2316 432
670 3300047315 Ga0495581_0000530 Ga0495581_0000530_15328_16626 432
671 3300047319 Ga0495674_0001486 Ga0495674_0001486_3887_5185 432
672 3300047320 Ga0495672_0034108 Ga0495672_0034108_1411_2709 432
673 3300047320 Ga0495672_0046474 Ga0495672_0046474_1279_2577 432
674 3300047321 Ga0495676_0095528 Ga0495676_0095528_537_1835 432
675 3300047471 Ga0495684_0032837 Ga0495684_0032837_1826_3124 432
676 3300047673 Ga0495593_0000345 Ga0495593_0000345_11164_12462 432
677 3300048903 Ga0496100_0054311 Ga0496100_0054311_129_1427 432
678 3300048904 Ga0496101_0004213 Ga0496101_0004213_1610_2908 432
679 3300048904 Ga0496101_0068477 Ga0496101_0068477_312_1610 432
680 3300048906 Ga0496103_0003429 Ga0496103_0003429_1106_2404 432
681 3300048907 Ga0496104_0149939 Ga0496104_0149939_79_1377 432
682 3300048908 Ga0496105_0036082 Ga0496105_0036082_392_1690 432
683 3300048909 Ga0496106_0113223 Ga0496106_0113223_392_1690 432
684 3300048910 Ga0496107_0008057 Ga0496107_0008057_5244_6542 432
685 3300048911 Ga0496108_0005354 Ga0496108_0005354_5752_7062 432
686 3300048911 Ga0496108_0008243 Ga0496108_0008243_1106_2404 432
687 3300048912 Ga0496109_0001899 Ga0496109_0001899_5924_7234 432
688 3300048912 Ga0496109_0134155 Ga0496109_0134155_118_1416 432
689 3300048912 Ga0496109_0275439 Ga0496109_0275439_214_1512 432
690 3300048912 Ga0496109_0318284 Ga0496109_0318284_39_1337 432
691 3300048913 Ga0496110_0001638 Ga0496110_0001638_5063_6373 432
692 3300048913 Ga0496110_0051151 Ga0496110_0051151_123_1421 432
693 3300048914 Ga0496111_0001713 Ga0496111_0001713_4735_6045 432
694 3300048914 Ga0496111_0003286 Ga0496111_0003286_1561_2859 432
695 3300048915 Ga0496112_0000004 Ga0496112_0000004_257951_259249 432
696 3300048915 Ga0496112_0022393 Ga0496112_0022393_4675_5985 432
697 3300048915 Ga0496112_0034589 Ga0496112_0034589_2358_3656 432
698 3300048916 Ga0496113_0014818 Ga0496113_0014818_132_1430 432
699 3300048916 Ga0496113_0033117 Ga0496113_0033117_2261_3559 432
700 3300048917 Ga0496114_0039109 Ga0496114_0039109_2371_3669 432
701 3300048918 Ga0496115_0006400 Ga0496115_0006400_129_1427 432
702 3300048922 Ga0496119_0048622 Ga0496119_0048622_558_1856 432
703 3300048923 Ga0496120_0041707 Ga0496120_0041707_997_2295 432
704 3300048924 Ga0496121_0004375 Ga0496121_0004375_7980_9281 432
705 3300048924 Ga0496121_0017689 Ga0496121_0017689_4233_5531 432
706 3300048924 Ga0496121_0044385 Ga0496121_0044385_2122_3420 432
707 3300048924 Ga0496121_0070359 Ga0496121_0070359_934_2232 432
708 3300048929 Ga0496126_0018663 Ga0496126_0018663_4771_6069 432
709 3300048929 Ga0496126_0025235 Ga0496126_0025235_3917_5215 432
710 3300048929 Ga0496126_0040762 Ga0496126_0040762_2161_3459 432
711 3300048929 Ga0496126_0046444 Ga0496126_0046444_2632_3930 432
712 3300049568 Ga0501031_0055369 Ga0501031_0055369_951_2249 432
713 3300049569 Ga0501032_0061313 Ga0501032_0061313_342_1640 432
714 3300049569 Ga0501032_0071711 Ga0501032_0071711_337_1635 432
715 3300049570 Ga0501033_0137995 Ga0501033_0137995_32_1330 432
716 3300049571 Ga0501034_0000032 Ga0501034_0000032_147701_148999 432
717 3300049571 Ga0501034_0063969 Ga0501034_0063969_70_1368 432
718 3300049571 Ga0501034_0126594 Ga0501034_0126594_1032_2330 432
719 3300049572 Ga0501036_0051485 Ga0501036_0051485_1014_2312 432
720 3300049572 Ga0501036_0063926 Ga0501036_0063926_382_1680 432
721 3300049572 Ga0501036_0164909 Ga0501036_0164909_78_1376 432
722 3300049573 Ga0501037_0051032 Ga0501037_0051032_124_1422 432
723 3300049573 Ga0501037_0116080 Ga0501037_0116080_436_1734 432
724 3300049574 Ga0501038_0009574 Ga0501038_0009574_7239_8537 432
725 3300049574 Ga0501038_0086561 Ga0501038_0086561_330_1628 432
726 3300049574 Ga0501038_0125019 Ga0501038_0125019_627_1925 432
727 3300049575 Ga0501039_0158354 Ga0501039_0158354_182_1480 432
728 3300049578 Ga0501042_0075397 Ga0501042_0075397_712_2010 432
729 3300049579 Ga0501043_0006630 Ga0501043_0006630_7368_8666 432
730 3300049579 Ga0501043_0045301 Ga0501043_0045301_1535_2833 432
731 3300049579 Ga0501043_0094042 Ga0501043_0094042_104_1402 432
732 3300049579 Ga0501043_0158632 Ga0501043_0158632_360_1658 432
733 3300049580 Ga0501046_0079255 Ga0501046_0079255_55_1353 432
734 3300049581 Ga0501047_0048611 Ga0501047_0048611_2318_3616 432
735 3300049581 Ga0501047_0127100 Ga0501047_0127100_452_1750 432
736 3300049581 Ga0501047_0141576 Ga0501047_0141576_329_1627 432
737 3300049581 Ga0501047_0250797 Ga0501047_0250797_281_1579 432
738 3300049584 Ga0501068_0020465 Ga0501068_0020465_418_1716 432
739 3300049584 Ga0501068_0052257 Ga0501068_0052257_282_1580 432
740 3300049584 Ga0501068_0083832 Ga0501068_0083832_13_1311 432
741 3300049586 Ga0501070_0029990 Ga0501070_0029990_77_1375 432
742 3300049586 Ga0501070_0060813 Ga0501070_0060813_457_1755 432
743 3300049587 Ga0501071_0026342 Ga0501071_0026342_1629_2927 432
744 3300049588 Ga0501072_0001051 Ga0501072_0001051_213_1511 432
745 3300049588 Ga0501072_0066504 Ga0501072_0066504_449_1747 432
746 3300049589 Ga0501073_0035819 Ga0501073_0035819_596_1894 432
747 3300049589 Ga0501073_0060342 Ga0501073_0060342_194_1492 432
748 3300049589 Ga0501073_0082683 Ga0501073_0082683_13_1311 432
749 3300049589 Ga0501073_0173309 Ga0501073_0173309_179_1477 432
750 3300049590 Ga0501074_0054256 Ga0501074_0054256_1305_2603 432
751 3300049742 Ga0501080_0026159 Ga0501080_0026159_3251_4549 432
752 3300049742 Ga0501080_0067483 Ga0501080_0067483_618_1916 432
753 3300049742 Ga0501080_0092246 Ga0501080_0092246_1316_2617 432
754 3300049744 Ga0501083_0001423 Ga0501083_0001423_1029_2387 432
755 3300049744 Ga0501083_0035733 Ga0501083_0035733_146_1444 432
756 3300049744 Ga0501083_0089514 Ga0501083_0089514_229_1527 432
757 3300049822 Ga0501035_0007645 Ga0501035_0007645_2165_3463 432
758 3300049822 Ga0501035_0059092 Ga0501035_0059092_1959_3257 432
759 3300049822 Ga0501035_0065875 Ga0501035_0065875_1186_2484 432
760 3300049824 Ga0501045_0092737 Ga0501045_0092737_112_1410 432
761 3300050492 nmdc:mga0yw44_1008_c1 nmdc:mga0yw44_1008_c1_199_1497 432
762 3300050492 nmdc:mga0yw44_4407_c1 nmdc:mga0yw44_4407_c1_1282_2580 432
763 3300050492 nmdc:mga0yw44_7568_c1 nmdc:mga0yw44_7568_c1_1412_2710 432
764 3300050493 nmdc:mga0k408_41747_c1 nmdc:mga0k408_41747_c1_852_2150 432
765 3300050494 nmdc:mga06z11_23196_c1 nmdc:mga06z11_23196_c1_765_2063 432
766 3300050514 nmdc:mga08x19_4_c2 nmdc:mga08x19_4_c2_149394_150695 432
767 3300053077 Ga0495601_0036761 Ga0495601_0036761_1061_2359 432
768 3300053077 Ga0495601_0047852 Ga0495601_0047852_66_1364 432
769 3300053083 Ga0495655_0001288 Ga0495655_0001288_130_1428 432
770 3300053084 Ga0495595_0100767 Ga0495595_0100767_17_1315 432
771 3300053085 Ga0495619_0048425 Ga0495619_0048425_1114_2415 432
772 3300053088 Ga0500644_0000786 Ga0500644_0000786_3898_5196 432
773 3300053093 Ga0500651_0027621 Ga0500651_0027621_170_1471 432
774 3300053094 Ga0500566_0000006 Ga0500566_0000006_10144_11442 432
775 3300053095 Ga0500640_003111 Ga0500640_003111_2421_3719 432
776 3300053111 Ga0500572_000870 Ga0500572_000870_1287_2585 432
777 3300053111 Ga0500572_001481 Ga0500572_001481_2677_3975 432
778 3300053119 Ga0500595_001964 Ga0500595_001964_5835_7136 432
779 3300053119 Ga0500595_002618 Ga0500595_002618_3413_4711 432
780 3300053119 Ga0500595_006167 Ga0500595_006167_2368_3666 432
781 3300053119 Ga0500595_030128 Ga0500595_030128_52_1350 432
782 3300053119 Ga0500595_033571 Ga0500595_033571_233_1531 432
783 3300053119 Ga0500595_038239 Ga0500595_038239_105_1406 432
784 3300053122 Ga0500608_010820 Ga0500608_010820_266_1564 432
785 3300053123 Ga0500614_000745 Ga0500614_000745_1284_2582 432
786 3300053136 Ga0500559_0000714 Ga0500559_0000714_7697_8995 432
787 3300053136 Ga0500559_0004788 Ga0500559_0004788_1457_2755 432
788 3300053150 Ga0500603_000339 Ga0500603_000339_6509_7807 432
789 3300053153 Ga0500616_0004537 Ga0500616_0004537_1461_2759 432
790 3300053153 Ga0500616_0012792 Ga0500616_0012792_13_1311 432
791 3300053159 Ga0500630_000788 Ga0500630_000788_12005_13303 432
792 3300053160 Ga0500633_0016195 Ga0500633_0016195_221_1519 432
793 3300053162 Ga0500638_084353 Ga0500638_084353_25_1326 432
794 3300053163 Ga0500639_000765 Ga0500639_000765_9954_11252 432
795 3300053177 Ga0500636_0036362 Ga0500636_0036362_364_1662 432
796 3300053178 Ga0500637_0074348 Ga0500637_0074348_648_1946 432
797 3300053735 Ga0500596_004638 Ga0500596_004638_1150_2448 432
798 3300053735 Ga0500596_005521 Ga0500596_005521_301_1599 432
799 3300053736 Ga0500599_001124 Ga0500599_001124_533_1831 432
800 3300054114 Ga0501084_0250095 Ga0501084_0250095_82_1380 432
801 3300060353 Ga0501082_0000183 Ga0501082_0000183_46968_48266 432
802 2209111006 2214745197 2213754561 433
803 3300000041 ARcpr5oldR_c000160 ARcpr5oldR_0001608 433
804 3300000042 ARSoilYngRDRAFT_c00063 ARSoilYngRDRAFT_0006314 433
805 3300000043 ARcpr5yngRDRAFT_c000034 ARcpr5yngRDRAFT_00003416 433
806 3300000044 ARSoilOldRDRAFT_c000147 ARSoilOldRDRAFT_0001475 433
807 3300001990 JGI24737J22298_10000521 JGI24737J22298_100005212 433
808 3300002070 JGI24750J21931_1000637 JGI24750J21931_10006373 433
809 3300002126 JGI24035J26624_1000503 JGI24035J26624_10005032 433
810 3300002244 JGI24742J22300_10001833 JGI24742J22300_100018331 433
811 3300002459 JGI24751J29686_10009828 JGI24751J29686_100098283 433
812 3300003203 JGI25406J46586_10000047 JGI25406J46586_1000004720 433
813 3300003794 Ga0055531_10003612 Ga0055531_100036125 433
814 3300005290 Ga0065712_10001661 Ga0065712_100016616 433
815 3300005293 Ga0065715_10004531 Ga0065715_100045312 433
816 3300005293 Ga0065715_10090446 Ga0065715_100904463 433
817 3300005327 Ga0070658_10098944 Ga0070658_100989442 433
818 3300005328 Ga0070676_10000905 Ga0070676_100009055 433
819 3300005329 Ga0070683_100022201 Ga0070683_1000222016 433
820 3300005329 Ga0070683_100089578 Ga0070683_1000895781 433
821 3300005330 Ga0070690_100002135 Ga0070690_1000021357 433
822 3300005333 Ga0070677_10006219 Ga0070677_100062192 433
823 3300005334 Ga0068869_100008696 Ga0068869_1000086965 433
824 3300005335 Ga0070666_10005333 Ga0070666_100053332 433
825 3300005335 Ga0070666_10007448 Ga0070666_100074482 433
826 3300005336 Ga0070680_100011041 Ga0070680_1000110415 433
827 3300005336 Ga0070680_100018350 Ga0070680_1000183503 433
828 3300005336 Ga0070680_100162923 Ga0070680_1001629231 433
829 3300005337 Ga0070682_100002763 Ga0070682_1000027633 433
830 3300005337 Ga0070682_100028035 Ga0070682_1000280352 433
831 3300005338 Ga0068868_100018639 Ga0068868_1000186395 433
832 3300005338 Ga0068868_100031028 Ga0068868_1000310282 433
833 3300005339 Ga0070660_100000985 Ga0070660_10000098513 433
834 3300005339 Ga0070660_100026110 Ga0070660_1000261104 433
835 3300005339 Ga0070660_100035104 Ga0070660_1000351043 433
836 3300005339 Ga0070660_100049723 Ga0070660_1000497232 433
837 3300005340 Ga0070689_100010818 Ga0070689_1000108183 433
838 3300005340 Ga0070689_100049462 Ga0070689_1000494622 433
839 3300005341 Ga0070691_10000060 Ga0070691_1000006015 433
840 3300005343 Ga0070687_100001608 Ga0070687_1000016085 433
841 3300005343 Ga0070687_100087956 Ga0070687_1000879562 433
842 3300005344 Ga0070661_100024705 Ga0070661_1000247051 433
843 3300005345 Ga0070692_10002122 Ga0070692_100021225 433
844 3300005345 Ga0070692_10019414 Ga0070692_100194143 433
845 3300005347 Ga0070668_100004462 Ga0070668_1000044625 433
846 3300005353 Ga0070669_100001173 Ga0070669_10000117311 433
847 3300005354 Ga0070675_100008084 Ga0070675_1000080844 433
848 3300005354 Ga0070675_100025493 Ga0070675_1000254933 433
849 3300005355 Ga0070671_100000349 Ga0070671_1000003495 433
850 3300005355 Ga0070671_100201469 Ga0070671_1002014692 433
851 3300005356 Ga0070674_100013947 Ga0070674_1000139472 433
852 3300005356 Ga0070674_100064813 Ga0070674_1000648132 433
853 3300005364 Ga0070673_100007101 Ga0070673_1000071014 433
854 3300005364 Ga0070673_100153399 Ga0070673_1001533991 433
855 3300005365 Ga0070688_100000475 Ga0070688_10000047517 433
856 3300005365 Ga0070688_100013195 Ga0070688_1000131954 433
857 3300005366 Ga0070659_100006503 Ga0070659_1000065033 433
858 3300005367 Ga0070667_100000810 Ga0070667_10000081023 433
859 3300005367 Ga0070667_100015010 Ga0070667_1000150105 433
860 3300005406 Ga0070703_10007949 Ga0070703_100079491 433
861 3300005434 Ga0070709_10011165 Ga0070709_100111654 433
862 3300005435 Ga0070714_100048569 Ga0070714_1000485693 433
863 3300005435 Ga0070714_100051098 Ga0070714_1000510982 433
864 3300005435 Ga0070714_100102147 Ga0070714_1001021472 433
865 3300005436 Ga0070713_100012585 Ga0070713_1000125853 433
866 3300005436 Ga0070713_100028354 Ga0070713_1000283542 433
867 3300005436 Ga0070713_100046807 Ga0070713_1000468072 433
868 3300005437 Ga0070710_10001849 Ga0070710_100018499 433
869 3300005438 Ga0070701_10005299 Ga0070701_100052993 433
870 3300005438 Ga0070701_10009325 Ga0070701_100093252 433
871 3300005439 Ga0070711_100063443 Ga0070711_1000634431 433
872 3300005440 Ga0070705_100015365 Ga0070705_1000153653 433
873 3300005441 Ga0070700_100000664 Ga0070700_1000006645 433
874 3300005444 Ga0070694_100005788 Ga0070694_1000057884 433
875 3300005455 Ga0070663_100034160 Ga0070663_1000341602 433
876 3300005456 Ga0070678_100003479 Ga0070678_1000034797 433
877 3300005457 Ga0070662_100005798 Ga0070662_1000057985 433
878 3300005457 Ga0070662_100007680 Ga0070662_1000076806 433
879 3300005458 Ga0070681_10015477 Ga0070681_100154775 433
880 3300005458 Ga0070681_10040444 Ga0070681_100404445 433
881 3300005458 Ga0070681_10115998 Ga0070681_101159982 433
882 3300005458 Ga0070681_10258209 Ga0070681_102582091 433
883 3300005459 Ga0068867_100002762 Ga0068867_1000027623 433
884 3300005459 Ga0068867_100110168 Ga0068867_1001101682 433
885 3300005459 Ga0068867_100118206 Ga0068867_1001182062 433
886 3300005466 Ga0070685_10004766 Ga0070685_100047663 433
887 3300005530 Ga0070679_100029125 Ga0070679_1000291253 433
888 3300005530 Ga0070679_100062725 Ga0070679_1000627253 433
889 3300005530 Ga0070679_100141517 Ga0070679_1001415173 433
890 3300005530 Ga0070679_100161968 Ga0070679_1001619682 433
891 3300005530 Ga0070679_100188559 Ga0070679_1001885591 433
892 3300005535 Ga0070684_100000464 Ga0070684_10000046413 433
893 3300005535 Ga0070684_100010906 Ga0070684_1000109061 433
894 3300005535 Ga0070684_100012560 Ga0070684_1000125602 433
895 3300005535 Ga0070684_100026872 Ga0070684_1000268722 433
896 3300005536 Ga0070697_100086517 Ga0070697_1000865172 433
897 3300005539 Ga0068853_100003829 Ga0068853_1000038299 433
898 3300005539 Ga0068853_100025347 Ga0068853_1000253472 433
899 3300005544 Ga0070686_100001439 Ga0070686_1000014393 433
900 3300005544 Ga0070686_100016485 Ga0070686_1000164853 433
901 3300005544 Ga0070686_100048141 Ga0070686_1000481413 433
902 3300005544 Ga0070686_100063471 Ga0070686_1000634711 433
903 3300005545 Ga0070695_100001619 Ga0070695_10000161910 433
904 3300005545 Ga0070695_100008441 Ga0070695_1000084413 433
905 3300005546 Ga0070696_100011085 Ga0070696_1000110855 433
906 3300005547 Ga0070693_100000266 Ga0070693_1000002667 433
907 3300005548 Ga0070665_100147673 Ga0070665_1001476732 433
908 3300005549 Ga0070704_100001701 Ga0070704_1000017016 433
909 3300005549 Ga0070704_100002112 Ga0070704_1000021128 433
910 3300005563 Ga0068855_100034429 Ga0068855_1000344295 433
911 3300005563 Ga0068855_100059531 Ga0068855_1000595313 433
912 3300005563 Ga0068855_100208295 Ga0068855_1002082954 433
913 3300005563 Ga0068855_100209137 Ga0068855_1002091372 433
914 3300005563 Ga0068855_100277971 Ga0068855_1002779712 433
915 3300005564 Ga0070664_100012689 Ga0070664_1000126893 433
916 3300005564 Ga0070664_100155908 Ga0070664_1001559083 433
917 3300005577 Ga0068857_100006833 Ga0068857_1000068333 433
918 3300005578 Ga0068854_100005898 Ga0068854_1000058984 433
919 3300005578 Ga0068854_100024241 Ga0068854_1000242413 433
920 3300005615 Ga0070702_100004216 Ga0070702_1000042163 433
921 3300005616 Ga0068852_100005120 Ga0068852_1000051205 433
922 3300005616 Ga0068852_100007306 Ga0068852_1000073065 433
923 3300005616 Ga0068852_100015569 Ga0068852_1000155694 433
924 3300005616 Ga0068852_100042670 Ga0068852_1000426702 433
925 3300005616 Ga0068852_100081153 Ga0068852_1000811534 433
926 3300005617 Ga0068859_100013817 Ga0068859_1000138175 433
927 3300005617 Ga0068859_100037907 Ga0068859_1000379072 433
928 3300005617 Ga0068859_100077641 Ga0068859_1000776413 433
929 3300005618 Ga0068864_100019484 Ga0068864_1000194845 433
930 3300005618 Ga0068864_100129170 Ga0068864_1001291703 433
931 3300005718 Ga0068866_10000694 Ga0068866_100006948 433
932 3300005719 Ga0068861_100013181 Ga0068861_1000131813 433
933 3300005840 Ga0068870_10009104 Ga0068870_100091043 433
934 3300005841 Ga0068863_100001201 Ga0068863_10000120123 433
935 3300005842 Ga0068858_100016234 Ga0068858_1000162345 433
936 3300005842 Ga0068858_100023790 Ga0068858_1000237903 433
937 3300005842 Ga0068858_100067510 Ga0068858_1000675103 433
938 3300005843 Ga0068860_100001359 Ga0068860_1000013593 433
939 3300005843 Ga0068860_100001708 Ga0068860_10000170810 433
940 3300005843 Ga0068860_100081370 Ga0068860_1000813703 433
941 3300005843 Ga0068860_100132560 Ga0068860_1001325603 433
942 3300005844 Ga0068862_100005931 Ga0068862_1000059316 433
943 3300005844 Ga0068862_100058981 Ga0068862_1000589813 433
944 3300005937 Ga0081455_10000009 Ga0081455_1000000949 433
945 3300005937 Ga0081455_10006680 Ga0081455_100066807 433
946 3300005985 Ga0081539_10000140 Ga0081539_1000014073 433
947 3300005985 Ga0081539_10002339 Ga0081539_1000233914 433
948 3300006028 Ga0070717_10001862 Ga0070717_100018623 433
949 3300006028 Ga0070717_10045194 Ga0070717_100451942 433
950 3300006163 Ga0070715_10003038 Ga0070715_100030381 433
951 3300006163 Ga0070715_10065946 Ga0070715_100659461 433
952 3300006173 Ga0070716_100003599 Ga0070716_1000035993 433
953 3300006175 Ga0070712_100027618 Ga0070712_1000276182 433
954 3300006175 Ga0070712_100220162 Ga0070712_1002201622 433
955 3300006237 Ga0097621_100001359 Ga0097621_1000013597 433
956 3300006353 Ga0075370_10103009 Ga0075370_101030092 433
957 3300006358 Ga0068871_100003508 Ga0068871_1000035088 433
958 3300006358 Ga0068871_100081780 Ga0068871_1000817802 433
959 3300006871 Ga0075434_100026091 Ga0075434_1000260913 433
960 3300006871 Ga0075434_100097339 Ga0075434_1000973393 433
961 3300006881 Ga0068865_100001830 Ga0068865_10000183011 433
962 3300006931 Ga0097620_100013818 Ga0097620_1000138185 433
963 3300006931 Ga0097620_100037906 Ga0097620_1000379062 433
964 3300006931 Ga0097620_100077644 Ga0097620_1000776443 433
965 3300007076 Ga0075435_100013273 Ga0075435_1000132732 433
966 3300007076 Ga0075435_100191542 Ga0075435_1001915422 433
967 3300009092 Ga0105250_10045953 Ga0105250_100459532 433
968 3300009093 Ga0105240_10017915 Ga0105240_100179158 433
969 3300009093 Ga0105240_10038025 Ga0105240_100380253 433
970 3300009093 Ga0105240_10047264 Ga0105240_100472642 433
971 3300009093 Ga0105240_10173056 Ga0105240_101730562 433
972 3300009093 Ga0105240_10275619 Ga0105240_102756192 433
973 3300009094 Ga0111539_10000173 Ga0111539_1000017369 433
974 3300009094 Ga0111539_10018558 Ga0111539_100185585 433
975 3300009094 Ga0111539_10078446 Ga0111539_100784464 433
976 3300009094 Ga0111539_10087823 Ga0111539_100878232 433
977 3300009098 Ga0105245_10003312 Ga0105245_1000331211 433
978 3300009101 Ga0105247_10024725 Ga0105247_100247251 433
979 3300009148 Ga0105243_10011575 Ga0105243_100115752 433
980 3300009174 Ga0105241_10009656 Ga0105241_100096563 433
981 3300009174 Ga0105241_10126238 Ga0105241_101262382 433
982 3300009176 Ga0105242_10000399 Ga0105242_100003999 433
983 3300009176 Ga0105242_10163493 Ga0105242_101634931 433
984 3300009177 Ga0105248_10032551 Ga0105248_100325513 433
985 3300009177 Ga0105248_10235723 Ga0105248_102357231 433
986 3300009177 Ga0105248_10241572 Ga0105248_102415723 433
987 3300009545 Ga0105237_10034867 Ga0105237_100348672 433
988 3300009545 Ga0105237_10184625 Ga0105237_101846253 433
989 3300009551 Ga0105238_10008599 Ga0105238_100085997 433
990 3300009551 Ga0105238_10082718 Ga0105238_100827182 433
991 3300009551 Ga0105238_10145210 Ga0105238_101452103 433
992 3300010375 Ga0105239_10082676 Ga0105239_100826763 433
993 3300010375 Ga0105239_10108616 Ga0105239_101086164 433
994 3300010375 Ga0105239_10279979 Ga0105239_102799792 433
995 3300011119 Ga0105246_10000033 Ga0105246_1000003353 433
996 3300011119 Ga0105246_10023862 Ga0105246_100238622 433
997 3300013100 Ga0157373_10005894 Ga0157373_100058943 433
998 3300013102 Ga0157371_10031668 Ga0157371_100316682 433
999 3300013104 Ga0157370_10128904 Ga0157370_101289042 433
1000 3300013105 Ga0157369_10088464 Ga0157369_100884643 433
1001 3300013297 Ga0157378_10009284 Ga0157378_100092845 433
1002 3300013306 Ga0163162_10007926 Ga0163162_100079266 433
1003 3300013306 Ga0163162_10049822 Ga0163162_100498221 433
1004 3300013307 Ga0157372_10001162 Ga0157372_100011629 433
1005 3300013307 Ga0157372_10154780 Ga0157372_101547802 433
1006 3300013308 Ga0157375_10018904 Ga0157375_100189046 433
1007 3300013308 Ga0157375_10021748 Ga0157375_100217487 433
1008 3300013308 Ga0157375_10033246 Ga0157375_100332462 433
1009 3300013308 Ga0157375_10141304 Ga0157375_101413042 433
1010 3300014325 Ga0163163_10001787 Ga0163163_100017876 433
1011 3300014325 Ga0163163_10060072 Ga0163163_100600722 433
1012 3300014325 Ga0163163_10098726 Ga0163163_100987261 433
1013 3300014745 Ga0157377_10000740 Ga0157377_100007403 433
1014 3300014968 Ga0157379_10003378 Ga0157379_100033789 433
1015 3300014969 Ga0157376_10005599 Ga0157376_100055997 433
1016 3300014969 Ga0157376_10229775 Ga0157376_102297752 433
1017 3300017792 Ga0163161_10008117 Ga0163161_100081174 433
1018 3300020070 Ga0206356_10558017 Ga0206356_105580171 433
1019 3300021320 Ga0214544_1000002 Ga0214544_1000002219 433
1020 3300021321 Ga0214542_1000001 Ga0214542_1000001569 433
1021 3300021324 Ga0214545_1000001 Ga0214545_1000001635 433
1022 3300021327 Ga0214543_1000001 Ga0214543_1000001561 433
1023 3300021384 Ga0213876_10009439 Ga0213876_100094393 433
1024 3300021384 Ga0213876_10056797 Ga0213876_100567972 433
1025 3300021388 Ga0213875_10000007 Ga0213875_10000007367 433
1026 3300025254 Ga0209148_1000428 Ga0209148_100042832 433
1027 3300025261 Ga0209233_1006202 Ga0209233_10062022 433
1028 3300025261 Ga0209233_1008608 Ga0209233_10086082 433
1029 3300025271 Ga0207666_1000006 Ga0207666_100000641 433
1030 3300025271 Ga0207666_1001276 Ga0207666_10012762 433
1031 3300025272 Ga0209455_1002286 Ga0209455_10022868 433
1032 3300025290 Ga0207673_1000712 Ga0207673_10007123 433
1033 3300025295 Ga0209564_1001578 Ga0209564_10015786 433
1034 3300025295 Ga0209564_1003479 Ga0209564_100347910 433
1035 3300025295 Ga0209564_1026529 Ga0209564_10265292 433
1036 3300025297 Ga0209758_1000140 Ga0209758_100014065 433
1037 3300025297 Ga0209758_1000321 Ga0209758_100032151 433
1038 3300025297 Ga0209758_1001092 Ga0209758_100109219 433
1039 3300025297 Ga0209758_1001514 Ga0209758_10015144 433
1040 3300025297 Ga0209758_1003492 Ga0209758_100349211 433
1041 3300025299 Ga0209256_1005434 Ga0209256_10054342 433
1042 3300025304 Ga0209257_1000522 Ga0209257_100052244 433
1043 3300025315 Ga0207697_10000009 Ga0207697_100000099 433
1044 3300025315 Ga0207697_10004408 Ga0207697_100044085 433
1045 3300025321 Ga0207656_10012199 Ga0207656_100121992 433
1046 3300025885 Ga0207653_10036515 Ga0207653_100365152 433
1047 3300025893 Ga0207682_10000301 Ga0207682_1000030122 433
1048 3300025898 Ga0207692_10000849 Ga0207692_100008494 433
1049 3300025898 Ga0207692_10034555 Ga0207692_100345553 433
1050 3300025901 Ga0207688_10000012 Ga0207688_100000122 433
1051 3300025901 Ga0207688_10041797 Ga0207688_100417972 433
1052 3300025903 Ga0207680_10007512 Ga0207680_100075124 433
1053 3300025903 Ga0207680_10029543 Ga0207680_100295433 433
1054 3300025904 Ga0207647_10006251 Ga0207647_100062517 433
1055 3300025904 Ga0207647_10033866 Ga0207647_100338664 433
1056 3300025905 Ga0207685_10004719 Ga0207685_100047192 433
1057 3300025906 Ga0207699_10017739 Ga0207699_100177395 433
1058 3300025907 Ga0207645_10000124 Ga0207645_1000012410 433
1059 3300025907 Ga0207645_10056703 Ga0207645_100567032 433
1060 3300025908 Ga0207643_10000046 Ga0207643_1000004624 433
1061 3300025909 Ga0207705_10115555 Ga0207705_101155552 433
1062 3300025910 Ga0207684_10133715 Ga0207684_101337152 433
1063 3300025911 Ga0207654_10004889 Ga0207654_100048892 433
1064 3300025912 Ga0207707_10011411 Ga0207707_100114111 433
1065 3300025912 Ga0207707_10024737 Ga0207707_100247374 433
1066 3300025912 Ga0207707_10033774 Ga0207707_100337743 433
1067 3300025912 Ga0207707_10059952 Ga0207707_100599524 433
1068 3300025912 Ga0207707_10294682 Ga0207707_102946821 433
1069 3300025913 Ga0207695_10000008 Ga0207695_100000083 433
1070 3300025913 Ga0207695_10008039 Ga0207695_100080399 433
1071 3300025913 Ga0207695_10120229 Ga0207695_101202292 433
1072 3300025914 Ga0207671_10007118 Ga0207671_100071184 433
1073 3300025914 Ga0207671_10120545 Ga0207671_101205451 433
1074 3300025915 Ga0207693_10018304 Ga0207693_100183044 433
1075 3300025915 Ga0207693_10050341 Ga0207693_100503414 433
1076 3300025915 Ga0207693_10055325 Ga0207693_100553252 433
1077 3300025916 Ga0207663_10010022 Ga0207663_100100223 433
1078 3300025916 Ga0207663_10021116 Ga0207663_100211162 433
1079 3300025917 Ga0207660_10071085 Ga0207660_100710852 433
1080 3300025917 Ga0207660_10133279 Ga0207660_101332791 433
1081 3300025918 Ga0207662_10000222 Ga0207662_100002229 433
1082 3300025918 Ga0207662_10032507 Ga0207662_100325072 433
1083 3300025918 Ga0207662_10144063 Ga0207662_101440631 433
1084 3300025919 Ga0207657_10000162 Ga0207657_1000016263 433
1085 3300025919 Ga0207657_10030200 Ga0207657_100302002 433
1086 3300025919 Ga0207657_10060302 Ga0207657_100603022 433
1087 3300025919 Ga0207657_10071568 Ga0207657_100715682 433
1088 3300025919 Ga0207657_10152882 Ga0207657_101528822 433
1089 3300025920 Ga0207649_10000798 Ga0207649_100007982 433
1090 3300025921 Ga0207652_10021470 Ga0207652_100214706 433
1091 3300025921 Ga0207652_10045919 Ga0207652_100459192 433
1092 3300025921 Ga0207652_10308076 Ga0207652_103080762 433
1093 3300025923 Ga0207681_10007488 Ga0207681_100074883 433
1094 3300025923 Ga0207681_10094623 Ga0207681_100946232 433
1095 3300025924 Ga0207694_10018170 Ga0207694_100181702 433
1096 3300025924 Ga0207694_10048738 Ga0207694_100487382 433
1097 3300025925 Ga0207650_10054665 Ga0207650_100546653 433
1098 3300025926 Ga0207659_10000762 Ga0207659_1000076211 433
1099 3300025926 Ga0207659_10199744 Ga0207659_101997442 433
1100 3300025927 Ga0207687_10023134 Ga0207687_100231343 433
1101 3300025928 Ga0207700_10000290 Ga0207700_1000029013 433
1102 3300025928 Ga0207700_10082443 Ga0207700_100824432 433
1103 3300025929 Ga0207664_10011397 Ga0207664_100113972 433
1104 3300025929 Ga0207664_10029434 Ga0207664_100294342 433
1105 3300025929 Ga0207664_10097259 Ga0207664_100972592 433
1106 3300025931 Ga0207644_10024576 Ga0207644_100245763 433
1107 3300025932 Ga0207690_10006396 Ga0207690_100063964 433
1108 3300025933 Ga0207706_10000929 Ga0207706_100009299 433
1109 3300025933 Ga0207706_10155385 Ga0207706_101553852 433
1110 3300025934 Ga0207686_10084159 Ga0207686_100841593 433
1111 3300025935 Ga0207709_10000256 Ga0207709_100002562 433
1112 3300025936 Ga0207670_10003293 Ga0207670_100032937 433
1113 3300025936 Ga0207670_10010584 Ga0207670_100105841 433
1114 3300025936 Ga0207670_10066843 Ga0207670_100668432 433
1115 3300025937 Ga0207669_10001769 Ga0207669_100017697 433
1116 3300025937 Ga0207669_10045983 Ga0207669_100459832 433
1117 3300025937 Ga0207669_10051306 Ga0207669_100513062 433
1118 3300025938 Ga0207704_10021960 Ga0207704_100219602 433
1119 3300025939 Ga0207665_10000719 Ga0207665_1000071911 433
1120 3300025940 Ga0207691_10006340 Ga0207691_100063405 433
1121 3300025940 Ga0207691_10006425 Ga0207691_100064253 433
1122 3300025941 Ga0207711_10036622 Ga0207711_100366224 433
1123 3300025941 Ga0207711_10053917 Ga0207711_100539173 433
1124 3300025942 Ga0207689_10000109 Ga0207689_1000010910 433
1125 3300025942 Ga0207689_10031109 Ga0207689_100311093 433
1126 3300025942 Ga0207689_10052656 Ga0207689_100526563 433
1127 3300025944 Ga0207661_10001655 Ga0207661_1000165510 433
1128 3300025944 Ga0207661_10006709 Ga0207661_100067094 433
1129 3300025944 Ga0207661_10093766 Ga0207661_100937662 433
1130 3300025944 Ga0207661_10096435 Ga0207661_100964354 433
1131 3300025944 Ga0207661_10115604 Ga0207661_101156042 433
1132 3300025945 Ga0207679_10000763 Ga0207679_100007639 433
1133 3300025945 Ga0207679_10027676 Ga0207679_100276764 433
1134 3300025945 Ga0207679_10210571 Ga0207679_102105712 433
1135 3300025949 Ga0207667_10021843 Ga0207667_100218435 433
1136 3300025949 Ga0207667_10034067 Ga0207667_100340672 433
1137 3300025949 Ga0207667_10109822 Ga0207667_101098222 433
1138 3300025949 Ga0207667_10119538 Ga0207667_101195383 433
1139 3300025949 Ga0207667_10123233 Ga0207667_101232333 433
1140 3300025949 Ga0207667_10164754 Ga0207667_101647542 433
1141 3300025960 Ga0207651_10004250 Ga0207651_100042506 433
1142 3300025960 Ga0207651_10130307 Ga0207651_101303072 433
1143 3300025961 Ga0207712_10022037 Ga0207712_100220372 433
1144 3300025961 Ga0207712_10030069 Ga0207712_100300692 433
1145 3300025961 Ga0207712_10040854 Ga0207712_100408544 433
1146 3300025972 Ga0207668_10015835 Ga0207668_100158352 433
1147 3300025981 Ga0207640_10004377 Ga0207640_100043774 433
1148 3300025986 Ga0207658_10034145 Ga0207658_100341452 433
1149 3300026023 Ga0207677_10007601 Ga0207677_100076013 433
1150 3300026035 Ga0207703_10012561 Ga0207703_100125613 433
1151 3300026035 Ga0207703_10028301 Ga0207703_100283012 433
1152 3300026035 Ga0207703_10060311 Ga0207703_100603113 433
1153 3300026041 Ga0207639_10039190 Ga0207639_100391902 433
1154 3300026041 Ga0207639_10053845 Ga0207639_100538451 433
1155 3300026067 Ga0207678_10004447 Ga0207678_100044473 433
1156 3300026067 Ga0207678_10006545 Ga0207678_100065455 433
1157 3300026067 Ga0207678_10056317 Ga0207678_100563173 433
1158 3300026075 Ga0207708_10000098 Ga0207708_100000989 433
1159 3300026075 Ga0207708_10002092 Ga0207708_100020926 433
1160 3300026078 Ga0207702_10000002 Ga0207702_10000002252 433
1161 3300026078 Ga0207702_10114296 Ga0207702_101142962 433
1162 3300026088 Ga0207641_10038224 Ga0207641_100382243 433
1163 3300026088 Ga0207641_10150619 Ga0207641_101506192 433
1164 3300026089 Ga0207648_10002003 Ga0207648_1000200311 433
1165 3300026089 Ga0207648_10010667 Ga0207648_100106675 433
1166 3300026095 Ga0207676_10017955 Ga0207676_100179552 433
1167 3300026095 Ga0207676_10095444 Ga0207676_100954443 433
1168 3300026116 Ga0207674_10000420 Ga0207674_100004209 433
1169 3300026116 Ga0207674_10033144 Ga0207674_100331445 433
1170 3300026118 Ga0207675_100002543 Ga0207675_1000025438 433
1171 3300026121 Ga0207683_10000004 Ga0207683_1000000418 433
1172 3300026121 Ga0207683_10001293 Ga0207683_100012937 433
1173 3300026121 Ga0207683_10020374 Ga0207683_100203743 433
1174 3300026142 Ga0207698_10017188 Ga0207698_100171882 433
1175 3300027695 Ga0209966_1001208 Ga0209966_10012083 433
1176 3300027717 Ga0209998_10002107 Ga0209998_100021073 433
1177 3300027717 Ga0209998_10003369 Ga0209998_100033693 433
1178 3300027876 Ga0209974_10009223 Ga0209974_100092231 433
1179 3300027907 Ga0207428_10000303 Ga0207428_100003038 433
1180 3300027907 Ga0207428_10019216 Ga0207428_100192163 433
1181 3300028379 Ga0268266_10047490 Ga0268266_100474902 433
1182 3300028380 Ga0268265_10012335 Ga0268265_100123354 433
1183 3300028381 Ga0268264_10000149 Ga0268264_1000014916 433
1184 3300028381 Ga0268264_10102135 Ga0268264_101021353 433
1185 3300028381 Ga0268264_10198647 Ga0268264_101986472 433
1186 3300028556 Ga0265337_1000539 Ga0265337_10005398 433
1187 3300028800 Ga0265338_10010360 Ga0265338_100103607 433
1188 3300028800 Ga0265338_10085175 Ga0265338_100851752 433
1189 3300031235 Ga0265330_10012435 Ga0265330_100124352 433
1190 3300031241 Ga0265325_10000603 Ga0265325_1000060313 433
1191 3300031241 Ga0265325_10008234 Ga0265325_100082342 433
1192 3300031241 Ga0265325_10055536 Ga0265325_100555362 433
1193 3300031247 Ga0265340_10023020 Ga0265340_100230202 433
1194 3300031249 Ga0265339_10000465 Ga0265339_1000046519 433
1195 3300031249 Ga0265339_10036117 Ga0265339_100361172 433
1196 3300031507 Ga0307509_10004311 Ga0307509_1000431117 433
1197 3300031595 Ga0265313_10000006 Ga0265313_10000006176 433
1198 3300031595 Ga0265313_10010630 Ga0265313_100106304 433
1199 3300031616 Ga0307508_10000018 Ga0307508_1000001814 433
1200 3300031616 Ga0307508_10109943 Ga0307508_101099432 433
1201 3300031711 Ga0265314_10019317 Ga0265314_100193171 433
1202 3300031712 Ga0265342_10001132 Ga0265342_100011322 433
1203 3300031712 Ga0265342_10094300 Ga0265342_100943001 433
1204 3300031852 Ga0307410_10176024 Ga0307410_101760241 433
1205 3300033179 Ga0307507_10022838 Ga0307507_100228382 433
1206 3300033180 Ga0307510_10048914 Ga0307510_100489144 433
1207 3300034819 Ga0373958_0001300 Ga0373958_0001300_975_2276 433
1208 3300034957 Ga0373938_0000022 Ga0373938_0000022_8554_9855 433
1209 3300035085 Ga0373929_0000472 Ga0373929_0000472_3486_4787 433
1210 3300035086 Ga0373934_0005378 Ga0373934_0005378_1973_3277 433
1211 3300035088 Ga0373940_0000137 Ga0373940_0000137_2328_3629 433
1212 3300035090 Ga0373949_0000261 Ga0373949_0000261_10498_11799 433
1213 3300035091 Ga0373951_0002760 Ga0373951_0002760_2221_3522 433
1214 3300035092 Ga0373952_0003517 Ga0373952_0003517_192_1493 433
1215 3300035112 Ga0373932_0002247 Ga0373932_0002247_3453_4754 433
1216 3300035114 Ga0373939_0000463 Ga0373939_0000463_4681_5985 433
1217 3300035114 Ga0373939_0003813 Ga0373939_0003813_509_1810 433
1218 3300035115 Ga0373941_0000221 Ga0373941_0000221_1192_2493 433
1219 3300035115 Ga0373941_0000589 Ga0373941_0000589_564_1865 433
1220 3300035117 Ga0373953_0040881 Ga0373953_0040881_499_1803 433
1221 3300035118 Ga0373954_0003471 Ga0373954_0003471_1758_3062 433
1222 3300035118 Ga0373954_0054642 Ga0373954_0054642_238_1542 433
1223 3300035119 Ga0373956_0002490 Ga0373956_0002490_1922_3226 433
1224 3300035120 Ga0373957_0009403 Ga0373957_0009403_1721_3025 433
1225 3300035121 Ga0373960_0000800 Ga0373960_0000800_3184_4485 433
1226 3300035121 Ga0373960_0002104 Ga0373960_0002104_2065_3366 433
1227 3300035170 Ga0373943_0000061 Ga0373943_0000061_1932_3266 433
1228 3300035171 Ga0373946_0025537 Ga0373946_0025537_643_1944 433
1229 3300035172 Ga0373955_0020458 Ga0373955_0020458_1553_2857 433
1230 3300035207 Ga0373942_0006530 Ga0373942_0006530_782_2083 433
1231 3300035241 Ga0373961_0005825 Ga0373961_0005825_461_1762 433
1232 3300035241 Ga0373961_0008356 Ga0373961_0008356_994_2295 433
1233 3300035242 Ga0373962_0003673 Ga0373962_0003673_1192_2493 433
1234 3300035242 Ga0373962_0013120 Ga0373962_0013120_403_1704 433
1235 3300035410 Ga0373924_0008696 Ga0373924_0008696_825_2126 433
1236 3300035410 Ga0373924_0011814 Ga0373924_0011814_699_2003 433
1237 3300035691 Ga0373931_0000750 Ga0373931_0000750_11464_12765 433
1238 3300035692 Ga0373935_0015189 Ga0373935_0015189_441_1742 433
1239 3300035692 Ga0373935_0068802 Ga0373935_0068802_185_1489 433
1240 3300035692 Ga0373935_0105033 Ga0373935_0105033_318_1619 433
1241 3300035695 Ga0373927_0000275 Ga0373927_0000275_19600_20934 433
1242 3300035695 Ga0373927_0004277 Ga0373927_0004277_4056_5393 433
1243 3300035695 Ga0373927_0020807 Ga0373927_0020807_1498_2799 433
1244 3300035695 Ga0373927_0053127 Ga0373927_0053127_99_1400 433
1245 3300035695 Ga0373927_0059425 Ga0373927_0059425_63_1370 433
1246 3300035724 Ga0373933_0001880 Ga0373933_0001880_6824_8125 433
1247 3300035724 Ga0373933_0003392 Ga0373933_0003392_4410_5714 433
1248 3300035724 Ga0373933_0081011 Ga0373933_0081011_599_1900 433
1249 3300035725 Ga0373947_0000187 Ga0373947_0000187_22745_24079 433
1250 3300035725 Ga0373947_0028877 Ga0373947_0028877_1349_2650 433
1251 3300036401 Ga0373937_0016414 Ga0373937_0016414_3167_4471 433
1252 3300037068 Ga0373925_0000791 Ga0373925_0000791_15140_16474 433
1253 3300037068 Ga0373925_0021188 Ga0373925_0021188_2232_3533 433
1254 3300037068 Ga0373925_0083593 Ga0373925_0083593_402_1703 433
1255 3300037068 Ga0373925_0133663 Ga0373925_0133663_468_1769 433
1256 3300037068 Ga0373925_0145606 Ga0373925_0145606_24_1361 433
1257 3300037312 Ga0395899_0048874 Ga0395899_0048874_1499_2800 433
1258 3300037418 Ga0395900_0183877 Ga0395900_0183877_586_1887 433
1259 3300037466 Ga0395898_0037214 Ga0395898_0037214_1295_2596 433
1260 3300037466 Ga0395898_0114923 Ga0395898_0114923_588_1889 433
1261 3300037466 Ga0395898_0116527 Ga0395898_0116527_164_1468 433
1262 3300037466 Ga0395898_0256323 Ga0395898_0256323_120_1421 433
1263 3300037471 Ga0395905_0013848 Ga0395905_0013848_665_1966 433
1264 3300037853 Ga0436364_0009242 Ga0436364_0009242_323_1630 433
1265 3300037853 Ga0436364_0565423 Ga0436364_0565423_3349_4650 433
1266 3300038443 Ga0395901_0102522 Ga0395901_0102522_1539_2840 433
1267 3300038443 Ga0395901_0206396 Ga0395901_0206396_727_2028 433
1268 3300038443 Ga0395901_0217750 Ga0395901_0217750_50_1351 433
1269 3300038443 Ga0395901_0281687 Ga0395901_0281687_320_1621 433
1270 3300039437 Ga0436365_0244105 Ga0436365_0244105_3293_4594 433
1271 3300039437 Ga0436365_0712843 Ga0436365_0712843_1444_2748 433
1272 3300039437 Ga0436365_1260219 Ga0436365_1260219_567_1952 433
1273 3300039450 Ga0436363_0312479 Ga0436363_0312479_4417_5718 433
1274 3300039450 Ga0436363_1211778 Ga0436363_1211778_516_1817 433
1275 3300044658 Ga0466972_0000160 Ga0466972_0000160_52152_53453 433
1276 3300044658 Ga0466972_0041245 Ga0466972_0041245_326_1627 433
1277 3300044683 Ga0466965_0068895 Ga0466965_0068895_181_1482 433
1278 3300044684 Ga0466966_0000669 Ga0466966_0000669_6918_8219 433
1279 3300044693 Ga0466961_0000208 Ga0466961_0000208_36814_38115 433
1280 3300044693 Ga0466961_0049061 Ga0466961_0049061_55_1356 433
1281 3300044901 Ga0466960_0004027 Ga0466960_0004027_1670_2971 433
1282 3300045049 Ga0466959_0000832 Ga0466959_0000832_16074_17375 433
1283 3300045976 Ga0466967_0007808 Ga0466967_0007808_1014_2318 433
1284 3300046454 Ga0495592_0002109 Ga0495592_0002109_10630_11934 433
1285 3300046454 Ga0495592_0010077 Ga0495592_0010077_2695_3996 433
1286 3300046455 Ga0495603_0005459 Ga0495603_0005459_994_2295 433
1287 3300046455 Ga0495603_0025716 Ga0495603_0025716_20_1321 433
1288 3300046459 Ga0495629_0000329 Ga0495629_0000329_10248_11549 433
1289 3300046459 Ga0495629_0008557 Ga0495629_0008557_1807_3111 433
1290 3300046459 Ga0495629_0073225 Ga0495629_0073225_1043_2344 433
1291 3300046461 Ga0495641_0009078 Ga0495641_0009078_1699_3000 433
1292 3300046462 Ga0495651_0000528 Ga0495651_0000528_26498_27799 433
1293 3300046462 Ga0495651_0001234 Ga0495651_0001234_10630_11934 433
1294 3300046463 Ga0495653_0000358 Ga0495653_0000358_24916_26220 433
1295 3300046463 Ga0495653_0024434 Ga0495653_0024434_2932_4269 433
1296 3300046473 Ga0495582_0039151 Ga0495582_0039151_1200_2501 433
1297 3300046476 Ga0495662_0007797 Ga0495662_0007797_1966_3303 433
1298 3300046476 Ga0495662_0055096 Ga0495662_0055096_570_1871 433
1299 3300046477 Ga0495664_0000510 Ga0495664_0000510_14599_15936 433
1300 3300046477 Ga0495664_0003203 Ga0495664_0003203_5099_6400 433
1301 3300046499 Ga0495594_0104469 Ga0495594_0104469_276_1580 433
1302 3300046507 Ga0495606_0045553 Ga0495606_0045553_351_1652 433
1303 3300046511 Ga0495608_0002274 Ga0495608_0002274_1925_3229 433
1304 3300046511 Ga0495608_0025275 Ga0495608_0025275_1592_2893 433
1305 3300046511 Ga0495608_0041729 Ga0495608_0041729_725_2032 433
1306 3300046514 Ga0495618_0002751 Ga0495618_0002751_7878_9215 433
1307 3300046516 Ga0495628_0019406 Ga0495628_0019406_3976_5283 433
1308 3300046516 Ga0495628_0022251 Ga0495628_0022251_2019_3323 433
1309 3300046529 Ga0495652_0002427 Ga0495652_0002427_4361_5662 433
1310 3300046529 Ga0495652_0005186 Ga0495652_0005186_422_1726 433
1311 3300046529 Ga0495652_0020974 Ga0495652_0020974_3998_5335 433
1312 3300046529 Ga0495652_0066937 Ga0495652_0066937_234_1541 433
1313 3300046531 Ga0495665_0001233 Ga0495665_0001233_1601_2938 433
1314 3300046533 Ga0495640_0009403 Ga0495640_0009403_5492_6829 433
1315 3300046533 Ga0495640_0027787 Ga0495640_0027787_2560_3864 433
1316 3300046533 Ga0495640_0065735 Ga0495640_0065735_803_2110 433
1317 3300046535 Ga0495586_0014173 Ga0495586_0014173_1574_2911 433
1318 3300046535 Ga0495586_0099032 Ga0495586_0099032_131_1435 433
1319 3300046536 Ga0495587_0024608 Ga0495587_0024608_1268_2569 433
1320 3300046536 Ga0495587_0030214 Ga0495587_0030214_1726_3033 433
1321 3300046538 Ga0495609_0071603 Ga0495609_0071603_145_1446 433
1322 3300046543 Ga0495645_0008975 Ga0495645_0008975_481_1785 433
1323 3300046543 Ga0495645_0112011 Ga0495645_0112011_536_1843 433
1324 3300046557 Ga0495622_0019370 Ga0495622_0019370_506_1807 433
1325 3300046557 Ga0495622_0032366 Ga0495622_0032366_376_1677 433
1326 3300046559 Ga0495667_0002234 Ga0495667_0002234_3355_4659 433
1327 3300046559 Ga0495667_0060233 Ga0495667_0060233_454_1761 433
1328 3300046642 Ga0495634_0002979 Ga0495634_0002979_1731_3068 433
1329 3300046642 Ga0495634_0015120 Ga0495634_0015120_224_1561 433
1330 3300046660 Ga0495625_0048927 Ga0495625_0048927_1187_2488 433
1331 3300046660 Ga0495625_0086437 Ga0495625_0086437_437_1744 433
1332 3300046663 Ga0495635_0000527 Ga0495635_0000527_12440_13744 433
1333 3300046663 Ga0495635_0001696 Ga0495635_0001696_1866_3167 433
1334 3300046663 Ga0495635_0031514 Ga0495635_0031514_128_1429 433
1335 3300046663 Ga0495635_0088227 Ga0495635_0088227_574_1881 433
1336 3300046663 Ga0495635_0138618 Ga0495635_0138618_150_1484 433
1337 3300046675 Ga0495657_0001550 Ga0495657_0001550_7830_9134 433
1338 3300046675 Ga0495657_0007232 Ga0495657_0007232_7141_8442 433
1339 3300046675 Ga0495657_0053087 Ga0495657_0053087_197_1501 433
1340 3300046678 Ga0495599_0002310 Ga0495599_0002310_1935_3239 433
1341 3300046678 Ga0495599_0133702 Ga0495599_0133702_215_1522 433
1342 3300046679 Ga0495623_0003518 Ga0495623_0003518_1478_2779 433
1343 3300046680 Ga0495646_0017484 Ga0495646_0017484_2838_4142 433
1344 3300046680 Ga0495646_0022612 Ga0495646_0022612_1288_2622 433
1345 3300046680 Ga0495646_0044539 Ga0495646_0044539_316_1623 433
1346 3300046680 Ga0495646_0057438 Ga0495646_0057438_384_1685 433
1347 3300046680 Ga0495646_0067909 Ga0495646_0067909_86_1387 433
1348 3300046680 Ga0495646_0101890 Ga0495646_0101890_69_1376 433
1349 3300046681 Ga0495647_0002668 Ga0495647_0002668_1960_3261 433
1350 3300046681 Ga0495647_0004959 Ga0495647_0004959_1216_2550 433
1351 3300046683 Ga0495658_0027133 Ga0495658_0027133_475_1776 433
1352 3300046683 Ga0495658_0109867 Ga0495658_0109867_267_1568 433
1353 3300046689 Ga0495613_0002281 Ga0495613_0002281_9465_10766 433
1354 3300046689 Ga0495613_0003015 Ga0495613_0003015_1717_3051 433
1355 3300046690 Ga0495624_0005449 Ga0495624_0005449_7221_8558 433
1356 3300046690 Ga0495624_0006912 Ga0495624_0006912_1407_2741 433
1357 3300046690 Ga0495624_0030168 Ga0495624_0030168_1022_2323 433
1358 3300046691 Ga0495670_0044264 Ga0495670_0044264_622_1929 433
1359 3300046809 Ga0495600_0001526 Ga0495600_0001526_2250_3551 433
1360 3300046809 Ga0495600_0001732 Ga0495600_0001732_1569_2873 433
1361 3300047315 Ga0495581_0014680 Ga0495581_0014680_2466_3803 433
1362 3300047317 Ga0495604_0002815 Ga0495604_0002815_10576_11880 433
1363 3300047317 Ga0495604_0165071 Ga0495604_0165071_28_1335 433
1364 3300047319 Ga0495674_0000138 Ga0495674_0000138_44180_45517 433
1365 3300047319 Ga0495674_0069326 Ga0495674_0069326_700_2007 433
1366 3300047319 Ga0495674_0090443 Ga0495674_0090443_1192_2493 433
1367 3300047319 Ga0495674_0273753 Ga0495674_0273753_11_1345 433
1368 3300047320 Ga0495672_0019216 Ga0495672_0019216_1154_2455 433
1369 3300047321 Ga0495676_0045353 Ga0495676_0045353_535_1869 433
1370 3300047322 Ga0495680_0011728 Ga0495680_0011728_2643_3944 433
1371 3300047322 Ga0495680_0061251 Ga0495680_0061251_884_2188 433
1372 3300047322 Ga0495680_0085190 Ga0495680_0085190_520_1827 433
1373 3300047322 Ga0495680_0130739 Ga0495680_0130739_401_1702 433
1374 3300047323 Ga0495683_0027742 Ga0495683_0027742_1517_2818 433
1375 3300047443 Ga0495687_014951 Ga0495687_014951_2573_3874 433
1376 3300047444 Ga0495675_0012926 Ga0495675_0012926_121_1425 433
1377 3300047444 Ga0495675_0017016 Ga0495675_0017016_1462_2763 433
1378 3300047471 Ga0495684_0001215 Ga0495684_0001215_10471_11775 433
1379 3300047471 Ga0495684_0019302 Ga0495684_0019302_2633_3970 433
1380 3300047471 Ga0495684_0027385 Ga0495684_0027385_524_1858 433
1381 3300047471 Ga0495684_0114104 Ga0495684_0114104_477_1778 433
1382 3300048088 Ga0495602_0012463 Ga0495602_0012463_2784_4085 433
1383 3300048088 Ga0495602_0053861 Ga0495602_0053861_686_1990 433
1384 3300048090 Ga0495615_0013853 Ga0495615_0013853_168_1469 433
1385 3300048903 Ga0496100_0007042 Ga0496100_0007042_1181_2482 433
1386 3300048903 Ga0496100_0061728 Ga0496100_0061728_489_1790 433
1387 3300048904 Ga0496101_0001619 Ga0496101_0001619_8272_9573 433
1388 3300048905 Ga0496102_0006904 Ga0496102_0006904_5494_6801 433
1389 3300048905 Ga0496102_0023343 Ga0496102_0023343_151_1452 433
1390 3300048906 Ga0496103_0062407 Ga0496103_0062407_981_2282 433
1391 3300048906 Ga0496103_0072235 Ga0496103_0072235_275_1582 433
1392 3300048907 Ga0496104_0009040 Ga0496104_0009040_7508_8809 433
1393 3300048907 Ga0496104_0067046 Ga0496104_0067046_14_1315 433
1394 3300048907 Ga0496104_0068763 Ga0496104_0068763_1535_2836 433
1395 3300048908 Ga0496105_0035275 Ga0496105_0035275_1827_3134 433
1396 3300048908 Ga0496105_0039020 Ga0496105_0039020_257_1558 433
1397 3300048908 Ga0496105_0046279 Ga0496105_0046279_1233_2534 433
1398 3300048909 Ga0496106_0000587 Ga0496106_0000587_22653_23954 433
1399 3300048909 Ga0496106_0004983 Ga0496106_0004983_4845_6152 433
1400 3300048909 Ga0496106_0012623 Ga0496106_0012623_163_1467 433
1401 3300048909 Ga0496106_0018998 Ga0496106_0018998_2036_3337 433
1402 3300048909 Ga0496106_0059119 Ga0496106_0059119_899_2200 433
1403 3300048910 Ga0496107_0002981 Ga0496107_0002981_2507_3808 433
1404 3300048910 Ga0496107_0037062 Ga0496107_0037062_630_1937 433
1405 3300048911 Ga0496108_0000517 Ga0496108_0000517_23437_24738 433
1406 3300048911 Ga0496108_0014716 Ga0496108_0014716_2487_3788 433
1407 3300048911 Ga0496108_0024182 Ga0496108_0024182_555_1856 433
1408 3300048911 Ga0496108_0056517 Ga0496108_0056517_1923_3224 433
1409 3300048912 Ga0496109_0003767 Ga0496109_0003767_9341_10642 433
1410 3300048912 Ga0496109_0015266 Ga0496109_0015266_2122_3423 433
1411 3300048912 Ga0496109_0022363 Ga0496109_0022363_2205_3506 433
1412 3300048912 Ga0496109_0033944 Ga0496109_0033944_633_1934 433
1413 3300048912 Ga0496109_0042157 Ga0496109_0042157_887_2188 433
1414 3300048912 Ga0496109_0049200 Ga0496109_0049200_967_2268 433
1415 3300048912 Ga0496109_0080204 Ga0496109_0080204_1057_2358 433
1416 3300048912 Ga0496109_0168887 Ga0496109_0168887_57_1358 433
1417 3300048913 Ga0496110_0018515 Ga0496110_0018515_2449_3750 433
1418 3300048913 Ga0496110_0035267 Ga0496110_0035267_2814_4121 433
1419 3300048913 Ga0496110_0139915 Ga0496110_0139915_631_1932 433
1420 3300048913 Ga0496110_0165008 Ga0496110_0165008_597_1901 433
1421 3300048913 Ga0496110_0257807 Ga0496110_0257807_192_1532 433
1422 3300048914 Ga0496111_0105893 Ga0496111_0105893_533_1834 433
1423 3300048914 Ga0496111_0108437 Ga0496111_0108437_535_1836 433
1424 3300048915 Ga0496112_0004435 Ga0496112_0004435_8724_10025 433
1425 3300048915 Ga0496112_0033460 Ga0496112_0033460_1861_3162 433
1426 3300048915 Ga0496112_0037988 Ga0496112_0037988_357_1658 433
1427 3300048915 Ga0496112_0048275 Ga0496112_0048275_68_1369 433
1428 3300048915 Ga0496112_0058807 Ga0496112_0058807_1588_2895 433
1429 3300048915 Ga0496112_0060042 Ga0496112_0060042_1067_2368 433
1430 3300048915 Ga0496112_0176529 Ga0496112_0176529_197_1501 433
1431 3300048916 Ga0496113_0006800 Ga0496113_0006800_5742_7043 433
1432 3300048916 Ga0496113_0060308 Ga0496113_0060308_366_1667 433
1433 3300048917 Ga0496114_0008606 Ga0496114_0008606_778_2079 433
1434 3300048917 Ga0496114_0011846 Ga0496114_0011846_4034_5335 433
1435 3300048917 Ga0496114_0083373 Ga0496114_0083373_406_1707 433
1436 3300048918 Ga0496115_0002504 Ga0496115_0002504_11338_12639 433
1437 3300048918 Ga0496115_0053770 Ga0496115_0053770_440_1741 433
1438 3300048919 Ga0496116_0028721 Ga0496116_0028721_2037_3344 433
1439 3300048920 Ga0496117_0071071 Ga0496117_0071071_982_2286 433
1440 3300048921 Ga0496118_0039892 Ga0496118_0039892_1395_2696 433
1441 3300048922 Ga0496119_0016774 Ga0496119_0016774_2870_4171 433
1442 3300048923 Ga0496120_0065797 Ga0496120_0065797_247_1548 433
1443 3300048924 Ga0496121_0000458 Ga0496121_0000458_11685_12986 433
1444 3300048924 Ga0496121_0001749 Ga0496121_0001749_28028_29332 433
1445 3300048924 Ga0496121_0002564 Ga0496121_0002564_15600_16904 433
1446 3300048924 Ga0496121_0009926 Ga0496121_0009926_5089_6393 433
1447 3300048924 Ga0496121_0132223 Ga0496121_0132223_475_1779 433
1448 3300048925 Ga0496122_0017860 Ga0496122_0017860_3253_4560 433
1449 3300048925 Ga0496122_0058303 Ga0496122_0058303_66_1367 433
1450 3300048926 Ga0496123_0088166 Ga0496123_0088166_58_1359 433
1451 3300048927 Ga0496124_0010603 Ga0496124_0010603_2908_4212 433
1452 3300048928 Ga0496125_0000951 Ga0496125_0000951_42043_43350 433
1453 3300048928 Ga0496125_0001462 Ga0496125_0001462_13504_14811 433
1454 3300048928 Ga0496125_0002254 Ga0496125_0002254_1967_3274 433
1455 3300048928 Ga0496125_0095051 Ga0496125_0095051_194_1498 433
1456 3300048929 Ga0496126_0100548 Ga0496126_0100548_1068_2372 433
1457 3300048929 Ga0496126_0120639 Ga0496126_0120639_854_2161 433
1458 3300048929 Ga0496126_0171016 Ga0496126_0171016_261_1562 433
1459 3300049568 Ga0501031_0004867 Ga0501031_0004867_2385_3686 433
1460 3300049569 Ga0501032_0006705 Ga0501032_0006705_6345_7646 433
1461 3300049570 Ga0501033_0000827 Ga0501033_0000827_19212_20513 433
1462 3300049570 Ga0501033_0001583 Ga0501033_0001583_3019_4323 433
1463 3300049570 Ga0501033_0016530 Ga0501033_0016530_679_1980 433
1464 3300049571 Ga0501034_0077338 Ga0501034_0077338_768_2072 433
1465 3300049571 Ga0501034_0161501 Ga0501034_0161501_257_1558 433
1466 3300049571 Ga0501034_0348099 Ga0501034_0348099_48_1352 433
1467 3300049572 Ga0501036_0000674 Ga0501036_0000674_3612_4973 433
1468 3300049572 Ga0501036_0004945 Ga0501036_0004945_7412_8716 433
1469 3300049572 Ga0501036_0037467 Ga0501036_0037467_2425_3726 433
1470 3300049573 Ga0501037_0000888 Ga0501037_0000888_9949_11250 433
1471 3300049573 Ga0501037_0007710 Ga0501037_0007710_283_1587 433
1472 3300049573 Ga0501037_0017413 Ga0501037_0017413_425_1726 433
1473 3300049573 Ga0501037_0023391 Ga0501037_0023391_2524_3825 433
1474 3300049573 Ga0501037_0025967 Ga0501037_0025967_1760_3121 433
1475 3300049574 Ga0501038_0001121 Ga0501038_0001121_11071_12372 433
1476 3300049574 Ga0501038_0032799 Ga0501038_0032799_963_2324 433
1477 3300049575 Ga0501039_0003466 Ga0501039_0003466_339_1640 433
1478 3300049575 Ga0501039_0151491 Ga0501039_0151491_366_1727 433
1479 3300049578 Ga0501042_0001932 Ga0501042_0001932_3457_4761 433
1480 3300049579 Ga0501043_0008464 Ga0501043_0008464_5268_6569 433
1481 3300049579 Ga0501043_0019806 Ga0501043_0019806_1648_3009 433
1482 3300049579 Ga0501043_0098002 Ga0501043_0098002_163_1464 433
1483 3300049580 Ga0501046_0021327 Ga0501046_0021327_3948_5309 433
1484 3300049580 Ga0501046_0029266 Ga0501046_0029266_2555_3856 433
1485 3300049580 Ga0501046_0062318 Ga0501046_0062318_1000_2304 433
1486 3300049580 Ga0501046_0177177 Ga0501046_0177177_89_1390 433
1487 3300049581 Ga0501047_0000010 Ga0501047_0000010_367303_368664 433
1488 3300049581 Ga0501047_0004062 Ga0501047_0004062_10760_12064 433
1489 3300049581 Ga0501047_0119186 Ga0501047_0119186_130_1431 433
1490 3300049581 Ga0501047_0201508 Ga0501047_0201508_314_1618 433
1491 3300049582 Ga0501048_0000653 Ga0501048_0000653_13955_15316 433
1492 3300049583 Ga0501067_0085856 Ga0501067_0085856_118_1422 433
1493 3300049584 Ga0501068_0024884 Ga0501068_0024884_1341_2645 433
1494 3300049584 Ga0501068_0031994 Ga0501068_0031994_1788_3092 433
1495 3300049586 Ga0501070_0002230 Ga0501070_0002230_14272_15576 433
1496 3300049586 Ga0501070_0086286 Ga0501070_0086286_623_1984 433
1497 3300049588 Ga0501072_0149988 Ga0501072_0149988_79_1383 433
1498 3300049589 Ga0501073_0030234 Ga0501073_0030234_1163_2467 433
1499 3300049589 Ga0501073_0050655 Ga0501073_0050655_170_1531 433
1500 3300049589 Ga0501073_0050877 Ga0501073_0050877_658_1959 433
1501 3300049590 Ga0501074_0015795 Ga0501074_0015795_945_2306 433
1502 3300049592 Ga0501076_0126782 Ga0501076_0126782_363_1664 433
1503 3300049593 Ga0501077_0046592 Ga0501077_0046592_121_1422 433
1504 3300049742 Ga0501080_0003063 Ga0501080_0003063_7813_9174 433
1505 3300049742 Ga0501080_0071767 Ga0501080_0071767_289_1593 433
1506 3300049744 Ga0501083_0008402 Ga0501083_0008402_1310_2614 433
1507 3300049744 Ga0501083_0025847 Ga0501083_0025847_313_1614 433
1508 3300049822 Ga0501035_0001426 Ga0501035_0001426_1694_2998 433
1509 3300049822 Ga0501035_0012953 Ga0501035_0012953_5674_6975 433
1510 3300049822 Ga0501035_0145794 Ga0501035_0145794_479_1783 433
1511 3300049822 Ga0501035_0163108 Ga0501035_0163108_89_1390 433
1512 3300049823 Ga0501044_0013258 Ga0501044_0013258_1203_2564 433
1513 3300049823 Ga0501044_0018430 Ga0501044_0018430_4138_5439 433
1514 3300049823 Ga0501044_0075210 Ga0501044_0075210_560_1861 433
1515 3300049823 Ga0501044_0136215 Ga0501044_0136215_778_2079 433
1516 3300049824 Ga0501045_0064688 Ga0501045_0064688_1061_2422 433
1517 3300049824 Ga0501045_0081311 Ga0501045_0081311_779_2083 433
1518 3300050511 nmdc:mga08y16_172_c1 nmdc:mga08y16_172_c1_50904_52205 433
1519 3300050512 nmdc:mga0n895_24014_c1 nmdc:mga0n895_24014_c1_2726_4027 433
1520 3300050513 nmdc:mga0rr50_180782_c1 nmdc:mga0rr50_180782_c1_128_1429 433
1521 3300053077 Ga0495601_0002574 Ga0495601_0002574_7976_9313 433
1522 3300053077 Ga0495601_0054332 Ga0495601_0054332_640_1941 433
1523 3300053078 Ga0495612_0004857 Ga0495612_0004857_4094_5431 433
1524 3300053080 Ga0500635_0027246 Ga0500635_0027246_325_1626 433
1525 3300053084 Ga0495595_0025302 Ga0495595_0025302_132_1439 433
1526 3300053085 Ga0495619_0000609 Ga0495619_0000609_12392_13693 433
1527 3300053085 Ga0495619_0000757 Ga0495619_0000757_9101_10405 433
1528 3300053085 Ga0495619_0001114 Ga0495619_0001114_2681_4018 433
1529 3300053085 Ga0495619_0026157 Ga0495619_0026157_815_2152 433
1530 3300053087 Ga0500643_000032 Ga0500643_000032_9541_10842 433
1531 3300053091 Ga0500647_0023164 Ga0500647_0023164_1039_2340 433
1532 3300053092 Ga0500583_0048761 Ga0500583_0048761_143_1444 433
1533 3300053094 Ga0500566_0002123 Ga0500566_0002123_9565_10866 433
1534 3300053094 Ga0500566_0011398 Ga0500566_0011398_3556_4857 433
1535 3300053094 Ga0500566_0017517 Ga0500566_0017517_1667_2971 433
1536 3300053096 Ga0500641_0011598 Ga0500641_0011598_881_2188 433
1537 3300053098 Ga0500650_0000167 Ga0500650_0000167_4675_5982 433
1538 3300053103 Ga0500555_002027 Ga0500555_002027_1615_2916 433
1539 3300053104 Ga0500556_0000030 Ga0500556_0000030_2055_3362 433
1540 3300053105 Ga0500557_000004 Ga0500557_000004_135765_137066 433
1541 3300053119 Ga0500595_000002 Ga0500595_000002_444595_445917 433
1542 3300053119 Ga0500595_000306 Ga0500595_000306_7285_8586 433
1543 3300053119 Ga0500595_009208 Ga0500595_009208_2003_3304 433
1544 3300053122 Ga0500608_066101 Ga0500608_066101_368_1672 433
1545 3300053130 Ga0500642_0000080 Ga0500642_0000080_30524_31825 433
1546 3300053130 Ga0500642_0000302 Ga0500642_0000302_13385_14692 433
1547 3300053131 Ga0500652_001787 Ga0500652_001787_3339_4646 433
1548 3300053131 Ga0500652_007383 Ga0500652_007383_1235_2557 433
1549 3300053133 Ga0500655_011446 Ga0500655_011446_24_1334 433
1550 3300053136 Ga0500559_0002857 Ga0500559_0002857_2240_3544 433
1551 3300053139 Ga0500568_0000978 Ga0500568_0000978_17050_18357 433
1552 3300053139 Ga0500568_0012491 Ga0500568_0012491_1163_2464 433
1553 3300053142 Ga0500577_0000263 Ga0500577_0000263_4838_6145 433
1554 3300053145 Ga0500586_001063 Ga0500586_001063_4215_5522 433
1555 3300053148 Ga0500590_082201 Ga0500590_082201_235_1536 433
1556 3300053150 Ga0500603_000163 Ga0500603_000163_12373_13674 433
1557 3300053153 Ga0500616_0000002 Ga0500616_0000002_517043_518356 433
1558 3300053153 Ga0500616_0000252 Ga0500616_0000252_2065_3372 433
1559 3300053153 Ga0500616_0000696 Ga0500616_0000696_4934_6235 433
1560 3300053156 Ga0500622_0003870 Ga0500622_0003870_4146_5453 433
1561 3300053177 Ga0500636_0000066 Ga0500636_0000066_24735_26036 433
1562 3300053177 Ga0500636_0015097 Ga0500636_0015097_1112_2416 433
1563 3300053178 Ga0500637_0003078 Ga0500637_0003078_1335_2636 433
1564 3300053178 Ga0500637_0009851 Ga0500637_0009851_2971_4272 433
1565 3300053729 Ga0500625_043521 Ga0500625_043521_721_2022 433
1566 3300053730 Ga0500645_000385 Ga0500645_000385_22719_24041 433
1567 3300053735 Ga0500596_005269 Ga0500596_005269_681_1985 433
1568 3300054114 Ga0501084_0170783 Ga0501084_0170783_124_1428 433

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

219

312

0.93

PF22458

RsmF-B_ferredox

Methyltr_RsmF/B-like, ferredoxin-like domain

126

197

0.93

PF01189

Methyltr_RsmB-F

16S rRNA methyltransferase RsmB/F

223

430

0.87

PF01728

FtsJ

FtsJ-like methyltransferase

213

373

0.84

PF13847

Methyltransf_31

Methyltransferase domain

228

403

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2frx-assembly2.cif.gz_B crystal structure of yebu, a m5c rna methyltransferase from e.coli 0.8806 126 433
7r6k-assembly1.cif.gz_q state e2 nucleolar 60s ribosomal intermediate - model for noc2/noc3 region 0.876 155 309
3a4t-assembly1.cif.gz_A crystal structure of atrm4 from m.jannaschii with sinefungin 0.8666 154 431
3a4t-assembly1.cif.gz_A crystal structure of atrm4 from m.jannaschii with sinefungin 0.8571 154 431
3m4x-assembly1.cif.gz_A structure of a ribosomal methyltransferase 0.8539 126 433
ID Description Score Start End Superfamily
af_B7ZXR6_266_358_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9516 215 285 3.40.50.150
af_Q8I5B4_187_375_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9213 219 431 3.40.50.150
1sqfA04 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9144 215 431 3.40.50.150
af_Q8I5B4_187_375_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9073 219 431 3.40.50.150
1sqfA04 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9056 215 431 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A537L2G6-F1-model_v4 RsmB/NOP family class I SAM-dependent RNA methyltransferase 0.9905 1 432 GO:0001510
GO:0003723
GO:0008173
AF-A0A537L2G6-F1-model_v4 RsmB/NOP family class I SAM-dependent RNA methyltransferase 0.9883 1 432 GO:0001510
GO:0003723
GO:0008173
AF-A0A527VW72-F1-model_v4 RsmB/NOP family class I SAM-dependent RNA methyltransferase 0.9705 135 364 GO:0001510
GO:0003723
GO:0008173
AF-A0A3S1VKP8-F1-model_v4 deleted 0.9644 1 228
AF-A0A356W3W8-F1-model_v4 MFS transporter 0.9643 1 303 GO:0001510
GO:0003723
GO:0008173

Feature Viewer

pLDDT pTM Quality
95.61 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map