F494726

General Info

Members Datasets Scaffolds Average Seq Length
1554 633 1385 317

Family's Representative Sequence

Representative Sequence 3300015687|Ga0183368_1003|Ga0183368_1003329
Length 360
Sequence MLREQRTVSDTTSDRRGTHNVNTSMHRRVIILGSGPAGYTAAVYAARANLKPTMITGLQQGGQLMTTTEVDNWPGDVEGLQGPALMQRMAEHAERLKTEMVFDHIHTVDLKQRPFRLKGDSGEYTCDALIVATGATAKYLGIASEEHFKGKGVSACATCDGFFFREQEVAVIGGGNTAVEEALYLSNIASKVYLVHRRDKLRAEKIMQDKLFEKAAAGKIELVWNHTVDEVLGDNSGVTGVRVKDINSDATRDIPVTGFFVAIGHTPNTGIFDGQLDMHDGYIKIRSGLAGMATMTSVPGVFAAGDVADHVYRQAVTSAGFGCMAALDAERFLDSASQRCGVFEGSGVSARRVHVPSIKH

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231004 Pseudomonas sp. GM102 Isolate Nodule
3 2511231006 Pseudomonas sp. GM17 Isolate Nodule
4 2511231007 Pseudomonas sp. GM18 Isolate Nodule
5 2511231008 Pseudomonas sp. GM21 Isolate Nodule
6 2511231011 Pseudomonas sp. GM30 Isolate Nodule
7 2511231012 Pseudomonas sp. GM33 Isolate Nodule
8 2511231014 Pseudomonas sp. GM48 Isolate Nodule
9 2511231015 Pseudomonas sp. GM49 Isolate Nodule
10 2511231016 Pseudomonas sp. GM50 Isolate Nodule
11 2511231017 Pseudomonas sp. GM55 Isolate Nodule
12 2511231018 Pseudomonas sp. GM60 Isolate Nodule
13 2511231019 Pseudomonas sp. GM67 Isolate Nodule
14 2511231020 Pseudomonas sp. GM74 Isolate Nodule
15 2511231021 Pseudomonas sp. GM78 Isolate Nodule
16 2511231022 Pseudomonas sp. GM79 Isolate Nodule
17 2511231023 Pseudomonas sp. GM80 Isolate Nodule
18 2511231031 Pseudomonas sp. GM16 Isolate Nodule
19 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
20 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
21 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
22 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
23 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
24 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
25 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
26 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
27 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
28 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
29 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
30 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
31 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
32 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
33 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
34 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
35 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
36 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
37 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
38 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
39 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
40 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
41 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
42 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
43 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
44 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
45 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
46 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
47 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
48 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
49 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
50 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
51 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
52 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
53 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
54 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
55 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
56 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
57 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
58 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
59 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
60 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
61 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
62 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
63 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
64 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
65 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
66 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
67 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
68 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
69 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
70 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
71 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
72 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
73 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
74 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
75 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
76 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
77 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
78 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
79 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
80 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
81 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
82 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
83 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
84 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
85 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
86 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
87 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
88 2734482264 Dyella sp. AD052 Isolate Unclassified
89 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
90 2738543009 Luteibacter sp. OK325 Isolate Unclassified
91 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
92 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
93 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
94 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
95 2739367700 Dyella sp. YR388 Isolate Unclassified
96 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
97 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
98 2773857670 Pseudomonas sp. 478 Isolate Unclassified
99 2773857673 Pseudomonas sp. 443 Isolate Unclassified
100 2784132063 Pseudomonas sp. 424 Isolate Unclassified
101 2784132072 Pseudomonas sp. 460 Isolate Unclassified
102 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
103 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
104 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
105 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
106 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
107 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
108 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
109 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
110 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
111 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
112 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
113 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
114 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
115 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
116 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
117 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
118 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
119 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
120 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
121 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
122 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
123 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
124 2884411467 Dyella sp. AD56 Isolate Rhizosphere
125 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
126 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
127 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
128 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
129 2919085039 Luteibacter sp. 1214 Isolate Unclassified
130 2919404418 Luteibacter sp. 3190 Isolate Unclassified
131 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
132 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
133 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
134 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
135 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
136 2928963466 Dyella japonica 1073 Isolate Unclassified
137 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
138 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
139 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
140 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
141 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
142 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
143 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
144 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
145 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
146 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
147 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
148 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
149 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
150 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
151 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
152 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
153 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
154 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
155 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
156 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
157 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
158 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
159 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
160 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
161 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
162 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
163 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
164 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
165 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
166 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
167 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
168 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
169 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
170 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
171 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
172 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
173 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
174 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
175 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
176 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
177 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
178 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
179 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
180 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
181 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
182 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
183 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
184 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
185 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
186 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
187 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
188 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
189 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
190 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
191 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
192 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
193 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
194 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
195 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
196 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
197 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
198 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
199 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
200 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
201 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
202 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
203 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
204 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
205 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
206 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
207 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
208 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
209 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
210 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
211 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
212 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
213 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
214 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
215 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
216 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
217 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
218 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
219 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
220 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
221 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
222 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
223 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
224 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
225 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
226 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
227 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
228 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
229 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
230 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
231 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
232 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
233 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
234 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
235 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
236 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
237 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
238 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
239 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
240 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
241 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
242 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
243 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
244 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
245 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
246 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
247 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
248 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
249 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
250 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
251 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
252 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
253 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
254 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
255 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
256 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
257 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
258 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
259 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
260 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
261 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
262 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
263 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
264 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
265 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
266 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
267 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
268 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
269 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
270 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
271 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
272 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
273 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
274 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
275 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
276 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
277 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
279 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
280 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
281 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
282 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
283 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
284 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
285 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
286 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
287 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
288 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
289 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
290 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
291 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
292 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
293 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
294 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
295 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
296 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
297 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
298 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
299 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
300 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
339 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
342 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
345 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
347 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
348 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
349 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
350 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
351 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
352 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
353 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
354 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
355 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
356 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
358 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
359 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
360 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
361 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
362 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
363 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
364 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
365 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
366 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
367 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
368 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
369 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
370 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
371 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
372 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
373 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
374 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
375 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
376 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
377 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
378 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
379 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
380 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
381 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
382 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
383 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
384 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
385 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
386 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
387 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
388 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
389 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
390 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
391 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
392 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
393 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
394 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
395 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
396 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
397 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
398 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
399 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
400 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
401 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
402 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
403 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
404 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
405 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
406 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
407 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
408 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
409 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
410 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
411 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
412 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
413 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
414 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
415 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
416 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
417 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
418 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
419 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
420 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
421 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
422 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
423 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
424 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
425 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
426 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
427 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
428 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
429 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
430 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
431 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
432 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
433 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
434 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
435 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
436 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
437 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
438 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
439 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
440 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
441 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
442 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
443 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
444 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
445 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
446 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
447 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
448 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
449 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
450 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
451 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
452 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
453 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
454 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
455 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
456 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
457 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
458 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
459 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
460 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
461 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
462 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
463 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
464 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
465 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
466 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
467 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
468 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
469 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
470 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
471 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
472 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
473 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
474 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
475 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
476 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
477 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
478 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
479 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
480 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
481 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
482 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
483 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
484 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
485 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
486 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
487 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
488 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
489 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
490 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
491 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
492 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
493 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
494 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
495 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
496 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
497 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
498 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
499 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
500 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
501 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
502 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
503 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
504 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
505 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
506 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
507 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
508 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
509 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
510 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
511 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
512 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
513 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
514 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
515 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
516 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
517 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
518 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
519 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
520 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
521 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
522 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
523 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
524 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
525 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
526 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
527 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
528 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
529 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
530 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
531 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
532 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
533 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
534 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
535 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
536 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
537 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
538 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
539 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
540 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
541 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
542 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
543 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
544 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
545 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
546 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
547 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
548 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
549 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
550 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
551 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
552 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
553 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
554 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
555 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
556 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
557 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
558 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
559 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
560 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
561 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
562 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
563 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
564 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
565 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
566 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
567 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
568 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
569 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
570 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
571 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
572 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
573 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
574 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
575 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
576 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
577 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
578 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
579 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
580 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
581 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
582 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
583 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
584 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
585 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
586 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
587 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
588 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
589 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
590 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
591 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
592 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
593 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
594 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
595 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
596 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
597 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
598 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
599 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
600 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
601 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
602 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
603 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
604 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
605 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
606 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
607 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
608 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
609 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
610 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
611 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
612 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
613 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
614 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
615 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
616 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
617 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
618 639633007 Azoarcus olearius BH72 Isolate Unclassified
619 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
620 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
621 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
622 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
623 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
624 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
625 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
626 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
627 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
628 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
629 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
630 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
631 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
632 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
633 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.35
Metatranscriptomes 0.77
Isolates 10.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.14
Nodule 1.09
Rhizoplane 4.7
Rhizosphere 75.03
Stem 0
Stem Tuber 0
Unclassified 10.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_886698 2162886007 Bacteria 2077
2 JGI24736J21556_1001980 3300001904 Bacteria 3637
3 JGI24741J21665_1001139 3300001915 Bacteria 7856
4 JGI24741J21665_1003731 3300001915 Bacteria 3549
5 JGI24740J21852_10003150 3300001979 Bacteria 7278
6 JGI24740J21852_10006936 3300001979 Bacteria 4650
7 JGI24740J21852_10009130 3300001979 Bacteria 3898
8 JGI24739J22299_10002601 3300001989 Bacteria 6951
9 JGI24737J22298_10001809 3300001990 Bacteria 7663
10 JGI24735J21928_10012840 3300002067 Bacteria 2644
11 JGI24735J21928_10023803 3300002067 Bacteria 1857
12 JGI24738J21930_10029385 3300002075 Bacteria 1124
13 JGI25162J39368_1000018 3300002737 Bacteria 277875
14 JGI25162J39368_1000349 3300002737 Bacteria 39636
15 JGI25162J39368_1000704 3300002737 Bacteria 23251
16 JGI25162J39368_1001950 3300002737 Bacteria 9293
17 JGI25157J39369_1000275 3300002741 Bacteria 37720
18 JGI25157J39369_1000340 3300002741 Bacteria 33129
19 JGI25163J39215_1000208 3300002771 Bacteria 22406
20 JGI25163J39215_1001733 3300002771 Bacteria 3067
21 JGI25163J39215_1001902 3300002771 Bacteria 2696
22 JGI25164J39214_1000007 3300002772 Bacteria 312507
23 JGI25164J39214_1000044 3300002772 Bacteria 125916
24 JGI25164J39214_1000372 3300002772 Bacteria 26710
25 JGI25164J39214_1000430 3300002772 Bacteria 23247
26 JGI25151J46595_10000174 3300003187 Bacteria 83009
27 JGI25165J46597_1000029 3300003214 Bacteria 312507
28 JGI25165J46597_1000131 3300003214 Bacteria 125895
29 JGI25165J46597_1000557 3300003214 Bacteria 33895
30 JGI25165J46597_1000823 3300003214 Bacteria 23251
31 rootH2_10006354 3300003320 Bacteria 8276
32 rootL2_10007600 3300003322 Bacteria 24170
33 rootL2_10361046 3300003322 Eukaryota 2081
34 Ga0006562J51391_1015243 3300003578 Bacteria 6210
35 Ga0006562J51391_1015244 3300003578 Bacteria 3511
36 Ga0055527_1001477 3300003760 Bacteria 4904
37 Ga0055535_1000103 3300003761 Bacteria 91199
38 Ga0055535_1000602 3300003761 Bacteria 29677
39 Ga0055535_1000679 3300003761 Bacteria 26491
40 Ga0055542_1000024 3300003762 Bacteria 277875
41 Ga0055542_1000222 3300003762 Bacteria 68762
42 Ga0055542_1000476 3300003762 Bacteria 37344
43 Ga0055542_1000584 3300003762 Bacteria 31631
44 Ga0055529_1000029 3300003763 Bacteria 277978
45 Ga0055529_1000426 3300003763 Bacteria 43142
46 Ga0055529_1001210 3300003763 Bacteria 10157
47 Ga0055524_1039049 3300003775 Bacteria 1231
48 Ga0055536_1008350 3300003781 Bacteria 4469
49 Ga0055530_10007740 3300003791 Bacteria 4458
50 Ga0055540_1006813 3300003792 Bacteria 4455
51 Ga0058692_1008408 3300003856 Bacteria 2663
52 Ga0065165_1000001 3300005262 Bacteria 494087
53 Ga0065165_1007335 3300005262 Bacteria 5459
54 Ga0065714_10007443 3300005288 Bacteria 4220
55 Ga0065714_10023853 3300005288 Bacteria 1153
56 Ga0065714_10023914 3300005288 Bacteria 1456
57 Ga0065704_10006559 3300005289 Bacteria 3206
58 Ga0065707_10083865 3300005295 Bacteria 8082
59 Ga0065707_10084601 3300005295 Bacteria 6997
60 Ga0070683_100002931 3300005329 Bacteria 13673
61 Ga0070690_100033522 3300005330 Bacteria 3216
62 Ga0070670_100095604 3300005331 Bacteria 2556
63 Ga0070666_10000005 3300005335 Bacteria 343092
64 Ga0070666_10003098 3300005335 Bacteria 10096
65 Ga0070666_10295416 3300005335 Eukaryota 1153
66 Ga0070680_100012331 3300005336 Bacteria 6638
67 Ga0070680_100120675 3300005336 Bacteria 2188
68 Ga0070682_100013148 3300005337 Bacteria 4755
69 Ga0070682_100024183 3300005337 Bacteria 3613
70 Ga0070660_100268669 3300005339 Bacteria 1394
71 Ga0070661_100022538 3300005344 Bacteria 4509
72 Ga0070668_100057599 3300005347 Bacteria 3003
73 Ga0070671_100033474 3300005355 Bacteria 4251
74 Ga0070671_100099071 3300005355 Bacteria 2445
75 Ga0070673_100243204 3300005364 Bacteria 1565
76 Ga0070659_100015907 3300005366 Bacteria 5642
77 Ga0070659_100018099 3300005366 Bacteria 5312
78 Ga0070667_100001132 3300005367 Bacteria 24302
79 Ga0070667_100058750 3300005367 Bacteria 3252
80 Ga0070714_100055822 3300005435 Bacteria 3376
81 Ga0070713_100010511 3300005436 Bacteria 6689
82 Ga0070663_100015776 3300005455 Bacteria 4887
83 Ga0070663_100103612 3300005455 Bacteria 2127
84 Ga0070663_100144313 3300005455 Bacteria 1820
85 Ga0070662_100091548 3300005457 Bacteria 2284
86 Ga0070662_100128584 3300005457 Bacteria 1950
87 Ga0070681_10003200 3300005458 Bacteria 15251
88 Ga0070681_10019847 3300005458 Bacteria 6732
89 Ga0070681_10028831 3300005458 Bacteria 5578
90 Ga0070681_10047564 3300005458 Bacteria 4288
91 Ga0070681_10072780 3300005458 Bacteria 3399
92 Ga0070681_10099083 3300005458 Bacteria 2861
93 Ga0070685_10223867 3300005466 Bacteria 1234
94 Ga0070679_100014688 3300005530 Bacteria 7526
95 Ga0070679_100018626 3300005530 Bacteria 6740
96 Ga0070679_100018670 3300005530 Bacteria 6732
97 Ga0070679_100036810 3300005530 Bacteria 4857
98 Ga0070684_100028987 3300005535 Bacteria 4687
99 Ga0070684_100147187 3300005535 Bacteria 2132
100 Ga0068853_100000945 3300005539 Bacteria 20385
101 Ga0068853_100002755 3300005539 Bacteria 13267
102 Ga0068853_100008261 3300005539 Bacteria 8355
103 Ga0068853_100031047 3300005539 Bacteria 4517
104 Ga0068853_100035857 3300005539 Bacteria 4215
105 Ga0068853_100037042 3300005539 Bacteria 4149
106 Ga0068853_100042270 3300005539 Bacteria 3896
107 Ga0070696_100006935 3300005546 Bacteria 7563
108 Ga0070696_100041176 3300005546 Bacteria 3191
109 Ga0070693_100094415 3300005547 Bacteria 1809
110 Ga0070665_100009525 3300005548 Bacteria 9825
111 Ga0070665_100036439 3300005548 Bacteria 4948
112 Ga0070665_100094043 3300005548 Bacteria 3003
113 Ga0070665_100114298 3300005548 Bacteria 2702
114 Ga0070665_100159718 3300005548 Bacteria 2256
115 Ga0070704_100113447 3300005549 Bacteria 2067
116 Ga0068855_100002047 3300005563 Bacteria 24995
117 Ga0068855_100033560 3300005563 Bacteria 6124
118 Ga0068855_100074556 3300005563 Bacteria 3940
119 Ga0068855_100083604 3300005563 Bacteria 3697
120 Ga0070664_100126911 3300005564 Bacteria 2239
121 Ga0068857_100001031 3300005577 Bacteria 21511
122 Ga0068857_100083642 3300005577 Bacteria 2851
123 Ga0068857_100114947 3300005577 Bacteria 2420
124 Ga0068854_100007913 3300005578 Bacteria 6803
125 Ga0068854_100026288 3300005578 Bacteria 3999
126 Ga0068856_100009328 3300005614 Bacteria 9530
127 Ga0068852_100326809 3300005616 Bacteria 1491
128 Ga0068859_100078758 3300005617 Bacteria 3336
129 Ga0068859_100139190 3300005617 Bacteria 2501
130 Ga0068859_100180988 3300005617 Bacteria 2191
131 Ga0068859_100232990 3300005617 Bacteria 1930
132 Ga0068864_100027628 3300005618 Bacteria 4794
133 Ga0068864_100084211 3300005618 Bacteria 2793
134 Ga0068851_10017413 3300005834 Bacteria 3450
135 Ga0068851_10073307 3300005834 Bacteria 1775
136 Ga0068851_10105033 3300005834 Bacteria 1502
137 Ga0068863_100005838 3300005841 Bacteria 12062
138 Ga0068863_100045644 3300005841 Bacteria 4158
139 Ga0068858_100002370 3300005842 Bacteria 19057
140 Ga0068858_100093351 3300005842 Bacteria 2802
141 Ga0068860_100130869 3300005843 Bacteria 2408
142 Ga0068860_100180852 3300005843 Bacteria 2038
143 Ga0068862_100034747 3300005844 Bacteria 4267
144 Ga0068862_100242761 3300005844 Bacteria 1638
145 Ga0081455_10095496 3300005937 Bacteria 2399
146 Ga0075365_10000037 3300006038 Bacteria 48789
147 Ga0075365_10003284 3300006038 Bacteria 8295
148 Ga0075365_10017059 3300006038 Bacteria 4433
149 Ga0075368_10040639 3300006042 Bacteria 1826
150 Ga0075363_100014120 3300006048 Bacteria 3893
151 Ga0075364_10002766 3300006051 Bacteria 9866
152 Ga0075364_10003188 3300006051 Bacteria 9293
153 Ga0075364_10004081 3300006051 Bacteria 8380
154 Ga0075364_10013235 3300006051 Bacteria 5065
155 Ga0075364_10020835 3300006051 Bacteria 4127
156 Ga0075364_10175708 3300006051 Bacteria 1448
157 Ga0075432_10005828 3300006058 Bacteria 4192
158 Ga0075432_10028272 3300006058 Bacteria 1934
159 Ga0075362_10033282 3300006177 Bacteria 2241
160 Ga0075362_10091076 3300006177 Bacteria 1415
161 Ga0075369_10001270 3300006186 Bacteria 8577
162 Ga0075369_10024363 3300006186 Bacteria 2507
163 Ga0075366_10022341 3300006195 Bacteria 3679
164 Ga0097621_100021251 3300006237 Bacteria 5016
165 Ga0075370_10000070 3300006353 Bacteria 31239
166 Ga0068871_100030329 3300006358 Bacteria 4257
167 Ga0075433_10005441 3300006852 Bacteria 10005
168 Ga0075434_100000591 3300006871 Bacteria 28020
169 Ga0075436_100288493 3300006914 Bacteria 1174
170 Ga0097620_100078753 3300006931 Bacteria 3336
171 Ga0097620_100139186 3300006931 Bacteria 2501
172 Ga0097620_100180993 3300006931 Bacteria 2191
173 Ga0097620_100232983 3300006931 Bacteria 1930
174 Ga0105251_10018815 3300009011 Bacteria 3662
175 Ga0105244_10009340 3300009036 Bacteria 6036
176 Ga0105244_10043069 3300009036 Bacteria 2331
177 Ga0105250_10015012 3300009092 Bacteria 3176
178 Ga0105240_10000127 3300009093 Bacteria 156461
179 Ga0105240_10000494 3300009093 Bacteria 72657
180 Ga0105240_10001888 3300009093 Bacteria 34840
181 Ga0105240_10014469 3300009093 Bacteria 10774
182 Ga0105240_10015710 3300009093 Bacteria 10273
183 Ga0105240_10196689 3300009093 Bacteria 2366
184 Ga0111539_10007423 3300009094 Bacteria 14049
185 Ga0105245_10122305 3300009098 Bacteria 2432
186 Ga0105245_10203394 3300009098 Bacteria 1903
187 Ga0105247_10004898 3300009101 Bacteria 8514
188 Ga0105241_10089636 3300009174 Bacteria 2424
189 Ga0105242_10138378 3300009176 Bacteria 2110
190 Ga0105242_10378021 3300009176 Bacteria 1316
191 Ga0105237_10000250 3300009545 Bacteria 76317
192 Ga0105237_10000565 3300009545 Bacteria 51782
193 Ga0105237_10546745 3300009545 Bacteria 1165
194 Ga0105238_10000783 3300009551 Bacteria 33020
195 Ga0105238_10124241 3300009551 Bacteria 2560
196 Ga0105238_10303295 3300009551 Bacteria 1581
197 Ga0105249_10060146 3300009553 Bacteria 3484
198 Ga0105249_10215913 3300009553 Bacteria 1885
199 Ga0105239_10000933 3300010375 Bacteria 41307
200 Ga0105239_10020822 3300010375 Bacteria 7238
201 Ga0105239_10038903 3300010375 Bacteria 5210
202 Ga0105239_10091374 3300010375 Bacteria 3359
203 Ga0105239_10136648 3300010375 Bacteria 2729
204 Ga0105239_10203762 3300010375 Bacteria 2217
205 Ga0105246_10191067 3300011119 Bacteria 1585
206 Ga0157345_1000590 3300012498 Bacteria 3142
207 Ga0157373_10009114 3300013100 Bacteria 7342
208 Ga0157373_10012457 3300013100 Bacteria 6250
209 Ga0157373_10052163 3300013100 Bacteria 2911
210 Ga0157373_10199127 3300013100 Bacteria 1412
211 Ga0157371_10001610 3300013102 Bacteria 23138
212 Ga0157371_10009007 3300013102 Bacteria 7890
213 Ga0157371_10034860 3300013102 Bacteria 3608
214 Ga0157371_10059202 3300013102 Bacteria 2716
215 Ga0157370_10004805 3300013104 Bacteria 15363
216 Ga0157370_10009321 3300013104 Bacteria 10509
217 Ga0157370_10024154 3300013104 Bacteria 6024
218 Ga0157370_10036936 3300013104 Bacteria 4738
219 Ga0157370_10065279 3300013104 Bacteria 3444
220 Ga0157370_10312457 3300013104 Bacteria 1450
221 Ga0157370_10393848 3300013104 Bacteria 1275
222 Ga0157369_10006171 3300013105 Bacteria 13910
223 Ga0157369_10023258 3300013105 Bacteria 6905
224 Ga0157369_10053073 3300013105 Bacteria 4382
225 Ga0157369_10055203 3300013105 Bacteria 4288
226 Ga0157374_10726072 3300013296 Bacteria 1007
227 Ga0157378_10039614 3300013297 Bacteria 4179
228 Ga0163162_10000281 3300013306 Bacteria 46556
229 Ga0163162_10011705 3300013306 Bacteria 8556
230 Ga0163162_10014199 3300013306 Bacteria 7782
231 Ga0163162_10020384 3300013306 Bacteria 6514
232 Ga0163162_10077075 3300013306 Bacteria 3397
233 Ga0157372_10005727 3300013307 Bacteria 13233
234 Ga0157372_10014832 3300013307 Bacteria 8343
235 Ga0157372_10038888 3300013307 Bacteria 5250
236 Ga0157372_10059072 3300013307 Bacteria 4288
237 Ga0157372_10076879 3300013307 Bacteria 3770
238 Ga0157372_10089067 3300013307 Bacteria 3505
239 Ga0157372_10097092 3300013307 Bacteria 3359
240 Ga0157372_10097910 3300013307 Bacteria 3346
241 Ga0157372_10149416 3300013307 Bacteria 2696
242 Ga0157372_10581304 3300013307 Bacteria 1305
243 Ga0157375_10001264 3300013308 Bacteria 21881
244 Ga0157375_10093638 3300013308 Bacteria 3071
245 Ga0157375_10310655 3300013308 Bacteria 1741
246 Ga0157375_10385868 3300013308 Bacteria 1567
247 Ga0157375_10387975 3300013308 Bacteria 1563
248 Ga0157380_10240014 3300014326 Bacteria 1633
249 Ga0157380_10295444 3300014326 Bacteria 1489
250 Ga0182008_10003295 3300014497 Bacteria 9827
251 Ga0182008_10005708 3300014497 Bacteria 7045
252 Ga0182008_10010615 3300014497 Bacteria 4925
253 Ga0182008_10010925 3300014497 Bacteria 4843
254 Ga0182008_10014631 3300014497 Bacteria 4103
255 Ga0182008_10015868 3300014497 Bacteria 3922
256 Ga0182008_10045788 3300014497 Bacteria 2175
257 Ga0157379_10262489 3300014968 Bacteria 1569
258 Ga0157376_10012224 3300014969 Bacteria 6364
259 Ga0157376_10020600 3300014969 Bacteria 5106
260 Ga0157376_10119112 3300014969 Bacteria 2337
261 Ga0157376_10197429 3300014969 Bacteria 1849
262 Ga0182006_1000005 3300015261 Bacteria 621201
263 Ga0182006_1000943 3300015261 Bacteria 19377
264 Ga0182006_1039310 3300015261 Bacteria 1867
265 Ga0182006_1047948 3300015261 Bacteria 1653
266 Ga0182007_10003743 3300015262 Bacteria 7101
267 Ga0182007_10011283 3300015262 Bacteria 3481
268 Ga0182005_1015088 3300015265 Bacteria 2156
269 Ga0183369_1012 3300015685 Bacteria 251554
270 Ga0183368_1003 3300015687 Bacteria 1276390
271 Ga0183368_1004 3300015687 Bacteria 1211761
272 Ga0163161_10003936 3300017792 Bacteria 10420
273 Ga0163161_10039366 3300017792 Bacteria 3393
274 Ga0163161_10055493 3300017792 Bacteria 2876
275 Ga0163161_10082124 3300017792 Bacteria 2374
276 Ga0163161_10087406 3300017792 Bacteria 2303
277 Ga0163161_10097625 3300017792 Bacteria 2182
278 Ga0163161_10246880 3300017792 Bacteria 1390
279 Ga0197907_10975134 3300020069 Bacteria 1326
280 Ga0206356_10595342 3300020070 Bacteria 2366
281 Ga0206356_11523636 3300020070 Bacteria 9353
282 Ga0206350_10027870 3300020080 Bacteria 1854
283 Ga0206354_10110314 3300020081 Bacteria 5609
284 Ga0206353_10713427 3300020082 Bacteria 3823
285 Ga0206353_11208957 3300020082 Bacteria 1802
286 Ga0154015_1104391 3300020610 Bacteria 9283
287 Ga0224712_10029744 3300022467 Bacteria 1965
288 Ga0224712_10059275 3300022467 Bacteria 1519
289 Ga0209760_100026 3300025207 Bacteria 153418
290 Ga0209760_100089 3300025207 Bacteria 72658
291 Ga0209760_100235 3300025207 Bacteria 23322
292 Ga0209784_100026 3300025224 Bacteria 371540
293 Ga0209674_100016 3300025226 Bacteria 696756
294 Ga0209674_101041 3300025226 Bacteria 8438
295 Ga0209674_101249 3300025226 Bacteria 7166
296 Ga0209672_100106 3300025228 Bacteria 100509
297 Ga0209672_100176 3300025228 Bacteria 53116
298 Ga0209672_104294 3300025228 Bacteria 2681
299 Ga0209563_101102 3300025230 Bacteria 7735
300 Ga0207427_100011 3300025231 Bacteria 640076
301 Ga0207427_100015 3300025231 Bacteria 542133
302 Ga0207427_100023 3300025231 Bacteria 439725
303 Ga0207427_100105 3300025231 Bacteria 118241
304 Ga0207427_100107 3300025231 Bacteria 116422
305 Ga0207427_100261 3300025231 Bacteria 41118
306 Ga0207427_101563 3300025231 Bacteria 7926
307 Ga0209437_100027 3300025233 Bacteria 542133
308 Ga0209437_100039 3300025233 Bacteria 448321
309 Ga0209437_100044 3300025233 Bacteria 430619
310 Ga0209437_100069 3300025233 Bacteria 307733
311 Ga0209437_100129 3300025233 Bacteria 184661
312 Ga0209437_100252 3300025233 Bacteria 84185
313 Ga0209437_100563 3300025233 Bacteria 24403
314 Ga0209437_102167 3300025233 Bacteria 3939
315 Ga0209258_100059 3300025242 Bacteria 324934
316 Ga0209258_100155 3300025242 Bacteria 157847
317 Ga0209258_100511 3300025242 Bacteria 37397
318 Ga0209258_101567 3300025242 Bacteria 7625
319 Ga0209646_1000577 3300025246 Bacteria 15267
320 Ga0209646_1000590 3300025246 Bacteria 14689
321 Ga0209646_1014065 3300025246 Bacteria 1208
322 Ga0209026_1000036 3300025250 Bacteria 296607
323 Ga0209026_1000105 3300025250 Bacteria 150738
324 Ga0209026_1000194 3300025250 Bacteria 85950
325 Ga0209026_1000234 3300025250 Bacteria 74634
326 Ga0209026_1000635 3300025250 Bacteria 21860
327 Ga0209026_1001141 3300025250 Bacteria 12494
328 Ga0209148_1000002 3300025254 Bacteria 2399500
329 Ga0209148_1000010 3300025254 Bacteria 1265567
330 Ga0209148_1000220 3300025254 Bacteria 94901
331 Ga0209148_1000533 3300025254 Bacteria 37397
332 Ga0209148_1004748 3300025254 Bacteria 3265
333 Ga0209759_1000300 3300025256 Bacteria 68198
334 Ga0209759_1000442 3300025256 Bacteria 48456
335 Ga0209759_1000901 3300025256 Bacteria 22183
336 Ga0209759_1002666 3300025256 Bacteria 7642
337 Ga0209759_1021541 3300025256 Bacteria 1463
338 Ga0209129_1009819 3300025258 Bacteria 2464
339 Ga0209233_1000009 3300025261 Bacteria 1265567
340 Ga0209233_1000039 3300025261 Bacteria 542133
341 Ga0209233_1000057 3300025261 Bacteria 430619
342 Ga0209233_1000224 3300025261 Bacteria 103605
343 Ga0209233_1000227 3300025261 Bacteria 102833
344 Ga0209233_1000300 3300025261 Bacteria 59294
345 Ga0209233_1000364 3300025261 Bacteria 41118
346 Ga0209455_1000020 3300025272 Bacteria 702259
347 Ga0209455_1000077 3300025272 Bacteria 279165
348 Ga0209455_1000233 3300025272 Bacteria 70104
349 Ga0209455_1000411 3300025272 Bacteria 34523
350 Ga0209455_1002848 3300025272 Bacteria 6415
351 Ga0209455_1005053 3300025272 Bacteria 4174
352 Ga0209676_1000017 3300025292 Bacteria 643409
353 Ga0209676_1006665 3300025292 Bacteria 5629
354 Ga0209025_1000027 3300025294 Bacteria 505882
355 Ga0209758_1000289 3300025297 Bacteria 98983
356 Ga0209758_1013062 3300025297 Bacteria 4569
357 Ga0209050_1000062 3300025298 Bacteria 316538
358 Ga0209050_1000508 3300025298 Bacteria 65889
359 Ga0209050_1002947 3300025298 Bacteria 13308
360 Ga0209256_1008266 3300025299 Bacteria 4868
361 Ga0209256_1029682 3300025299 Bacteria 1520
362 Ga0209051_1000060 3300025303 Bacteria 257304
363 Ga0209051_1002917 3300025303 Bacteria 11727
364 Ga0207656_10023055 3300025321 Bacteria 2503
365 Ga0207656_10028127 3300025321 Bacteria 2305
366 Ga0207696_1000051 3300025711 Bacteria 276833
367 Ga0207696_1011441 3300025711 Bacteria 3194
368 Ga0207655_1008619 3300025728 Bacteria 6446
369 Ga0207655_1011063 3300025728 Bacteria 5411
370 Ga0207655_1020838 3300025728 Bacteria 3353
371 Ga0207655_1031388 3300025728 Bacteria 2449
372 Ga0207655_1033697 3300025728 Bacteria 2317
373 Ga0207713_1000397 3300025735 Bacteria 46586
374 Ga0207713_1012424 3300025735 Bacteria 4554
375 Ga0207710_10006424 3300025900 Bacteria 5019
376 Ga0207710_10039518 3300025900 Bacteria 2088
377 Ga0207680_10000005 3300025903 Bacteria 660983
378 Ga0207680_10004362 3300025903 Bacteria 6702
379 Ga0207680_10080179 3300025903 Bacteria 2049
380 Ga0207647_10001740 3300025904 Bacteria 16681
381 Ga0207647_10003545 3300025904 Bacteria 11708
382 Ga0207647_10004435 3300025904 Bacteria 10402
383 Ga0207647_10005413 3300025904 Bacteria 9365
384 Ga0207647_10033287 3300025904 Bacteria 3301
385 Ga0207705_10004364 3300025909 Bacteria 10695
386 Ga0207705_10008125 3300025909 Bacteria 7684
387 Ga0207705_10014569 3300025909 Bacteria 5658
388 Ga0207705_10021453 3300025909 Bacteria 4609
389 Ga0207705_10059564 3300025909 Bacteria 2756
390 Ga0207705_10128226 3300025909 Bacteria 1886
391 Ga0207707_10000630 3300025912 Bacteria 34922
392 Ga0207707_10000644 3300025912 Bacteria 34474
393 Ga0207707_10000699 3300025912 Bacteria 33304
394 Ga0207707_10007899 3300025912 Bacteria 9252
395 Ga0207707_10009345 3300025912 Bacteria 8502
396 Ga0207707_10016237 3300025912 Bacteria 6495
397 Ga0207707_10027478 3300025912 Bacteria 4975
398 Ga0207707_10035181 3300025912 Bacteria 4380
399 Ga0207707_10036397 3300025912 Bacteria 4303
400 Ga0207707_10036560 3300025912 Bacteria 4292
401 Ga0207707_10084835 3300025912 Bacteria 2767
402 Ga0207707_10095396 3300025912 Bacteria 2600
403 Ga0207695_10000349 3300025913 Bacteria 106823
404 Ga0207695_10000821 3300025913 Bacteria 57510
405 Ga0207695_10000975 3300025913 Bacteria 50860
406 Ga0207695_10001809 3300025913 Bacteria 33712
407 Ga0207695_10006439 3300025913 Bacteria 15246
408 Ga0207695_10038190 3300025913 Bacteria 5173
409 Ga0207695_10046997 3300025913 Bacteria 4572
410 Ga0207695_10065507 3300025913 Bacteria 3736
411 Ga0207695_10176256 3300025913 Bacteria 2060
412 Ga0207671_10000059 3300025914 Bacteria 179761
413 Ga0207671_10000116 3300025914 Bacteria 122775
414 Ga0207693_10080089 3300025915 Bacteria 2557
415 Ga0207660_10004613 3300025917 Bacteria 8979
416 Ga0207660_10005110 3300025917 Bacteria 8543
417 Ga0207660_10005371 3300025917 Bacteria 8319
418 Ga0207660_10021239 3300025917 Bacteria 4365
419 Ga0207660_10030404 3300025917 Bacteria 3712
420 Ga0207657_10003793 3300025919 Bacteria 16074
421 Ga0207657_10006186 3300025919 Bacteria 12444
422 Ga0207657_10082329 3300025919 Bacteria 2702
423 Ga0207649_10009210 3300025920 Bacteria 5398
424 Ga0207649_10028400 3300025920 Bacteria 3293
425 Ga0207649_10198315 3300025920 Bacteria 1416
426 Ga0207649_10212141 3300025920 Bacteria 1374
427 Ga0207652_10000030 3300025921 Bacteria 144884
428 Ga0207652_10000719 3300025921 Bacteria 32081
429 Ga0207652_10000940 3300025921 Bacteria 27407
430 Ga0207652_10001717 3300025921 Bacteria 19113
431 Ga0207652_10012038 3300025921 Bacteria 6982
432 Ga0207652_10012507 3300025921 Bacteria 6858
433 Ga0207652_10036615 3300025921 Bacteria 4148
434 Ga0207652_10067572 3300025921 Bacteria 3100
435 Ga0207681_10165378 3300025923 Bacteria 1672
436 Ga0207694_10000916 3300025924 Bacteria 26125
437 Ga0207694_10038513 3300025924 Bacteria 3675
438 Ga0207694_10047570 3300025924 Bacteria 3318
439 Ga0207650_10038734 3300025925 Bacteria 3483
440 Ga0207687_10086432 3300025927 Bacteria 2277
441 Ga0207687_10099429 3300025927 Bacteria 2137
442 Ga0207700_10015898 3300025928 Bacteria 4981
443 Ga0207664_10000109 3300025929 Bacteria 72701
444 Ga0207664_10157055 3300025929 Bacteria 1937
445 Ga0207644_10076861 3300025931 Bacteria 2457
446 Ga0207644_10118698 3300025931 Bacteria 2010
447 Ga0207690_10000729 3300025932 Bacteria 21207
448 Ga0207690_10000799 3300025932 Bacteria 20248
449 Ga0207690_10006154 3300025932 Bacteria 7109
450 Ga0207690_10006729 3300025932 Bacteria 6811
451 Ga0207690_10015212 3300025932 Bacteria 4659
452 Ga0207690_10024146 3300025932 Bacteria 3804
453 Ga0207690_10030630 3300025932 Bacteria 3434
454 Ga0207706_10012181 3300025933 Bacteria 7836
455 Ga0207706_10041980 3300025933 Bacteria 4053
456 Ga0207706_10163310 3300025933 Bacteria 1958
457 Ga0207686_10202431 3300025934 Bacteria 1423
458 Ga0207709_10003679 3300025935 Bacteria 9025
459 Ga0207670_10006074 3300025936 Bacteria 6673
460 Ga0207691_10025713 3300025940 Bacteria 5525
461 Ga0207689_10024604 3300025942 Bacteria 5050
462 Ga0207661_10001956 3300025944 Bacteria 14166
463 Ga0207679_10009626 3300025945 Bacteria 6192
464 Ga0207667_10000031 3300025949 Bacteria 323587
465 Ga0207667_10000383 3300025949 Bacteria 59865
466 Ga0207667_10000679 3300025949 Bacteria 44080
467 Ga0207667_10018339 3300025949 Bacteria 7851
468 Ga0207667_10022064 3300025949 Bacteria 7044
469 Ga0207667_10030354 3300025949 Bacteria 5849
470 Ga0207667_10039557 3300025949 Bacteria 5025
471 Ga0207667_10041288 3300025949 Bacteria 4907
472 Ga0207667_10048410 3300025949 Bacteria 4495
473 Ga0207667_10058956 3300025949 Bacteria 4024
474 Ga0207667_10079388 3300025949 Bacteria 3401
475 Ga0207651_10085653 3300025960 Bacteria 2287
476 Ga0207651_10223351 3300025960 Bacteria 1524
477 Ga0207712_10266890 3300025961 Bacteria 1390
478 Ga0207640_10000082 3300025981 Bacteria 74895
479 Ga0207640_10003658 3300025981 Bacteria 8294
480 Ga0207640_10020984 3300025981 Bacteria 3884
481 Ga0207640_10026972 3300025981 Bacteria 3495
482 Ga0207640_10029460 3300025981 Bacteria 3370
483 Ga0207640_10031357 3300025981 Bacteria 3283
484 Ga0207658_10001749 3300025986 Bacteria 16347
485 Ga0207658_10095315 3300025986 Bacteria 2318
486 Ga0207658_10124569 3300025986 Bacteria 2060
487 Ga0207677_10246370 3300026023 Bacteria 1449
488 Ga0207703_10002882 3300026035 Bacteria 14643
489 Ga0207639_10000174 3300026041 Bacteria 50069
490 Ga0207639_10000513 3300026041 Bacteria 26781
491 Ga0207639_10002691 3300026041 Bacteria 11928
492 Ga0207639_10012806 3300026041 Bacteria 5853
493 Ga0207639_10044758 3300026041 Bacteria 3330
494 Ga0207639_10048492 3300026041 Bacteria 3215
495 Ga0207639_10053524 3300026041 Bacteria 3080
496 Ga0207678_10002717 3300026067 Bacteria 16042
497 Ga0207678_10025836 3300026067 Bacteria 5125
498 Ga0207678_10030603 3300026067 Bacteria 4699
499 Ga0207678_10065984 3300026067 Bacteria 3108
500 Ga0207678_10094868 3300026067 Bacteria 2549
501 Ga0207702_10004220 3300026078 Bacteria 12835
502 Ga0207702_10007120 3300026078 Bacteria 9571
503 Ga0207702_10012242 3300026078 Bacteria 7139
504 Ga0207702_10048806 3300026078 Bacteria 3571
505 Ga0207702_10060640 3300026078 Bacteria 3225
506 Ga0207702_10083218 3300026078 Bacteria 2784
507 Ga0207702_10237690 3300026078 Bacteria 1705
508 Ga0207702_10407001 3300026078 Bacteria 1313
509 Ga0207641_10045696 3300026088 Bacteria 3689
510 Ga0207641_10047189 3300026088 Bacteria 3631
511 Ga0207676_10036177 3300026095 Bacteria 3754
512 Ga0207676_10185251 3300026095 Bacteria 1826
513 Ga0207674_10000189 3300026116 Bacteria 75437
514 Ga0207674_10004902 3300026116 Bacteria 16014
515 Ga0207674_10008708 3300026116 Bacteria 11679
516 Ga0207674_10030156 3300026116 Bacteria 5705
517 Ga0207683_10026765 3300026121 Bacteria 4981
518 Ga0207683_10104416 3300026121 Bacteria 2532
519 Ga0207683_10149374 3300026121 Bacteria 2108
520 Ga0207698_10002583 3300026142 Bacteria 10759
521 Ga0207698_10003400 3300026142 Bacteria 9579
522 Ga0207698_10007313 3300026142 Bacteria 6921
523 Ga0207698_10161485 3300026142 Bacteria 1960
524 Ga0207698_10268212 3300026142 Bacteria 1572
525 Ga0209371_1000360 3300027312 Bacteria 49198
526 Ga0209371_1016094 3300027312 Bacteria 1985
527 Ga0209996_1007749 3300027395 Bacteria 1401
528 Ga0209999_1014480 3300027543 Bacteria 1433
529 Ga0210002_1005269 3300027617 Bacteria 1941
530 Ga0209983_1002344 3300027665 Bacteria 4154
531 Ga0209971_1000373 3300027682 Bacteria 12252
532 Ga0209813_10008860 3300027866 Bacteria 2553
533 Ga0209974_10006082 3300027876 Bacteria 4225
534 Ga0207428_10006431 3300027907 Bacteria 10850
535 Ga0207428_10094872 3300027907 Bacteria 2312
536 Ga0207428_10129356 3300027907 Bacteria 1933
537 Ga0207428_10149017 3300027907 Bacteria 1782
538 Ga0207428_10324860 3300027907 Bacteria 1136
539 Ga0268266_10000004 3300028379 Bacteria 1495817
540 Ga0268266_10002024 3300028379 Bacteria 22580
541 Ga0268266_10023735 3300028379 Bacteria 5220
542 Ga0268266_10048144 3300028379 Bacteria 3653
543 Ga0268265_10468153 3300028380 Bacteria 1181
544 Ga0268264_10020403 3300028381 Bacteria 5416
545 Ga0268264_10072956 3300028381 Bacteria 2911
546 Ga0265334_10000079 3300028573 Bacteria 69969
547 Ga0307517_10001511 3300028786 Bacteria 38826
548 Ga0307517_10141289 3300028786 Bacteria 1689
549 Ga0307515_10002191 3300028794 Bacteria 42879
550 Ga0307515_10086241 3300028794 Bacteria 4005
551 Ga0307515_10166542 3300028794 Bacteria 2218
552 Ga0265338_10019938 3300028800 Bacteria 7080
553 Ga0268256_1000306 3300030500 Bacteria 49198
554 Ga0268256_1017881 3300030500 Bacteria 1985
555 Ga0307511_10027469 3300030521 Bacteria 5199
556 Ga0265332_10000020 3300031238 Bacteria 219119
557 Ga0265328_10002748 3300031239 Bacteria 7869
558 Ga0265340_10009410 3300031247 Bacteria 5246
559 Ga0265331_10009690 3300031250 Bacteria 5388
560 Ga0265331_10019841 3300031250 Bacteria 3463
561 Ga0265327_10000696 3300031251 Bacteria 53491
562 Ga0307513_10037752 3300031456 Bacteria 5372
563 Ga0307513_10075865 3300031456 Bacteria 3489
564 Ga0307513_10241173 3300031456 Bacteria 1612
565 Ga0307509_10003552 3300031507 Bacteria 23484
566 Ga0307509_10030410 3300031507 Bacteria 5974
567 Ga0307509_10063399 3300031507 Bacteria 3891
568 Ga0307509_10196672 3300031507 Bacteria 1859
569 Ga0307509_10335217 3300031507 Bacteria 1242
570 Ga0307408_100000004 3300031548 Bacteria 572889
571 Ga0307408_100129550 3300031548 Bacteria 1966
572 Ga0316575_10081722 3300031665 Bacteria 1303
573 Ga0316579_10024667 3300031691 Bacteria 2709
574 Ga0265314_10001065 3300031711 Bacteria 31865
575 Ga0265342_10192614 3300031712 Bacteria 1112
576 Ga0316576_10018808 3300031727 Bacteria 4724
577 Ga0316576_10029083 3300031727 Bacteria 3901
578 Ga0316576_10070050 3300031727 Bacteria 2587
579 Ga0307516_10000278 3300031730 Bacteria 66314
580 Ga0307516_10000326 3300031730 Bacteria 61941
581 Ga0316577_10024003 3300031733 Bacteria 3387
582 Ga0307413_10188417 3300031824 Bacteria 1479
583 Ga0307407_10132664 3300031903 Bacteria 1596
584 Ga0307412_10000689 3300031911 Bacteria 19524
585 Ga0307412_10003342 3300031911 Bacteria 8911
586 Ga0307409_100253384 3300031995 Bacteria 1611
587 Ga0307414_10098828 3300032004 Bacteria 2191
588 Ga0316585_10005266 3300032137 Bacteria 3647
589 Ga0307507_10021035 3300033179 Bacteria 7282
590 Ga0307510_10006365 3300033180 Bacteria 14082
591 Ga0307510_10024655 3300033180 Bacteria 6947
592 Ga0307510_10056428 3300033180 Bacteria 4090
593 Ga0307510_10068525 3300033180 Bacteria 3559
594 Ga0307510_10190831 3300033180 Bacteria 1597
595 Ga0373926_0089621 3300035083 Bacteria 1143
596 Ga0373943_0108649 3300035170 Bacteria 1460
597 Ga0373943_0176947 3300035170 Bacteria 1171
598 Ga0316574_0016143 3300035398 Bacteria 4345
599 Ga0316574_0027646 3300035398 Bacteria 3417
600 Ga0373931_0014186 3300035691 Bacteria 3891
601 Ga0373935_0013173 3300035692 Bacteria 4985
602 Ga0373927_0018005 3300035695 Bacteria 4646
603 Ga0373927_0038788 3300035695 Bacteria 3092
604 Ga0373947_0175139 3300035725 Bacteria 1394
605 Ga0373937_0089511 3300036401 Bacteria 2850
606 Ga0316582_0034258 3300036647 Bacteria 3126
607 Ga0316584_0003999 3300036712 Bacteria 9698
608 Ga0316584_0053751 3300036712 Bacteria 3014
609 Ga0373925_0013961 3300037068 Bacteria 5814
610 Ga0373925_0050073 3300037068 Bacteria 3115
611 Ga0373925_0128567 3300037068 Bacteria 1973
612 Ga0373925_0196156 3300037068 Bacteria 1604
613 Ga0395899_0000460 3300037312 Bacteria 46114
614 Ga0395899_0046545 3300037312 Bacteria 3231
615 Ga0395899_0232892 3300037312 Bacteria 1271
616 Ga0395900_0000061 3300037418 Bacteria 202483
617 Ga0395900_0021982 3300037418 Bacteria 6522
618 Ga0395900_0130114 3300037418 Bacteria 2580
619 Ga0395900_0190954 3300037418 Bacteria 2077
620 Ga0395900_0381377 3300037418 Bacteria 1377
621 Ga0395898_0000034 3300037466 Bacteria 356745
622 Ga0395898_0000363 3300037466 Bacteria 99698
623 Ga0395898_0043661 3300037466 Bacteria 4416
624 Ga0395898_0177291 3300037466 Bacteria 2037
625 Ga0395898_0246903 3300037466 Bacteria 1702
626 Ga0395898_0250918 3300037466 Bacteria 1687
627 Ga0395898_0253926 3300037466 Bacteria 1676
628 Ga0395905_0000043 3300037471 Bacteria 247469
629 Ga0395905_0124487 3300037471 Bacteria 2424
630 Ga0395901_0001799 3300038443 Bacteria 22129
631 Ga0395901_0021740 3300038443 Bacteria 6573
632 Ga0395901_0093046 3300038443 Bacteria 3156
633 Ga0395901_0196744 3300038443 Bacteria 2113
634 Ga0395901_0218068 3300038443 Bacteria 1994
635 Ga0436360_0096801 3300039438 Bacteria 5865
636 Ga0436360_1280455 3300039438 Bacteria 1609
637 Ga0436363_0125963 3300039450 Bacteria 1700
638 Ga0439436_0000119 3300041404 Bacteria 18290
639 Ga0439436_0002294 3300041404 Bacteria 5733
640 Ga0439438_002420 3300041405 Bacteria 7946
641 Ga0439438_002578 3300041405 Bacteria 7679
642 Ga0439438_007706 3300041405 Bacteria 3648
643 Ga0439438_007817 3300041405 Bacteria 3611
644 Ga0439438_010145 3300041405 Bacteria 2998
645 Ga0439438_021235 3300041405 Bacteria 1813
646 Ga0439438_032534 3300041405 Bacteria 1382
647 Ga0439447_002139 3300041407 Bacteria 7243
648 Ga0439447_004018 3300041407 Bacteria 5144
649 Ga0439447_005552 3300041407 Bacteria 4177
650 Ga0439447_028981 3300041407 Bacteria 1404
651 Ga0439466_0003242 3300041411 Bacteria 6338
652 Ga0439466_0005337 3300041411 Bacteria 4914
653 Ga0439466_0006628 3300041411 Bacteria 4397
654 Ga0439466_0015997 3300041411 Bacteria 2717
655 Ga0439466_0025261 3300041411 Bacteria 2074
656 Ga0439466_0030704 3300041411 Bacteria 1841
657 Ga0451797_0854670 3300041453 Bacteria 1286
658 Ga0451802_1080082 3300041460 Bacteria 2127
659 Ga0451807_0480466 3300041486 Bacteria 1771
660 Ga0451853_0608741 3300041512 Bacteria 2273
661 Ga0439432_007489 3300042006 Bacteria 3868
662 Ga0439451_001585 3300042009 Bacteria 4497
663 Ga0439451_006191 3300042009 Bacteria 2447
664 Ga0439452_004333 3300042010 Bacteria 4786
665 Ga0439452_005352 3300042010 Bacteria 4135
666 Ga0439452_005534 3300042010 Bacteria 4056
667 Ga0439452_007705 3300042010 Bacteria 3282
668 Ga0439452_008951 3300042010 Bacteria 2981
669 Ga0439452_029851 3300042010 Bacteria 1349
670 Ga0439456_010280 3300042013 Bacteria 1933
671 Ga0439456_013745 3300042013 Bacteria 1686
672 Ga0439463_004331 3300042016 Bacteria 3556
673 Ga0439463_038252 3300042016 Bacteria 1217
674 Ga0450911_004131 3300042115 Bacteria 2424
675 Ga0450920_002485 3300042122 Bacteria 3140
676 Ga0450922_000519 3300042124 Bacteria 4090
677 Ga0450923_010172 3300042125 Bacteria 1662
678 Ga0450890_002488 3300042127 Bacteria 2531
679 Ga0450902_002746 3300042137 Bacteria 2513
680 Ga0450902_005667 3300042137 Bacteria 1896
681 Ga0450903_002871 3300042138 Bacteria 3013
682 Ga0450903_004407 3300042138 Bacteria 2401
683 Ga0450905_002981 3300042142 Bacteria 2210
684 Ga0450889_003532 3300042144 Bacteria 1544
685 Ga0450906_003928 3300042145 Bacteria 3149
686 Ga0450907_002892 3300042146 Bacteria 3166
687 Ga0450907_002985 3300042146 Bacteria 3095
688 Ga0450910_001185 3300042147 Bacteria 3240
689 Ga0439446_0002197 3300042156 Bacteria 4648
690 Ga0439446_0008400 3300042156 Bacteria 2740
691 Ga0450908_002805 3300042184 Bacteria 3387
692 Ga0439434_0024141 3300042435 Bacteria 1833
693 Ga0439459_0000759 3300042438 Bacteria 4437
694 Ga0439464_0020409 3300042439 Bacteria 1814
695 Ga0439460_0009588 3300042461 Bacteria 2459
696 Ga0450893_0011278 3300042532 Bacteria 1476
697 Ga0450893_0016029 3300042532 Bacteria 1266
698 Ga0451577_0012480 3300042876 Bacteria 7975
699 Ga0451577_0027697 3300042876 Bacteria 5129
700 Ga0451577_0153792 3300042876 Bacteria 2070
701 Ga0439440_0002625 3300042993 Bacteria 3406
702 Ga0439440_0016632 3300042993 Bacteria 1613
703 Ga0466969_0000848 3300044656 Bacteria 16567
704 Ga0466969_0077671 3300044656 Bacteria 1588
705 Ga0466972_0013529 3300044658 Bacteria 4097
706 Ga0466972_0173522 3300044658 Bacteria 1011
707 Ga0466982_0000010 3300044672 Bacteria 188341
708 Ga0466982_0000092 3300044672 Bacteria 21991
709 Ga0466965_0033053 3300044683 Bacteria 2527
710 Ga0466965_0074136 3300044683 Bacteria 1714
711 Ga0466965_0091699 3300044683 Bacteria 1546
712 Ga0466966_0000831 3300044684 Bacteria 19700
713 Ga0466966_0002865 3300044684 Bacteria 11351
714 Ga0466966_0033650 3300044684 Bacteria 3317
715 Ga0466961_0004818 3300044693 Bacteria 8489
716 Ga0466961_0006853 3300044693 Bacteria 7247
717 Ga0466961_0019935 3300044693 Bacteria 4316
718 Ga0466961_0020014 3300044693 Bacteria 4305
719 Ga0466961_0038475 3300044693 Bacteria 3068
720 Ga0466964_0000149 3300044706 Bacteria 18838
721 Ga0466964_0012755 3300044706 Bacteria 3182
722 Ga0466964_0154312 3300044706 Bacteria 1067
723 Ga0453684_0000298 3300044712 Bacteria 209777
724 Ga0453684_0107105 3300044712 Bacteria 3405
725 Ga0453684_0492301 3300044712 Bacteria 1359
726 Ga0466971_0000098 3300044719 Bacteria 31871
727 Ga0466971_0004686 3300044719 Bacteria 5911
728 Ga0466971_0005715 3300044719 Bacteria 5407
729 Ga0466971_0079721 3300044719 Bacteria 1492
730 Ga0466968_0002781 3300044735 Bacteria 6465
731 Ga0466970_0023490 3300044765 Bacteria 3220
732 Ga0466970_0025303 3300044765 Bacteria 3107
733 Ga0466957_0050559 3300044842 Bacteria 2529
734 Ga0466957_0094566 3300044842 Bacteria 1877
735 Ga0466957_0112179 3300044842 Bacteria 1730
736 Ga0466957_0118560 3300044842 Bacteria 1685
737 Ga0466960_0005398 3300044901 Bacteria 5062
738 Ga0466959_0001544 3300045049 Bacteria 14164
739 Ga0466959_0002272 3300045049 Bacteria 12250
740 Ga0466959_0010715 3300045049 Bacteria 6565
741 Ga0466959_0016043 3300045049 Bacteria 5467
742 Ga0466959_0032733 3300045049 Bacteria 3848
743 Ga0466959_0035688 3300045049 Bacteria 3675
744 Ga0451576_0000033 3300045051 Bacteria 393131
745 Ga0466958_0019881 3300045836 Bacteria 3912
746 Ga0466958_0145291 3300045836 Bacteria 1494
747 Ga0495617_000236 3300046452 Bacteria 33306
748 Ga0495617_001020 3300046452 Bacteria 12892
749 Ga0495617_011643 3300046452 Bacteria 2999
750 Ga0495617_012097 3300046452 Bacteria 2942
751 Ga0495617_019326 3300046452 Bacteria 2303
752 Ga0495617_024212 3300046452 Bacteria 2048
753 Ga0495627_004072 3300046453 Bacteria 6223
754 Ga0495627_013476 3300046453 Bacteria 2874
755 Ga0495627_013799 3300046453 Bacteria 2837
756 Ga0495627_015586 3300046453 Bacteria 2620
757 Ga0495627_027340 3300046453 Bacteria 1831
758 Ga0495627_047697 3300046453 Bacteria 1298
759 Ga0495592_0090282 3300046454 Bacteria 2198
760 Ga0495603_0044887 3300046455 Bacteria 2637
761 Ga0495590_0008530 3300046457 Bacteria 3912
762 Ga0495590_0012865 3300046457 Bacteria 3089
763 Ga0495590_0029983 3300046457 Bacteria 1906
764 Ga0495590_0040385 3300046457 Bacteria 1627
765 Ga0495590_0066642 3300046457 Bacteria 1261
766 Ga0495591_003604 3300046458 Bacteria 7893
767 Ga0495591_003793 3300046458 Bacteria 7641
768 Ga0495591_006286 3300046458 Bacteria 5285
769 Ga0495591_013413 3300046458 Bacteria 2998
770 Ga0495591_013948 3300046458 Bacteria 2911
771 Ga0495591_014946 3300046458 Bacteria 2762
772 Ga0495591_020806 3300046458 Bacteria 2157
773 Ga0495591_021381 3300046458 Bacteria 2112
774 Ga0495591_024787 3300046458 Bacteria 1893
775 Ga0495591_025008 3300046458 Bacteria 1880
776 Ga0495591_050382 3300046458 Bacteria 1140
777 Ga0495638_0000069 3300046460 Bacteria 167503
778 Ga0495638_0000166 3300046460 Bacteria 102926
779 Ga0495638_0000515 3300046460 Bacteria 45367
780 Ga0495638_0011829 3300046460 Bacteria 6004
781 Ga0495638_0021123 3300046460 Bacteria 4294
782 Ga0495638_0024878 3300046460 Bacteria 3897
783 Ga0495638_0028642 3300046460 Bacteria 3594
784 Ga0495638_0046425 3300046460 Bacteria 2728
785 Ga0495638_0079636 3300046460 Bacteria 1991
786 Ga0495638_0091939 3300046460 Bacteria 1826
787 Ga0495638_0114237 3300046460 Bacteria 1601
788 Ga0495653_0033007 3300046463 Bacteria 4105
789 Ga0495653_0035949 3300046463 Bacteria 3906
790 Ga0495653_0098453 3300046463 Bacteria 2123
791 Ga0495650_0000220 3300046471 Bacteria 119197
792 Ga0495650_0000247 3300046471 Bacteria 106616
793 Ga0495650_0013132 3300046471 Bacteria 4401
794 Ga0495650_0033867 3300046471 Bacteria 2267
795 Ga0495650_0039949 3300046471 Bacteria 2019
796 Ga0495650_0042917 3300046471 Bacteria 1923
797 Ga0495650_0052242 3300046471 Bacteria 1678
798 Ga0495580_0099599 3300046472 Bacteria 2022
799 Ga0495582_0020000 3300046473 Bacteria 3661
800 Ga0495605_0021892 3300046474 Bacteria 3380
801 Ga0495605_0041782 3300046474 Bacteria 2282
802 Ga0495605_0065114 3300046474 Bacteria 1734
803 Ga0495605_0092230 3300046474 Bacteria 1402
804 Ga0495584_0005401 3300046491 Bacteria 6768
805 Ga0495584_0011769 3300046491 Bacteria 4473
806 Ga0495584_0018741 3300046491 Bacteria 3518
807 Ga0495584_0022127 3300046491 Bacteria 3226
808 Ga0495584_0022859 3300046491 Bacteria 3172
809 Ga0495584_0049885 3300046491 Bacteria 2108
810 Ga0495585_0023142 3300046492 Bacteria 3565
811 Ga0495585_0029247 3300046492 Bacteria 3137
812 Ga0495585_0031124 3300046492 Bacteria 3032
813 Ga0495585_0094121 3300046492 Bacteria 1610
814 Ga0495585_0096876 3300046492 Bacteria 1582
815 Ga0495596_0009034 3300046500 Bacteria 4406
816 Ga0495596_0022976 3300046500 Bacteria 2534
817 Ga0495596_0058189 3300046500 Bacteria 1507
818 Ga0495607_0000027 3300046501 Bacteria 155694
819 Ga0495607_0000059 3300046501 Bacteria 109443
820 Ga0495607_0000128 3300046501 Bacteria 80585
821 Ga0495607_0028798 3300046501 Bacteria 3422
822 Ga0495607_0032232 3300046501 Bacteria 3201
823 Ga0495607_0032825 3300046501 Bacteria 3164
824 Ga0495607_0035935 3300046501 Bacteria 2991
825 Ga0495607_0036500 3300046501 Bacteria 2960
826 Ga0495607_0057221 3300046501 Bacteria 2235
827 Ga0495607_0061394 3300046501 Bacteria 2136
828 Ga0495607_0063267 3300046501 Bacteria 2094
829 Ga0495607_0098957 3300046501 Bacteria 1565
830 Ga0495583_0021660 3300046506 Bacteria 3301
831 Ga0495583_0033167 3300046506 Bacteria 2484
832 Ga0495583_0121143 3300046506 Bacteria 1101
833 Ga0495606_0000050 3300046507 Bacteria 203375
834 Ga0495606_0001020 3300046507 Bacteria 40589
835 Ga0495606_0002002 3300046507 Bacteria 25095
836 Ga0495606_0003327 3300046507 Bacteria 17163
837 Ga0495606_0028377 3300046507 Bacteria 3948
838 Ga0495606_0044821 3300046507 Bacteria 2939
839 Ga0495606_0047938 3300046507 Bacteria 2814
840 Ga0495606_0048592 3300046507 Bacteria 2789
841 Ga0495606_0071466 3300046507 Bacteria 2184
842 Ga0495610_0007382 3300046512 Bacteria 7334
843 Ga0495610_0017561 3300046512 Bacteria 4076
844 Ga0495610_0038819 3300046512 Bacteria 2413
845 Ga0495610_0044999 3300046512 Bacteria 2186
846 Ga0495610_0057942 3300046512 Bacteria 1855
847 Ga0495610_0074611 3300046512 Bacteria 1573
848 Ga0495616_0000023 3300046513 Bacteria 147717
849 Ga0495616_0014329 3300046513 Bacteria 4440
850 Ga0495616_0033475 3300046513 Bacteria 2677
851 Ga0495616_0043813 3300046513 Bacteria 2271
852 Ga0495616_0050794 3300046513 Bacteria 2071
853 Ga0495616_0053458 3300046513 Bacteria 2006
854 Ga0495616_0082991 3300046513 Bacteria 1529
855 Ga0495620_0000140 3300046515 Bacteria 59199
856 Ga0495620_0004721 3300046515 Bacteria 7659
857 Ga0495620_0011521 3300046515 Bacteria 4611
858 Ga0495620_0020346 3300046515 Bacteria 3242
859 Ga0495620_0051245 3300046515 Bacteria 1757
860 Ga0495620_0072707 3300046515 Bacteria 1403
861 Ga0495630_0039302 3300046517 Bacteria 3538
862 Ga0495630_0047459 3300046517 Bacteria 3212
863 Ga0495631_0000044 3300046518 Bacteria 76306
864 Ga0495631_0015022 3300046518 Bacteria 3721
865 Ga0495631_0021708 3300046518 Bacteria 2988
866 Ga0495632_0000167 3300046519 Bacteria 68027
867 Ga0495632_0015410 3300046519 Bacteria 4287
868 Ga0495632_0018801 3300046519 Bacteria 3781
869 Ga0495632_0019682 3300046519 Bacteria 3672
870 Ga0495632_0033224 3300046519 Bacteria 2651
871 Ga0495632_0033723 3300046519 Bacteria 2626
872 Ga0495632_0040171 3300046519 Bacteria 2357
873 Ga0495632_0040930 3300046519 Bacteria 2330
874 Ga0495632_0046005 3300046519 Bacteria 2170
875 Ga0495632_0046114 3300046519 Bacteria 2167
876 Ga0495632_0061363 3300046519 Bacteria 1825
877 Ga0495632_0066688 3300046519 Bacteria 1736
878 Ga0495632_0126128 3300046519 Bacteria 1193
879 Ga0495632_0157485 3300046519 Bacteria 1047
880 Ga0495637_0004170 3300046520 Bacteria 7518
881 Ga0495637_0011029 3300046520 Bacteria 4352
882 Ga0495637_0011979 3300046520 Bacteria 4157
883 Ga0495637_0013660 3300046520 Bacteria 3849
884 Ga0495637_0014425 3300046520 Bacteria 3729
885 Ga0495637_0021374 3300046520 Bacteria 2968
886 Ga0495637_0025266 3300046520 Bacteria 2677
887 Ga0495637_0032622 3300046520 Bacteria 2293
888 Ga0495637_0035701 3300046520 Bacteria 2169
889 Ga0495637_0037500 3300046520 Bacteria 2104
890 Ga0495643_0001804 3300046522 Bacteria 18335
891 Ga0495643_0019647 3300046522 Bacteria 3904
892 Ga0495643_0044027 3300046522 Bacteria 2426
893 Ga0495643_0050974 3300046522 Bacteria 2227
894 Ga0495643_0079816 3300046522 Bacteria 1705
895 Ga0495643_0101232 3300046522 Bacteria 1476
896 Ga0495643_0137307 3300046522 Bacteria 1222
897 Ga0495643_0199731 3300046522 Bacteria 960
898 Ga0495644_0010877 3300046523 Bacteria 3506
899 Ga0495644_0013921 3300046523 Bacteria 3083
900 Ga0495644_0014265 3300046523 Bacteria 3044
901 Ga0495644_0041810 3300046523 Bacteria 1726
902 Ga0495644_0075970 3300046523 Bacteria 1265
903 Ga0495648_0004277 3300046524 Bacteria 12247
904 Ga0495648_0008878 3300046524 Bacteria 7855
905 Ga0495648_0021620 3300046524 Bacteria 4452
906 Ga0495648_0022426 3300046524 Bacteria 4346
907 Ga0495648_0023263 3300046524 Bacteria 4248
908 Ga0495648_0026425 3300046524 Bacteria 3908
909 Ga0495648_0039691 3300046524 Bacteria 2992
910 Ga0495648_0059928 3300046524 Bacteria 2267
911 Ga0495648_0074547 3300046524 Bacteria 1954
912 Ga0495648_0095876 3300046524 Bacteria 1649
913 Ga0495648_0120087 3300046524 Bacteria 1414
914 Ga0495666_0015825 3300046526 Bacteria 3758
915 Ga0495666_0049024 3300046526 Bacteria 2032
916 Ga0495642_0006475 3300046528 Bacteria 4493
917 Ga0495642_0006609 3300046528 Bacteria 4452
918 Ga0495654_0008855 3300046530 Bacteria 5533
919 Ga0495654_0022578 3300046530 Bacteria 3265
920 Ga0495654_0023731 3300046530 Bacteria 3174
921 Ga0495654_0028107 3300046530 Bacteria 2877
922 Ga0495654_0028517 3300046530 Bacteria 2854
923 Ga0495654_0030659 3300046530 Bacteria 2735
924 Ga0495654_0036152 3300046530 Bacteria 2483
925 Ga0495654_0054535 3300046530 Bacteria 1939
926 Ga0495654_0065299 3300046530 Bacteria 1737
927 Ga0495654_0074531 3300046530 Bacteria 1602
928 Ga0495586_0033613 3300046535 Bacteria 2753
929 Ga0495587_0028417 3300046536 Bacteria 3400
930 Ga0495609_0007421 3300046538 Bacteria 5479
931 Ga0495609_0014474 3300046538 Bacteria 3706
932 Ga0495609_0021500 3300046538 Bacteria 2976
933 Ga0495609_0029510 3300046538 Bacteria 2497
934 Ga0495609_0043685 3300046538 Bacteria 2012
935 Ga0495609_0076862 3300046538 Bacteria 1462
936 Ga0495609_0082241 3300046538 Bacteria 1407
937 Ga0495597_0017913 3300046542 Bacteria 3326
938 Ga0495597_0020203 3300046542 Bacteria 3105
939 Ga0495597_0020987 3300046542 Bacteria 3037
940 Ga0495597_0023622 3300046542 Bacteria 2843
941 Ga0495597_0035208 3300046542 Bacteria 2259
942 Ga0495597_0037866 3300046542 Bacteria 2164
943 Ga0495597_0108821 3300046542 Bacteria 1163
944 Ga0495622_0013197 3300046557 Bacteria 3834
945 Ga0495622_0037545 3300046557 Bacteria 2256
946 Ga0495622_0044352 3300046557 Bacteria 2067
947 Ga0495622_0093133 3300046557 Bacteria 1383
948 Ga0495622_0157385 3300046557 Bacteria 1026
949 Ga0495633_0024867 3300046558 Bacteria 2955
950 Ga0495633_0028265 3300046558 Bacteria 2735
951 Ga0495656_0109547 3300046615 Bacteria 1289
952 Ga0495656_0136374 3300046615 Bacteria 1172
953 Ga0495668_0016218 3300046616 Bacteria 4332
954 Ga0495668_0017287 3300046616 Bacteria 4184
955 Ga0495668_0021753 3300046616 Bacteria 3671
956 Ga0495668_0035260 3300046616 Bacteria 2804
957 Ga0495634_0058599 3300046642 Bacteria 2566
958 Ga0495611_0000001 3300046648 Bacteria 2628469
959 Ga0495611_0002914 3300046648 Bacteria 7634
960 Ga0495611_0005183 3300046648 Bacteria 5587
961 Ga0495611_0041581 3300046648 Bacteria 2050
962 Ga0495625_0000001 3300046660 Bacteria 1641829
963 Ga0495625_0028142 3300046660 Bacteria 4219
964 Ga0495625_0028453 3300046660 Bacteria 4191
965 Ga0495625_0031772 3300046660 Bacteria 3923
966 Ga0495625_0032112 3300046660 Bacteria 3898
967 Ga0495625_0054479 3300046660 Bacteria 2856
968 Ga0495625_0058240 3300046660 Bacteria 2745
969 Ga0495625_0070443 3300046660 Bacteria 2455
970 Ga0495625_0081167 3300046660 Bacteria 2257
971 Ga0495625_0094130 3300046660 Bacteria 2067
972 Ga0495625_0141094 3300046660 Bacteria 1625
973 Ga0495661_0038418 3300046665 Bacteria 2982
974 Ga0495661_0045989 3300046665 Bacteria 2666
975 Ga0495661_0064726 3300046665 Bacteria 2156
976 Ga0495661_0111571 3300046665 Bacteria 1523
977 Ga0495661_0134287 3300046665 Bacteria 1352
978 Ga0495588_0016749 3300046674 Bacteria 3545
979 Ga0495623_0029618 3300046679 Bacteria 3522
980 Ga0495646_0024984 3300046680 Bacteria 3759
981 Ga0495646_0043494 3300046680 Bacteria 2749
982 Ga0495658_0213284 3300046683 Bacteria 1207
983 Ga0495669_0018938 3300046684 Bacteria 2966
984 Ga0495669_0025216 3300046684 Bacteria 2592
985 Ga0495613_0034417 3300046689 Bacteria 3762
986 Ga0495613_0034705 3300046689 Bacteria 3745
987 Ga0495613_0146897 3300046689 Bacteria 1683
988 Ga0495624_0013766 3300046690 Bacteria 5508
989 Ga0495624_0105519 3300046690 Bacteria 1734
990 Ga0495670_0004264 3300046691 Bacteria 7002
991 Ga0495670_0048501 3300046691 Bacteria 2124
992 Ga0495670_0057903 3300046691 Bacteria 1945
993 Ga0495670_0072758 3300046691 Bacteria 1742
994 Ga0495670_0110435 3300046691 Bacteria 1422
995 Ga0495671_0000356 3300046692 Bacteria 37988
996 Ga0495671_0005082 3300046692 Bacteria 7741
997 Ga0495671_0007153 3300046692 Bacteria 6387
998 Ga0495671_0008717 3300046692 Bacteria 5695
999 Ga0495671_0013007 3300046692 Bacteria 4525
1000 Ga0495671_0016937 3300046692 Bacteria 3884
1001 Ga0495671_0022315 3300046692 Bacteria 3318
1002 Ga0495671_0036069 3300046692 Bacteria 2507
1003 Ga0495671_0041422 3300046692 Bacteria 2318
1004 Ga0495671_0045621 3300046692 Bacteria 2193
1005 Ga0495671_0049137 3300046692 Bacteria 2103
1006 Ga0495671_0076323 3300046692 Bacteria 1643
1007 Ga0495671_0084446 3300046692 Bacteria 1555
1008 Ga0495649_0000374 3300046694 Bacteria 38763
1009 Ga0495649_0007770 3300046694 Bacteria 6505
1010 Ga0495649_0015054 3300046694 Bacteria 4413
1011 Ga0495649_0016082 3300046694 Bacteria 4246
1012 Ga0495649_0018507 3300046694 Bacteria 3918
1013 Ga0495649_0019615 3300046694 Bacteria 3798
1014 Ga0495649_0021897 3300046694 Bacteria 3579
1015 Ga0495649_0029383 3300046694 Bacteria 3040
1016 Ga0495649_0036562 3300046694 Bacteria 2697
1017 Ga0495649_0051912 3300046694 Bacteria 2223
1018 Ga0495649_0075076 3300046694 Bacteria 1811
1019 Ga0495649_0167808 3300046694 Bacteria 1149
1020 Ga0495589_0000106 3300046794 Bacteria 80663
1021 Ga0495589_0014632 3300046794 Bacteria 4037
1022 Ga0495589_0020877 3300046794 Bacteria 3347
1023 Ga0495589_0021144 3300046794 Bacteria 3325
1024 Ga0495589_0037492 3300046794 Bacteria 2429
1025 Ga0495600_0027554 3300046809 Bacteria 3672
1026 Ga0495600_0034830 3300046809 Bacteria 3269
1027 Ga0495660_0000463 3300046810 Bacteria 33620
1028 Ga0495660_0001296 3300046810 Bacteria 17304
1029 Ga0495660_0019532 3300046810 Bacteria 3890
1030 Ga0495660_0019657 3300046810 Bacteria 3876
1031 Ga0495660_0025516 3300046810 Bacteria 3356
1032 Ga0495660_0032782 3300046810 Bacteria 2917
1033 Ga0495660_0034051 3300046810 Bacteria 2852
1034 Ga0495660_0034631 3300046810 Bacteria 2824
1035 Ga0495660_0038992 3300046810 Bacteria 2639
1036 Ga0495660_0042046 3300046810 Bacteria 2526
1037 Ga0495660_0043827 3300046810 Bacteria 2464
1038 Ga0495660_0052334 3300046810 Bacteria 2218
1039 Ga0495660_0097038 3300046810 Bacteria 1522
1040 Ga0495604_0042967 3300047317 Bacteria 3540
1041 Ga0495604_0056090 3300047317 Bacteria 3034
1042 Ga0495604_0251813 3300047317 Bacteria 1203
1043 Ga0495672_0010021 3300047320 Bacteria 6793
1044 Ga0495672_0015676 3300047320 Bacteria 5135
1045 Ga0495672_0020723 3300047320 Bacteria 4302
1046 Ga0495672_0033436 3300047320 Bacteria 3185
1047 Ga0495672_0036921 3300047320 Bacteria 2995
1048 Ga0495672_0039519 3300047320 Bacteria 2868
1049 Ga0495672_0045840 3300047320 Bacteria 2612
1050 Ga0495672_0107950 3300047320 Bacteria 1498
1051 Ga0495676_0042776 3300047321 Bacteria 3714
1052 Ga0495676_0053319 3300047321 Bacteria 3223
1053 Ga0495680_0071529 3300047322 Bacteria 2640
1054 Ga0495680_0093236 3300047322 Bacteria 2254
1055 Ga0495680_0128005 3300047322 Bacteria 1868
1056 Ga0495683_0000911 3300047323 Bacteria 20874
1057 Ga0495683_0013728 3300047323 Bacteria 4231
1058 Ga0495683_0023481 3300047323 Bacteria 3170
1059 Ga0495683_0024543 3300047323 Bacteria 3093
1060 Ga0495683_0028794 3300047323 Bacteria 2839
1061 Ga0495683_0056938 3300047323 Bacteria 1943
1062 Ga0495683_0062428 3300047323 Bacteria 1843
1063 Ga0495687_083537 3300047443 Bacteria 1243
1064 Ga0495675_0005310 3300047444 Bacteria 7848
1065 Ga0495675_0117226 3300047444 Bacteria 1660
1066 Ga0495675_0168177 3300047444 Bacteria 1347
1067 Ga0495677_0007936 3300047445 Bacteria 3944
1068 Ga0495679_000029 3300047446 Bacteria 190883
1069 Ga0495679_014921 3300047446 Bacteria 2859
1070 Ga0495679_014957 3300047446 Bacteria 2853
1071 Ga0495679_016223 3300047446 Bacteria 2699
1072 Ga0495679_019397 3300047446 Bacteria 2390
1073 Ga0495679_023266 3300047446 Bacteria 2103
1074 Ga0495673_0000001 3300047469 Bacteria 1630730
1075 Ga0495673_0000018 3300047469 Bacteria 569190
1076 Ga0495673_0013515 3300047469 Bacteria 4283
1077 Ga0495673_0015221 3300047469 Bacteria 3970
1078 Ga0495673_0015748 3300047469 Bacteria 3887
1079 Ga0495673_0035623 3300047469 Bacteria 2291
1080 Ga0495673_0043197 3300047469 Bacteria 2019
1081 Ga0495673_0046433 3300047469 Bacteria 1925
1082 Ga0495681_0006351 3300047470 Bacteria 7779
1083 Ga0495681_0014717 3300047470 Bacteria 4468
1084 Ga0495681_0016372 3300047470 Bacteria 4158
1085 Ga0495681_0018009 3300047470 Bacteria 3906
1086 Ga0495681_0018155 3300047470 Bacteria 3883
1087 Ga0495681_0023160 3300047470 Bacteria 3305
1088 Ga0495681_0023334 3300047470 Bacteria 3289
1089 Ga0495681_0026424 3300047470 Bacteria 3021
1090 Ga0495681_0032349 3300047470 Bacteria 2634
1091 Ga0495681_0055976 3300047470 Bacteria 1837
1092 Ga0495681_0062428 3300047470 Bacteria 1713
1093 Ga0495681_0098831 3300047470 Bacteria 1278
1094 Ga0495684_0051416 3300047471 Bacteria 3145
1095 Ga0495686_0000043 3300047472 Bacteria 291565
1096 Ga0495686_0001964 3300047472 Bacteria 20422
1097 Ga0495686_0003614 3300047472 Bacteria 13266
1098 Ga0495686_0019136 3300047472 Bacteria 4579
1099 Ga0495686_0022905 3300047472 Bacteria 4127
1100 Ga0495686_0024099 3300047472 Bacteria 4001
1101 Ga0495686_0033680 3300047472 Bacteria 3305
1102 Ga0495686_0049719 3300047472 Bacteria 2636
1103 Ga0495686_0279229 3300047472 Bacteria 929
1104 Ga0495593_0025541 3300047673 Bacteria 3269
1105 Ga0495593_0033078 3300047673 Bacteria 2816
1106 Ga0495593_0036439 3300047673 Bacteria 2668
1107 Ga0495593_0060527 3300047673 Bacteria 1982
1108 Ga0495602_0076400 3300048088 Bacteria 2837
1109 Ga0495626_0004935 3300048091 Bacteria 8005
1110 Ga0495626_0008853 3300048091 Bacteria 5469
1111 Ga0495626_0013707 3300048091 Bacteria 4205
1112 Ga0495626_0016548 3300048091 Bacteria 3743
1113 Ga0495626_0019229 3300048091 Bacteria 3416
1114 Ga0495626_0028548 3300048091 Bacteria 2704
1115 Ga0495626_0041420 3300048091 Bacteria 2169
1116 Ga0495626_0044218 3300048091 Bacteria 2085
1117 Ga0495626_0123346 3300048091 Bacteria 1111
1118 Ga0496101_0020973 3300048904 Bacteria 4484
1119 Ga0496103_0126055 3300048906 Bacteria 1633
1120 Ga0496103_0178328 3300048906 Bacteria 1365
1121 Ga0496104_0000548 3300048907 Bacteria 32116
1122 Ga0496105_0012260 3300048908 Bacteria 6787
1123 Ga0496106_0105368 3300048909 Bacteria 2191
1124 Ga0496106_0293115 3300048909 Bacteria 1304
1125 Ga0496108_0068164 3300048911 Bacteria 3001
1126 Ga0496109_0427559 3300048912 Bacteria 1251
1127 Ga0496110_0000417 3300048913 Bacteria 28932
1128 Ga0496111_0001433 3300048914 Bacteria 13610
1129 Ga0496111_0043668 3300048914 Bacteria 3222
1130 Ga0496112_0073805 3300048915 Bacteria 3372
1131 Ga0496114_0054820 3300048917 Bacteria 3324
1132 Ga0496115_0000039 3300048918 Bacteria 124044
1133 Ga0496115_0000180 3300048918 Bacteria 59336
1134 Ga0496115_0096497 3300048918 Bacteria 2420
1135 Ga0496116_0000005 3300048919 Bacteria 827804
1136 Ga0496116_0000525 3300048919 Bacteria 51688
1137 Ga0496116_0010154 3300048919 Bacteria 7928
1138 Ga0496116_0032247 3300048919 Bacteria 3737
1139 Ga0496116_0071902 3300048919 Bacteria 2188
1140 Ga0496117_0003376 3300048920 Bacteria 18603
1141 Ga0496117_0044731 3300048920 Bacteria 3204
1142 Ga0496117_0054077 3300048920 Bacteria 2816
1143 Ga0496117_0094031 3300048920 Bacteria 1920
1144 Ga0496117_0098132 3300048920 Bacteria 1863
1145 Ga0496117_0172955 3300048920 Bacteria 1251
1146 Ga0496118_0003182 3300048921 Bacteria 20970
1147 Ga0496118_0008052 3300048921 Bacteria 11000
1148 Ga0496118_0008930 3300048921 Bacteria 10231
1149 Ga0496118_0073100 3300048921 Bacteria 2458
1150 Ga0496118_0109105 3300048921 Bacteria 1843
1151 Ga0496119_0000158 3300048922 Bacteria 93884
1152 Ga0496119_0007528 3300048922 Bacteria 9784
1153 Ga0496119_0057933 3300048922 Bacteria 2338
1154 Ga0496119_0073203 3300048922 Bacteria 1998
1155 Ga0496119_0073209 3300048922 Bacteria 1998
1156 Ga0496119_0184428 3300048922 Bacteria 1092
1157 Ga0496120_0001056 3300048923 Bacteria 36468
1158 Ga0496120_0001816 3300048923 Bacteria 23877
1159 Ga0496120_0008467 3300048923 Bacteria 7463
1160 Ga0496120_0047290 3300048923 Bacteria 2481
1161 Ga0496121_0000106 3300048924 Bacteria 191065
1162 Ga0496121_0000157 3300048924 Bacteria 149289
1163 Ga0496121_0003918 3300048924 Bacteria 20638
1164 Ga0496121_0009744 3300048924 Bacteria 10987
1165 Ga0496121_0033195 3300048924 Bacteria 4675
1166 Ga0496121_0044599 3300048924 Bacteria 3822
1167 Ga0496122_0000542 3300048925 Bacteria 78290
1168 Ga0496122_0037231 3300048925 Bacteria 3920
1169 Ga0496122_0056858 3300048925 Bacteria 2911
1170 Ga0496123_0000480 3300048926 Bacteria 69227
1171 Ga0496123_0002456 3300048926 Bacteria 22971
1172 Ga0496123_0023533 3300048926 Bacteria 4712
1173 Ga0496123_0058521 3300048926 Bacteria 2498
1174 Ga0496124_0000104 3300048927 Bacteria 177382
1175 Ga0496124_0000565 3300048927 Bacteria 62666
1176 Ga0496124_0000571 3300048927 Bacteria 62412
1177 Ga0496124_0009158 3300048927 Bacteria 10226
1178 Ga0496124_0049492 3300048927 Bacteria 3585
1179 Ga0496124_0054907 3300048927 Bacteria 3369
1180 Ga0496124_0075149 3300048927 Bacteria 2791
1181 Ga0496124_0091498 3300048927 Bacteria 2479
1182 Ga0496124_0175326 3300048927 Bacteria 1655
1183 Ga0496124_0199824 3300048927 Bacteria 1521
1184 Ga0496125_0000028 3300048928 Bacteria 387222
1185 Ga0496125_0001081 3300048928 Bacteria 41966
1186 Ga0496125_0005731 3300048928 Bacteria 13670
1187 Ga0496125_0031642 3300048928 Bacteria 4712
1188 Ga0496125_0043091 3300048928 Bacteria 3836
1189 Ga0496126_0016675 3300048929 Bacteria 7341
1190 Ga0496126_0017502 3300048929 Bacteria 7138
1191 Ga0495678_000647 3300049459 Bacteria 32025
1192 Ga0495678_015524 3300049459 Bacteria 3500
1193 Ga0495678_016236 3300049459 Bacteria 3408
1194 Ga0495678_016913 3300049459 Bacteria 3318
1195 Ga0495678_018704 3300049459 Bacteria 3109
1196 Ga0495678_019295 3300049459 Bacteria 3045
1197 Ga0495678_023850 3300049459 Bacteria 2651
1198 Ga0495678_031457 3300049459 Bacteria 2212
1199 Ga0495682_0000079 3300049460 Bacteria 85081
1200 Ga0495682_0014314 3300049460 Bacteria 3009
1201 Ga0495682_0014612 3300049460 Bacteria 2976
1202 Ga0495682_0030882 3300049460 Bacteria 1981
1203 Ga0495682_0055167 3300049460 Bacteria 1441
1204 Ga0501031_0004157 3300049568 Bacteria 9351
1205 Ga0501031_0014430 3300049568 Bacteria 5135
1206 Ga0501031_0096770 3300049568 Bacteria 1926
1207 Ga0501032_0001019 3300049569 Bacteria 22598
1208 Ga0501032_0010708 3300049569 Bacteria 6599
1209 Ga0501032_0018068 3300049569 Bacteria 4946
1210 Ga0501032_0031326 3300049569 Bacteria 3646
1211 Ga0501033_0002269 3300049570 Bacteria 16449
1212 Ga0501033_0002407 3300049570 Bacteria 15920
1213 Ga0501033_0006904 3300049570 Bacteria 8864
1214 Ga0501033_0020211 3300049570 Bacteria 5033
1215 Ga0501033_0045012 3300049570 Bacteria 3285
1216 Ga0501033_0096134 3300049570 Bacteria 2165
1217 Ga0501034_0003602 3300049571 Bacteria 17577
1218 Ga0501034_0021552 3300049571 Bacteria 6565
1219 Ga0501034_0029512 3300049571 Bacteria 5575
1220 Ga0501034_0334643 3300049571 Bacteria 1445
1221 Ga0501034_0376299 3300049571 Bacteria 1345
1222 Ga0501036_0005972 3300049572 Bacteria 9871
1223 Ga0501036_0034377 3300049572 Bacteria 4287
1224 Ga0501036_0048742 3300049572 Bacteria 3586
1225 Ga0501036_0097505 3300049572 Bacteria 2485
1226 Ga0501036_0121463 3300049572 Bacteria 2206
1227 Ga0501036_0307122 3300049572 Bacteria 1326
1228 Ga0501037_0005393 3300049573 Bacteria 9311
1229 Ga0501037_0017642 3300049573 Bacteria 5255
1230 Ga0501037_0019859 3300049573 Bacteria 4958
1231 Ga0501037_0057224 3300049573 Bacteria 2847
1232 Ga0501037_0106890 3300049573 Bacteria 2016
1233 Ga0501037_0199717 3300049573 Bacteria 1413
1234 Ga0501038_0009795 3300049574 Bacteria 8774
1235 Ga0501038_0009821 3300049574 Bacteria 8760
1236 Ga0501038_0016996 3300049574 Bacteria 6583
1237 Ga0501038_0029481 3300049574 Bacteria 4861
1238 Ga0501038_0489760 3300049574 Bacteria 941
1239 Ga0501039_0086678 3300049575 Bacteria 2439
1240 Ga0501039_0133525 3300049575 Bacteria 1948
1241 Ga0501040_0050547 3300049576 Bacteria 2844
1242 Ga0501040_0061349 3300049576 Bacteria 2586
1243 Ga0501041_0024009 3300049577 Bacteria 3658
1244 Ga0501041_0037242 3300049577 Bacteria 2947
1245 Ga0501042_0050196 3300049578 Bacteria 2976
1246 Ga0501042_0213029 3300049578 Bacteria 1393
1247 Ga0501043_0007712 3300049579 Bacteria 8521
1248 Ga0501043_0023963 3300049579 Bacteria 4788
1249 Ga0501043_0037632 3300049579 Bacteria 3805
1250 Ga0501043_0066983 3300049579 Bacteria 2820
1251 Ga0501046_0000225 3300049580 Bacteria 58907
1252 Ga0501046_0005040 3300049580 Bacteria 11852
1253 Ga0501047_0003089 3300049581 Bacteria 15797
1254 Ga0501047_0005471 3300049581 Bacteria 11953
1255 Ga0501047_0007083 3300049581 Bacteria 10531
1256 Ga0501047_0010533 3300049581 Bacteria 8743
1257 Ga0501047_0013611 3300049581 Bacteria 7716
1258 Ga0501047_0044695 3300049581 Bacteria 4281
1259 Ga0501047_0051515 3300049581 Bacteria 3978
1260 Ga0501047_0094942 3300049581 Bacteria 2861
1261 Ga0501047_0384087 3300049581 Bacteria 1238
1262 Ga0501048_0019371 3300049582 Bacteria 4993
1263 Ga0501048_0025094 3300049582 Bacteria 4346
1264 Ga0501048_0173495 3300049582 Bacteria 1528
1265 Ga0501067_0016911 3300049583 Bacteria 4029
1266 Ga0501068_0011706 3300049584 Bacteria 4959
1267 Ga0501068_0052452 3300049584 Bacteria 2468
1268 Ga0501069_0000978 3300049585 Bacteria 13605
1269 Ga0501069_0002954 3300049585 Bacteria 8741
1270 Ga0501069_0009997 3300049585 Bacteria 5016
1271 Ga0501069_0011907 3300049585 Bacteria 4615
1272 Ga0501070_0000105 3300049586 Bacteria 73931
1273 Ga0501070_0002736 3300049586 Bacteria 15392
1274 Ga0501070_0002792 3300049586 Bacteria 15243
1275 Ga0501070_0003218 3300049586 Bacteria 14204
1276 Ga0501070_0005852 3300049586 Bacteria 10486
1277 Ga0501070_0006054 3300049586 Bacteria 10303
1278 Ga0501070_0054161 3300049586 Bacteria 3326
1279 Ga0501070_0116516 3300049586 Bacteria 2206
1280 Ga0501070_0146116 3300049586 Bacteria 1952
1281 Ga0501070_0181709 3300049586 Bacteria 1731
1282 Ga0501071_0002675 3300049587 Bacteria 10908
1283 Ga0501071_0072985 3300049587 Bacteria 2503
1284 Ga0501071_0085271 3300049587 Bacteria 2316
1285 Ga0501071_0096620 3300049587 Bacteria 2174
1286 Ga0501072_0003622 3300049588 Bacteria 11626
1287 Ga0501072_0021858 3300049588 Bacteria 4962
1288 Ga0501073_0003412 3300049589 Bacteria 11948
1289 Ga0501073_0004459 3300049589 Bacteria 10517
1290 Ga0501074_0003031 3300049590 Bacteria 11831
1291 Ga0501074_0004871 3300049590 Bacteria 9627
1292 Ga0501074_0007822 3300049590 Bacteria 7740
1293 Ga0501074_0018953 3300049590 Bacteria 4999
1294 Ga0501074_0029239 3300049590 Bacteria 3991
1295 Ga0501075_0028709 3300049591 Bacteria 4108
1296 Ga0501075_0119572 3300049591 Bacteria 2004
1297 Ga0501076_0087644 3300049592 Bacteria 2502
1298 Ga0501079_0017667 3300049741 Bacteria 5448
1299 Ga0501079_0032541 3300049741 Bacteria 4010
1300 Ga0501079_0151767 3300049741 Bacteria 1806
1301 Ga0501080_0004356 3300049742 Bacteria 12572
1302 Ga0501080_0008184 3300049742 Bacteria 9472
1303 Ga0501080_0009176 3300049742 Bacteria 9008
1304 Ga0501080_0015072 3300049742 Bacteria 7123
1305 Ga0501080_0015424 3300049742 Bacteria 7043
1306 Ga0501080_0019416 3300049742 Bacteria 6296
1307 Ga0501080_0034933 3300049742 Bacteria 4694
1308 Ga0501080_0125102 3300049742 Bacteria 2381
1309 Ga0501080_0192349 3300049742 Bacteria 1875
1310 Ga0501081_0015666 3300049743 Bacteria 5003
1311 Ga0501081_0106645 3300049743 Bacteria 1986
1312 Ga0501083_0105016 3300049744 Bacteria 1861
1313 Ga0501083_0141378 3300049744 Bacteria 1576
1314 Ga0501035_0001421 3300049822 Bacteria 24513
1315 Ga0501035_0008514 3300049822 Bacteria 9551
1316 Ga0501035_0011122 3300049822 Bacteria 8334
1317 Ga0501035_0011812 3300049822 Bacteria 8086
1318 Ga0501035_0015237 3300049822 Bacteria 7094
1319 Ga0501035_0020545 3300049822 Bacteria 6064
1320 Ga0501035_0021957 3300049822 Bacteria 5864
1321 Ga0501035_0031056 3300049822 Bacteria 4865
1322 Ga0501035_0049365 3300049822 Bacteria 3771
1323 Ga0501035_0079251 3300049822 Bacteria 2901
1324 Ga0501035_0123608 3300049822 Bacteria 2260
1325 Ga0501035_0144046 3300049822 Bacteria 2070
1326 Ga0501035_0148929 3300049822 Bacteria 2032
1327 Ga0501035_0278246 3300049822 Bacteria 1415
1328 Ga0501044_0000170 3300049823 Bacteria 80445
1329 Ga0501044_0007143 3300049823 Bacteria 12287
1330 Ga0501044_0011000 3300049823 Bacteria 9821
1331 Ga0501044_0018678 3300049823 Bacteria 7426
1332 Ga0501044_0018697 3300049823 Bacteria 7422
1333 Ga0501044_0019937 3300049823 Bacteria 7162
1334 Ga0501044_0030492 3300049823 Bacteria 5683
1335 Ga0501044_0039650 3300049823 Bacteria 4912
1336 Ga0501044_0057837 3300049823 Bacteria 3978
1337 Ga0501044_0084120 3300049823 Bacteria 3216
1338 Ga0501044_0177491 3300049823 Bacteria 2098
1339 Ga0501044_0238847 3300049823 Bacteria 1761
1340 Ga0501045_0141929 3300049824 Bacteria 1786
1341 nmdc:mga03n38_233_c1 3300050490 Bacteria 12980
1342 nmdc:mga00v17_116_c1 3300050491 Bacteria 47624
1343 nmdc:mga00v17_25236_c1 3300050491 Bacteria 3454
1344 nmdc:mga00v17_36503_c1 3300050491 Bacteria 2929
1345 nmdc:mga00v17_44043_c1 3300050491 Bacteria 2690
1346 nmdc:mga00v17_59903_c1 3300050491 Bacteria 2337
1347 nmdc:mga0yw44_1625_c1 3300050492 Bacteria 9042
1348 nmdc:mga0yw44_64_c1 3300050492 Bacteria 38466
1349 nmdc:mga06z11_10428_c1 3300050494 Bacteria 3961
1350 nmdc:mga04h51_9833_c1 3300050495 Bacteria 2608
1351 nmdc:mga07m45_79_c1 3300050496 Bacteria 35992
1352 nmdc:mga05p37_110746_c1 3300050507 Bacteria 3377
1353 nmdc:mga08y16_9557_c1 3300050511 Bacteria 10179
1354 nmdc:mga0n895_19557_c1 3300050512 Bacteria 6297
1355 nmdc:mga0rr50_342228_c1 3300050513 Bacteria 1257
1356 nmdc:mga0a205_6796_c1 3300050515 Bacteria 10351
1357 nmdc:mga0sz30_42_c1 3300050516 Bacteria 18630
1358 Ga0500643_000002 3300053087 Bacteria 1277657
1359 Ga0500644_0038253 3300053088 Bacteria 1573
1360 Ga0500583_0052537 3300053092 Bacteria 1896
1361 Ga0500583_0071208 3300053092 Bacteria 1662
1362 Ga0500651_0007369 3300053093 Bacteria 6424
1363 Ga0500651_0196958 3300053093 Bacteria 1190
1364 Ga0500641_0018128 3300053096 Bacteria 2643
1365 Ga0500555_018448 3300053103 Bacteria 2011
1366 Ga0500556_0000731 3300053104 Bacteria 19806
1367 Ga0500572_005148 3300053111 Bacteria 2956
1368 Ga0500594_0000346 3300053118 Bacteria 10412
1369 Ga0500617_011127 3300053124 Bacteria 3745
1370 Ga0500621_063954 3300053126 Bacteria 1486
1371 Ga0500658_0031971 3300053134 Bacteria 2061
1372 Ga0500559_0000076 3300053136 Bacteria 76510
1373 Ga0500568_0103051 3300053139 Bacteria 1070
1374 Ga0500604_0000359 3300053151 Bacteria 12613
1375 Ga0500622_0001530 3300053156 Bacteria 18329
1376 Ga0501084_0031017 3300054114 Bacteria 4471
1377 Ga0501084_0253874 3300054114 Bacteria 1484
1378 Ga0501082_0023493 3300060353 Bacteria 5319
1379 Ga0501082_0028957 3300060353 Bacteria 4771
1380 Ga0501082_0063120 3300060353 Bacteria 3190
1381 Ga0466962_0000641 3300061719 Bacteria 15594
1382 Ga0466962_0007332 3300061719 Bacteria 5293
1383 Ga0466962_0033445 3300061719 Bacteria 2459
1384 Ga0530510_0034334 3300061734 Bacteria 3653
1385 Ga0530510_0063926 3300061734 Bacteria 2665

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044658 Ga0466972_0173522 Ga0466972_0173522_170_997 251
2 3300025298 Ga0209050_1002947 Ga0209050_100294711 262
3 3300031911 Ga0307412_10000689 Ga0307412_1000068915 262
4 3300048919 Ga0496116_0071902 Ga0496116_0071902_1311_2138 262
5 3300048922 Ga0496119_0184428 Ga0496119_0184428_36_863 262
6 3300048927 Ga0496124_0075149 Ga0496124_0075149_51_878 262
7 3300044706 Ga0466964_0154312 Ga0466964_0154312_163_1056 273
8 3300049586 Ga0501070_0116516 Ga0501070_0116516_15_881 283
9 3300049744 Ga0501083_0105016 Ga0501083_0105016_546_1442 286
10 iso_pu_bacteria 2554235132 2554814828 289
11 3300048912 Ga0496109_0427559 Ga0496109_0427559_256_1185 292
12 3300009093 Ga0105240_10000494 Ga0105240_1000049454 293
13 3300025913 Ga0207695_10000821 Ga0207695_1000082153 293
14 3300031712 Ga0265342_10192614 Ga0265342_101926141 293
15 3300044656 Ga0466969_0000848 Ga0466969_0000848_9259_10158 293
16 3300044693 Ga0466961_0004818 Ga0466961_0004818_5493_6392 293
17 3300044706 Ga0466964_0000149 Ga0466964_0000149_8251_9150 293
18 3300044719 Ga0466971_0000098 Ga0466971_0000098_6410_7309 293
19 3300044765 Ga0466970_0023490 Ga0466970_0023490_1527_2426 293
20 3300045049 Ga0466959_0016043 Ga0466959_0016043_2395_3294 293
21 3300046500 Ga0495596_0022976 Ga0495596_0022976_1616_2509 293
22 3300046522 Ga0495643_0199731 Ga0495643_0199731_32_925 293
23 3300046538 Ga0495609_0043685 Ga0495609_0043685_975_1871 293
24 3300046557 Ga0495622_0157385 Ga0495622_0157385_25_918 293
25 3300047443 Ga0495687_083537 Ga0495687_083537_282_1178 293
26 3300047472 Ga0495686_0279229 Ga0495686_0279229_24_905 293
27 3300049574 Ga0501038_0489760 Ga0501038_0489760_32_925 293
28 3300049587 Ga0501071_0072985 Ga0501071_0072985_1585_2478 293
29 3300053092 Ga0500583_0052537 Ga0500583_0052537_262_1161 293
30 3300053093 Ga0500651_0196958 Ga0500651_0196958_150_1049 293
31 3300053096 Ga0500641_0018128 Ga0500641_0018128_1379_2278 293
32 3300053124 Ga0500617_011127 Ga0500617_011127_1607_2506 293
33 3300053134 Ga0500658_0031971 Ga0500658_0031971_434_1333 293
34 3300053139 Ga0500568_0103051 Ga0500568_0103051_20_919 293
35 3300061719 Ga0466962_0000641 Ga0466962_0000641_11982_12881 293
36 3300044842 Ga0466957_0094566 Ga0466957_0094566_635_1591 294
37 3300044672 Ga0466982_0000010 Ga0466982_0000010_134919_135878 295
38 3300044683 Ga0466965_0074136 Ga0466965_0074136_622_1581 295
39 3300044684 Ga0466966_0000831 Ga0466966_0000831_1736_2695 295
40 3300044719 Ga0466971_0004686 Ga0466971_0004686_3981_4940 295
41 3300044735 Ga0466968_0002781 Ga0466968_0002781_3037_3996 295
42 3300044765 Ga0466970_0025303 Ga0466970_0025303_2097_3056 295
43 3300044901 Ga0466960_0005398 Ga0466960_0005398_746_1705 295
44 3300005337 Ga0070682_100024183 Ga0070682_1000241832 296
45 3300005455 Ga0070663_100015776 Ga0070663_1000157762 296
46 3300006038 Ga0075365_10017059 Ga0075365_100170593 296
47 3300009093 Ga0105240_10014469 Ga0105240_1001446910 296
48 3300009545 Ga0105237_10000250 Ga0105237_1000025017 296
49 3300010375 Ga0105239_10038903 Ga0105239_100389033 296
50 3300013104 Ga0157370_10065279 Ga0157370_100652792 296
51 3300013104 Ga0157370_10393848 Ga0157370_103938481 296
52 3300020069 Ga0197907_10975134 Ga0197907_109751341 296
53 3300020082 Ga0206353_11208957 Ga0206353_112089572 296
54 3300025250 Ga0209026_1000234 Ga0209026_100023455 296
55 3300025256 Ga0209759_1002666 Ga0209759_10026667 296
56 3300025256 Ga0209759_1021541 Ga0209759_10215412 296
57 3300025272 Ga0209455_1000233 Ga0209455_10002335 296
58 3300025299 Ga0209256_1029682 Ga0209256_10296822 296
59 3300025913 Ga0207695_10001809 Ga0207695_1000180933 296
60 3300025914 Ga0207671_10000116 Ga0207671_100001161 296
61 3300048918 Ga0496115_0096497 Ga0496115_0096497_882_1838 296
62 3300049568 Ga0501031_0096770 Ga0501031_0096770_644_1609 296
63 3300049570 Ga0501033_0006904 Ga0501033_0006904_4875_5840 296
64 3300049572 Ga0501036_0307122 Ga0501036_0307122_78_1043 296
65 3300049573 Ga0501037_0199717 Ga0501037_0199717_298_1263 296
66 3300049574 Ga0501038_0016996 Ga0501038_0016996_2588_3553 296
67 3300049579 Ga0501043_0023963 Ga0501043_0023963_459_1424 296
68 3300049579 Ga0501043_0066983 Ga0501043_0066983_253_1218 296
69 3300049581 Ga0501047_0384087 Ga0501047_0384087_60_1025 296
70 3300049822 Ga0501035_0031056 Ga0501035_0031056_1546_2511 296
71 3300049822 Ga0501035_0049365 Ga0501035_0049365_2437_3402 296
72 3300049823 Ga0501044_0039650 Ga0501044_0039650_3240_4205 296
73 3300050492 nmdc:mga0yw44_1625_c1 nmdc:mga0yw44_1625_c1_4843_5793 296
74 3300025228 Ga0209672_100176 Ga0209672_1001768 297
75 3300025272 Ga0209455_1002848 Ga0209455_10028483 297
76 3300048919 Ga0496116_0000005 Ga0496116_0000005_84067_85080 297
77 3300048921 Ga0496118_0008052 Ga0496118_0008052_5394_6326 297
78 3300048922 Ga0496119_0007528 Ga0496119_0007528_3172_4104 297
79 3300048923 Ga0496120_0008467 Ga0496120_0008467_3464_4396 297
80 3300048924 Ga0496121_0000106 Ga0496121_0000106_74122_75135 297
81 3300048927 Ga0496124_0009158 Ga0496124_0009158_6247_7209 297
82 3300048928 Ga0496125_0000028 Ga0496125_0000028_309054_309986 297
83 3300048929 Ga0496126_0016675 Ga0496126_0016675_643_1608 297
84 3300049823 Ga0501044_0057837 Ga0501044_0057837_87_1046 297
85 3300002067 JGI24735J21928_10012840 JGI24735J21928_100128403 298
86 3300005262 Ga0065165_1000001 Ga0065165_100000158 298
87 3300005458 Ga0070681_10099083 Ga0070681_100990833 298
88 3300005614 Ga0068856_100009328 Ga0068856_1000093282 298
89 3300009093 Ga0105240_10000127 Ga0105240_1000012711 298
90 3300009101 Ga0105247_10004898 Ga0105247_100048983 298
91 3300009551 Ga0105238_10124241 Ga0105238_101242412 298
92 3300010375 Ga0105239_10000933 Ga0105239_1000093311 298
93 3300013105 Ga0157369_10023258 Ga0157369_100232582 298
94 3300013307 Ga0157372_10076879 Ga0157372_100768792 298
95 3300013307 Ga0157372_10089067 Ga0157372_100890674 298
96 3300014497 Ga0182008_10014631 Ga0182008_100146313 298
97 3300015261 Ga0182006_1000005 Ga0182006_1000005548 298
98 3300015685 Ga0183369_1012 Ga0183369_101271 298
99 3300017792 Ga0163161_10003936 Ga0163161_100039369 298
100 3300025900 Ga0207710_10006424 Ga0207710_100064243 298
101 3300025912 Ga0207707_10027478 Ga0207707_100274786 298
102 3300025913 Ga0207695_10006439 Ga0207695_1000643911 298
103 3300025924 Ga0207694_10047570 Ga0207694_100475702 298
104 3300026078 Ga0207702_10007120 Ga0207702_100071208 298
105 3300037418 Ga0395900_0381377 Ga0395900_0381377_175_1137 298
106 3300037466 Ga0395898_0250918 Ga0395898_0250918_696_1658 298
107 3300037466 Ga0395898_0253926 Ga0395898_0253926_510_1472 298
108 3300037471 Ga0395905_0124487 Ga0395905_0124487_1227_2189 298
109 3300038443 Ga0395901_0196744 Ga0395901_0196744_508_1470 298
110 3300038443 Ga0395901_0218068 Ga0395901_0218068_337_1299 298
111 3300046501 Ga0495607_0000027 Ga0495607_0000027_5725_6687 298
112 3300046501 Ga0495607_0032232 Ga0495607_0032232_415_1377 298
113 3300046507 Ga0495606_0002002 Ga0495606_0002002_23049_24011 298
114 3300046519 Ga0495632_0000167 Ga0495632_0000167_13070_14032 298
115 3300046665 Ga0495661_0038418 Ga0495661_0038418_1764_2726 298
116 3300046810 Ga0495660_0001296 Ga0495660_0001296_13654_14616 298
117 3300047469 Ga0495673_0000001 Ga0495673_0000001_238060_239022 298
118 3300047472 Ga0495686_0019136 Ga0495686_0019136_3268_4230 298
119 3300048909 Ga0496106_0105368 Ga0496106_0105368_128_1090 298
120 3300048920 Ga0496117_0003376 Ga0496117_0003376_5368_6330 298
121 3300048921 Ga0496118_0003182 Ga0496118_0003182_1346_2311 298
122 3300048921 Ga0496118_0008930 Ga0496118_0008930_314_1276 298
123 3300048922 Ga0496119_0000158 Ga0496119_0000158_1361_2323 298
124 3300048923 Ga0496120_0001056 Ga0496120_0001056_13349_14311 298
125 3300048923 Ga0496120_0001816 Ga0496120_0001816_4701_5663 298
126 3300048924 Ga0496121_0003918 Ga0496121_0003918_18337_19299 298
127 3300048924 Ga0496121_0009744 Ga0496121_0009744_8905_9870 298
128 3300048929 Ga0496126_0017502 Ga0496126_0017502_4726_5691 298
129 3300049570 Ga0501033_0045012 Ga0501033_0045012_994_1956 298
130 3300049571 Ga0501034_0334643 Ga0501034_0334643_416_1369 298
131 3300049581 Ga0501047_0007083 Ga0501047_0007083_9196_10158 298
132 3300049582 Ga0501048_0025094 Ga0501048_0025094_733_1695 298
133 3300049822 Ga0501035_0021957 Ga0501035_0021957_1137_2099 298
134 3300049823 Ga0501044_0030492 Ga0501044_0030492_3851_4813 298
135 3300003761 Ga0055535_1000602 Ga0055535_100060217 299
136 3300003762 Ga0055542_1000476 Ga0055542_100047620 299
137 3300006038 Ga0075365_10003284 Ga0075365_100032846 299
138 3300025228 Ga0209672_104294 Ga0209672_1042942 299
139 3300025242 Ga0209258_100511 Ga0209258_10051119 299
140 3300025254 Ga0209148_1000533 Ga0209148_100053316 299
141 3300025272 Ga0209455_1005053 Ga0209455_10050533 299
142 3300037312 Ga0395899_0000460 Ga0395899_0000460_927_1886 299
143 3300037466 Ga0395898_0000363 Ga0395898_0000363_49193_50152 299
144 3300042438 Ga0439459_0000759 Ga0439459_0000759_626_1627 299
145 3300044656 Ga0466969_0077671 Ga0466969_0077671_380_1339 299
146 3300044658 Ga0466972_0013529 Ga0466972_0013529_2674_3630 299
147 3300044683 Ga0466965_0033053 Ga0466965_0033053_982_1941 299
148 3300044693 Ga0466961_0020014 Ga0466961_0020014_1168_2127 299
149 3300044693 Ga0466961_0038475 Ga0466961_0038475_1874_2833 299
150 3300044719 Ga0466971_0005715 Ga0466971_0005715_1438_2397 299
151 3300045049 Ga0466959_0032733 Ga0466959_0032733_507_1466 299
152 3300045049 Ga0466959_0035688 Ga0466959_0035688_2545_3504 299
153 3300045836 Ga0466958_0019881 Ga0466958_0019881_501_1460 299
154 3300046460 Ga0495638_0000069 Ga0495638_0000069_39476_40477 299
155 3300047321 Ga0495676_0042776 Ga0495676_0042776_1053_2114 299
156 3300061719 Ga0466962_0007332 Ga0466962_0007332_1225_2184 299
157 3300061719 Ga0466962_0033445 Ga0466962_0033445_903_1862 299
158 3300003322 rootL2_10361046 rootL2_103610462 300
159 3300031903 Ga0307407_10132664 Ga0307407_101326642 300
160 3300039450 Ga0436363_0125963 Ga0436363_0125963_12_965 300
161 3300046692 Ga0495671_0008717 Ga0495671_0008717_4353_5315 300
162 3300001979 JGI24740J21852_10009130 JGI24740J21852_100091302 301
163 3300001989 JGI24739J22299_10002601 JGI24739J22299_100026013 301
164 3300001990 JGI24737J22298_10001809 JGI24737J22298_100018094 301
165 3300002737 JGI25162J39368_1000349 JGI25162J39368_100034928 301
166 3300002772 JGI25164J39214_1000372 JGI25164J39214_100037215 301
167 3300003214 JGI25165J46597_1000557 JGI25165J46597_100055727 301
168 3300003578 Ga0006562J51391_1015243 Ga0006562J51391_10152433 301
169 3300003578 Ga0006562J51391_1015244 Ga0006562J51391_10152441 301
170 3300003760 Ga0055527_1001477 Ga0055527_10014772 301
171 3300003761 Ga0055535_1000679 Ga0055535_10006795 301
172 3300003762 Ga0055542_1000584 Ga0055542_100058421 301
173 3300003763 Ga0055529_1000426 Ga0055529_10004268 301
174 3300005335 Ga0070666_10295416 Ga0070666_102954161 301
175 3300005577 Ga0068857_100001031 Ga0068857_10000103112 301
176 3300005578 Ga0068854_100026288 Ga0068854_1000262884 301
177 3300005834 Ga0068851_10017413 Ga0068851_100174132 301
178 3300005842 Ga0068858_100093351 Ga0068858_1000933512 301
179 3300006177 Ga0075362_10091076 Ga0075362_100910761 301
180 3300009093 Ga0105240_10001888 Ga0105240_1000188826 301
181 3300009545 Ga0105237_10000565 Ga0105237_1000056510 301
182 3300009553 Ga0105249_10215913 Ga0105249_102159132 301
183 3300010375 Ga0105239_10020822 Ga0105239_100208224 301
184 3300017792 Ga0163161_10246880 Ga0163161_102468801 301
185 3300022467 Ga0224712_10029744 Ga0224712_100297442 301
186 3300025228 Ga0209672_100106 Ga0209672_10010633 301
187 3300025231 Ga0207427_100261 Ga0207427_10026113 301
188 3300025233 Ga0209437_100563 Ga0209437_10056314 301
189 3300025242 Ga0209258_100155 Ga0209258_100155123 301
190 3300025246 Ga0209646_1000590 Ga0209646_100059011 301
191 3300025250 Ga0209026_1000635 Ga0209026_10006356 301
192 3300025254 Ga0209148_1000220 Ga0209148_100022033 301
193 3300025256 Ga0209759_1000442 Ga0209759_100044228 301
194 3300025258 Ga0209129_1009819 Ga0209129_10098192 301
195 3300025261 Ga0209233_1000364 Ga0209233_100036413 301
196 3300025272 Ga0209455_1000077 Ga0209455_100007733 301
197 3300025297 Ga0209758_1000289 Ga0209758_100028987 301
198 3300025321 Ga0207656_10028127 Ga0207656_100281271 301
199 3300025913 Ga0207695_10000349 Ga0207695_1000034939 301
200 3300025914 Ga0207671_10000059 Ga0207671_10000059125 301
201 3300025949 Ga0207667_10000031 Ga0207667_10000031131 301
202 3300025949 Ga0207667_10000383 Ga0207667_1000038322 301
203 3300025961 Ga0207712_10266890 Ga0207712_102668901 301
204 3300025981 Ga0207640_10000082 Ga0207640_1000008249 301
205 3300025981 Ga0207640_10031357 Ga0207640_100313572 301
206 3300026095 Ga0207676_10185251 Ga0207676_101852512 301
207 3300026116 Ga0207674_10000189 Ga0207674_1000018935 301
208 3300031507 Ga0307509_10196672 Ga0307509_101966722 301
209 3300031730 Ga0307516_10000326 Ga0307516_1000032638 301
210 3300048928 Ga0496125_0005731 Ga0496125_0005731_2637_3596 301
211 3300005458 Ga0070681_10028831 Ga0070681_100288312 302
212 3300005530 Ga0070679_100036810 Ga0070679_1000368102 302
213 3300025912 Ga0207707_10084835 Ga0207707_100848353 302
214 3300031250 Ga0265331_10019841 Ga0265331_100198413 302
215 3300031711 Ga0265314_10001065 Ga0265314_1000106514 302
216 3300017792 Ga0163161_10039366 Ga0163161_100393662 303
217 3300049460 Ga0495682_0055167 Ga0495682_0055167_305_1264 303
218 3300041405 Ga0439438_002420 Ga0439438_002420_5343_6302 304
219 3300041407 Ga0439447_004018 Ga0439447_004018_2547_3506 304
220 3300041411 Ga0439466_0003242 Ga0439466_0003242_1628_2587 304
221 3300042010 Ga0439452_004333 Ga0439452_004333_2187_3146 304
222 3300042137 Ga0450902_005667 Ga0450902_005667_545_1504 304
223 3300046453 Ga0495627_047697 Ga0495627_047697_91_1050 304
224 3300046457 Ga0495590_0029983 Ga0495590_0029983_157_1116 304
225 3300046458 Ga0495591_003604 Ga0495591_003604_5274_6233 304
226 3300046471 Ga0495650_0033867 Ga0495650_0033867_840_1799 304
227 3300046491 Ga0495584_0022859 Ga0495584_0022859_1618_2577 304
228 3300046500 Ga0495596_0009034 Ga0495596_0009034_1656_2615 304
229 3300046501 Ga0495607_0000128 Ga0495607_0000128_78177_79133 304
230 3300046501 Ga0495607_0036500 Ga0495607_0036500_1641_2600 304
231 3300046501 Ga0495607_0061394 Ga0495607_0061394_313_1272 304
232 3300046512 Ga0495610_0038819 Ga0495610_0038819_1204_2163 304
233 3300046519 Ga0495632_0033224 Ga0495632_0033224_1657_2616 304
234 3300046520 Ga0495637_0011029 Ga0495637_0011029_1661_2620 304
235 3300046524 Ga0495648_0059928 Ga0495648_0059928_469_1428 304
236 3300046530 Ga0495654_0028517 Ga0495654_0028517_1427_2386 304
237 3300046616 Ga0495668_0017287 Ga0495668_0017287_1661_2620 304
238 3300046660 Ga0495625_0032112 Ga0495625_0032112_2359_3318 304
239 3300046665 Ga0495661_0064726 Ga0495661_0064726_715_1674 304
240 3300046694 Ga0495649_0167808 Ga0495649_0167808_155_1114 304
241 3300046794 Ga0495589_0021144 Ga0495589_0021144_1656_2615 304
242 3300047323 Ga0495683_0056938 Ga0495683_0056938_743_1702 304
243 3300047470 Ga0495681_0032349 Ga0495681_0032349_36_995 304
244 3300047470 Ga0495681_0098831 Ga0495681_0098831_36_995 304
245 3300048091 Ga0495626_0008853 Ga0495626_0008853_1691_2650 304
246 3300049459 Ga0495678_016913 Ga0495678_016913_1464_2423 304
247 3300049459 Ga0495678_019295 Ga0495678_019295_592_1551 304
248 3300049568 Ga0501031_0004157 Ga0501031_0004157_902_1861 304
249 3300049569 Ga0501032_0010708 Ga0501032_0010708_1410_2369 304
250 3300049570 Ga0501033_0002269 Ga0501033_0002269_2288_3247 304
251 3300049571 Ga0501034_0021552 Ga0501034_0021552_5208_6167 304
252 3300049572 Ga0501036_0005972 Ga0501036_0005972_3524_4483 304
253 3300049573 Ga0501037_0005393 Ga0501037_0005393_4508_5467 304
254 3300049574 Ga0501038_0009795 Ga0501038_0009795_1454_2413 304
255 3300049580 Ga0501046_0005040 Ga0501046_0005040_9628_10587 304
256 3300049822 Ga0501035_0011812 Ga0501035_0011812_3586_4545 304
257 3300002075 JGI24738J21930_10029385 JGI24738J21930_100293851 305
258 3300003187 JGI25151J46595_10000174 JGI25151J46595_1000017425 305
259 3300003775 Ga0055524_1039049 Ga0055524_10390491 305
260 3300005344 Ga0070661_100022538 Ga0070661_1000225383 305
261 3300005539 Ga0068853_100035857 Ga0068853_1000358572 305
262 3300006051 Ga0075364_10002766 Ga0075364_100027665 305
263 3300006051 Ga0075364_10003188 Ga0075364_100031887 305
264 3300006051 Ga0075364_10004081 Ga0075364_100040816 305
265 3300006051 Ga0075364_10013235 Ga0075364_100132353 305
266 3300006186 Ga0075369_10024363 Ga0075369_100243632 305
267 3300010375 Ga0105239_10136648 Ga0105239_101366482 305
268 3300013308 Ga0157375_10385868 Ga0157375_103858682 305
269 3300014497 Ga0182008_10003295 Ga0182008_100032952 305
270 3300015261 Ga0182006_1000943 Ga0182006_10009432 305
271 3300015262 Ga0182007_10003743 Ga0182007_100037432 305
272 3300017792 Ga0163161_10087406 Ga0163161_100874061 305
273 3300025226 Ga0209674_101041 Ga0209674_1010412 305
274 3300025233 Ga0209437_102167 Ga0209437_1021673 305
275 3300025254 Ga0209148_1004748 Ga0209148_10047481 305
276 3300025294 Ga0209025_1000027 Ga0209025_1000027200 305
277 3300025297 Ga0209758_1013062 Ga0209758_10130623 305
278 3300025299 Ga0209256_1008266 Ga0209256_10082663 305
279 3300027312 Ga0209371_1016094 Ga0209371_10160943 305
280 3300030500 Ga0268256_1017881 Ga0268256_10178812 305
281 3300031824 Ga0307413_10188417 Ga0307413_101884171 305
282 3300031911 Ga0307412_10003342 Ga0307412_100033421 305
283 3300037418 Ga0395900_0130114 Ga0395900_0130114_865_1851 305
284 3300041404 Ga0439436_0000119 Ga0439436_0000119_109_1071 305
285 3300044672 Ga0466982_0000092 Ga0466982_0000092_122_1084 305
286 3300044842 Ga0466957_0112179 Ga0466957_0112179_59_1021 305
287 3300046452 Ga0495617_000236 Ga0495617_000236_721_1683 305
288 3300046452 Ga0495617_001020 Ga0495617_001020_11041_12003 305
289 3300046460 Ga0495638_0000515 Ga0495638_0000515_14232_15194 305
290 3300046491 Ga0495584_0005401 Ga0495584_0005401_218_1180 305
291 3300046501 Ga0495607_0000059 Ga0495607_0000059_103475_104437 305
292 3300046507 Ga0495606_0003327 Ga0495606_0003327_16145_17107 305
293 3300046507 Ga0495606_0047938 Ga0495606_0047938_106_1068 305
294 3300046513 Ga0495616_0000023 Ga0495616_0000023_98269_99231 305
295 3300046513 Ga0495616_0050794 Ga0495616_0050794_1000_1962 305
296 3300046515 Ga0495620_0000140 Ga0495620_0000140_4898_5860 305
297 3300046515 Ga0495620_0004721 Ga0495620_0004721_6005_6967 305
298 3300046518 Ga0495631_0000044 Ga0495631_0000044_2679_3641 305
299 3300046520 Ga0495637_0014425 Ga0495637_0014425_840_1802 305
300 3300046524 Ga0495648_0004277 Ga0495648_0004277_5637_6599 305
301 3300046538 Ga0495609_0014474 Ga0495609_0014474_775_1737 305
302 3300046648 Ga0495611_0000001 Ga0495611_0000001_1627184_1628146 305
303 3300046648 Ga0495611_0005183 Ga0495611_0005183_1953_2915 305
304 3300046660 Ga0495625_0000001 Ga0495625_0000001_287891_288853 305
305 3300046691 Ga0495670_0072758 Ga0495670_0072758_685_1647 305
306 3300046691 Ga0495670_0110435 Ga0495670_0110435_66_1028 305
307 3300046692 Ga0495671_0000356 Ga0495671_0000356_26299_27261 305
308 3300046694 Ga0495649_0075076 Ga0495649_0075076_704_1666 305
309 3300046794 Ga0495589_0000106 Ga0495589_0000106_2554_3516 305
310 3300046810 Ga0495660_0000463 Ga0495660_0000463_30016_30978 305
311 3300047323 Ga0495683_0000911 Ga0495683_0000911_5675_6637 305
312 3300047446 Ga0495679_000029 Ga0495679_000029_148822_149784 305
313 3300047469 Ga0495673_0000018 Ga0495673_0000018_321533_322495 305
314 3300047472 Ga0495686_0000043 Ga0495686_0000043_290093_291055 305
315 3300047472 Ga0495686_0001964 Ga0495686_0001964_3026_3988 305
316 3300047472 Ga0495686_0022905 Ga0495686_0022905_42_1004 305
317 3300048904 Ga0496101_0020973 Ga0496101_0020973_71_1033 305
318 3300048920 Ga0496117_0172955 Ga0496117_0172955_98_1060 305
319 3300048924 Ga0496121_0000157 Ga0496121_0000157_41063_42022 305
320 3300048925 Ga0496122_0000542 Ga0496122_0000542_35172_36131 305
321 3300048925 Ga0496122_0037231 Ga0496122_0037231_2618_3580 305
322 3300048926 Ga0496123_0000480 Ga0496123_0000480_31707_32666 305
323 3300048926 Ga0496123_0002456 Ga0496123_0002456_19968_20930 305
324 3300048927 Ga0496124_0000104 Ga0496124_0000104_34438_35400 305
325 3300048927 Ga0496124_0000565 Ga0496124_0000565_50942_51904 305
326 3300048927 Ga0496124_0000571 Ga0496124_0000571_10723_11685 305
327 3300048928 Ga0496125_0043091 Ga0496125_0043091_982_1941 305
328 3300049459 Ga0495678_000647 Ga0495678_000647_14204_15166 305
329 3300049460 Ga0495682_0030882 Ga0495682_0030882_652_1614 305
330 3300049570 Ga0501033_0020211 Ga0501033_0020211_2462_3421 305
331 3300049581 Ga0501047_0051515 Ga0501047_0051515_1385_2344 305
332 3300049582 Ga0501048_0173495 Ga0501048_0173495_557_1516 305
333 3300049822 Ga0501035_0015237 Ga0501035_0015237_514_1473 305
334 3300049823 Ga0501044_0007143 Ga0501044_0007143_531_1490 305
335 3300050491 nmdc:mga00v17_36503_c1 nmdc:mga00v17_36503_c1_1916_2875 305
336 3300050491 nmdc:mga00v17_44043_c1 nmdc:mga00v17_44043_c1_66_1025 305
337 3300050491 nmdc:mga00v17_59903_c1 nmdc:mga00v17_59903_c1_1099_2058 305
338 3300053087 Ga0500643_000002 Ga0500643_000002_191860_192822 305
339 3300003763 Ga0055529_1001210 Ga0055529_10012103 307
340 3300025272 Ga0209455_1000411 Ga0209455_100041117 307
341 3300049822 Ga0501035_0008514 Ga0501035_0008514_6801_7760 307
342 3300049823 Ga0501044_0000170 Ga0501044_0000170_60653_61612 307
343 3300005262 Ga0065165_1007335 Ga0065165_10073352 308
344 3300025250 Ga0209026_1000194 Ga0209026_100019418 308
345 3300025256 Ga0209759_1000901 Ga0209759_100090117 308
346 3300037418 Ga0395900_0000061 Ga0395900_0000061_49733_50692 308
347 3300037466 Ga0395898_0000034 Ga0395898_0000034_352961_353920 308
348 3300044684 Ga0466966_0033650 Ga0466966_0033650_1262_2221 308
349 3300044693 Ga0466961_0006853 Ga0466961_0006853_912_1871 308
350 3300044693 Ga0466961_0019935 Ga0466961_0019935_1262_2221 308
351 3300044842 Ga0466957_0118560 Ga0466957_0118560_707_1666 308
352 3300045049 Ga0466959_0001544 Ga0466959_0001544_4384_5343 308
353 3300045049 Ga0466959_0010715 Ga0466959_0010715_22_981 308
354 iso_pu_bacteria 2919704043 2919706459 308
355 3300037312 Ga0395899_0232892 Ga0395899_0232892_101_1036 309
356 iso_pu_bacteria 2574179768 2574432935 309
357 iso_pu_bacteria 639633007 639786502 309
358 3300014497 Ga0182008_10005708 Ga0182008_100057083 311
359 3300015262 Ga0182007_10011283 Ga0182007_100112834 311
360 3300035725 Ga0373947_0175139 Ga0373947_0175139_205_1161 311
361 3300049586 Ga0501070_0146116 Ga0501070_0146116_523_1473 311
362 iso_pu_bacteria 2511231004 2511257160 311
363 iso_pu_bacteria 2511231006 2511267319 311
364 iso_pu_bacteria 2511231007 2511274021 311
365 iso_pu_bacteria 2511231008 2511279311 311
366 iso_pu_bacteria 2511231011 2511296987 311
367 iso_pu_bacteria 2511231012 2511300290 311
368 iso_pu_bacteria 2511231014 2511313995 311
369 iso_pu_bacteria 2511231015 2511321536 311
370 iso_pu_bacteria 2511231016 2511325605 311
371 iso_pu_bacteria 2511231017 2511329775 311
372 iso_pu_bacteria 2511231018 2511338621 311
373 iso_pu_bacteria 2511231019 2511346903 311
374 iso_pu_bacteria 2511231020 2511350014 311
375 iso_pu_bacteria 2511231021 2511357897 311
376 iso_pu_bacteria 2511231022 2511361119 311
377 iso_pu_bacteria 2511231023 2511371822 311
378 iso_pu_bacteria 2511231031 2511410597 311
379 iso_pu_bacteria 2512047018 2512325495 311
380 iso_pu_bacteria 2537561836 2538832730 311
381 iso_pu_bacteria 2554235341 2555670882 311
382 iso_pu_bacteria 2582580891 2583793157 311
383 iso_pu_bacteria 2593339238 2595446448 311
384 iso_pu_bacteria 2593339239 2595452088 311
385 iso_pu_bacteria 2597489887 2597858897 311
386 iso_pu_bacteria 2599185160 2599357557 311
387 iso_pu_bacteria 2599185161 2599364347 311
388 iso_pu_bacteria 2599185162 2599370668 311
389 iso_pu_bacteria 2599185163 2599377139 311
390 iso_pu_bacteria 2599185164 2599382726 311
391 iso_pu_bacteria 2599185165 2599389174 311
392 iso_pu_bacteria 2599185166 2599395893 311
393 iso_pu_bacteria 2599185168 2599408283 311
394 iso_pu_bacteria 2599185181 2599463954 311
395 iso_pu_bacteria 2599185182 2599470981 311
396 iso_pu_bacteria 2599185185 2599487665 311
397 iso_pu_bacteria 2599185186 2599492973 311
398 iso_pu_bacteria 2599185188 2599502019 311
399 iso_pu_bacteria 2599185212 2599611240 311
400 iso_pu_bacteria 2599185248 2599769908 311
401 iso_pu_bacteria 2599185257 2599806009 311
402 iso_pu_bacteria 2599185289 2599887232 311
403 iso_pu_bacteria 2599185291 2599898603 311
404 iso_pu_bacteria 2599185300 2599932921 311
405 iso_pu_bacteria 2599185302 2599942679 311
406 iso_pu_bacteria 2599185304 2599953428 311
407 iso_pu_bacteria 2599185305 2599959062 311
408 iso_pu_bacteria 2599185306 2599964331 311
409 iso_pu_bacteria 2599185308 2599975798 311
410 iso_pu_bacteria 2599185309 2599982389 311
411 iso_pu_bacteria 2599185310 2599989172 311
412 iso_pu_bacteria 2599185312 2599999420 311
413 iso_pu_bacteria 2599185313 2600005957 311
414 iso_pu_bacteria 2599185314 2600009565 311
415 iso_pu_bacteria 2599185315 2600017094 311
416 iso_pu_bacteria 2599185316 2600023513 311
417 iso_pu_bacteria 2599185317 2600029144 311
418 iso_pu_bacteria 2599185318 2600035593 311
419 iso_pu_bacteria 2599185319 2600042125 311
420 iso_pu_bacteria 2599185320 2600047070 311
421 iso_pu_bacteria 2599185321 2600051917 311
422 iso_pu_bacteria 2599185322 2600057185 311
423 iso_pu_bacteria 2599185323 2600064917 311
424 iso_pu_bacteria 2599185324 2600069852 311
425 iso_pu_bacteria 2599185325 2600077330 311
426 iso_pu_bacteria 2599185356 2600217095 311
427 iso_pu_bacteria 2600254930 2600358518 311
428 iso_pu_bacteria 2600254931 2600366714 311
429 iso_pu_bacteria 2600254954 2600444787 311
430 iso_pu_bacteria 2600255313 2601777266 311
431 iso_pu_bacteria 2600255389 2602011909 311
432 iso_pu_bacteria 2606217733 2608383684 311
433 iso_pu_bacteria 2643221562 2643830178 311
434 iso_pu_bacteria 2643221565 2643843579 311
435 iso_pu_bacteria 2643221633 2644188512 311
436 iso_pu_bacteria 2651869719 2652546883 311
437 iso_pu_bacteria 2667528170 2671091095 311
438 iso_pu_bacteria 2667528171 2671100511 311
439 iso_pu_bacteria 2667528176 2671124610 311
440 iso_pu_bacteria 2671180172 2671772925 311
441 iso_pu_bacteria 2675903515 2678264085 311
442 iso_pu_bacteria 2718218334 2721026996 311
443 iso_pu_bacteria 2734482264 2735837461 311
444 iso_pu_bacteria 2738543004 2739199895 311
445 iso_pu_bacteria 2738543009 2739226885 311
446 iso_pu_bacteria 2738543015 2739260232 311
447 iso_pu_bacteria 2738543020 2739285265 311
448 iso_pu_bacteria 2738543021 2739290579 311
449 iso_pu_bacteria 2738543025 2739313733 311
450 iso_pu_bacteria 2740892503 2743738417 311
451 iso_pu_bacteria 2744054620 2745004541 311
452 iso_pu_bacteria 2773857670 2774119075 311
453 iso_pu_bacteria 2773857673 2774135059 311
454 iso_pu_bacteria 2784132063 2784265130 311
455 iso_pu_bacteria 2784132072 2784312714 311
456 iso_pu_bacteria 2808606361 2808858516 311
457 iso_pu_bacteria 2808606376 2808925626 311
458 iso_pu_bacteria 2808606377 2808931763 311
459 iso_pu_bacteria 2808606378 2808938705 311
460 iso_pu_bacteria 2808606379 2808943284 311
461 iso_pu_bacteria 2808606380 2808947690 311
462 iso_pu_bacteria 2808606381 2808953883 311
463 iso_pu_bacteria 2808606382 2808959101 311
464 iso_pu_bacteria 2808606383 2808967001 311
465 iso_pu_bacteria 2808606389 2809001831 311
466 iso_pu_bacteria 2818991456 2819657751 311
467 iso_pu_bacteria 2818991464 2819706173 311
468 iso_pu_bacteria 2823421272 2823423794 311
469 iso_pu_bacteria 2825651385 2825657092 311
470 iso_pu_bacteria 2842805378 2842807020 311
471 iso_pu_bacteria 2842854478 2842855063 311
472 iso_pu_bacteria 2842914999 2842917516 311
473 iso_pu_bacteria 2842918807 2842919370 311
474 iso_pu_bacteria 2844665904 2844671437 311
475 iso_pu_bacteria 2852657418 2852659430 311
476 iso_pu_bacteria 2857542790 2857546473 311
477 iso_pu_bacteria 2880230671 2880232833 311
478 iso_pu_bacteria 2895395659 2895399145 311
479 iso_pu_bacteria 2904518522 2904520429 311
480 iso_pu_bacteria 2904550169 2904553628 311
481 iso_pu_bacteria 2917070673 2917074741 311
482 iso_pu_bacteria 2919085039 2919085079 311
483 iso_pu_bacteria 2919404418 2919405755 311
484 iso_pu_bacteria 2919456309 2919461293 311
485 iso_pu_bacteria 2919501602 2919503536 311
486 iso_pu_bacteria 2923153595 2923157473 311
487 iso_pu_bacteria 2926063275 2926065892 311
488 iso_pu_bacteria 2929144301 2929146355 311
489 iso_pu_bacteria 2935353572 2935355272 311
490 iso_pu_bacteria 2939636861 2939640287 311
491 iso_pu_bacteria 2953994433 2953998166 311
492 iso_pu_bacteria 2969304461 2969308210 311
493 iso_pu_bacteria 2984286254 2984288667 311
494 iso_pu_bacteria 2988728565 2988729676 311
495 iso_pu_bacteria 2990196909 2990199459 311
496 iso_pu_bacteria 3007252601 3007252758 311
497 iso_pu_bacteria 3007315729 3007318598 311
498 iso_pu_bacteria 3007395558 3007396795 311
499 iso_pu_bacteria 3007419365 3007424010 311
500 iso_pu_bacteria 3007511990 3007515175 311
501 iso_pu_bacteria 3007614139 3007616681 311
502 iso_pu_bacteria 3007619802 3007625107 311
503 iso_pu_bacteria 3007866637 3007868536 311
504 iso_pu_bacteria 637000220 637321218 311
505 iso_pu_bacteria 640427133 640488238 311
506 iso_pu_bacteria 651053060 651176192 311
507 iso_pu_bacteria 8002392321 8002395095 311
508 iso_pu_bacteria 8011350971 8011354097 311
509 iso_pu_bacteria 8015687852 8015691636 311
510 iso_pu_bacteria 8019769354 8019772171 311
511 iso_pu_bacteria 8034962539 8034964706 311
512 iso_pu_bacteria 8048746797 8048749657 311
513 iso_pu_bacteria 8055770955 8055774825 311
514 iso_pu_bacteria 8056125926 8056129723 311
515 iso_pu_bacteria 8056143049 8056146922 311
516 iso_pu_bacteria 8056155041 8056160263 311
517 iso_pu_bacteria 8056177738 8056183891 311
518 iso_pu_bacteria 8056569372 8056573624 311
519 iso_pu_bacteria 8057798959 8057801359 311
520 3300003322 rootL2_10007600 rootL2_100076009 312
521 3300028573 Ga0265334_10000079 Ga0265334_1000007948 312
522 3300035083 Ga0373926_0089621 Ga0373926_0089621_32_970 312
523 3300042532 Ga0450893_0011278 Ga0450893_0011278_48_1001 312
524 3300044712 Ga0453684_0107105 Ga0453684_0107105_154_1095 312
525 3300049581 Ga0501047_0094942 Ga0501047_0094942_1004_1966 312
526 3300049742 Ga0501080_0015072 Ga0501080_0015072_4256_5218 312
527 3300049822 Ga0501035_0123608 Ga0501035_0123608_788_1750 312
528 3300049823 Ga0501044_0011000 Ga0501044_0011000_3627_4589 312
529 iso_pu_bacteria 2643221577 2643894745 312
530 iso_pu_bacteria 2643221685 2644476902 312
531 iso_pu_bacteria 2687453130 2687583006 312
532 iso_pu_bacteria 2739367700 2739730945 312
533 iso_pu_bacteria 2884411467 2884412394 312
534 iso_pu_bacteria 2928963466 2928963989 312
535 3300025900 Ga0207710_10039518 Ga0207710_100395182 313
536 3300031238 Ga0265332_10000020 Ga0265332_1000002083 313
537 3300037471 Ga0395905_0000043 Ga0395905_0000043_86931_87881 313
538 3300042876 Ga0451577_0027697 Ga0451577_0027697_1951_2895 313
539 3300048906 Ga0496103_0126055 Ga0496103_0126055_658_1617 313
540 3300048928 Ga0496125_0001081 Ga0496125_0001081_4144_5100 313
541 3300048928 Ga0496125_0031642 Ga0496125_0031642_1125_2084 313
542 3300049581 Ga0501047_0044695 Ga0501047_0044695_1485_2432 313
543 3300002067 JGI24735J21928_10023803 JGI24735J21928_100238032 314
544 3300005335 Ga0070666_10000005 Ga0070666_1000000536 314
545 3300005367 Ga0070667_100058750 Ga0070667_1000587502 314
546 3300005548 Ga0070665_100009525 Ga0070665_1000095255 314
547 3300005844 Ga0068862_100034747 Ga0068862_1000347475 314
548 3300005937 Ga0081455_10095496 Ga0081455_100954963 314
549 3300009093 Ga0105240_10196689 Ga0105240_101966892 314
550 3300009176 Ga0105242_10378021 Ga0105242_103780212 314
551 3300009551 Ga0105238_10000783 Ga0105238_100007837 314
552 3300009553 Ga0105249_10060146 Ga0105249_100601463 314
553 3300013306 Ga0163162_10000281 Ga0163162_100002818 314
554 3300015687 Ga0183368_1003 Ga0183368_1003329 314
555 3300025903 Ga0207680_10000005 Ga0207680_10000005392 314
556 3300025913 Ga0207695_10176256 Ga0207695_101762562 314
557 3300025924 Ga0207694_10000916 Ga0207694_100009167 314
558 3300025986 Ga0207658_10124569 Ga0207658_101245692 314
559 3300028379 Ga0268266_10000004 Ga0268266_100000041138 314
560 3300028379 Ga0268266_10002024 Ga0268266_1000202411 314
561 3300028379 Ga0268266_10023735 Ga0268266_100237355 314
562 3300028380 Ga0268265_10468153 Ga0268265_104681531 314
563 3300028786 Ga0307517_10141289 Ga0307517_101412892 314
564 3300030521 Ga0307511_10027469 Ga0307511_100274693 314
565 3300031456 Ga0307513_10075865 Ga0307513_100758651 314
566 3300031730 Ga0307516_10000278 Ga0307516_100002787 314
567 3300033180 Ga0307510_10006365 Ga0307510_100063657 314
568 3300046471 Ga0495650_0000247 Ga0495650_0000247_77207_78166 314
569 3300046522 Ga0495643_0079816 Ga0495643_0079816_77_1024 314
570 3300046660 Ga0495625_0028453 Ga0495625_0028453_1042_1989 314
571 3300046660 Ga0495625_0054479 Ga0495625_0054479_96_1055 314
572 3300049587 Ga0501071_0085271 Ga0501071_0085271_133_1089 314
573 3300049591 Ga0501075_0119572 Ga0501075_0119572_750_1706 314
574 iso_pu_bacteria 2939611941 2939614744 314
575 2162886007 SwRhRL2b_contig_886698 SwRhRL2b_0587.00001690 315
576 3300001904 JGI24736J21556_1001980 JGI24736J21556_10019803 315
577 3300001915 JGI24741J21665_1001139 JGI24741J21665_10011398 315
578 3300001915 JGI24741J21665_1003731 JGI24741J21665_10037313 315
579 3300001979 JGI24740J21852_10003150 JGI24740J21852_100031503 315
580 3300001979 JGI24740J21852_10006936 JGI24740J21852_100069364 315
581 3300002737 JGI25162J39368_1000018 JGI25162J39368_1000018212 315
582 3300002737 JGI25162J39368_1000704 JGI25162J39368_10007043 315
583 3300002737 JGI25162J39368_1001950 JGI25162J39368_10019503 315
584 3300002741 JGI25157J39369_1000275 JGI25157J39369_10002756 315
585 3300002741 JGI25157J39369_1000340 JGI25157J39369_100034017 315
586 3300002771 JGI25163J39215_1000208 JGI25163J39215_100020812 315
587 3300002771 JGI25163J39215_1001733 JGI25163J39215_10017334 315
588 3300002771 JGI25163J39215_1001902 JGI25163J39215_10019021 315
589 3300002772 JGI25164J39214_1000007 JGI25164J39214_1000007212 315
590 3300002772 JGI25164J39214_1000044 JGI25164J39214_10000443 315
591 3300002772 JGI25164J39214_1000430 JGI25164J39214_10004303 315
592 3300003214 JGI25165J46597_1000029 JGI25165J46597_100002977 315
593 3300003214 JGI25165J46597_1000131 JGI25165J46597_1000131143 315
594 3300003214 JGI25165J46597_1000823 JGI25165J46597_10008233 315
595 3300003320 rootH2_10006354 rootH2_100063543 315
596 3300003761 Ga0055535_1000103 Ga0055535_100010342 315
597 3300003762 Ga0055542_1000024 Ga0055542_1000024212 315
598 3300003762 Ga0055542_1000222 Ga0055542_100022236 315
599 3300003763 Ga0055529_1000029 Ga0055529_1000029212 315
600 3300003781 Ga0055536_1008350 Ga0055536_10083503 315
601 3300003791 Ga0055530_10007740 Ga0055530_100077403 315
602 3300003792 Ga0055540_1006813 Ga0055540_10068133 315
603 3300003856 Ga0058692_1008408 Ga0058692_10084083 315
604 3300005288 Ga0065714_10007443 Ga0065714_100074432 315
605 3300005288 Ga0065714_10023853 Ga0065714_100238531 315
606 3300005288 Ga0065714_10023914 Ga0065714_100239142 315
607 3300005289 Ga0065704_10006559 Ga0065704_100065593 315
608 3300005295 Ga0065707_10083865 Ga0065707_100838657 315
609 3300005295 Ga0065707_10084601 Ga0065707_100846015 315
610 3300005329 Ga0070683_100002931 Ga0070683_10000293111 315
611 3300005330 Ga0070690_100033522 Ga0070690_1000335222 315
612 3300005331 Ga0070670_100095604 Ga0070670_1000956044 315
613 3300005335 Ga0070666_10003098 Ga0070666_100030985 315
614 3300005336 Ga0070680_100012331 Ga0070680_1000123316 315
615 3300005336 Ga0070680_100120675 Ga0070680_1001206751 315
616 3300005337 Ga0070682_100013148 Ga0070682_1000131481 315
617 3300005339 Ga0070660_100268669 Ga0070660_1002686692 315
618 3300005347 Ga0070668_100057599 Ga0070668_1000575991 315
619 3300005355 Ga0070671_100033474 Ga0070671_1000334743 315
620 3300005355 Ga0070671_100099071 Ga0070671_1000990713 315
621 3300005364 Ga0070673_100243204 Ga0070673_1002432042 315
622 3300005366 Ga0070659_100015907 Ga0070659_1000159073 315
623 3300005366 Ga0070659_100018099 Ga0070659_1000180995 315
624 3300005367 Ga0070667_100001132 Ga0070667_10000113224 315
625 3300005435 Ga0070714_100055822 Ga0070714_1000558224 315
626 3300005436 Ga0070713_100010511 Ga0070713_1000105112 315
627 3300005455 Ga0070663_100103612 Ga0070663_1001036122 315
628 3300005455 Ga0070663_100144313 Ga0070663_1001443132 315
629 3300005457 Ga0070662_100091548 Ga0070662_1000915482 315
630 3300005457 Ga0070662_100128584 Ga0070662_1001285842 315
631 3300005458 Ga0070681_10003200 Ga0070681_1000320015 315
632 3300005458 Ga0070681_10019847 Ga0070681_100198477 315
633 3300005458 Ga0070681_10047564 Ga0070681_100475642 315
634 3300005458 Ga0070681_10072780 Ga0070681_100727803 315
635 3300005466 Ga0070685_10223867 Ga0070685_102238671 315
636 3300005530 Ga0070679_100014688 Ga0070679_1000146883 315
637 3300005530 Ga0070679_100018626 Ga0070679_1000186266 315
638 3300005530 Ga0070679_100018670 Ga0070679_1000186703 315
639 3300005535 Ga0070684_100028987 Ga0070684_1000289873 315
640 3300005535 Ga0070684_100147187 Ga0070684_1001471872 315
641 3300005539 Ga0068853_100000945 Ga0068853_1000009455 315
642 3300005539 Ga0068853_100002755 Ga0068853_1000027552 315
643 3300005539 Ga0068853_100008261 Ga0068853_1000082614 315
644 3300005539 Ga0068853_100031047 Ga0068853_1000310472 315
645 3300005539 Ga0068853_100037042 Ga0068853_1000370422 315
646 3300005539 Ga0068853_100042270 Ga0068853_1000422702 315
647 3300005546 Ga0070696_100006935 Ga0070696_1000069353 315
648 3300005546 Ga0070696_100041176 Ga0070696_1000411761 315
649 3300005547 Ga0070693_100094415 Ga0070693_1000944151 315
650 3300005548 Ga0070665_100036439 Ga0070665_1000364393 315
651 3300005548 Ga0070665_100094043 Ga0070665_1000940434 315
652 3300005548 Ga0070665_100114298 Ga0070665_1001142982 315
653 3300005548 Ga0070665_100159718 Ga0070665_1001597182 315
654 3300005549 Ga0070704_100113447 Ga0070704_1001134472 315
655 3300005563 Ga0068855_100002047 Ga0068855_10000204716 315
656 3300005563 Ga0068855_100033560 Ga0068855_1000335603 315
657 3300005563 Ga0068855_100074556 Ga0068855_1000745561 315
658 3300005563 Ga0068855_100083604 Ga0068855_1000836041 315
659 3300005564 Ga0070664_100126911 Ga0070664_1001269112 315
660 3300005577 Ga0068857_100083642 Ga0068857_1000836422 315
661 3300005577 Ga0068857_100114947 Ga0068857_1001149472 315
662 3300005578 Ga0068854_100007913 Ga0068854_1000079133 315
663 3300005616 Ga0068852_100326809 Ga0068852_1003268091 315
664 3300005617 Ga0068859_100078758 Ga0068859_1000787584 315
665 3300005617 Ga0068859_100139190 Ga0068859_1001391902 315
666 3300005617 Ga0068859_100180988 Ga0068859_1001809884 315
667 3300005617 Ga0068859_100232990 Ga0068859_1002329902 315
668 3300005618 Ga0068864_100027628 Ga0068864_1000276282 315
669 3300005618 Ga0068864_100084211 Ga0068864_1000842114 315
670 3300005834 Ga0068851_10073307 Ga0068851_100733072 315
671 3300005834 Ga0068851_10105033 Ga0068851_101050331 315
672 3300005841 Ga0068863_100005838 Ga0068863_1000058385 315
673 3300005841 Ga0068863_100045644 Ga0068863_1000456443 315
674 3300005842 Ga0068858_100002370 Ga0068858_1000023703 315
675 3300005843 Ga0068860_100130869 Ga0068860_1001308693 315
676 3300005843 Ga0068860_100180852 Ga0068860_1001808522 315
677 3300005844 Ga0068862_100242761 Ga0068862_1002427612 315
678 3300006038 Ga0075365_10000037 Ga0075365_1000003745 315
679 3300006042 Ga0075368_10040639 Ga0075368_100406392 315
680 3300006048 Ga0075363_100014120 Ga0075363_1000141202 315
681 3300006051 Ga0075364_10020835 Ga0075364_100208352 315
682 3300006051 Ga0075364_10175708 Ga0075364_101757081 315
683 3300006058 Ga0075432_10005828 Ga0075432_100058283 315
684 3300006058 Ga0075432_10028272 Ga0075432_100282721 315
685 3300006177 Ga0075362_10033282 Ga0075362_100332822 315
686 3300006186 Ga0075369_10001270 Ga0075369_100012702 315
687 3300006195 Ga0075366_10022341 Ga0075366_100223415 315
688 3300006237 Ga0097621_100021251 Ga0097621_1000212514 315
689 3300006353 Ga0075370_10000070 Ga0075370_1000007013 315
690 3300006358 Ga0068871_100030329 Ga0068871_1000303292 315
691 3300006852 Ga0075433_10005441 Ga0075433_100054413 315
692 3300006871 Ga0075434_100000591 Ga0075434_10000059112 315
693 3300006914 Ga0075436_100288493 Ga0075436_1002884932 315
694 3300006931 Ga0097620_100078753 Ga0097620_1000787533 315
695 3300006931 Ga0097620_100139186 Ga0097620_1001391862 315
696 3300006931 Ga0097620_100180993 Ga0097620_1001809932 315
697 3300006931 Ga0097620_100232983 Ga0097620_1002329832 315
698 3300009011 Ga0105251_10018815 Ga0105251_100188153 315
699 3300009036 Ga0105244_10009340 Ga0105244_100093405 315
700 3300009036 Ga0105244_10043069 Ga0105244_100430692 315
701 3300009092 Ga0105250_10015012 Ga0105250_100150122 315
702 3300009093 Ga0105240_10015710 Ga0105240_100157107 315
703 3300009094 Ga0111539_10007423 Ga0111539_100074235 315
704 3300009098 Ga0105245_10122305 Ga0105245_101223052 315
705 3300009098 Ga0105245_10203394 Ga0105245_102033943 315
706 3300009174 Ga0105241_10089636 Ga0105241_100896362 315
707 3300009176 Ga0105242_10138378 Ga0105242_101383782 315
708 3300009545 Ga0105237_10546745 Ga0105237_105467451 315
709 3300009551 Ga0105238_10303295 Ga0105238_103032952 315
710 3300010375 Ga0105239_10091374 Ga0105239_100913743 315
711 3300010375 Ga0105239_10203762 Ga0105239_102037622 315
712 3300011119 Ga0105246_10191067 Ga0105246_101910671 315
713 3300012498 Ga0157345_1000590 Ga0157345_10005902 315
714 3300013100 Ga0157373_10009114 Ga0157373_100091145 315
715 3300013100 Ga0157373_10012457 Ga0157373_100124574 315
716 3300013100 Ga0157373_10052163 Ga0157373_100521632 315
717 3300013100 Ga0157373_10199127 Ga0157373_101991271 315
718 3300013102 Ga0157371_10001610 Ga0157371_1000161024 315
719 3300013102 Ga0157371_10009007 Ga0157371_100090075 315
720 3300013102 Ga0157371_10034860 Ga0157371_100348603 315
721 3300013102 Ga0157371_10059202 Ga0157371_100592022 315
722 3300013104 Ga0157370_10004805 Ga0157370_100048053 315
723 3300013104 Ga0157370_10009321 Ga0157370_1000932110 315
724 3300013104 Ga0157370_10024154 Ga0157370_100241542 315
725 3300013104 Ga0157370_10036936 Ga0157370_100369361 315
726 3300013104 Ga0157370_10312457 Ga0157370_103124572 315
727 3300013105 Ga0157369_10006171 Ga0157369_1000617110 315
728 3300013105 Ga0157369_10053073 Ga0157369_100530732 315
729 3300013105 Ga0157369_10055203 Ga0157369_100552033 315
730 3300013296 Ga0157374_10726072 Ga0157374_107260721 315
731 3300013297 Ga0157378_10039614 Ga0157378_100396142 315
732 3300013306 Ga0163162_10011705 Ga0163162_100117054 315
733 3300013306 Ga0163162_10014199 Ga0163162_100141993 315
734 3300013306 Ga0163162_10020384 Ga0163162_100203845 315
735 3300013306 Ga0163162_10077075 Ga0163162_100770752 315
736 3300013307 Ga0157372_10005727 Ga0157372_100057272 315
737 3300013307 Ga0157372_10014832 Ga0157372_100148323 315
738 3300013307 Ga0157372_10038888 Ga0157372_100388883 315
739 3300013307 Ga0157372_10059072 Ga0157372_100590723 315
740 3300013307 Ga0157372_10097092 Ga0157372_100970923 315
741 3300013307 Ga0157372_10097910 Ga0157372_100979103 315
742 3300013307 Ga0157372_10149416 Ga0157372_101494161 315
743 3300013307 Ga0157372_10581304 Ga0157372_105813041 315
744 3300013308 Ga0157375_10001264 Ga0157375_100012642 315
745 3300013308 Ga0157375_10093638 Ga0157375_100936382 315
746 3300013308 Ga0157375_10310655 Ga0157375_103106553 315
747 3300013308 Ga0157375_10387975 Ga0157375_103879752 315
748 3300014326 Ga0157380_10240014 Ga0157380_102400141 315
749 3300014326 Ga0157380_10295444 Ga0157380_102954441 315
750 3300014497 Ga0182008_10010615 Ga0182008_100106153 315
751 3300014497 Ga0182008_10010925 Ga0182008_100109253 315
752 3300014497 Ga0182008_10015868 Ga0182008_100158682 315
753 3300014497 Ga0182008_10045788 Ga0182008_100457882 315
754 3300014968 Ga0157379_10262489 Ga0157379_102624892 315
755 3300014969 Ga0157376_10012224 Ga0157376_100122242 315
756 3300014969 Ga0157376_10020600 Ga0157376_100206002 315
757 3300014969 Ga0157376_10119112 Ga0157376_101191121 315
758 3300014969 Ga0157376_10197429 Ga0157376_101974292 315
759 3300015261 Ga0182006_1039310 Ga0182006_10393101 315
760 3300015261 Ga0182006_1047948 Ga0182006_10479481 315
761 3300015265 Ga0182005_1015088 Ga0182005_10150881 315
762 3300015687 Ga0183368_1004 Ga0183368_1004421 315
763 3300017792 Ga0163161_10055493 Ga0163161_100554933 315
764 3300017792 Ga0163161_10082124 Ga0163161_100821242 315
765 3300017792 Ga0163161_10097625 Ga0163161_100976252 315
766 3300020070 Ga0206356_10595342 Ga0206356_105953422 315
767 3300020070 Ga0206356_11523636 Ga0206356_115236364 315
768 3300020080 Ga0206350_10027870 Ga0206350_100278702 315
769 3300020081 Ga0206354_10110314 Ga0206354_101103145 315
770 3300020082 Ga0206353_10713427 Ga0206353_107134273 315
771 3300020610 Ga0154015_1104391 Ga0154015_11043918 315
772 3300022467 Ga0224712_10059275 Ga0224712_100592752 315
773 3300025207 Ga0209760_100026 Ga0209760_100026175 315
774 3300025207 Ga0209760_100089 Ga0209760_1000897 315
775 3300025207 Ga0209760_100235 Ga0209760_10023511 315
776 3300025224 Ga0209784_100026 Ga0209784_100026195 315
777 3300025226 Ga0209674_100016 Ga0209674_100016210 315
778 3300025226 Ga0209674_101249 Ga0209674_1012492 315
779 3300025230 Ga0209563_101102 Ga0209563_1011024 315
780 3300025231 Ga0207427_100011 Ga0207427_100011225 315
781 3300025231 Ga0207427_100015 Ga0207427_100015329 315
782 3300025231 Ga0207427_100023 Ga0207427_100023195 315
783 3300025231 Ga0207427_100105 Ga0207427_10010541 315
784 3300025231 Ga0207427_100107 Ga0207427_10010728 315
785 3300025231 Ga0207427_101563 Ga0207427_1015632 315
786 3300025233 Ga0209437_100027 Ga0209437_100027186 315
787 3300025233 Ga0209437_100039 Ga0209437_10003985 315
788 3300025233 Ga0209437_100044 Ga0209437_100044225 315
789 3300025233 Ga0209437_100069 Ga0209437_10006967 315
790 3300025233 Ga0209437_100129 Ga0209437_100129105 315
791 3300025233 Ga0209437_100252 Ga0209437_10025248 315
792 3300025242 Ga0209258_100059 Ga0209258_100059195 315
793 3300025242 Ga0209258_101567 Ga0209258_1015674 315
794 3300025246 Ga0209646_1000577 Ga0209646_10005778 315
795 3300025246 Ga0209646_1014065 Ga0209646_10140651 315
796 3300025250 Ga0209026_1000036 Ga0209026_100003658 315
797 3300025250 Ga0209026_1000105 Ga0209026_1000105135 315
798 3300025250 Ga0209026_1001141 Ga0209026_10011413 315
799 3300025254 Ga0209148_1000002 Ga0209148_10000022132 315
800 3300025254 Ga0209148_1000010 Ga0209148_1000010194 315
801 3300025256 Ga0209759_1000300 Ga0209759_100030036 315
802 3300025261 Ga0209233_1000009 Ga0209233_1000009977 315
803 3300025261 Ga0209233_1000039 Ga0209233_1000039329 315
804 3300025261 Ga0209233_1000057 Ga0209233_1000057225 315
805 3300025261 Ga0209233_1000224 Ga0209233_100022464 315
806 3300025261 Ga0209233_1000227 Ga0209233_100022717 315
807 3300025261 Ga0209233_1000300 Ga0209233_100030050 315
808 3300025272 Ga0209455_1000020 Ga0209455_1000020409 315
809 3300025292 Ga0209676_1000017 Ga0209676_1000017330 315
810 3300025292 Ga0209676_1006665 Ga0209676_10066652 315
811 3300025298 Ga0209050_1000062 Ga0209050_100006212 315
812 3300025298 Ga0209050_1000508 Ga0209050_100050864 315
813 3300025303 Ga0209051_1000060 Ga0209051_100006012 315
814 3300025303 Ga0209051_1002917 Ga0209051_10029173 315
815 3300025321 Ga0207656_10023055 Ga0207656_100230552 315
816 3300025711 Ga0207696_1000051 Ga0207696_1000051206 315
817 3300025711 Ga0207696_1011441 Ga0207696_10114413 315
818 3300025728 Ga0207655_1008619 Ga0207655_10086196 315
819 3300025728 Ga0207655_1011063 Ga0207655_10110634 315
820 3300025728 Ga0207655_1020838 Ga0207655_10208382 315
821 3300025728 Ga0207655_1031388 Ga0207655_10313883 315
822 3300025728 Ga0207655_1033697 Ga0207655_10336973 315
823 3300025735 Ga0207713_1000397 Ga0207713_100039739 315
824 3300025735 Ga0207713_1012424 Ga0207713_10124242 315
825 3300025903 Ga0207680_10004362 Ga0207680_100043623 315
826 3300025903 Ga0207680_10080179 Ga0207680_100801792 315
827 3300025904 Ga0207647_10001740 Ga0207647_100017408 315
828 3300025904 Ga0207647_10003545 Ga0207647_100035459 315
829 3300025904 Ga0207647_10004435 Ga0207647_100044355 315
830 3300025904 Ga0207647_10005413 Ga0207647_100054139 315
831 3300025904 Ga0207647_10033287 Ga0207647_100332872 315
832 3300025909 Ga0207705_10004364 Ga0207705_100043648 315
833 3300025909 Ga0207705_10008125 Ga0207705_100081253 315
834 3300025909 Ga0207705_10014569 Ga0207705_100145693 315
835 3300025909 Ga0207705_10021453 Ga0207705_100214532 315
836 3300025909 Ga0207705_10059564 Ga0207705_100595642 315
837 3300025909 Ga0207705_10128226 Ga0207705_101282262 315
838 3300025912 Ga0207707_10000630 Ga0207707_1000063029 315
839 3300025912 Ga0207707_10000644 Ga0207707_1000064429 315
840 3300025912 Ga0207707_10000699 Ga0207707_1000069915 315
841 3300025912 Ga0207707_10007899 Ga0207707_100078999 315
842 3300025912 Ga0207707_10009345 Ga0207707_100093458 315
843 3300025912 Ga0207707_10016237 Ga0207707_100162372 315
844 3300025912 Ga0207707_10035181 Ga0207707_100351813 315
845 3300025912 Ga0207707_10036397 Ga0207707_100363972 315
846 3300025912 Ga0207707_10036560 Ga0207707_100365603 315
847 3300025912 Ga0207707_10095396 Ga0207707_100953962 315
848 3300025913 Ga0207695_10000975 Ga0207695_100009753 315
849 3300025913 Ga0207695_10038190 Ga0207695_100381902 315
850 3300025913 Ga0207695_10046997 Ga0207695_100469973 315
851 3300025913 Ga0207695_10065507 Ga0207695_100655072 315
852 3300025915 Ga0207693_10080089 Ga0207693_100800892 315
853 3300025917 Ga0207660_10004613 Ga0207660_100046134 315
854 3300025917 Ga0207660_10005110 Ga0207660_100051103 315
855 3300025917 Ga0207660_10005371 Ga0207660_100053712 315
856 3300025917 Ga0207660_10021239 Ga0207660_100212393 315
857 3300025917 Ga0207660_10030404 Ga0207660_100304043 315
858 3300025919 Ga0207657_10003793 Ga0207657_100037932 315
859 3300025919 Ga0207657_10006186 Ga0207657_100061867 315
860 3300025919 Ga0207657_10082329 Ga0207657_100823292 315
861 3300025920 Ga0207649_10009210 Ga0207649_100092102 315
862 3300025920 Ga0207649_10028400 Ga0207649_100284002 315
863 3300025920 Ga0207649_10198315 Ga0207649_101983151 315
864 3300025920 Ga0207649_10212141 Ga0207649_102121411 315
865 3300025921 Ga0207652_10000030 Ga0207652_1000003038 315
866 3300025921 Ga0207652_10000719 Ga0207652_1000071913 315
867 3300025921 Ga0207652_10000940 Ga0207652_1000094024 315
868 3300025921 Ga0207652_10001717 Ga0207652_100017172 315
869 3300025921 Ga0207652_10012038 Ga0207652_100120383 315
870 3300025921 Ga0207652_10012507 Ga0207652_100125073 315
871 3300025921 Ga0207652_10036615 Ga0207652_100366153 315
872 3300025921 Ga0207652_10067572 Ga0207652_100675722 315
873 3300025923 Ga0207681_10165378 Ga0207681_101653781 315
874 3300025924 Ga0207694_10038513 Ga0207694_100385133 315
875 3300025925 Ga0207650_10038734 Ga0207650_100387344 315
876 3300025927 Ga0207687_10086432 Ga0207687_100864322 315
877 3300025927 Ga0207687_10099429 Ga0207687_100994292 315
878 3300025928 Ga0207700_10015898 Ga0207700_100158983 315
879 3300025929 Ga0207664_10000109 Ga0207664_1000010917 315
880 3300025929 Ga0207664_10157055 Ga0207664_101570551 315
881 3300025931 Ga0207644_10076861 Ga0207644_100768612 315
882 3300025931 Ga0207644_10118698 Ga0207644_101186982 315
883 3300025932 Ga0207690_10000729 Ga0207690_100007295 315
884 3300025932 Ga0207690_10000799 Ga0207690_1000079922 315
885 3300025932 Ga0207690_10006154 Ga0207690_100061543 315
886 3300025932 Ga0207690_10006729 Ga0207690_100067293 315
887 3300025932 Ga0207690_10015212 Ga0207690_100152121 315
888 3300025932 Ga0207690_10024146 Ga0207690_100241464 315
889 3300025932 Ga0207690_10030630 Ga0207690_100306303 315
890 3300025933 Ga0207706_10012181 Ga0207706_100121813 315
891 3300025933 Ga0207706_10041980 Ga0207706_100419802 315
892 3300025933 Ga0207706_10163310 Ga0207706_101633102 315
893 3300025934 Ga0207686_10202431 Ga0207686_102024311 315
894 3300025935 Ga0207709_10003679 Ga0207709_100036794 315
895 3300025936 Ga0207670_10006074 Ga0207670_100060742 315
896 3300025940 Ga0207691_10025713 Ga0207691_100257133 315
897 3300025942 Ga0207689_10024604 Ga0207689_100246043 315
898 3300025944 Ga0207661_10001956 Ga0207661_100019566 315
899 3300025945 Ga0207679_10009626 Ga0207679_100096263 315
900 3300025949 Ga0207667_10000679 Ga0207667_1000067940 315
901 3300025949 Ga0207667_10018339 Ga0207667_100183392 315
902 3300025949 Ga0207667_10022064 Ga0207667_100220642 315
903 3300025949 Ga0207667_10030354 Ga0207667_100303544 315
904 3300025949 Ga0207667_10039557 Ga0207667_100395573 315
905 3300025949 Ga0207667_10041288 Ga0207667_100412882 315
906 3300025949 Ga0207667_10048410 Ga0207667_100484102 315
907 3300025949 Ga0207667_10058956 Ga0207667_100589563 315
908 3300025949 Ga0207667_10079388 Ga0207667_100793883 315
909 3300025960 Ga0207651_10085653 Ga0207651_100856531 315
910 3300025960 Ga0207651_10223351 Ga0207651_102233512 315
911 3300025981 Ga0207640_10003658 Ga0207640_100036588 315
912 3300025981 Ga0207640_10020984 Ga0207640_100209842 315
913 3300025981 Ga0207640_10026972 Ga0207640_100269723 315
914 3300025981 Ga0207640_10029460 Ga0207640_100294603 315
915 3300025986 Ga0207658_10001749 Ga0207658_100017492 315
916 3300025986 Ga0207658_10095315 Ga0207658_100953152 315
917 3300026023 Ga0207677_10246370 Ga0207677_102463701 315
918 3300026035 Ga0207703_10002882 Ga0207703_1000288214 315
919 3300026041 Ga0207639_10000174 Ga0207639_1000017448 315
920 3300026041 Ga0207639_10000513 Ga0207639_1000051312 315
921 3300026041 Ga0207639_10002691 Ga0207639_100026913 315
922 3300026041 Ga0207639_10012806 Ga0207639_100128062 315
923 3300026041 Ga0207639_10044758 Ga0207639_100447583 315
924 3300026041 Ga0207639_10048492 Ga0207639_100484922 315
925 3300026041 Ga0207639_10053524 Ga0207639_100535242 315
926 3300026067 Ga0207678_10002717 Ga0207678_100027172 315
927 3300026067 Ga0207678_10025836 Ga0207678_100258362 315
928 3300026067 Ga0207678_10030603 Ga0207678_100306032 315
929 3300026067 Ga0207678_10065984 Ga0207678_100659842 315
930 3300026067 Ga0207678_10094868 Ga0207678_100948682 315
931 3300026078 Ga0207702_10004220 Ga0207702_100042205 315
932 3300026078 Ga0207702_10012242 Ga0207702_100122425 315
933 3300026078 Ga0207702_10048806 Ga0207702_100488062 315
934 3300026078 Ga0207702_10060640 Ga0207702_100606402 315
935 3300026078 Ga0207702_10083218 Ga0207702_100832183 315
936 3300026078 Ga0207702_10237690 Ga0207702_102376902 315
937 3300026078 Ga0207702_10407001 Ga0207702_104070011 315
938 3300026088 Ga0207641_10045696 Ga0207641_100456962 315
939 3300026088 Ga0207641_10047189 Ga0207641_100471894 315
940 3300026095 Ga0207676_10036177 Ga0207676_100361772 315
941 3300026116 Ga0207674_10004902 Ga0207674_100049022 315
942 3300026116 Ga0207674_10008708 Ga0207674_100087083 315
943 3300026116 Ga0207674_10030156 Ga0207674_100301562 315
944 3300026121 Ga0207683_10026765 Ga0207683_100267651 315
945 3300026121 Ga0207683_10104416 Ga0207683_101044162 315
946 3300026121 Ga0207683_10149374 Ga0207683_101493742 315
947 3300026142 Ga0207698_10002583 Ga0207698_100025834 315
948 3300026142 Ga0207698_10003400 Ga0207698_100034009 315
949 3300026142 Ga0207698_10007313 Ga0207698_100073137 315
950 3300026142 Ga0207698_10161485 Ga0207698_101614852 315
951 3300026142 Ga0207698_10268212 Ga0207698_102682122 315
952 3300027312 Ga0209371_1000360 Ga0209371_100036033 315
953 3300027395 Ga0209996_1007749 Ga0209996_10077492 315
954 3300027543 Ga0209999_1014480 Ga0209999_10144802 315
955 3300027617 Ga0210002_1005269 Ga0210002_10052691 315
956 3300027665 Ga0209983_1002344 Ga0209983_10023444 315
957 3300027682 Ga0209971_1000373 Ga0209971_10003739 315
958 3300027866 Ga0209813_10008860 Ga0209813_100088602 315
959 3300027876 Ga0209974_10006082 Ga0209974_100060825 315
960 3300027907 Ga0207428_10006431 Ga0207428_100064319 315
961 3300027907 Ga0207428_10094872 Ga0207428_100948723 315
962 3300027907 Ga0207428_10129356 Ga0207428_101293562 315
963 3300027907 Ga0207428_10149017 Ga0207428_101490171 315
964 3300027907 Ga0207428_10324860 Ga0207428_103248601 315
965 3300028379 Ga0268266_10048144 Ga0268266_100481443 315
966 3300028381 Ga0268264_10020403 Ga0268264_100204033 315
967 3300028381 Ga0268264_10072956 Ga0268264_100729562 315
968 3300028786 Ga0307517_10001511 Ga0307517_1000151116 315
969 3300028794 Ga0307515_10002191 Ga0307515_1000219135 315
970 3300028794 Ga0307515_10086241 Ga0307515_100862415 315
971 3300028794 Ga0307515_10166542 Ga0307515_101665424 315
972 3300028800 Ga0265338_10019938 Ga0265338_100199383 315
973 3300030500 Ga0268256_1000306 Ga0268256_100030613 315
974 3300031239 Ga0265328_10002748 Ga0265328_100027482 315
975 3300031247 Ga0265340_10009410 Ga0265340_100094103 315
976 3300031250 Ga0265331_10009690 Ga0265331_100096903 315
977 3300031251 Ga0265327_10000696 Ga0265327_1000069621 315
978 3300031456 Ga0307513_10037752 Ga0307513_100377525 315
979 3300031456 Ga0307513_10241173 Ga0307513_102411731 315
980 3300031507 Ga0307509_10003552 Ga0307509_1000355224 315
981 3300031507 Ga0307509_10030410 Ga0307509_100304107 315
982 3300031507 Ga0307509_10063399 Ga0307509_100633994 315
983 3300031507 Ga0307509_10335217 Ga0307509_103352172 315
984 3300031548 Ga0307408_100000004 Ga0307408_100000004539 315
985 3300031548 Ga0307408_100129550 Ga0307408_1001295502 315
986 3300031665 Ga0316575_10081722 Ga0316575_100817222 315
987 3300031691 Ga0316579_10024667 Ga0316579_100246671 315
988 3300031727 Ga0316576_10018808 Ga0316576_100188083 315
989 3300031727 Ga0316576_10029083 Ga0316576_100290832 315
990 3300031727 Ga0316576_10070050 Ga0316576_100700502 315
991 3300031733 Ga0316577_10024003 Ga0316577_100240032 315
992 3300031995 Ga0307409_100253384 Ga0307409_1002533842 315
993 3300032004 Ga0307414_10098828 Ga0307414_100988282 315
994 3300032137 Ga0316585_10005266 Ga0316585_100052662 315
995 3300033179 Ga0307507_10021035 Ga0307507_100210357 315
996 3300033180 Ga0307510_10024655 Ga0307510_100246554 315
997 3300033180 Ga0307510_10056428 Ga0307510_100564283 315
998 3300033180 Ga0307510_10068525 Ga0307510_100685251 315
999 3300033180 Ga0307510_10190831 Ga0307510_101908311 315
1000 3300035170 Ga0373943_0108649 Ga0373943_0108649_189_1139 315
1001 3300035170 Ga0373943_0176947 Ga0373943_0176947_202_1155 315
1002 3300035398 Ga0316574_0016143 Ga0316574_0016143_975_1940 315
1003 3300035398 Ga0316574_0027646 Ga0316574_0027646_1722_2684 315
1004 3300035691 Ga0373931_0014186 Ga0373931_0014186_1821_2774 315
1005 3300035692 Ga0373935_0013173 Ga0373935_0013173_1770_2726 315
1006 3300035695 Ga0373927_0018005 Ga0373927_0018005_1365_2336 315
1007 3300035695 Ga0373927_0038788 Ga0373927_0038788_1699_2649 315
1008 3300036401 Ga0373937_0089511 Ga0373937_0089511_225_1187 315
1009 3300036647 Ga0316582_0034258 Ga0316582_0034258_1919_2884 315
1010 3300036712 Ga0316584_0003999 Ga0316584_0003999_8104_9069 315
1011 3300036712 Ga0316584_0053751 Ga0316584_0053751_259_1257 315
1012 3300037068 Ga0373925_0013961 Ga0373925_0013961_300_1250 315
1013 3300037068 Ga0373925_0050073 Ga0373925_0050073_1596_2552 315
1014 3300037068 Ga0373925_0128567 Ga0373925_0128567_926_1876 315
1015 3300037068 Ga0373925_0196156 Ga0373925_0196156_497_1450 315
1016 3300037312 Ga0395899_0046545 Ga0395899_0046545_2002_2964 315
1017 3300037418 Ga0395900_0021982 Ga0395900_0021982_3100_4086 315
1018 3300037418 Ga0395900_0190954 Ga0395900_0190954_434_1396 315
1019 3300037466 Ga0395898_0043661 Ga0395898_0043661_2450_3412 315
1020 3300037466 Ga0395898_0177291 Ga0395898_0177291_647_1639 315
1021 3300037466 Ga0395898_0246903 Ga0395898_0246903_286_1248 315
1022 3300038443 Ga0395901_0001799 Ga0395901_0001799_17736_18701 315
1023 3300038443 Ga0395901_0021740 Ga0395901_0021740_3527_4489 315
1024 3300038443 Ga0395901_0093046 Ga0395901_0093046_2057_3049 315
1025 3300039438 Ga0436360_0096801 Ga0436360_0096801_1318_2313 315
1026 3300039438 Ga0436360_1280455 Ga0436360_1280455_150_1121 315
1027 3300041404 Ga0439436_0002294 Ga0439436_0002294_4693_5643 315
1028 3300041405 Ga0439438_002578 Ga0439438_002578_2600_3550 315
1029 3300041405 Ga0439438_007706 Ga0439438_007706_1043_2002 315
1030 3300041405 Ga0439438_007817 Ga0439438_007817_808_1767 315
1031 3300041405 Ga0439438_010145 Ga0439438_010145_416_1375 315
1032 3300041405 Ga0439438_021235 Ga0439438_021235_284_1243 315
1033 3300041405 Ga0439438_032534 Ga0439438_032534_304_1263 315
1034 3300041407 Ga0439447_002139 Ga0439447_002139_4293_5243 315
1035 3300041407 Ga0439447_005552 Ga0439447_005552_1726_2685 315
1036 3300041407 Ga0439447_028981 Ga0439447_028981_261_1220 315
1037 3300041411 Ga0439466_0005337 Ga0439466_0005337_2518_3468 315
1038 3300041411 Ga0439466_0006628 Ga0439466_0006628_1649_2599 315
1039 3300041411 Ga0439466_0015997 Ga0439466_0015997_750_1709 315
1040 3300041411 Ga0439466_0025261 Ga0439466_0025261_706_1665 315
1041 3300041411 Ga0439466_0030704 Ga0439466_0030704_815_1765 315
1042 3300041453 Ga0451797_0854670 Ga0451797_0854670_27_977 315
1043 3300041460 Ga0451802_1080082 Ga0451802_1080082_604_1557 315
1044 3300041486 Ga0451807_0480466 Ga0451807_0480466_184_1146 315
1045 3300041512 Ga0451853_0608741 Ga0451853_0608741_978_1940 315
1046 3300042006 Ga0439432_007489 Ga0439432_007489_1844_2803 315
1047 3300042009 Ga0439451_001585 Ga0439451_001585_378_1328 315
1048 3300042009 Ga0439451_006191 Ga0439451_006191_1181_2140 315
1049 3300042010 Ga0439452_005352 Ga0439452_005352_1518_2477 315
1050 3300042010 Ga0439452_005534 Ga0439452_005534_1484_2434 315
1051 3300042010 Ga0439452_007705 Ga0439452_007705_1658_2617 315
1052 3300042010 Ga0439452_008951 Ga0439452_008951_1135_2085 315
1053 3300042010 Ga0439452_029851 Ga0439452_029851_210_1169 315
1054 3300042013 Ga0439456_010280 Ga0439456_010280_31_981 315
1055 3300042013 Ga0439456_013745 Ga0439456_013745_593_1552 315
1056 3300042016 Ga0439463_004331 Ga0439463_004331_1623_2573 315
1057 3300042016 Ga0439463_038252 Ga0439463_038252_170_1129 315
1058 3300042115 Ga0450911_004131 Ga0450911_004131_889_1848 315
1059 3300042122 Ga0450920_002485 Ga0450920_002485_1030_1989 315
1060 3300042124 Ga0450922_000519 Ga0450922_000519_1776_2735 315
1061 3300042125 Ga0450923_010172 Ga0450923_010172_361_1320 315
1062 3300042127 Ga0450890_002488 Ga0450890_002488_1069_2028 315
1063 3300042137 Ga0450902_002746 Ga0450902_002746_1528_2487 315
1064 3300042138 Ga0450903_002871 Ga0450903_002871_1625_2584 315
1065 3300042138 Ga0450903_004407 Ga0450903_004407_177_1136 315
1066 3300042142 Ga0450905_002981 Ga0450905_002981_982_1941 315
1067 3300042144 Ga0450889_003532 Ga0450889_003532_101_1060 315
1068 3300042145 Ga0450906_003928 Ga0450906_003928_699_1658 315
1069 3300042146 Ga0450907_002892 Ga0450907_002892_848_1807 315
1070 3300042146 Ga0450907_002985 Ga0450907_002985_1647_2606 315
1071 3300042147 Ga0450910_001185 Ga0450910_001185_622_1581 315
1072 3300042156 Ga0439446_0002197 Ga0439446_0002197_1676_2626 315
1073 3300042156 Ga0439446_0008400 Ga0439446_0008400_592_1542 315
1074 3300042184 Ga0450908_002805 Ga0450908_002805_1287_2246 315
1075 3300042435 Ga0439434_0024141 Ga0439434_0024141_511_1470 315
1076 3300042439 Ga0439464_0020409 Ga0439464_0020409_43_993 315
1077 3300042461 Ga0439460_0009588 Ga0439460_0009588_623_1582 315
1078 3300042532 Ga0450893_0016029 Ga0450893_0016029_94_1053 315
1079 3300042876 Ga0451577_0012480 Ga0451577_0012480_741_1703 315
1080 3300042876 Ga0451577_0153792 Ga0451577_0153792_919_1881 315
1081 3300042993 Ga0439440_0002625 Ga0439440_0002625_813_1772 315
1082 3300042993 Ga0439440_0016632 Ga0439440_0016632_271_1221 315
1083 3300044683 Ga0466965_0091699 Ga0466965_0091699_20_1018 315
1084 3300044684 Ga0466966_0002865 Ga0466966_0002865_1465_2463 315
1085 3300044706 Ga0466964_0012755 Ga0466964_0012755_1758_2756 315
1086 3300044712 Ga0453684_0000298 Ga0453684_0000298_175684_176649 315
1087 3300044712 Ga0453684_0492301 Ga0453684_0492301_244_1197 315
1088 3300044719 Ga0466971_0079721 Ga0466971_0079721_507_1466 315
1089 3300044842 Ga0466957_0050559 Ga0466957_0050559_839_1837 315
1090 3300045049 Ga0466959_0002272 Ga0466959_0002272_8435_9433 315
1091 3300045051 Ga0451576_0000033 Ga0451576_0000033_216483_217448 315
1092 3300045836 Ga0466958_0145291 Ga0466958_0145291_402_1400 315
1093 3300046452 Ga0495617_011643 Ga0495617_011643_472_1431 315
1094 3300046452 Ga0495617_012097 Ga0495617_012097_859_1920 315
1095 3300046452 Ga0495617_019326 Ga0495617_019326_32_991 315
1096 3300046452 Ga0495617_024212 Ga0495617_024212_401_1360 315
1097 3300046453 Ga0495627_004072 Ga0495627_004072_1655_2716 315
1098 3300046453 Ga0495627_013476 Ga0495627_013476_264_1325 315
1099 3300046453 Ga0495627_013799 Ga0495627_013799_875_1834 315
1100 3300046453 Ga0495627_015586 Ga0495627_015586_1169_2128 315
1101 3300046453 Ga0495627_027340 Ga0495627_027340_61_1020 315
1102 3300046454 Ga0495592_0090282 Ga0495592_0090282_1089_2048 315
1103 3300046455 Ga0495603_0044887 Ga0495603_0044887_1642_2601 315
1104 3300046457 Ga0495590_0008530 Ga0495590_0008530_1340_2299 315
1105 3300046457 Ga0495590_0012865 Ga0495590_0012865_493_1452 315
1106 3300046457 Ga0495590_0040385 Ga0495590_0040385_227_1288 315
1107 3300046457 Ga0495590_0066642 Ga0495590_0066642_61_1011 315
1108 3300046458 Ga0495591_003793 Ga0495591_003793_4989_6050 315
1109 3300046458 Ga0495591_006286 Ga0495591_006286_2771_3730 315
1110 3300046458 Ga0495591_013413 Ga0495591_013413_836_1822 315
1111 3300046458 Ga0495591_013948 Ga0495591_013948_203_1264 315
1112 3300046458 Ga0495591_014946 Ga0495591_014946_203_1162 315
1113 3300046458 Ga0495591_020806 Ga0495591_020806_309_1325 315
1114 3300046458 Ga0495591_021381 Ga0495591_021381_199_1260 315
1115 3300046458 Ga0495591_024787 Ga0495591_024787_160_1119 315
1116 3300046458 Ga0495591_025008 Ga0495591_025008_34_993 315
1117 3300046458 Ga0495591_050382 Ga0495591_050382_148_1107 315
1118 3300046460 Ga0495638_0000166 Ga0495638_0000166_41993_42958 315
1119 3300046460 Ga0495638_0011829 Ga0495638_0011829_1652_2611 315
1120 3300046460 Ga0495638_0021123 Ga0495638_0021123_1709_2668 315
1121 3300046460 Ga0495638_0024878 Ga0495638_0024878_1632_2591 315
1122 3300046460 Ga0495638_0028642 Ga0495638_0028642_1018_1977 315
1123 3300046460 Ga0495638_0046425 Ga0495638_0046425_925_1884 315
1124 3300046460 Ga0495638_0079636 Ga0495638_0079636_1011_1970 315
1125 3300046460 Ga0495638_0091939 Ga0495638_0091939_15_974 315
1126 3300046460 Ga0495638_0114237 Ga0495638_0114237_133_1092 315
1127 3300046463 Ga0495653_0033007 Ga0495653_0033007_1531_2490 315
1128 3300046463 Ga0495653_0035949 Ga0495653_0035949_1308_2267 315
1129 3300046463 Ga0495653_0098453 Ga0495653_0098453_1068_2027 315
1130 3300046471 Ga0495650_0000220 Ga0495650_0000220_96845_97849 315
1131 3300046471 Ga0495650_0013132 Ga0495650_0013132_1646_2605 315
1132 3300046471 Ga0495650_0039949 Ga0495650_0039949_279_1340 315
1133 3300046471 Ga0495650_0042917 Ga0495650_0042917_814_1773 315
1134 3300046471 Ga0495650_0052242 Ga0495650_0052242_551_1510 315
1135 3300046472 Ga0495580_0099599 Ga0495580_0099599_761_1720 315
1136 3300046473 Ga0495582_0020000 Ga0495582_0020000_1096_2055 315
1137 3300046474 Ga0495605_0021892 Ga0495605_0021892_1015_1974 315
1138 3300046474 Ga0495605_0041782 Ga0495605_0041782_297_1358 315
1139 3300046474 Ga0495605_0065114 Ga0495605_0065114_582_1541 315
1140 3300046474 Ga0495605_0092230 Ga0495605_0092230_218_1279 315
1141 3300046491 Ga0495584_0011769 Ga0495584_0011769_1817_2776 315
1142 3300046491 Ga0495584_0018741 Ga0495584_0018741_1600_2559 315
1143 3300046491 Ga0495584_0022127 Ga0495584_0022127_825_1784 315
1144 3300046491 Ga0495584_0049885 Ga0495584_0049885_320_1381 315
1145 3300046492 Ga0495585_0023142 Ga0495585_0023142_937_1896 315
1146 3300046492 Ga0495585_0029247 Ga0495585_0029247_1324_2283 315
1147 3300046492 Ga0495585_0031124 Ga0495585_0031124_1150_2109 315
1148 3300046492 Ga0495585_0094121 Ga0495585_0094121_346_1407 315
1149 3300046492 Ga0495585_0096876 Ga0495585_0096876_203_1264 315
1150 3300046500 Ga0495596_0058189 Ga0495596_0058189_233_1294 315
1151 3300046501 Ga0495607_0028798 Ga0495607_0028798_925_1986 315
1152 3300046501 Ga0495607_0032825 Ga0495607_0032825_596_1555 315
1153 3300046501 Ga0495607_0035935 Ga0495607_0035935_352_1413 315
1154 3300046501 Ga0495607_0057221 Ga0495607_0057221_267_1226 315
1155 3300046501 Ga0495607_0063267 Ga0495607_0063267_860_1921 315
1156 3300046501 Ga0495607_0098957 Ga0495607_0098957_159_1175 315
1157 3300046506 Ga0495583_0021660 Ga0495583_0021660_707_1666 315
1158 3300046506 Ga0495583_0033167 Ga0495583_0033167_1305_2366 315
1159 3300046506 Ga0495583_0121143 Ga0495583_0121143_19_1014 315
1160 3300046507 Ga0495606_0000050 Ga0495606_0000050_43804_44808 315
1161 3300046507 Ga0495606_0001020 Ga0495606_0001020_37306_38253 315
1162 3300046507 Ga0495606_0028377 Ga0495606_0028377_1620_2636 315
1163 3300046507 Ga0495606_0044821 Ga0495606_0044821_284_1345 315
1164 3300046507 Ga0495606_0048592 Ga0495606_0048592_284_1345 315
1165 3300046507 Ga0495606_0071466 Ga0495606_0071466_878_1837 315
1166 3300046512 Ga0495610_0007382 Ga0495610_0007382_4753_5712 315
1167 3300046512 Ga0495610_0017561 Ga0495610_0017561_1619_2578 315
1168 3300046512 Ga0495610_0044999 Ga0495610_0044999_348_1307 315
1169 3300046512 Ga0495610_0057942 Ga0495610_0057942_197_1156 315
1170 3300046512 Ga0495610_0074611 Ga0495610_0074611_374_1333 315
1171 3300046513 Ga0495616_0014329 Ga0495616_0014329_1716_2777 315
1172 3300046513 Ga0495616_0033475 Ga0495616_0033475_1383_2342 315
1173 3300046513 Ga0495616_0043813 Ga0495616_0043813_386_1345 315
1174 3300046513 Ga0495616_0053458 Ga0495616_0053458_468_1427 315
1175 3300046513 Ga0495616_0082991 Ga0495616_0082991_163_1122 315
1176 3300046515 Ga0495620_0011521 Ga0495620_0011521_1627_2586 315
1177 3300046515 Ga0495620_0020346 Ga0495620_0020346_836_1795 315
1178 3300046515 Ga0495620_0051245 Ga0495620_0051245_654_1613 315
1179 3300046515 Ga0495620_0072707 Ga0495620_0072707_293_1252 315
1180 3300046517 Ga0495630_0039302 Ga0495630_0039302_1088_2047 315
1181 3300046517 Ga0495630_0047459 Ga0495630_0047459_596_1555 315
1182 3300046518 Ga0495631_0015022 Ga0495631_0015022_1172_2131 315
1183 3300046518 Ga0495631_0021708 Ga0495631_0021708_293_1354 315
1184 3300046519 Ga0495632_0015410 Ga0495632_0015410_1683_2642 315
1185 3300046519 Ga0495632_0018801 Ga0495632_0018801_1194_2153 315
1186 3300046519 Ga0495632_0019682 Ga0495632_0019682_1534_2493 315
1187 3300046519 Ga0495632_0033723 Ga0495632_0033723_1635_2594 315
1188 3300046519 Ga0495632_0040171 Ga0495632_0040171_557_1516 315
1189 3300046519 Ga0495632_0040930 Ga0495632_0040930_380_1339 315
1190 3300046519 Ga0495632_0046005 Ga0495632_0046005_907_1968 315
1191 3300046519 Ga0495632_0046114 Ga0495632_0046114_875_1918 315
1192 3300046519 Ga0495632_0061363 Ga0495632_0061363_374_1330 315
1193 3300046519 Ga0495632_0066688 Ga0495632_0066688_281_1342 315
1194 3300046519 Ga0495632_0126128 Ga0495632_0126128_62_1021 315
1195 3300046519 Ga0495632_0157485 Ga0495632_0157485_67_1026 315
1196 3300046520 Ga0495637_0004170 Ga0495637_0004170_1530_2591 315
1197 3300046520 Ga0495637_0011979 Ga0495637_0011979_1549_2508 315
1198 3300046520 Ga0495637_0013660 Ga0495637_0013660_1629_2588 315
1199 3300046520 Ga0495637_0021374 Ga0495637_0021374_493_1452 315
1200 3300046520 Ga0495637_0025266 Ga0495637_0025266_1658_2617 315
1201 3300046520 Ga0495637_0032622 Ga0495637_0032622_438_1397 315
1202 3300046520 Ga0495637_0035701 Ga0495637_0035701_848_1807 315
1203 3300046520 Ga0495637_0037500 Ga0495637_0037500_714_1784 315
1204 3300046522 Ga0495643_0001804 Ga0495643_0001804_1638_2585 315
1205 3300046522 Ga0495643_0019647 Ga0495643_0019647_1263_2324 315
1206 3300046522 Ga0495643_0044027 Ga0495643_0044027_676_1623 315
1207 3300046522 Ga0495643_0050974 Ga0495643_0050974_909_1970 315
1208 3300046522 Ga0495643_0101232 Ga0495643_0101232_95_1054 315
1209 3300046522 Ga0495643_0137307 Ga0495643_0137307_19_1062 315
1210 3300046523 Ga0495644_0010877 Ga0495644_0010877_1637_2596 315
1211 3300046523 Ga0495644_0013921 Ga0495644_0013921_1650_2609 315
1212 3300046523 Ga0495644_0014265 Ga0495644_0014265_557_1516 315
1213 3300046523 Ga0495644_0041810 Ga0495644_0041810_391_1452 315
1214 3300046523 Ga0495644_0075970 Ga0495644_0075970_21_980 315
1215 3300046524 Ga0495648_0008878 Ga0495648_0008878_1639_2589 315
1216 3300046524 Ga0495648_0021620 Ga0495648_0021620_1922_2881 315
1217 3300046524 Ga0495648_0022426 Ga0495648_0022426_1594_2553 315
1218 3300046524 Ga0495648_0023263 Ga0495648_0023263_1592_2653 315
1219 3300046524 Ga0495648_0026425 Ga0495648_0026425_1347_2408 315
1220 3300046524 Ga0495648_0039691 Ga0495648_0039691_340_1401 315
1221 3300046524 Ga0495648_0074547 Ga0495648_0074547_464_1423 315
1222 3300046524 Ga0495648_0095876 Ga0495648_0095876_61_1020 315
1223 3300046524 Ga0495648_0120087 Ga0495648_0120087_93_1052 315
1224 3300046526 Ga0495666_0015825 Ga0495666_0015825_1648_2607 315
1225 3300046526 Ga0495666_0049024 Ga0495666_0049024_658_1617 315
1226 3300046528 Ga0495642_0006475 Ga0495642_0006475_1658_2617 315
1227 3300046528 Ga0495642_0006609 Ga0495642_0006609_1619_2578 315
1228 3300046530 Ga0495654_0008855 Ga0495654_0008855_2899_3960 315
1229 3300046530 Ga0495654_0022578 Ga0495654_0022578_1527_2486 315
1230 3300046530 Ga0495654_0023731 Ga0495654_0023731_540_1601 315
1231 3300046530 Ga0495654_0028107 Ga0495654_0028107_1598_2557 315
1232 3300046530 Ga0495654_0030659 Ga0495654_0030659_124_1083 315
1233 3300046530 Ga0495654_0036152 Ga0495654_0036152_151_1110 315
1234 3300046530 Ga0495654_0054535 Ga0495654_0054535_954_1904 315
1235 3300046530 Ga0495654_0065299 Ga0495654_0065299_746_1705 315
1236 3300046530 Ga0495654_0074531 Ga0495654_0074531_184_1143 315
1237 3300046535 Ga0495586_0033613 Ga0495586_0033613_1189_2139 315
1238 3300046536 Ga0495587_0028417 Ga0495587_0028417_1633_2592 315
1239 3300046538 Ga0495609_0007421 Ga0495609_0007421_2865_3824 315
1240 3300046538 Ga0495609_0021500 Ga0495609_0021500_1652_2713 315
1241 3300046538 Ga0495609_0029510 Ga0495609_0029510_1420_2379 315
1242 3300046538 Ga0495609_0076862 Ga0495609_0076862_294_1355 315
1243 3300046538 Ga0495609_0082241 Ga0495609_0082241_38_997 315
1244 3300046542 Ga0495597_0017913 Ga0495597_0017913_1632_2693 315
1245 3300046542 Ga0495597_0020203 Ga0495597_0020203_1578_2537 315
1246 3300046542 Ga0495597_0020987 Ga0495597_0020987_447_1406 315
1247 3300046542 Ga0495597_0023622 Ga0495597_0023622_719_1678 315
1248 3300046542 Ga0495597_0035208 Ga0495597_0035208_626_1585 315
1249 3300046542 Ga0495597_0037866 Ga0495597_0037866_396_1355 315
1250 3300046542 Ga0495597_0108821 Ga0495597_0108821_54_1013 315
1251 3300046557 Ga0495622_0013197 Ga0495622_0013197_1645_2604 315
1252 3300046557 Ga0495622_0037545 Ga0495622_0037545_384_1343 315
1253 3300046557 Ga0495622_0044352 Ga0495622_0044352_812_1765 315
1254 3300046557 Ga0495622_0093133 Ga0495622_0093133_115_1080 315
1255 3300046558 Ga0495633_0024867 Ga0495633_0024867_377_1336 315
1256 3300046558 Ga0495633_0028265 Ga0495633_0028265_1550_2500 315
1257 3300046615 Ga0495656_0109547 Ga0495656_0109547_54_1004 315
1258 3300046615 Ga0495656_0136374 Ga0495656_0136374_160_1119 315
1259 3300046616 Ga0495668_0016218 Ga0495668_0016218_1656_2615 315
1260 3300046616 Ga0495668_0021753 Ga0495668_0021753_1043_2059 315
1261 3300046616 Ga0495668_0035260 Ga0495668_0035260_281_1342 315
1262 3300046642 Ga0495634_0058599 Ga0495634_0058599_1186_2145 315
1263 3300046648 Ga0495611_0002914 Ga0495611_0002914_1639_2700 315
1264 3300046648 Ga0495611_0041581 Ga0495611_0041581_749_1708 315
1265 3300046660 Ga0495625_0028142 Ga0495625_0028142_1522_2583 315
1266 3300046660 Ga0495625_0031772 Ga0495625_0031772_1455_2516 315
1267 3300046660 Ga0495625_0058240 Ga0495625_0058240_509_1468 315
1268 3300046660 Ga0495625_0070443 Ga0495625_0070443_877_1824 315
1269 3300046660 Ga0495625_0081167 Ga0495625_0081167_475_1434 315
1270 3300046660 Ga0495625_0094130 Ga0495625_0094130_827_1870 315
1271 3300046660 Ga0495625_0141094 Ga0495625_0141094_272_1231 315
1272 3300046665 Ga0495661_0045989 Ga0495661_0045989_61_1020 315
1273 3300046665 Ga0495661_0111571 Ga0495661_0111571_251_1312 315
1274 3300046665 Ga0495661_0134287 Ga0495661_0134287_280_1341 315
1275 3300046674 Ga0495588_0016749 Ga0495588_0016749_1006_1965 315
1276 3300046679 Ga0495623_0029618 Ga0495623_0029618_904_1863 315
1277 3300046680 Ga0495646_0024984 Ga0495646_0024984_1124_2083 315
1278 3300046680 Ga0495646_0043494 Ga0495646_0043494_190_1149 315
1279 3300046683 Ga0495658_0213284 Ga0495658_0213284_62_1015 315
1280 3300046684 Ga0495669_0018938 Ga0495669_0018938_1374_2333 315
1281 3300046684 Ga0495669_0025216 Ga0495669_0025216_541_1500 315
1282 3300046689 Ga0495613_0034417 Ga0495613_0034417_1342_2301 315
1283 3300046689 Ga0495613_0034705 Ga0495613_0034705_1289_2248 315
1284 3300046689 Ga0495613_0146897 Ga0495613_0146897_45_1016 315
1285 3300046690 Ga0495624_0013766 Ga0495624_0013766_2545_3504 315
1286 3300046690 Ga0495624_0105519 Ga0495624_0105519_419_1378 315
1287 3300046691 Ga0495670_0004264 Ga0495670_0004264_3184_4245 315
1288 3300046691 Ga0495670_0048501 Ga0495670_0048501_869_1828 315
1289 3300046691 Ga0495670_0057903 Ga0495670_0057903_965_1924 315
1290 3300046692 Ga0495671_0005082 Ga0495671_0005082_5138_6097 315
1291 3300046692 Ga0495671_0007153 Ga0495671_0007153_1644_2603 315
1292 3300046692 Ga0495671_0013007 Ga0495671_0013007_1729_2688 315
1293 3300046692 Ga0495671_0016937 Ga0495671_0016937_1691_2650 315
1294 3300046692 Ga0495671_0022315 Ga0495671_0022315_164_1111 315
1295 3300046692 Ga0495671_0036069 Ga0495671_0036069_821_1780 315
1296 3300046692 Ga0495671_0041422 Ga0495671_0041422_1338_2297 315
1297 3300046692 Ga0495671_0045621 Ga0495671_0045621_208_1269 315
1298 3300046692 Ga0495671_0049137 Ga0495671_0049137_173_1132 315
1299 3300046692 Ga0495671_0076323 Ga0495671_0076323_248_1207 315
1300 3300046692 Ga0495671_0084446 Ga0495671_0084446_262_1323 315
1301 3300046694 Ga0495649_0000374 Ga0495649_0000374_31765_32730 315
1302 3300046694 Ga0495649_0007770 Ga0495649_0007770_4867_5814 315
1303 3300046694 Ga0495649_0015054 Ga0495649_0015054_1690_2637 315
1304 3300046694 Ga0495649_0016082 Ga0495649_0016082_1640_2701 315
1305 3300046694 Ga0495649_0018507 Ga0495649_0018507_1623_2582 315
1306 3300046694 Ga0495649_0019615 Ga0495649_0019615_1518_2477 315
1307 3300046694 Ga0495649_0021897 Ga0495649_0021897_1613_2572 315
1308 3300046694 Ga0495649_0029383 Ga0495649_0029383_458_1417 315
1309 3300046694 Ga0495649_0036562 Ga0495649_0036562_279_1238 315
1310 3300046694 Ga0495649_0051912 Ga0495649_0051912_464_1423 315
1311 3300046794 Ga0495589_0014632 Ga0495589_0014632_1433_2392 315
1312 3300046794 Ga0495589_0020877 Ga0495589_0020877_1374_2333 315
1313 3300046794 Ga0495589_0037492 Ga0495589_0037492_462_1421 315
1314 3300046809 Ga0495600_0027554 Ga0495600_0027554_1098_2057 315
1315 3300046809 Ga0495600_0034830 Ga0495600_0034830_1633_2592 315
1316 3300046810 Ga0495660_0019532 Ga0495660_0019532_1418_2461 315
1317 3300046810 Ga0495660_0019657 Ga0495660_0019657_1267_2226 315
1318 3300046810 Ga0495660_0025516 Ga0495660_0025516_954_1913 315
1319 3300046810 Ga0495660_0032782 Ga0495660_0032782_1573_2532 315
1320 3300046810 Ga0495660_0034051 Ga0495660_0034051_1589_2650 315
1321 3300046810 Ga0495660_0034631 Ga0495660_0034631_203_1264 315
1322 3300046810 Ga0495660_0038992 Ga0495660_0038992_87_1046 315
1323 3300046810 Ga0495660_0042046 Ga0495660_0042046_1411_2370 315
1324 3300046810 Ga0495660_0043827 Ga0495660_0043827_280_1341 315
1325 3300046810 Ga0495660_0052334 Ga0495660_0052334_850_1809 315
1326 3300046810 Ga0495660_0097038 Ga0495660_0097038_369_1328 315
1327 3300047317 Ga0495604_0042967 Ga0495604_0042967_1617_2576 315
1328 3300047317 Ga0495604_0056090 Ga0495604_0056090_1193_2152 315
1329 3300047317 Ga0495604_0251813 Ga0495604_0251813_55_1014 315
1330 3300047320 Ga0495672_0010021 Ga0495672_0010021_1639_2598 315
1331 3300047320 Ga0495672_0015676 Ga0495672_0015676_2524_3483 315
1332 3300047320 Ga0495672_0020723 Ga0495672_0020723_1707_2666 315
1333 3300047320 Ga0495672_0033436 Ga0495672_0033436_587_1546 315
1334 3300047320 Ga0495672_0036921 Ga0495672_0036921_384_1343 315
1335 3300047320 Ga0495672_0039519 Ga0495672_0039519_467_1417 315
1336 3300047320 Ga0495672_0045840 Ga0495672_0045840_1643_2602 315
1337 3300047320 Ga0495672_0107950 Ga0495672_0107950_324_1385 315
1338 3300047321 Ga0495676_0053319 Ga0495676_0053319_773_1732 315
1339 3300047322 Ga0495680_0071529 Ga0495680_0071529_39_998 315
1340 3300047322 Ga0495680_0093236 Ga0495680_0093236_1241_2200 315
1341 3300047322 Ga0495680_0128005 Ga0495680_0128005_39_998 315
1342 3300047323 Ga0495683_0013728 Ga0495683_0013728_1627_2586 315
1343 3300047323 Ga0495683_0023481 Ga0495683_0023481_889_1950 315
1344 3300047323 Ga0495683_0024543 Ga0495683_0024543_1374_2333 315
1345 3300047323 Ga0495683_0028794 Ga0495683_0028794_660_1619 315
1346 3300047323 Ga0495683_0062428 Ga0495683_0062428_580_1641 315
1347 3300047444 Ga0495675_0005310 Ga0495675_0005310_5273_6232 315
1348 3300047444 Ga0495675_0117226 Ga0495675_0117226_398_1357 315
1349 3300047444 Ga0495675_0168177 Ga0495675_0168177_21_980 315
1350 3300047445 Ga0495677_0007936 Ga0495677_0007936_1631_2590 315
1351 3300047446 Ga0495679_014921 Ga0495679_014921_1591_2652 315
1352 3300047446 Ga0495679_014957 Ga0495679_014957_916_1875 315
1353 3300047446 Ga0495679_016223 Ga0495679_016223_208_1269 315
1354 3300047446 Ga0495679_019397 Ga0495679_019397_1328_2287 315
1355 3300047446 Ga0495679_023266 Ga0495679_023266_377_1393 315
1356 3300047469 Ga0495673_0013515 Ga0495673_0013515_1716_2675 315
1357 3300047469 Ga0495673_0015221 Ga0495673_0015221_1376_2335 315
1358 3300047469 Ga0495673_0015748 Ga0495673_0015748_1560_2519 315
1359 3300047469 Ga0495673_0035623 Ga0495673_0035623_324_1385 315
1360 3300047469 Ga0495673_0043197 Ga0495673_0043197_680_1639 315
1361 3300047469 Ga0495673_0046433 Ga0495673_0046433_519_1478 315
1362 3300047470 Ga0495681_0006351 Ga0495681_0006351_5174_6133 315
1363 3300047470 Ga0495681_0014717 Ga0495681_0014717_1600_2559 315
1364 3300047470 Ga0495681_0016372 Ga0495681_0016372_1652_2611 315
1365 3300047470 Ga0495681_0018009 Ga0495681_0018009_1651_2610 315
1366 3300047470 Ga0495681_0018155 Ga0495681_0018155_1289_2248 315
1367 3300047470 Ga0495681_0023160 Ga0495681_0023160_1664_2623 315
1368 3300047470 Ga0495681_0023334 Ga0495681_0023334_722_1681 315
1369 3300047470 Ga0495681_0026424 Ga0495681_0026424_487_1446 315
1370 3300047470 Ga0495681_0055976 Ga0495681_0055976_596_1555 315
1371 3300047470 Ga0495681_0062428 Ga0495681_0062428_722_1681 315
1372 3300047471 Ga0495684_0051416 Ga0495684_0051416_1119_2078 315
1373 3300047472 Ga0495686_0003614 Ga0495686_0003614_6337_7287 315
1374 3300047472 Ga0495686_0024099 Ga0495686_0024099_1409_2368 315
1375 3300047472 Ga0495686_0033680 Ga0495686_0033680_1447_2406 315
1376 3300047472 Ga0495686_0049719 Ga0495686_0049719_1620_2579 315
1377 3300047673 Ga0495593_0025541 Ga0495593_0025541_660_1619 315
1378 3300047673 Ga0495593_0033078 Ga0495593_0033078_241_1200 315
1379 3300047673 Ga0495593_0036439 Ga0495593_0036439_380_1339 315
1380 3300047673 Ga0495593_0060527 Ga0495593_0060527_150_1109 315
1381 3300048088 Ga0495602_0076400 Ga0495602_0076400_1638_2597 315
1382 3300048091 Ga0495626_0004935 Ga0495626_0004935_1647_2606 315
1383 3300048091 Ga0495626_0013707 Ga0495626_0013707_1602_2561 315
1384 3300048091 Ga0495626_0016548 Ga0495626_0016548_1197_2156 315
1385 3300048091 Ga0495626_0019229 Ga0495626_0019229_1646_2605 315
1386 3300048091 Ga0495626_0028548 Ga0495626_0028548_1295_2356 315
1387 3300048091 Ga0495626_0041420 Ga0495626_0041420_260_1219 315
1388 3300048091 Ga0495626_0044218 Ga0495626_0044218_100_1161 315
1389 3300048091 Ga0495626_0123346 Ga0495626_0123346_49_1092 315
1390 3300048906 Ga0496103_0178328 Ga0496103_0178328_177_1151 315
1391 3300048907 Ga0496104_0000548 Ga0496104_0000548_22337_23299 315
1392 3300048908 Ga0496105_0012260 Ga0496105_0012260_727_1689 315
1393 3300048909 Ga0496106_0293115 Ga0496106_0293115_327_1286 315
1394 3300048911 Ga0496108_0068164 Ga0496108_0068164_238_1200 315
1395 3300048913 Ga0496110_0000417 Ga0496110_0000417_12324_13286 315
1396 3300048914 Ga0496111_0001433 Ga0496111_0001433_12225_13187 315
1397 3300048914 Ga0496111_0043668 Ga0496111_0043668_1051_2010 315
1398 3300048915 Ga0496112_0073805 Ga0496112_0073805_1587_2537 315
1399 3300048917 Ga0496114_0054820 Ga0496114_0054820_263_1225 315
1400 3300048918 Ga0496115_0000039 Ga0496115_0000039_24996_25961 315
1401 3300048918 Ga0496115_0000180 Ga0496115_0000180_56976_57941 315
1402 3300048919 Ga0496116_0000525 Ga0496116_0000525_1663_2613 315
1403 3300048919 Ga0496116_0010154 Ga0496116_0010154_4943_6004 315
1404 3300048919 Ga0496116_0032247 Ga0496116_0032247_1658_2617 315
1405 3300048920 Ga0496117_0044731 Ga0496117_0044731_1671_2621 315
1406 3300048920 Ga0496117_0054077 Ga0496117_0054077_1642_2601 315
1407 3300048920 Ga0496117_0094031 Ga0496117_0094031_76_1035 315
1408 3300048920 Ga0496117_0098132 Ga0496117_0098132_217_1176 315
1409 3300048921 Ga0496118_0073100 Ga0496118_0073100_13_972 315
1410 3300048921 Ga0496118_0109105 Ga0496118_0109105_158_1117 315
1411 3300048922 Ga0496119_0057933 Ga0496119_0057933_497_1456 315
1412 3300048922 Ga0496119_0073203 Ga0496119_0073203_859_1818 315
1413 3300048922 Ga0496119_0073209 Ga0496119_0073209_859_1818 315
1414 3300048923 Ga0496120_0047290 Ga0496120_0047290_1226_2185 315
1415 3300048924 Ga0496121_0033195 Ga0496121_0033195_1652_2602 315
1416 3300048924 Ga0496121_0044599 Ga0496121_0044599_1650_2609 315
1417 3300048925 Ga0496122_0056858 Ga0496122_0056858_1376_2326 315
1418 3300048926 Ga0496123_0023533 Ga0496123_0023533_2104_3054 315
1419 3300048926 Ga0496123_0058521 Ga0496123_0058521_1284_2243 315
1420 3300048927 Ga0496124_0049492 Ga0496124_0049492_993_1952 315
1421 3300048927 Ga0496124_0054907 Ga0496124_0054907_1640_2599 315
1422 3300048927 Ga0496124_0091498 Ga0496124_0091498_310_1260 315
1423 3300048927 Ga0496124_0175326 Ga0496124_0175326_13_972 315
1424 3300048927 Ga0496124_0199824 Ga0496124_0199824_35_994 315
1425 3300049459 Ga0495678_015524 Ga0495678_015524_1641_2600 315
1426 3300049459 Ga0495678_016236 Ga0495678_016236_696_1655 315
1427 3300049459 Ga0495678_018704 Ga0495678_018704_1205_2170 315
1428 3300049459 Ga0495678_023850 Ga0495678_023850_61_1020 315
1429 3300049459 Ga0495678_031457 Ga0495678_031457_865_1908 315
1430 3300049460 Ga0495682_0000079 Ga0495682_0000079_82414_83364 315
1431 3300049460 Ga0495682_0014314 Ga0495682_0014314_1648_2607 315
1432 3300049460 Ga0495682_0014612 Ga0495682_0014612_1632_2591 315
1433 3300049568 Ga0501031_0014430 Ga0501031_0014430_4007_4957 315
1434 3300049569 Ga0501032_0001019 Ga0501032_0001019_3919_4869 315
1435 3300049569 Ga0501032_0018068 Ga0501032_0018068_1491_2441 315
1436 3300049569 Ga0501032_0031326 Ga0501032_0031326_2245_3204 315
1437 3300049570 Ga0501033_0002407 Ga0501033_0002407_837_1787 315
1438 3300049570 Ga0501033_0096134 Ga0501033_0096134_135_1094 315
1439 3300049571 Ga0501034_0003602 Ga0501034_0003602_8841_9800 315
1440 3300049571 Ga0501034_0029512 Ga0501034_0029512_2082_3044 315
1441 3300049571 Ga0501034_0376299 Ga0501034_0376299_375_1334 315
1442 3300049572 Ga0501036_0034377 Ga0501036_0034377_2010_2972 315
1443 3300049572 Ga0501036_0048742 Ga0501036_0048742_2042_3001 315
1444 3300049572 Ga0501036_0097505 Ga0501036_0097505_68_1018 315
1445 3300049572 Ga0501036_0121463 Ga0501036_0121463_985_1944 315
1446 3300049573 Ga0501037_0017642 Ga0501037_0017642_548_1507 315
1447 3300049573 Ga0501037_0019859 Ga0501037_0019859_3186_4148 315
1448 3300049573 Ga0501037_0057224 Ga0501037_0057224_1561_2520 315
1449 3300049573 Ga0501037_0106890 Ga0501037_0106890_401_1363 315
1450 3300049574 Ga0501038_0009821 Ga0501038_0009821_2577_3536 315
1451 3300049574 Ga0501038_0029481 Ga0501038_0029481_48_998 315
1452 3300049575 Ga0501039_0086678 Ga0501039_0086678_178_1137 315
1453 3300049575 Ga0501039_0133525 Ga0501039_0133525_115_1065 315
1454 3300049576 Ga0501040_0050547 Ga0501040_0050547_1826_2785 315
1455 3300049576 Ga0501040_0061349 Ga0501040_0061349_1291_2250 315
1456 3300049577 Ga0501041_0024009 Ga0501041_0024009_653_1612 315
1457 3300049577 Ga0501041_0037242 Ga0501041_0037242_1464_2423 315
1458 3300049578 Ga0501042_0050196 Ga0501042_0050196_1142_2101 315
1459 3300049578 Ga0501042_0213029 Ga0501042_0213029_169_1128 315
1460 3300049579 Ga0501043_0007712 Ga0501043_0007712_1573_2523 315
1461 3300049579 Ga0501043_0037632 Ga0501043_0037632_796_1755 315
1462 3300049580 Ga0501046_0000225 Ga0501046_0000225_33988_34938 315
1463 3300049581 Ga0501047_0003089 Ga0501047_0003089_9043_10002 315
1464 3300049581 Ga0501047_0005471 Ga0501047_0005471_10846_11808 315
1465 3300049581 Ga0501047_0010533 Ga0501047_0010533_4934_5893 315
1466 3300049581 Ga0501047_0013611 Ga0501047_0013611_454_1404 315
1467 3300049582 Ga0501048_0019371 Ga0501048_0019371_2762_3721 315
1468 3300049583 Ga0501067_0016911 Ga0501067_0016911_2905_3864 315
1469 3300049584 Ga0501068_0011706 Ga0501068_0011706_1937_2896 315
1470 3300049584 Ga0501068_0052452 Ga0501068_0052452_19_978 315
1471 3300049585 Ga0501069_0000978 Ga0501069_0000978_11808_12770 315
1472 3300049585 Ga0501069_0002954 Ga0501069_0002954_1748_2710 315
1473 3300049585 Ga0501069_0009997 Ga0501069_0009997_44_1003 315
1474 3300049585 Ga0501069_0011907 Ga0501069_0011907_349_1311 315
1475 3300049586 Ga0501070_0000105 Ga0501070_0000105_6587_7549 315
1476 3300049586 Ga0501070_0002736 Ga0501070_0002736_12189_13148 315
1477 3300049586 Ga0501070_0002792 Ga0501070_0002792_8271_9230 315
1478 3300049586 Ga0501070_0003218 Ga0501070_0003218_3013_3975 315
1479 3300049586 Ga0501070_0005852 Ga0501070_0005852_2161_3123 315
1480 3300049586 Ga0501070_0006054 Ga0501070_0006054_4426_5388 315
1481 3300049586 Ga0501070_0054161 Ga0501070_0054161_1231_2193 315
1482 3300049586 Ga0501070_0181709 Ga0501070_0181709_163_1125 315
1483 3300049587 Ga0501071_0002675 Ga0501071_0002675_1376_2338 315
1484 3300049587 Ga0501071_0096620 Ga0501071_0096620_880_1839 315
1485 3300049588 Ga0501072_0003622 Ga0501072_0003622_8077_9036 315
1486 3300049588 Ga0501072_0021858 Ga0501072_0021858_3809_4768 315
1487 3300049589 Ga0501073_0003412 Ga0501073_0003412_8058_9017 315
1488 3300049589 Ga0501073_0004459 Ga0501073_0004459_8271_9233 315
1489 3300049590 Ga0501074_0003031 Ga0501074_0003031_2175_3137 315
1490 3300049590 Ga0501074_0004871 Ga0501074_0004871_246_1205 315
1491 3300049590 Ga0501074_0007822 Ga0501074_0007822_1552_2514 315
1492 3300049590 Ga0501074_0018953 Ga0501074_0018953_2287_3246 315
1493 3300049590 Ga0501074_0029239 Ga0501074_0029239_1959_2921 315
1494 3300049591 Ga0501075_0028709 Ga0501075_0028709_2205_3164 315
1495 3300049592 Ga0501076_0087644 Ga0501076_0087644_710_1669 315
1496 3300049741 Ga0501079_0017667 Ga0501079_0017667_670_1629 315
1497 3300049741 Ga0501079_0032541 Ga0501079_0032541_379_1338 315
1498 3300049741 Ga0501079_0151767 Ga0501079_0151767_454_1413 315
1499 3300049742 Ga0501080_0004356 Ga0501080_0004356_2719_3678 315
1500 3300049742 Ga0501080_0008184 Ga0501080_0008184_22_984 315
1501 3300049742 Ga0501080_0009176 Ga0501080_0009176_3300_4259 315
1502 3300049742 Ga0501080_0015424 Ga0501080_0015424_5679_6638 315
1503 3300049742 Ga0501080_0019416 Ga0501080_0019416_5227_6189 315
1504 3300049742 Ga0501080_0034933 Ga0501080_0034933_728_1690 315
1505 3300049742 Ga0501080_0125102 Ga0501080_0125102_836_1795 315
1506 3300049742 Ga0501080_0192349 Ga0501080_0192349_773_1735 315
1507 3300049743 Ga0501081_0015666 Ga0501081_0015666_2072_3031 315
1508 3300049743 Ga0501081_0106645 Ga0501081_0106645_405_1364 315
1509 3300049744 Ga0501083_0141378 Ga0501083_0141378_319_1281 315
1510 3300049822 Ga0501035_0001421 Ga0501035_0001421_18667_19629 315
1511 3300049822 Ga0501035_0011122 Ga0501035_0011122_1775_2737 315
1512 3300049822 Ga0501035_0020545 Ga0501035_0020545_3029_3979 315
1513 3300049822 Ga0501035_0079251 Ga0501035_0079251_879_1838 315
1514 3300049822 Ga0501035_0144046 Ga0501035_0144046_789_1751 315
1515 3300049822 Ga0501035_0148929 Ga0501035_0148929_728_1687 315
1516 3300049822 Ga0501035_0278246 Ga0501035_0278246_222_1190 315
1517 3300049823 Ga0501044_0018678 Ga0501044_0018678_2755_3717 315
1518 3300049823 Ga0501044_0018697 Ga0501044_0018697_5974_6936 315
1519 3300049823 Ga0501044_0019937 Ga0501044_0019937_4426_5388 315
1520 3300049823 Ga0501044_0084120 Ga0501044_0084120_967_1926 315
1521 3300049823 Ga0501044_0177491 Ga0501044_0177491_582_1532 315
1522 3300049823 Ga0501044_0238847 Ga0501044_0238847_406_1368 315
1523 3300049824 Ga0501045_0141929 Ga0501045_0141929_237_1196 315
1524 3300050490 nmdc:mga03n38_233_c1 nmdc:mga03n38_233_c1_2569_3525 315
1525 3300050491 nmdc:mga00v17_116_c1 nmdc:mga00v17_116_c1_19428_20384 315
1526 3300050491 nmdc:mga00v17_25236_c1 nmdc:mga00v17_25236_c1_1547_2503 315
1527 3300050492 nmdc:mga0yw44_64_c1 nmdc:mga0yw44_64_c1_2558_3514 315
1528 3300050494 nmdc:mga06z11_10428_c1 nmdc:mga06z11_10428_c1_607_1563 315
1529 3300050495 nmdc:mga04h51_9833_c1 nmdc:mga04h51_9833_c1_749_1705 315
1530 3300050496 nmdc:mga07m45_79_c1 nmdc:mga07m45_79_c1_16268_17224 315
1531 3300050507 nmdc:mga05p37_110746_c1 nmdc:mga05p37_110746_c1_2015_2974 315
1532 3300050511 nmdc:mga08y16_9557_c1 nmdc:mga08y16_9557_c1_5532_6491 315
1533 3300050512 nmdc:mga0n895_19557_c1 nmdc:mga0n895_19557_c1_4069_5028 315
1534 3300050513 nmdc:mga0rr50_342228_c1 nmdc:mga0rr50_342228_c1_268_1227 315
1535 3300050515 nmdc:mga0a205_6796_c1 nmdc:mga0a205_6796_c1_1919_2878 315
1536 3300050516 nmdc:mga0sz30_42_c1 nmdc:mga0sz30_42_c1_15226_16182 315
1537 3300053088 Ga0500644_0038253 Ga0500644_0038253_34_987 315
1538 3300053092 Ga0500583_0071208 Ga0500583_0071208_216_1175 315
1539 3300053093 Ga0500651_0007369 Ga0500651_0007369_1536_2498 315
1540 3300053103 Ga0500555_018448 Ga0500555_018448_239_1198 315
1541 3300053104 Ga0500556_0000731 Ga0500556_0000731_15745_16713 315
1542 3300053111 Ga0500572_005148 Ga0500572_005148_1603_2562 315
1543 3300053118 Ga0500594_0000346 Ga0500594_0000346_2067_3020 315
1544 3300053126 Ga0500621_063954 Ga0500621_063954_133_1092 315
1545 3300053136 Ga0500559_0000076 Ga0500559_0000076_8545_9498 315
1546 3300053151 Ga0500604_0000359 Ga0500604_0000359_5994_6953 315
1547 3300053156 Ga0500622_0001530 Ga0500622_0001530_12611_13564 315
1548 3300054114 Ga0501084_0031017 Ga0501084_0031017_813_1772 315
1549 3300054114 Ga0501084_0253874 Ga0501084_0253874_294_1253 315
1550 3300060353 Ga0501082_0023493 Ga0501082_0023493_3610_4569 315
1551 3300060353 Ga0501082_0028957 Ga0501082_0028957_556_1515 315
1552 3300060353 Ga0501082_0063120 Ga0501082_0063120_1266_2225 315
1553 3300061734 Ga0530510_0034334 Ga0530510_0034334_2198_3157 315
1554 3300061734 Ga0530510_0063926 Ga0530510_0063926_464_1423 315

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

168

249

0.93

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

27

322

0.9

PF13738

Pyr_redox_3

Pyridine nucleotide-disulphide oxidoreductase

77

305

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
1cl0-assembly1.cif.gz_A crystal structure of reduced thioredoxin reductase from escherichia coli. 0.9422 4 314
1tdf-assembly1.cif.gz_A crystal structure of escherichia coli thioredoxin reductase refined at 2 angstrom resolution: implications for a large conformational change during catalysis 0.9409 4 315
7e52-assembly1.cif.gz_A-2 acinetobacter baumannii thioredoxin reductase 0.9371 3 315
3f8r-assembly1.cif.gz_A crystal structure of sulfolobus solfataricus thioredoxin reductase b3 in complex with two nadp molecules 0.9365 1 314
3f8d-assembly1.cif.gz_A structure of sulfolobus solfataricus thioredoxin reductase mutant c147a 0.9364 1 314
ID Description Score Start End Superfamily
5u63A02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9888 118 244 3.50.50.60
5u63A02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9811 118 244 3.50.50.60
3f8rD02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9794 118 244 3.50.50.60
4ykgA03 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9711 118 244 3.50.50.60
3f8rD02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9711 118 244 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A6N6X486-F1-model_v4 deleted 0.9812 109 240
AF-A0A1E9VPB0-F1-model_v4 Thioredoxin-disulfide reductase 0.9793 56 314 GO:0016668
AF-A0A6G3XGX0-F1-model_v4 FAD-dependent oxidoreductase 0.9727 73 252 GO:0016668
AF-A0A533UT16-F1-model_v4 Thioredoxin-disulfide reductase (EC 1.8.1.9) 0.9725 5 314 GO:0004791
GO:0005737
GO:0019430
AF-A0A7K4F3P8-F1-model_v4 FAD-dependent oxidoreductase 0.9725 108 314 GO:0016668

Feature Viewer

pLDDT pTM Quality
92.9 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map