F494641

General Info

Members Datasets Scaffolds Average Seq Length
1537 674 3074 206

Family's Representative Sequence

Representative Sequence 3300046462|Ga0495651_0005180|Ga0495651_0005180_1333_2049
Length 238
Sequence MCPLSLTPSTADPVPKASWRRENRQLIPYARRMAKYFDVHPENPQPRTIGSVADLVRSGALVAYPTDSCFALGCQLGNREGIGRIRSVRELDDRHHFTLVCRNFAQLGQFVHIDNKVFRAIKAATPGSYTFILPATSEVPRQLLHPKKRTVGVRIPDHVVAQALLAELGEPLVSSTLLLPGEDEPMTQGWEIKERLDHVLDAVLDSGDCGTEPTTVIDFSSGDAEIVRRGAGDTARFV

Samples

Sample ID Description Type Environment
1 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
81 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
84 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
85 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
86 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
87 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
88 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
89 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
90 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
91 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
92 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
93 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
100 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
101 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
102 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
117 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
132 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
140 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
141 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
143 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
145 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
146 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
147 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
148 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
149 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
203 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
204 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
206 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
207 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
208 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
209 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
210 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
211 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
212 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
213 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
214 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
215 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
216 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
217 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
218 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
219 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
221 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
222 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
223 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
224 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
225 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
226 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
227 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
228 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
229 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
230 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
231 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
232 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
233 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
234 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
235 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
236 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
237 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
238 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
239 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
240 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
241 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
242 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
243 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
244 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
245 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
246 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
247 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
248 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
249 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
250 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
251 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
252 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
253 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
254 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
255 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
256 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
257 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
258 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
259 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
260 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
261 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
262 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
263 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
264 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
265 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
266 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
267 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
268 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
269 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
270 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
271 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
272 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
273 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
274 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
275 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
276 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
277 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
278 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
279 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
280 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
281 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
282 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
283 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
284 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
285 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
286 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
287 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
288 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
289 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
290 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
291 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
292 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
293 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
294 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
295 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
296 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
297 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
298 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
299 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
300 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
301 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
302 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
303 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
304 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
305 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
306 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
307 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
308 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
309 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
310 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
311 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
312 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
313 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
314 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
315 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
316 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
317 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
318 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
319 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
320 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
321 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
322 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
323 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
324 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
325 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
326 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
327 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
328 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
329 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
330 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
331 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
332 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
333 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
334 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
335 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
336 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
337 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
338 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
339 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
340 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
341 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
342 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
343 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
344 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
345 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
346 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
347 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
348 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
349 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
350 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
351 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
352 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
353 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
354 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
355 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
356 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
357 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
358 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
359 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
360 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
361 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
362 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
363 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
364 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
365 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
366 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
367 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
368 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
369 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
370 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
371 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
372 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
373 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
374 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
375 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
376 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
377 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
378 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
379 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
380 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
381 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
382 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
383 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
384 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
385 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
386 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
387 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
388 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
389 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
390 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
391 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
392 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
393 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
394 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
395 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
396 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
397 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
398 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
399 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
400 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
401 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
402 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
403 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
404 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
405 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
406 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
407 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
408 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
409 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
410 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
411 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
412 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
413 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
414 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
415 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
416 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
417 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
418 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
419 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
420 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
421 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
422 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
423 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
424 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
425 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
426 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
427 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
428 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
429 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
430 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
431 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
432 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
433 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
434 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
435 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
436 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
437 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
438 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
439 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
440 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
441 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
442 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
443 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
444 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
445 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
446 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
447 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
448 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
449 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
450 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
451 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
452 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
453 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
454 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
455 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
456 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
457 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
458 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
459 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
460 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
461 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
462 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
463 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
464 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
465 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
466 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
467 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
468 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
469 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
470 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
471 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
472 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
473 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
474 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
475 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
476 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
477 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
478 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
479 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
480 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
481 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
482 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
483 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
484 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
485 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
486 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
487 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
488 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
489 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
490 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
491 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
492 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
493 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
494 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
495 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
496 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
497 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
498 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
499 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
500 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
501 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
502 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
503 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
504 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
505 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
506 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
507 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
508 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
509 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
510 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
511 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
512 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
513 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
514 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
515 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
516 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
517 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
518 2501939600 Micromonospora sp. L5 Isolate Unclassified
519 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
520 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
521 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
522 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
523 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
524 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
525 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
526 2558860280 Kutzneria sp. 744 Isolate Unclassified
527 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
528 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
529 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
530 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
531 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
532 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
533 2643221548 Streptomyces sp. Root55 Isolate Unclassified
534 2643221578 Streptomyces sp. Root63 Isolate Unclassified
535 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
536 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
537 2643221613 Oerskovia sp. Root22 Isolate Unclassified
538 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
539 2643221647 Streptomyces sp. Root369 Isolate Unclassified
540 2643221670 Streptomyces sp. Root431 Isolate Unclassified
541 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
542 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
543 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
544 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
545 2643221714 Streptomyces sp. Root264 Isolate Unclassified
546 2643221721 Oerskovia sp. Root918 Isolate Unclassified
547 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
548 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
549 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
550 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
551 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
552 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
553 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
554 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
555 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
556 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
557 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
558 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
559 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
560 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
561 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
562 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
563 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
564 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
565 2808606448 Streptomyces sp. 193411 Isolate Unclassified
566 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
567 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
568 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
569 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
570 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
571 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
572 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
573 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
574 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
575 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
576 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
577 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
578 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
579 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
580 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
581 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
582 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
583 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
584 2862574272 Streptomyces sp. AcE210 Isolate Nodule
585 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
586 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
587 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
588 2867369537 Streptomyces sp. Z26 Isolate Unclassified
589 2867428634 Streptomyces sp. RP5T Isolate Unclassified
590 2867475112 Streptomyces sp. TM32 Isolate Unclassified
591 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
592 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
593 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
594 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
595 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
596 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
597 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
598 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
599 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
600 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
601 2902582711 Micromonospora sp. AP08 Isolate Unclassified
602 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
603 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
604 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
605 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
606 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
607 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
608 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
609 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
610 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
611 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
612 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
613 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
614 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
615 2922554459 Rhodococcus sp. 66b Isolate Unclassified
616 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
617 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
618 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
619 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
620 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
621 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
622 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
623 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
624 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
625 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
626 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
627 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
628 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
629 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
630 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
631 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
632 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
633 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
634 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
635 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
636 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
637 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
638 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
639 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
640 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
641 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
642 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
643 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
644 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
645 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
646 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
647 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
648 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
649 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
650 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
651 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
652 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
653 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
654 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
655 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
656 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
657 649633069 Micromonospora sp. L5 Isolate Unclassified
658 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
659 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
660 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
661 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
662 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
663 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
664 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
665 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
666 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
667 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
668 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
669 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
670 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
671 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
672 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
673 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
674 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.68
Metatranscriptomes 1.11
Isolates 10.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.49
Nodule 0.26
Rhizoplane 5.66
Rhizosphere 79.38
Stem 0
Stem Tuber 0.07
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495651_0005180 3300046462 Bacteria 9945
2 LJQas_1000535 3300000549 Bacteria 6242
3 LJQas_1002191 3300000549 Bacteria 2757
4 JGI24747J21853_1009459 3300001978 Bacteria 964
5 JGI24740J21852_10041884 3300001979 Bacteria 1376
6 JGI24739J22299_10048222 3300001989 Bacteria 1386
7 JGI24738J21930_10029325 3300002075 Bacteria 1125
8 JGI25152J39213_1000124 3300002773 Bacteria 52334
9 rootH1_10013192 3300003316 Bacteria 3047
10 rootH1_10112119 3300003316 Bacteria 2763
11 rootH2_10005306 3300003320 Bacteria 8319
12 rootH2_10036987 3300003320 Bacteria 4189
13 rootL2_10002055 3300003322 Bacteria 8705
14 rootH1_10088740 3300003323 Bacteria 3739
15 JGI25160J50197_1017012 3300003354 Bacteria 2320
16 JGI25160J50197_1026859 3300003354 Bacteria 1579
17 JGI25160J50197_1033597 3300003354 Bacteria 1288
18 JGI25160J50197_1048716 3300003354 Bacteria 913
19 Ga0055542_1018106 3300003762 Bacteria 1075
20 Ga0065714_10116297 3300005288 Bacteria 1405
21 Ga0070676_10072757 3300005328 Bacteria 2067
22 Ga0070683_100073511 3300005329 Bacteria 3192
23 Ga0070690_100084707 3300005330 Bacteria 2078
24 Ga0070670_100225957 3300005331 Bacteria 1629
25 Ga0068869_100442107 3300005334 Bacteria 1076
26 Ga0070666_10064382 3300005335 Bacteria 2487
27 Ga0070666_10174208 3300005335 Bacteria 1508
28 Ga0070682_100060004 3300005337 Bacteria 2404
29 Ga0070682_100257041 3300005337 Bacteria 1262
30 Ga0068868_100317012 3300005338 Bacteria 1327
31 Ga0068868_100666654 3300005338 Bacteria 928
32 Ga0070660_100069941 3300005339 Bacteria 2738
33 Ga0070689_100749988 3300005340 Bacteria 855
34 Ga0070691_10239118 3300005341 Bacteria 969
35 Ga0070661_100128843 3300005344 Bacteria 1899
36 Ga0070692_10110429 3300005345 Bacteria 1520
37 Ga0070668_100477793 3300005347 Bacteria 1076
38 Ga0070668_100623168 3300005347 Bacteria 946
39 Ga0070675_100012367 3300005354 Bacteria 6689
40 Ga0070675_100051392 3300005354 Bacteria 3387
41 Ga0070671_100024680 3300005355 Bacteria 4925
42 Ga0070671_100255122 3300005355 Bacteria 1490
43 Ga0070673_100417417 3300005364 Bacteria 1202
44 Ga0070688_100090767 3300005365 Bacteria 1996
45 Ga0070659_100582495 3300005366 Bacteria 960
46 Ga0070659_100742238 3300005366 Bacteria 851
47 Ga0070659_100821582 3300005366 Bacteria 809
48 Ga0070703_10011369 3300005406 Bacteria 2514
49 Ga0070709_10002968 3300005434 Bacteria 9134
50 Ga0070709_10064220 3300005434 Bacteria 2347
51 Ga0070709_10094386 3300005434 Bacteria 1979
52 Ga0070709_10301508 3300005434 Bacteria 1170
53 Ga0070709_10491591 3300005434 Bacteria 931
54 Ga0070709_10677397 3300005434 Bacteria 801
55 Ga0070714_100005159 3300005435 Bacteria 9942
56 Ga0070714_100063865 3300005435 Bacteria 3167
57 Ga0070714_100076110 3300005435 Bacteria 2913
58 Ga0070714_100184067 3300005435 Bacteria 1902
59 Ga0070714_100202369 3300005435 Bacteria 1817
60 Ga0070714_100328582 3300005435 Bacteria 1431
61 Ga0070714_100420221 3300005435 Bacteria 1266
62 Ga0070714_100473049 3300005435 Bacteria 1192
63 Ga0070714_100563543 3300005435 Bacteria 1091
64 Ga0070714_100676969 3300005435 Bacteria 994
65 Ga0070713_100067709 3300005436 Bacteria 3007
66 Ga0070713_100107105 3300005436 Bacteria 2431
67 Ga0070713_100107386 3300005436 Bacteria 2428
68 Ga0070713_100111518 3300005436 Bacteria 2386
69 Ga0070713_100192701 3300005436 Bacteria 1838
70 Ga0070713_100308167 3300005436 Bacteria 1459
71 Ga0070710_10129196 3300005437 Bacteria 1538
72 Ga0070710_10225789 3300005437 Bacteria 1193
73 Ga0070701_10217931 3300005438 Bacteria 1137
74 Ga0070711_100034804 3300005439 Bacteria 3362
75 Ga0070711_100216864 3300005439 Bacteria 1485
76 Ga0070711_100303401 3300005439 Bacteria 1270
77 Ga0070711_100545367 3300005439 Bacteria 961
78 Ga0070700_100147406 3300005441 Bacteria 1606
79 Ga0070694_100125456 3300005444 Bacteria 1847
80 Ga0070708_100026859 3300005445 Bacteria 4932
81 Ga0070708_100031874 3300005445 Bacteria 4566
82 Ga0070708_100699609 3300005445 Bacteria 954
83 Ga0070663_100000200 3300005455 Bacteria 29769
84 Ga0070663_100094838 3300005455 Bacteria 2216
85 Ga0070678_100041960 3300005456 Bacteria 3248
86 Ga0070678_100044896 3300005456 Bacteria 3158
87 Ga0070662_100041824 3300005457 Bacteria 3272
88 Ga0070681_10220371 3300005458 Bacteria 1812
89 Ga0070681_10371782 3300005458 Bacteria 1340
90 Ga0070685_10022823 3300005466 Bacteria 3417
91 Ga0070706_100005952 3300005467 Bacteria 11536
92 Ga0070706_100062786 3300005467 Bacteria 3433
93 Ga0070706_100260877 3300005467 Bacteria 1617
94 Ga0070706_100301676 3300005467 Bacteria 1494
95 Ga0070706_100614708 3300005467 Bacteria 1009
96 Ga0070707_100021379 3300005468 Bacteria 6114
97 Ga0070707_100046002 3300005468 Bacteria 4176
98 Ga0070707_100277078 3300005468 Bacteria 1630
99 Ga0070707_100320307 3300005468 Bacteria 1507
100 Ga0070698_100015722 3300005471 Bacteria 7992
101 Ga0070698_100040242 3300005471 Bacteria 4805
102 Ga0070698_100059047 3300005471 Bacteria 3875
103 Ga0070698_100104626 3300005471 Bacteria 2800
104 Ga0070698_100502148 3300005471 Bacteria 1151
105 Ga0070698_100823409 3300005471 Bacteria 873
106 Ga0070699_100004229 3300005518 Bacteria 12695
107 Ga0070699_100112281 3300005518 Bacteria 2394
108 Ga0070679_100020051 3300005530 Bacteria 6516
109 Ga0070679_100148284 3300005530 Bacteria 2323
110 Ga0070679_100991786 3300005530 Bacteria 784
111 Ga0070684_100117990 3300005535 Bacteria 2384
112 Ga0070684_100123846 3300005535 Bacteria 2327
113 Ga0070684_100169416 3300005535 Bacteria 1983
114 Ga0070684_100726117 3300005535 Bacteria 927
115 Ga0070697_100000297 3300005536 Bacteria 39837
116 Ga0070697_100249985 3300005536 Bacteria 1516
117 Ga0068853_100003712 3300005539 Bacteria 11725
118 Ga0068853_100050169 3300005539 Bacteria 3589
119 Ga0068853_100162906 3300005539 Bacteria 2013
120 Ga0068853_100299520 3300005539 Bacteria 1486
121 Ga0070672_100037137 3300005543 Bacteria 3715
122 Ga0070672_100288829 3300005543 Bacteria 1388
123 Ga0070672_100393752 3300005543 Bacteria 1186
124 Ga0070686_100052369 3300005544 Bacteria 2602
125 Ga0070695_100032353 3300005545 Bacteria 3269
126 Ga0070693_100048338 3300005547 Bacteria 2422
127 Ga0070665_100066875 3300005548 Bacteria 3605
128 Ga0070665_100135130 3300005548 Bacteria 2468
129 Ga0070665_100538105 3300005548 Bacteria 1180
130 Ga0070704_100123499 3300005549 Bacteria 1993
131 Ga0068855_100232018 3300005563 Bacteria 2066
132 Ga0070664_100952478 3300005564 Bacteria 806
133 Ga0068857_100065627 3300005577 Bacteria 3228
134 Ga0068854_100019910 3300005578 Bacteria 4530
135 Ga0068856_100103223 3300005614 Bacteria 2845
136 Ga0068856_100118950 3300005614 Bacteria 2643
137 Ga0070702_100033411 3300005615 Bacteria 2829
138 Ga0068859_100304670 3300005617 Bacteria 1687
139 Ga0068864_100044733 3300005618 Bacteria 3796
140 Ga0068864_100189675 3300005618 Bacteria 1884
141 Ga0068864_100258911 3300005618 Bacteria 1618
142 Ga0068866_10050747 3300005718 Bacteria 2108
143 Ga0068866_10144192 3300005718 Bacteria 1371
144 Ga0068866_10163428 3300005718 Bacteria 1300
145 Ga0068861_100117328 3300005719 Bacteria 2142
146 Ga0068861_100176561 3300005719 Bacteria 1774
147 Ga0068851_10162167 3300005834 Bacteria 1229
148 Ga0068870_10006949 3300005840 Bacteria 5020
149 Ga0068863_100004992 3300005841 Bacteria 13079
150 Ga0068863_100032201 3300005841 Bacteria 4997
151 Ga0068863_100712410 3300005841 Bacteria 998
152 Ga0068858_100074577 3300005842 Bacteria 3150
153 Ga0068860_100784821 3300005843 Bacteria 965
154 Ga0068862_100031297 3300005844 Bacteria 4490
155 Ga0081455_10000045 3300005937 Bacteria 128603
156 Ga0081455_10062588 3300005937 Bacteria 3126
157 Ga0081538_10000036 3300005981 Bacteria 119944
158 Ga0081540_1001418 3300005983 Bacteria 20736
159 Ga0081539_10001518 3300005985 Bacteria 38975
160 Ga0081539_10002486 3300005985 Bacteria 25922
161 Ga0070717_10013495 3300006028 Bacteria 6262
162 Ga0070717_10019489 3300006028 Bacteria 5320
163 Ga0070717_10022664 3300006028 Bacteria 4966
164 Ga0070717_10044166 3300006028 Bacteria 3639
165 Ga0070717_10053539 3300006028 Bacteria 3327
166 Ga0070717_10200894 3300006028 Bacteria 1746
167 Ga0070717_10221305 3300006028 Bacteria 1664
168 Ga0070717_10314907 3300006028 Bacteria 1393
169 Ga0075368_10001580 3300006042 Bacteria 7310
170 Ga0075363_100001400 3300006048 Bacteria 9113
171 Ga0075363_100048444 3300006048 Bacteria 2260
172 Ga0075363_100125899 3300006048 Bacteria 1434
173 Ga0075364_10031453 3300006051 Bacteria 3410
174 Ga0075432_10185752 3300006058 Bacteria 815
175 Ga0070715_10013884 3300006163 Bacteria 2969
176 Ga0070715_10106382 3300006163 Bacteria 1316
177 Ga0070715_10122570 3300006163 Bacteria 1241
178 Ga0070715_10135485 3300006163 Bacteria 1190
179 Ga0070716_100008308 3300006173 Bacteria 5150
180 Ga0070716_100093886 3300006173 Bacteria 1822
181 Ga0070712_100072461 3300006175 Bacteria 2468
182 Ga0070712_100125749 3300006175 Bacteria 1936
183 Ga0070712_100192400 3300006175 Bacteria 1597
184 Ga0070712_100195833 3300006175 Bacteria 1584
185 Ga0070712_100302706 3300006175 Bacteria 1294
186 Ga0070712_100736567 3300006175 Bacteria 843
187 Ga0075362_10123914 3300006177 Bacteria 1225
188 Ga0075367_10002607 3300006178 Bacteria 8283
189 Ga0075370_10056980 3300006353 Bacteria 2221
190 Ga0075370_10096132 3300006353 Bacteria 1712
191 Ga0075434_100184513 3300006871 Bacteria 2107
192 Ga0068865_100039270 3300006881 Bacteria 3210
193 Ga0068865_100500477 3300006881 Bacteria 1013
194 Ga0097620_100304673 3300006931 Bacteria 1687
195 Ga0099826_10081186 3300006948 Bacteria 2019
196 Ga0075435_100022404 3300007076 Bacteria 4874
197 Ga0075435_100808802 3300007076 Bacteria 816
198 Ga0099795_10012716 3300007788 Bacteria 2561
199 Ga0105251_10022179 3300009011 Bacteria 3302
200 Ga0105251_10024584 3300009011 Bacteria 3092
201 Ga0105244_10047301 3300009036 Bacteria 2207
202 Ga0105244_10220369 3300009036 Bacteria 890
203 Ga0105250_10088893 3300009092 Bacteria 1255
204 Ga0105240_10078079 3300009093 Bacteria 4078
205 Ga0105245_10034867 3300009098 Bacteria 4464
206 Ga0105245_10384319 3300009098 Bacteria 1399
207 Ga0105245_10503400 3300009098 Bacteria 1228
208 Ga0105245_10625681 3300009098 Bacteria 1105
209 Ga0105245_10764077 3300009098 Bacteria 1003
210 Ga0105245_11653844 3300009098 Bacteria 692
211 Ga0105247_10073415 3300009101 Bacteria 2143
212 Ga0105243_10050363 3300009148 Bacteria 3290
213 Ga0105243_10055962 3300009148 Bacteria 3135
214 Ga0105243_10347082 3300009148 Bacteria 1361
215 Ga0105243_10757939 3300009148 Bacteria 952
216 Ga0105243_10842457 3300009148 Bacteria 907
217 Ga0105241_10256312 3300009174 Bacteria 1485
218 Ga0105241_10596625 3300009174 Bacteria 997
219 Ga0105242_10068343 3300009176 Bacteria 2939
220 Ga0105242_10075622 3300009176 Bacteria 2805
221 Ga0105242_11083859 3300009176 Bacteria 814
222 Ga0105248_10056660 3300009177 Bacteria 4397
223 Ga0105248_10228276 3300009177 Bacteria 2095
224 Ga0105248_11403710 3300009177 Bacteria 790
225 Ga0105237_11472947 3300009545 Bacteria 687
226 Ga0105238_10245300 3300009551 Bacteria 1769
227 Ga0105238_10315285 3300009551 Bacteria 1549
228 Ga0105238_10903286 3300009551 Bacteria 902
229 Ga0105249_10395111 3300009553 Bacteria 1412
230 Ga0105249_11358580 3300009553 Bacteria 782
231 Ga0099796_10068767 3300010159 Bacteria 1273
232 Ga0105239_10276517 3300010375 Bacteria 1889
233 Ga0105239_10450866 3300010375 Bacteria 1459
234 Ga0105239_11025249 3300010375 Bacteria 949
235 Ga0105246_10000197 3300011119 Bacteria 30217
236 Ga0105246_10002208 3300011119 Bacteria 11745
237 Ga0105246_10024288 3300011119 Bacteria 3936
238 Ga0105246_10051267 3300011119 Bacteria 2833
239 Ga0105246_10112621 3300011119 Bacteria 2001
240 Ga0105246_10207496 3300011119 Bacteria 1527
241 Ga0105246_10483823 3300011119 Bacteria 1048
242 Ga0157336_1001633 3300012477 Bacteria 1182
243 Ga0157338_1004574 3300012515 Bacteria 1203
244 Ga0157373_10001679 3300013100 Bacteria 16898
245 Ga0157373_10521465 3300013100 Bacteria 860
246 Ga0157371_10025927 3300013102 Bacteria 4265
247 Ga0157371_10144590 3300013102 Bacteria 1694
248 Ga0157371_10579807 3300013102 Bacteria 833
249 Ga0157370_10025635 3300013104 Bacteria 5835
250 Ga0157369_10009358 3300013105 Bacteria 11204
251 Ga0157369_10069859 3300013105 Bacteria 3773
252 Ga0157369_10086834 3300013105 Bacteria 3341
253 Ga0157369_10105151 3300013105 Bacteria 3005
254 Ga0157369_10297435 3300013105 Bacteria 1680
255 Ga0157369_10405979 3300013105 Bacteria 1413
256 Ga0157369_10927349 3300013105 Bacteria 893
257 Ga0157374_10065606 3300013296 Bacteria 3410
258 Ga0157374_10217344 3300013296 Bacteria 1875
259 Ga0157378_10280101 3300013297 Bacteria 1607
260 Ga0157378_10445481 3300013297 Bacteria 1284
261 Ga0157378_11697520 3300013297 Bacteria 678
262 Ga0163162_10034673 3300013306 Bacteria 5023
263 Ga0163162_10190209 3300013306 Bacteria 2180
264 Ga0163162_10701604 3300013306 Bacteria 1133
265 Ga0157372_10092016 3300013307 Bacteria 3449
266 Ga0157372_10426512 3300013307 Bacteria 1545
267 Ga0157375_10077748 3300013308 Bacteria 3349
268 Ga0157375_10159717 3300013308 Bacteria 2395
269 Ga0157375_10182570 3300013308 Bacteria 2250
270 Ga0157375_10679982 3300013308 Bacteria 1184
271 Ga0157375_11002394 3300013308 Bacteria 975
272 Ga0157375_11457604 3300013308 Bacteria 807
273 Ga0157375_11485186 3300013308 Bacteria 800
274 Ga0163163_10019634 3300014325 Bacteria 6348
275 Ga0163163_10111660 3300014325 Bacteria 2762
276 Ga0163163_10883665 3300014325 Bacteria 957
277 Ga0157380_10028146 3300014326 Bacteria 4281
278 Ga0182008_10001956 3300014497 Bacteria 13238
279 Ga0157376_10345454 3300014969 Bacteria 1422
280 Ga0157376_11086934 3300014969 Bacteria 825
281 Ga0182007_10000163 3300015262 Bacteria 46066
282 Ga0183367_1012 3300015688 Bacteria 347438
283 Ga0163161_10168721 3300017792 Bacteria 1672
284 Ga0163161_10677782 3300017792 Bacteria 857
285 Ga0163161_10725115 3300017792 Bacteria 830
286 Ga0197907_10815515 3300020069 Bacteria 1242
287 Ga0206356_11463270 3300020070 Bacteria 683
288 Ga0206356_11859014 3300020070 Bacteria 1109
289 Ga0206351_10108314 3300020077 Bacteria 873
290 Ga0206351_10251250 3300020077 Bacteria 771
291 Ga0206354_10086865 3300020081 Bacteria 1812
292 Ga0206354_10919820 3300020081 Bacteria 786
293 Ga0206354_11407995 3300020081 Bacteria 937
294 Ga0206353_10084704 3300020082 Bacteria 1015
295 Ga0206353_10810170 3300020082 Bacteria 1647
296 Ga0206353_11864166 3300020082 Bacteria 4286
297 Ga0213876_10137141 3300021384 Bacteria 1301
298 Ga0213875_10001662 3300021388 Bacteria 14016
299 Ga0213875_10002613 3300021388 Bacteria 10689
300 Ga0213875_10014186 3300021388 Bacteria 3893
301 Ga0213875_10079264 3300021388 Bacteria 1532
302 Ga0213875_10279945 3300021388 Bacteria 788
303 Ga0213875_10321178 3300021388 Bacteria 734
304 Ga0224712_10023797 3300022467 Bacteria 2131
305 Ga0224712_10273934 3300022467 Bacteria 784
306 Ga0224572_1011013 3300024225 Bacteria 1708
307 Ga0224572_1033009 3300024225 Bacteria 985
308 Ga0209148_1003971 3300025254 Bacteria 3798
309 Ga0209759_1029106 3300025256 Bacteria 1113
310 Ga0209129_1000067 3300025258 Bacteria 219974
311 Ga0209025_1000971 3300025294 Bacteria 42988
312 Ga0209758_1005907 3300025297 Bacteria 9111
313 Ga0207426_1000338 3300025302 Bacteria 88019
314 Ga0207426_1001520 3300025302 Bacteria 18903
315 Ga0207426_1031921 3300025302 Bacteria 1714
316 Ga0207426_1053126 3300025302 Bacteria 1197
317 Ga0209051_1000810 3300025303 Bacteria 32584
318 Ga0207697_10006382 3300025315 Bacteria 5341
319 Ga0207655_1005461 3300025728 Bacteria 8633
320 Ga0207655_1017475 3300025728 Bacteria 3866
321 Ga0207692_10003051 3300025898 Bacteria 6499
322 Ga0207692_10034193 3300025898 Bacteria 2459
323 Ga0207692_10074518 3300025898 Bacteria 1798
324 Ga0207692_10235530 3300025898 Bacteria 1091
325 Ga0207692_10266704 3300025898 Bacteria 1031
326 Ga0207692_10338471 3300025898 Bacteria 925
327 Ga0207692_10490597 3300025898 Bacteria 778
328 Ga0207642_10009380 3300025899 Bacteria 3401
329 Ga0207710_10137629 3300025900 Bacteria 1177
330 Ga0207688_10024482 3300025901 Bacteria 3311
331 Ga0207688_10042431 3300025901 Bacteria 2532
332 Ga0207688_10066415 3300025901 Bacteria 2040
333 Ga0207688_10351945 3300025901 Bacteria 908
334 Ga0207680_10177279 3300025903 Bacteria 1439
335 Ga0207680_10189510 3300025903 Bacteria 1395
336 Ga0207647_10091661 3300025904 Bacteria 1812
337 Ga0207647_10470686 3300025904 Bacteria 703
338 Ga0207685_10068604 3300025905 Bacteria 1429
339 Ga0207699_10002526 3300025906 Bacteria 8638
340 Ga0207699_10058070 3300025906 Bacteria 2313
341 Ga0207699_10176720 3300025906 Bacteria 1432
342 Ga0207699_10223185 3300025906 Bacteria 1287
343 Ga0207699_10421165 3300025906 Bacteria 954
344 Ga0207699_10610499 3300025906 Bacteria 795
345 Ga0207645_10035601 3300025907 Bacteria 3197
346 Ga0207643_10032287 3300025908 Bacteria 2924
347 Ga0207643_10072698 3300025908 Bacteria 1981
348 Ga0207705_10442043 3300025909 Bacteria 1008
349 Ga0207684_10032042 3300025910 Bacteria 4471
350 Ga0207684_10152822 3300025910 Bacteria 1986
351 Ga0207684_10173517 3300025910 Bacteria 1858
352 Ga0207684_10197793 3300025910 Bacteria 1734
353 Ga0207684_10669986 3300025910 Bacteria 883
354 Ga0207684_10926337 3300025910 Bacteria 731
355 Ga0207707_10132396 3300025912 Bacteria 2181
356 Ga0207693_10031316 3300025915 Bacteria 4202
357 Ga0207693_10131940 3300025915 Bacteria 1964
358 Ga0207693_10529986 3300025915 Bacteria 919
359 Ga0207693_10653801 3300025915 Bacteria 816
360 Ga0207663_10119125 3300025916 Bacteria 1804
361 Ga0207660_10047151 3300025917 Bacteria 3044
362 Ga0207662_10002144 3300025918 Bacteria 9824
363 Ga0207662_10350090 3300025918 Bacteria 992
364 Ga0207657_10015855 3300025919 Bacteria 7282
365 Ga0207657_10126054 3300025919 Bacteria 2103
366 Ga0207646_10029891 3300025922 Bacteria 4946
367 Ga0207646_10037944 3300025922 Bacteria 4342
368 Ga0207646_10118462 3300025922 Bacteria 2378
369 Ga0207646_10239390 3300025922 Bacteria 1639
370 Ga0207646_10259932 3300025922 Bacteria 1569
371 Ga0207646_10565058 3300025922 Bacteria 1022
372 Ga0207646_10806877 3300025922 Bacteria 836
373 Ga0207681_10034161 3300025923 Bacteria 3341
374 Ga0207694_10125335 3300025924 Bacteria 2054
375 Ga0207694_10275321 3300025924 Bacteria 1381
376 Ga0207694_10327174 3300025924 Bacteria 1266
377 Ga0207694_10703340 3300025924 Bacteria 852
378 Ga0207659_10099983 3300025926 Bacteria 2185
379 Ga0207687_10087006 3300025927 Bacteria 2270
380 Ga0207687_10141219 3300025927 Bacteria 1827
381 Ga0207700_10010090 3300025928 Bacteria 5938
382 Ga0207700_10025873 3300025928 Bacteria 4083
383 Ga0207700_10037584 3300025928 Bacteria 3507
384 Ga0207700_10086010 3300025928 Bacteria 2469
385 Ga0207700_10110443 3300025928 Bacteria 2211
386 Ga0207700_10225305 3300025928 Bacteria 1591
387 Ga0207700_10261064 3300025928 Bacteria 1483
388 Ga0207700_10281996 3300025928 Bacteria 1429
389 Ga0207664_10000492 3300025929 Bacteria 28137
390 Ga0207664_10005718 3300025929 Bacteria 8501
391 Ga0207664_10007561 3300025929 Bacteria 7541
392 Ga0207664_10011017 3300025929 Bacteria 6405
393 Ga0207664_10026896 3300025929 Bacteria 4354
394 Ga0207664_10131302 3300025929 Bacteria 2109
395 Ga0207664_10151825 3300025929 Bacteria 1968
396 Ga0207664_10155014 3300025929 Bacteria 1949
397 Ga0207664_10163229 3300025929 Bacteria 1901
398 Ga0207664_10210545 3300025929 Bacteria 1682
399 Ga0207664_10706878 3300025929 Bacteria 906
400 Ga0207690_10076202 3300025932 Bacteria 2328
401 Ga0207706_10720902 3300025933 Bacteria 851
402 Ga0207686_10041336 3300025934 Bacteria 2810
403 Ga0207709_10068634 3300025935 Bacteria 2241
404 Ga0207709_10255051 3300025935 Bacteria 1283
405 Ga0207709_10370178 3300025935 Bacteria 1087
406 Ga0207709_10661869 3300025935 Bacteria 832
407 Ga0207669_10153418 3300025937 Bacteria 1617
408 Ga0207669_10370234 3300025937 Bacteria 1113
409 Ga0207665_10004487 3300025939 Bacteria 9263
410 Ga0207665_10007373 3300025939 Bacteria 7270
411 Ga0207665_10026937 3300025939 Bacteria 3797
412 Ga0207665_10046112 3300025939 Bacteria 2920
413 Ga0207665_10095485 3300025939 Bacteria 2066
414 Ga0207691_10000484 3300025940 Bacteria 39400
415 Ga0207689_10005167 3300025942 Bacteria 11725
416 Ga0207661_10065552 3300025944 Bacteria 2949
417 Ga0207661_10076201 3300025944 Bacteria 2754
418 Ga0207667_10166731 3300025949 Bacteria 2264
419 Ga0207651_10725276 3300025960 Bacteria 877
420 Ga0207712_10163796 3300025961 Bacteria 1731
421 Ga0207712_10497387 3300025961 Bacteria 1042
422 Ga0207668_10146609 3300025972 Bacteria 1822
423 Ga0207668_10283072 3300025972 Bacteria 1361
424 Ga0207668_10499011 3300025972 Bacteria 1047
425 Ga0207668_10992441 3300025972 Bacteria 750
426 Ga0207640_10445065 3300025981 Bacteria 1066
427 Ga0207677_11039689 3300026023 Bacteria 744
428 Ga0207639_10018681 3300026041 Bacteria 4930
429 Ga0207639_10036114 3300026041 Bacteria 3660
430 Ga0207678_10000087 3300026067 Bacteria 76296
431 Ga0207678_10001935 3300026067 Bacteria 18899
432 Ga0207678_10451178 3300026067 Bacteria 1118
433 Ga0207708_10016045 3300026075 Bacteria 5626
434 Ga0207708_10230133 3300026075 Bacteria 1488
435 Ga0207702_10025105 3300026078 Bacteria 4943
436 Ga0207702_10091051 3300026078 Bacteria 2670
437 Ga0207702_10158911 3300026078 Bacteria 2063
438 Ga0207702_10232033 3300026078 Bacteria 1725
439 Ga0207702_10715617 3300026078 Bacteria 987
440 Ga0207641_10008662 3300026088 Bacteria 8402
441 Ga0207641_10152650 3300026088 Bacteria 2093
442 Ga0207648_10308167 3300026089 Bacteria 1421
443 Ga0207648_11065345 3300026089 Bacteria 758
444 Ga0207676_10557413 3300026095 Bacteria 1095
445 Ga0207674_10034736 3300026116 Bacteria 5267
446 Ga0207674_10051731 3300026116 Bacteria 4192
447 Ga0207683_10002130 3300026121 Bacteria 17397
448 Ga0207683_10003875 3300026121 Bacteria 12975
449 Ga0207683_10120118 3300026121 Bacteria 2359
450 Ga0207698_10269218 3300026142 Bacteria 1570
451 Ga0209813_10006915 3300027866 Bacteria 2815
452 Ga0207428_10121699 3300027907 Bacteria 2001
453 Ga0207428_10178890 3300027907 Bacteria 1603
454 Ga0268266_10128891 3300028379 Bacteria 2261
455 Ga0268266_10148120 3300028379 Bacteria 2113
456 Ga0268266_10202262 3300028379 Bacteria 1818
457 Ga0265337_1000784 3300028556 Bacteria 16711
458 Ga0265337_1035017 3300028556 Bacteria 1473
459 Ga0265326_10024854 3300028558 Bacteria 1708
460 Ga0265319_1006043 3300028563 Bacteria 5681
461 Ga0265334_10002216 3300028573 Bacteria 9147
462 Ga0265318_10121994 3300028577 Bacteria 958
463 Ga0265323_10033990 3300028653 Bacteria 1885
464 Ga0265336_10001403 3300028666 Bacteria 11120
465 Ga0307517_10013671 3300028786 Bacteria 11001
466 Ga0307515_10000050 3300028794 Bacteria 275624
467 Ga0307515_10051468 3300028794 Bacteria 6139
468 Ga0307515_10053114 3300028794 Bacteria 5988
469 Ga0307515_10098689 3300028794 Bacteria 3554
470 Ga0307515_10178784 3300028794 Bacteria 2081
471 Ga0307515_10192698 3300028794 Bacteria 1942
472 Ga0265338_10002384 3300028800 Bacteria 28309
473 Ga0265338_10004367 3300028800 Bacteria 19136
474 Ga0265338_10009574 3300028800 Bacteria 11524
475 Ga0265338_10035787 3300028800 Bacteria 4763
476 Ga0265324_10002386 3300029957 Bacteria 9671
477 Ga0307511_10000080 3300030521 Bacteria 80604
478 Ga0307511_10017601 3300030521 Bacteria 6851
479 Ga0307512_10002990 3300030522 Bacteria 20379
480 Ga0307512_10004801 3300030522 Bacteria 14517
481 Ga0307512_10020534 3300030522 Bacteria 5972
482 Ga0307512_10040788 3300030522 Bacteria 3868
483 Ga0307512_10085418 3300030522 Bacteria 2236
484 Ga0316180_1173122 3300030736 Bacteria 1116
485 Ga0265760_10019825 3300031090 Bacteria 1939
486 Ga0265332_10010221 3300031238 Bacteria 4176
487 Ga0265320_10034635 3300031240 Bacteria 2566
488 Ga0265325_10013623 3300031241 Bacteria 4623
489 Ga0265340_10002174 3300031247 Bacteria 11232
490 Ga0265316_10054485 3300031344 Bacteria 3131
491 Ga0307513_10004852 3300031456 Bacteria 17855
492 Ga0307513_10032771 3300031456 Bacteria 5853
493 Ga0307513_10068129 3300031456 Bacteria 3729
494 Ga0307513_10336719 3300031456 Bacteria 1261
495 Ga0307513_10354394 3300031456 Bacteria 1214
496 Ga0307509_10257602 3300031507 Bacteria 1522
497 Ga0307509_10282797 3300031507 Bacteria 1419
498 Ga0307509_10467457 3300031507 Bacteria 952
499 Ga0307408_100024343 3300031548 Bacteria 4133
500 Ga0307408_100031030 3300031548 Bacteria 3717
501 Ga0307408_100044689 3300031548 Bacteria 3158
502 Ga0307408_100044843 3300031548 Bacteria 3154
503 Ga0307408_100183151 3300031548 Bacteria 1681
504 Ga0307408_100218449 3300031548 Bacteria 1554
505 Ga0307408_100416314 3300031548 Bacteria 1157
506 Ga0265313_10005878 3300031595 Bacteria 8897
507 Ga0307508_10002207 3300031616 Bacteria 20770
508 Ga0307508_10002455 3300031616 Bacteria 19546
509 Ga0307508_10005361 3300031616 Bacteria 12212
510 Ga0307508_10021648 3300031616 Bacteria 5846
511 Ga0307508_10060834 3300031616 Bacteria 3338
512 Ga0307508_10185418 3300031616 Bacteria 1683
513 Ga0307514_10057674 3300031649 Bacteria 2973
514 Ga0307514_10110476 3300031649 Bacteria 1948
515 Ga0316575_10000792 3300031665 Bacteria 9594
516 Ga0316579_10004707 3300031691 Bacteria 5443
517 Ga0265314_10008241 3300031711 Bacteria 8948
518 Ga0265342_10002853 3300031712 Bacteria 14586
519 Ga0316576_10003957 3300031727 Bacteria 8803
520 Ga0316578_10005456 3300031728 Bacteria 6171
521 Ga0307516_10008723 3300031730 Bacteria 11404
522 Ga0307516_10019872 3300031730 Bacteria 6944
523 Ga0307516_10027222 3300031730 Bacteria 5798
524 Ga0307516_10114073 3300031730 Bacteria 2500
525 Ga0307405_10006646 3300031731 Bacteria 5707
526 Ga0307405_10013737 3300031731 Bacteria 4328
527 Ga0307405_10025650 3300031731 Bacteria 3388
528 Ga0307405_10054318 3300031731 Bacteria 2500
529 Ga0307405_10069388 3300031731 Bacteria 2259
530 Ga0307405_10125904 3300031731 Bacteria 1761
531 Ga0307405_10206287 3300031731 Bacteria 1431
532 Ga0307405_10248983 3300031731 Bacteria 1321
533 Ga0316577_10124158 3300031733 Bacteria 1451
534 Ga0307413_10019132 3300031824 Bacteria 3610
535 Ga0307413_10024267 3300031824 Bacteria 3303
536 Ga0307413_10058885 3300031824 Bacteria 2357
537 Ga0307413_10063857 3300031824 Bacteria 2285
538 Ga0307518_10000218 3300031838 Bacteria 43271
539 Ga0307518_10088394 3300031838 Bacteria 2232
540 Ga0307518_10193780 3300031838 Bacteria 1358
541 Ga0307410_10008763 3300031852 Bacteria 5632
542 Ga0307410_10024914 3300031852 Bacteria 3745
543 Ga0307410_10029352 3300031852 Bacteria 3502
544 Ga0307410_10073165 3300031852 Bacteria 2382
545 Ga0307410_10081401 3300031852 Bacteria 2274
546 Ga0307410_10218504 3300031852 Bacteria 1465
547 Ga0307410_10446982 3300031852 Bacteria 1053
548 Ga0307406_10022720 3300031901 Bacteria 3723
549 Ga0307406_10056311 3300031901 Bacteria 2517
550 Ga0307407_10040658 3300031903 Bacteria 2595
551 Ga0307407_10085531 3300031903 Bacteria 1919
552 Ga0307407_10182627 3300031903 Bacteria 1391
553 Ga0307407_10228160 3300031903 Bacteria 1263
554 Ga0307412_10002052 3300031911 Bacteria 11174
555 Ga0307412_10012455 3300031911 Bacteria 4959
556 Ga0307412_10026891 3300031911 Bacteria 3582
557 Ga0307412_10034900 3300031911 Bacteria 3209
558 Ga0307412_10035432 3300031911 Bacteria 3189
559 Ga0307412_10120213 3300031911 Bacteria 1890
560 Ga0307412_10222366 3300031911 Bacteria 1448
561 Ga0307412_10332218 3300031911 Bacteria 1213
562 Ga0307412_10727583 3300031911 Bacteria 854
563 Ga0307409_100003753 3300031995 Bacteria 8350
564 Ga0307409_100080222 3300031995 Bacteria 2632
565 Ga0307409_100135889 3300031995 Bacteria 2110
566 Ga0307409_100452060 3300031995 Bacteria 1240
567 Ga0307409_100507298 3300031995 Bacteria 1176
568 Ga0307409_100725174 3300031995 Bacteria 996
569 Ga0307409_100733648 3300031995 Bacteria 990
570 Ga0307409_100788252 3300031995 Bacteria 957
571 Ga0307409_101095355 3300031995 Bacteria 817
572 Ga0307416_100048766 3300032002 Bacteria 3362
573 Ga0307416_100063338 3300032002 Bacteria 3028
574 Ga0307416_100076375 3300032002 Bacteria 2807
575 Ga0307416_100201252 3300032002 Bacteria 1890
576 Ga0307416_100551146 3300032002 Bacteria 1226
577 Ga0307416_101175529 3300032002 Bacteria 872
578 Ga0307414_10019805 3300032004 Bacteria 4179
579 Ga0307414_10081723 3300032004 Bacteria 2367
580 Ga0307414_10810406 3300032004 Bacteria 854
581 Ga0307414_10894603 3300032004 Bacteria 814
582 Ga0307411_10152122 3300032005 Bacteria 1721
583 Ga0307411_10528777 3300032005 Bacteria 1002
584 Ga0307415_100087668 3300032126 Bacteria 2243
585 Ga0307415_100118386 3300032126 Bacteria 1980
586 Ga0307415_100466896 3300032126 Bacteria 1095
587 Ga0316585_10048468 3300032137 Bacteria 1361
588 Ga0307507_10017996 3300033179 Bacteria 8074
589 Ga0307510_10003092 3300033180 Bacteria 19240
590 Ga0307510_10004930 3300033180 Bacteria 15799
591 Ga0307510_10102295 3300033180 Bacteria 2648
592 Ga0316214_1002649 3300033545 Bacteria 2209
593 Ga0373948_0009436 3300034817 Bacteria 1682
594 Ga0373958_0007085 3300034819 Bacteria 1773
595 Ga0373926_0004046 3300035083 Bacteria 4783
596 Ga0373926_0023231 3300035083 Bacteria 2153
597 Ga0373928_0009779 3300035084 Bacteria 1877
598 Ga0373934_0010825 3300035086 Bacteria 3427
599 Ga0373934_0044774 3300035086 Bacteria 1749
600 Ga0373940_0005225 3300035088 Bacteria 2799
601 Ga0373951_0003077 3300035091 Bacteria 4115
602 Ga0373951_0016358 3300035091 Bacteria 1673
603 Ga0373952_0023651 3300035092 Bacteria 1314
604 Ga0373923_0013974 3300035111 Bacteria 3006
605 Ga0373923_0014072 3300035111 Bacteria 2997
606 Ga0373923_0019408 3300035111 Bacteria 2632
607 Ga0373923_0140396 3300035111 Bacteria 1092
608 Ga0373923_0185487 3300035111 Bacteria 957
609 Ga0373932_0004097 3300035112 Bacteria 3464
610 Ga0373936_0001422 3300035113 Bacteria 8700
611 Ga0373936_0015936 3300035113 Bacteria 2884
612 Ga0373936_0048790 3300035113 Bacteria 1710
613 Ga0373939_0023139 3300035114 Bacteria 1719
614 Ga0373941_0017473 3300035115 Bacteria 1966
615 Ga0373945_0002358 3300035116 Bacteria 5928
616 Ga0373945_0042879 3300035116 Bacteria 1640
617 Ga0373954_0099084 3300035118 Bacteria 1405
618 Ga0373954_0273548 3300035118 Bacteria 832
619 Ga0373956_0257604 3300035119 Bacteria 829
620 Ga0373957_0002120 3300035120 Bacteria 5579
621 Ga0373957_0014832 3300035120 Bacteria 2670
622 Ga0373957_0120377 3300035120 Bacteria 1062
623 Ga0373943_0078331 3300035170 Bacteria 1689
624 Ga0373946_0000398 3300035171 Bacteria 14160
625 Ga0373946_0013890 3300035171 Bacteria 3031
626 Ga0373955_0122713 3300035172 Bacteria 1511
627 Ga0373955_0180925 3300035172 Bacteria 1251
628 Ga0373962_0025650 3300035242 Bacteria 1584
629 Ga0316574_0011191 3300035398 Bacteria 5092
630 Ga0373924_0024697 3300035410 Bacteria 2370
631 Ga0373924_0170498 3300035410 Bacteria 956
632 Ga0373935_0018810 3300035692 Bacteria 4208
633 Ga0373927_0029341 3300035695 Bacteria 3584
634 Ga0373927_0160328 3300035695 Bacteria 1473
635 Ga0373933_0010751 3300035724 Bacteria 5022
636 Ga0373933_0056005 3300035724 Bacteria 2366
637 Ga0373933_0074319 3300035724 Bacteria 2072
638 Ga0373947_0022659 3300035725 Bacteria 3644
639 Ga0373947_0055048 3300035725 Bacteria 2402
640 Ga0373947_0193285 3300035725 Bacteria 1328
641 Ga0373947_0710775 3300035725 Bacteria 686
642 Ga0373937_0016715 3300036401 Bacteria 6520
643 Ga0373937_0042857 3300036401 Bacteria 4130
644 Ga0373937_0216172 3300036401 Bacteria 1804
645 Ga0372808_007581 3300036459 Bacteria 1487
646 Ga0316582_0001650 3300036647 Bacteria 9986
647 Ga0316584_0020649 3300036712 Bacteria 4779
648 Ga0373925_0001533 3300037068 Bacteria 19714
649 Ga0373925_0015583 3300037068 Bacteria 5500
650 Ga0373925_0019220 3300037068 Bacteria 4968
651 Ga0373925_0027975 3300037068 Bacteria 4128
652 Ga0373925_0035205 3300037068 Bacteria 3693
653 Ga0373925_0084551 3300037068 Bacteria 2418
654 Ga0373925_0089777 3300037068 Bacteria 2348
655 Ga0373925_0503491 3300037068 Bacteria 994
656 Ga0373925_1022192 3300037068 Bacteria 680
657 Ga0373925_1045791 3300037068 Bacteria 672
658 Ga0395899_0038060 3300037312 Bacteria 3604
659 Ga0395899_0044858 3300037312 Bacteria 3293
660 Ga0395899_0134618 3300037312 Bacteria 1762
661 Ga0395899_0275062 3300037312 Bacteria 1147
662 Ga0395899_0612614 3300037312 Bacteria 692
663 Ga0395900_0032828 3300037418 Bacteria 5339
664 Ga0395900_0093708 3300037418 Bacteria 3085
665 Ga0395900_0110020 3300037418 Bacteria 2831
666 Ga0395900_0139695 3300037418 Bacteria 2481
667 Ga0395900_0203312 3300037418 Bacteria 2003
668 Ga0395900_0207573 3300037418 Bacteria 1979
669 Ga0395900_0631476 3300037418 Bacteria 1009
670 Ga0395898_0001632 3300037466 Bacteria 30376
671 Ga0395898_0002149 3300037466 Bacteria 24274
672 Ga0395898_0008284 3300037466 Bacteria 10991
673 Ga0395898_0020796 3300037466 Bacteria 6660
674 Ga0395898_0021707 3300037466 Bacteria 6507
675 Ga0395898_0036794 3300037466 Bacteria 4858
676 Ga0395898_0085160 3300037466 Bacteria 3046
677 Ga0395898_0095229 3300037466 Bacteria 2861
678 Ga0395898_0279922 3300037466 Bacteria 1591
679 Ga0395898_0604101 3300037466 Bacteria 1040
680 Ga0395898_0821717 3300037466 Bacteria 869
681 Ga0395898_0916356 3300037466 Bacteria 814
682 Ga0395905_0001202 3300037471 Bacteria 32359
683 Ga0395905_0116969 3300037471 Bacteria 2505
684 Ga0395905_0509676 3300037471 Bacteria 1103
685 Ga0436364_0150636 3300037853 Bacteria 12283
686 Ga0436364_0395751 3300037853 Bacteria 17578
687 Ga0436364_0531502 3300037853 Bacteria 2071
688 Ga0436364_0784392 3300037853 Bacteria 1369
689 Ga0436364_0919138 3300037853 Bacteria 7564
690 Ga0436364_1320999 3300037853 Bacteria 6137
691 Ga0436364_1362811 3300037853 Bacteria 2337
692 Ga0436364_1517030 3300037853 Bacteria 99478
693 Ga0395901_0001966 3300038443 Bacteria 21141
694 Ga0395901_0003051 3300038443 Bacteria 16874
695 Ga0395901_0027170 3300038443 Bacteria 5879
696 Ga0395901_0044069 3300038443 Bacteria 4627
697 Ga0395901_0177249 3300038443 Bacteria 2235
698 Ga0395901_0179391 3300038443 Bacteria 2221
699 Ga0395901_0260685 3300038443 Bacteria 1804
700 Ga0395901_0376729 3300038443 Bacteria 1461
701 Ga0400485_15671 3300038735 Bacteria 29558
702 Ga0400486_02662 3300038742 Bacteria 74467
703 Ga0400486_13685 3300038742 Bacteria 2581
704 Ga0436365_0420689 3300039437 Bacteria 1212
705 Ga0436365_1811262 3300039437 Bacteria 5047
706 Ga0436360_0629473 3300039438 Bacteria 709
707 Ga0436361_0900465 3300039447 Bacteria 24867
708 Ga0436362_0534645 3300039453 Bacteria 919
709 Ga0436362_0824423 3300039453 Bacteria 925
710 Ga0439436_0000844 3300041404 Bacteria 8373
711 Ga0439436_0003084 3300041404 Bacteria 5051
712 Ga0439436_0005353 3300041404 Bacteria 3937
713 Ga0439436_0032311 3300041404 Bacteria 1518
714 Ga0439439_0001593 3300041406 Bacteria 4576
715 Ga0439439_0002844 3300041406 Bacteria 3741
716 Ga0439439_0025811 3300041406 Bacteria 1480
717 Ga0439461_0006529 3300041410 Bacteria 2035
718 Ga0439466_0001635 3300041411 Bacteria 8770
719 Ga0439466_0062472 3300041411 Bacteria 1197
720 Ga0439466_0081549 3300041411 Bacteria 1020
721 Ga0451793_0126831 3300041452 Bacteria 4440
722 Ga0451795_0121483 3300041456 Bacteria 2342
723 Ga0451833_0410178 3300041491 Bacteria 659
724 Ga0451837_0776717 3300041494 Bacteria 1799
725 Ga0451837_1343481 3300041494 Bacteria 1246
726 Ga0451841_0340527 3300041498 Bacteria 1040
727 Ga0451843_1293141 3300041509 Bacteria 1959
728 Ga0451843_1384929 3300041509 Bacteria 1694
729 Ga0451843_1552399 3300041509 Bacteria 1753
730 Ga0451853_0882312 3300041512 Bacteria 1113
731 Ga0451853_2556618 3300041512 Bacteria 1396
732 Ga0451853_2771047 3300041512 Bacteria 1626
733 Ga0451853_3274728 3300041512 Bacteria 921
734 Ga0451853_3485447 3300041512 Bacteria 2192
735 Ga0439433_0001722 3300041999 Bacteria 4544
736 Ga0439433_0004646 3300041999 Bacteria 2950
737 Ga0439433_0052443 3300041999 Bacteria 963
738 Ga0439442_000229 3300042002 Bacteria 13772
739 Ga0439442_000270 3300042002 Bacteria 12664
740 Ga0439442_043974 3300042002 Bacteria 941
741 Ga0439442_071765 3300042002 Bacteria 738
742 Ga0439448_0040106 3300042005 Bacteria 1511
743 Ga0439432_003959 3300042006 Bacteria 5448
744 Ga0439432_055494 3300042006 Bacteria 1229
745 Ga0439432_069218 3300042006 Bacteria 1078
746 Ga0439449_0000462 3300042007 Bacteria 15170
747 Ga0439449_0001950 3300042007 Bacteria 8099
748 Ga0439449_0014782 3300042007 Bacteria 2933
749 Ga0439449_0034925 3300042007 Bacteria 1872
750 Ga0439449_0069315 3300042007 Bacteria 1300
751 Ga0439449_0073024 3300042007 Bacteria 1264
752 Ga0439449_0139481 3300042007 Bacteria 902
753 Ga0439452_005042 3300042010 Bacteria 4312
754 Ga0439457_000259 3300042014 Bacteria 14444
755 Ga0439457_000484 3300042014 Bacteria 11509
756 Ga0439457_006468 3300042014 Bacteria 2869
757 Ga0439462_0025025 3300042015 Bacteria 1570
758 Ga0439462_0026643 3300042015 Bacteria 1524
759 Ga0439462_0051250 3300042015 Bacteria 1109
760 Ga0450919_014088 3300042121 Bacteria 903
761 Ga0450920_010457 3300042122 Bacteria 1721
762 Ga0450920_037827 3300042122 Bacteria 959
763 Ga0450894_000017 3300042131 Bacteria 23709
764 Ga0450896_001345 3300042133 Bacteria 2993
765 Ga0450898_001329 3300042134 Bacteria 3228
766 Ga0450899_000582 3300042135 Bacteria 4151
767 Ga0450903_000170 3300042138 Bacteria 14266
768 Ga0450906_006430 3300042145 Bacteria 2373
769 Ga0450907_002416 3300042146 Bacteria 3566
770 Ga0450907_017351 3300042146 Bacteria 1200
771 Ga0439458_0008360 3300042157 Bacteria 2304
772 Ga0450908_002967 3300042184 Bacteria 3306
773 Ga0450909_001368 3300042185 Bacteria 3388
774 Ga0439434_0000397 3300042435 Bacteria 12414
775 Ga0439434_0031409 3300042435 Bacteria 1614
776 Ga0450918_000574 3300042531 Bacteria 7815
777 Ga0450918_003347 3300042531 Bacteria 2979
778 Ga0466969_0001422 3300044656 Bacteria 12919
779 Ga0466969_0001882 3300044656 Bacteria 11220
780 Ga0466969_0040748 3300044656 Bacteria 2326
781 Ga0466969_0046972 3300044656 Bacteria 2138
782 Ga0466972_0003583 3300044658 Bacteria 7719
783 Ga0466972_0054977 3300044658 Bacteria 1915
784 Ga0466972_0113074 3300044658 Bacteria 1282
785 Ga0466972_0118593 3300044658 Bacteria 1248
786 Ga0466965_0002385 3300044683 Bacteria 7966
787 Ga0466965_0013515 3300044683 Bacteria 3853
788 Ga0466965_0115586 3300044683 Bacteria 1382
789 Ga0466965_0255202 3300044683 Bacteria 941
790 Ga0466965_0278362 3300044683 Bacteria 903
791 Ga0466966_0021627 3300044684 Bacteria 4223
792 Ga0466966_0030730 3300044684 Bacteria 3484
793 Ga0466966_0223787 3300044684 Bacteria 1135
794 Ga0466966_0235044 3300044684 Bacteria 1105
795 Ga0466961_0002971 3300044693 Bacteria 10527
796 Ga0466961_0356590 3300044693 Bacteria 890
797 Ga0466963_0001086 3300044694 Bacteria 14185
798 Ga0466963_0026338 3300044694 Bacteria 3718
799 Ga0466963_0065138 3300044694 Bacteria 2442
800 Ga0466963_0114573 3300044694 Bacteria 1852
801 Ga0466963_0176137 3300044694 Bacteria 1492
802 Ga0466963_0265137 3300044694 Bacteria 1206
803 Ga0466964_0003028 3300044706 Bacteria 6096
804 Ga0466964_0073551 3300044706 Bacteria 1451
805 Ga0466964_0135643 3300044706 Bacteria 1126
806 Ga0466964_0292931 3300044706 Bacteria 818
807 Ga0466971_0010428 3300044719 Bacteria 4060
808 Ga0466971_0018388 3300044719 Bacteria 3095
809 Ga0466971_0040993 3300044719 Bacteria 2080
810 Ga0466971_0050447 3300044719 Bacteria 1873
811 Ga0466968_0022011 3300044735 Bacteria 2587
812 Ga0466970_0000351 3300044765 Bacteria 22339
813 Ga0466970_0000945 3300044765 Bacteria 14039
814 Ga0466970_0010378 3300044765 Bacteria 4728
815 Ga0466970_0012006 3300044765 Bacteria 4423
816 Ga0466970_0192092 3300044765 Bacteria 1135
817 Ga0466970_0386280 3300044765 Bacteria 797
818 Ga0466970_0545358 3300044765 Bacteria 670
819 Ga0466957_0000810 3300044842 Bacteria 15942
820 Ga0466957_0012904 3300044842 Bacteria 4842
821 Ga0466960_0014836 3300044901 Bacteria 3347
822 Ga0466960_0025608 3300044901 Bacteria 2671
823 Ga0466960_0039396 3300044901 Bacteria 2228
824 Ga0466960_0093462 3300044901 Bacteria 1537
825 Ga0466960_0134497 3300044901 Bacteria 1308
826 Ga0466959_0001040 3300045049 Bacteria 16627
827 Ga0466959_0045253 3300045049 Bacteria 3241
828 Ga0466959_0093399 3300045049 Bacteria 2159
829 Ga0466959_0452473 3300045049 Bacteria 870
830 Ga0466958_0000718 3300045836 Bacteria 14480
831 Ga0466958_0002027 3300045836 Bacteria 9994
832 Ga0466958_0077604 3300045836 Bacteria 2040
833 Ga0466958_0434519 3300045836 Bacteria 849
834 Ga0466967_0022318 3300045976 Bacteria 5162
835 Ga0466967_0024594 3300045976 Bacteria 4954
836 Ga0466967_0030054 3300045976 Bacteria 4555
837 Ga0466967_0114113 3300045976 Bacteria 2487
838 Ga0466967_0190348 3300045976 Bacteria 1938
839 Ga0466967_0568248 3300045976 Bacteria 1117
840 Ga0466967_0574298 3300045976 Bacteria 1111
841 Ga0466967_0847801 3300045976 Bacteria 908
842 Ga0495592_0034168 3300046454 Bacteria 3833
843 Ga0495592_0116406 3300046454 Bacteria 1886
844 Ga0495592_0120291 3300046454 Bacteria 1848
845 Ga0495603_0000289 3300046455 Bacteria 26710
846 Ga0495603_0000661 3300046455 Bacteria 19477
847 Ga0495603_0000674 3300046455 Bacteria 19370
848 Ga0495603_0015404 3300046455 Bacteria 4626
849 Ga0495603_0036433 3300046455 Bacteria 2954
850 Ga0495603_0098020 3300046455 Bacteria 1712
851 Ga0495629_0000707 3300046459 Bacteria 27008
852 Ga0495629_0000836 3300046459 Bacteria 24977
853 Ga0495629_0005889 3300046459 Bacteria 9135
854 Ga0495629_0010308 3300046459 Bacteria 6809
855 Ga0495629_0012702 3300046459 Bacteria 6097
856 Ga0495629_0019392 3300046459 Bacteria 4859
857 Ga0495629_0109965 3300046459 Bacteria 1921
858 Ga0495629_0118311 3300046459 Bacteria 1846
859 Ga0495629_0261512 3300046459 Bacteria 1189
860 Ga0495629_0269857 3300046459 Bacteria 1169
861 Ga0495641_0001407 3300046461 Bacteria 20458
862 Ga0495651_0007222 3300046462 Bacteria 8492
863 Ga0495651_0034250 3300046462 Bacteria 3958
864 Ga0495651_0040256 3300046462 Bacteria 3635
865 Ga0495651_0047527 3300046462 Bacteria 3318
866 Ga0495651_0096599 3300046462 Bacteria 2207
867 Ga0495651_0109519 3300046462 Bacteria 2044
868 Ga0495651_0113178 3300046462 Bacteria 2003
869 Ga0495653_0001977 3300046463 Bacteria 16126
870 Ga0495653_0006324 3300046463 Bacteria 9719
871 Ga0495653_0018018 3300046463 Bacteria 5740
872 Ga0495653_0023407 3300046463 Bacteria 4991
873 Ga0495653_0055310 3300046463 Bacteria 3028
874 Ga0495653_0077750 3300046463 Bacteria 2463
875 Ga0495653_0100670 3300046463 Bacteria 2094
876 Ga0495650_0047918 3300046471 Bacteria 1784
877 Ga0495580_0007396 3300046472 Bacteria 8832
878 Ga0495580_0028835 3300046472 Bacteria 4033
879 Ga0495582_0001725 3300046473 Bacteria 12330
880 Ga0495582_0019391 3300046473 Bacteria 3718
881 Ga0495582_0026659 3300046473 Bacteria 3168
882 Ga0495582_0086160 3300046473 Bacteria 1748
883 Ga0495639_0002961 3300046475 Bacteria 7390
884 Ga0495639_0003573 3300046475 Bacteria 6705
885 Ga0495639_0053154 3300046475 Bacteria 1845
886 Ga0495639_0174079 3300046475 Bacteria 1046
887 Ga0495662_0001446 3300046476 Bacteria 11748
888 Ga0495662_0006850 3300046476 Bacteria 5668
889 Ga0495662_0039735 3300046476 Bacteria 2272
890 Ga0495662_0259843 3300046476 Bacteria 855
891 Ga0495664_0001216 3300046477 Bacteria 13471
892 Ga0495664_0001349 3300046477 Bacteria 12925
893 Ga0495664_0004093 3300046477 Bacteria 7957
894 Ga0495664_0021131 3300046477 Bacteria 3760
895 Ga0495664_0089126 3300046477 Bacteria 1854
896 Ga0495664_0192081 3300046477 Bacteria 1237
897 Ga0495664_0520604 3300046477 Bacteria 710
898 Ga0495585_0021922 3300046492 Bacteria 3667
899 Ga0495585_0062706 3300046492 Bacteria 2042
900 Ga0495594_0006506 3300046499 Bacteria 6013
901 Ga0495594_0015830 3300046499 Bacteria 3967
902 Ga0495594_0034590 3300046499 Bacteria 2749
903 Ga0495594_0044987 3300046499 Bacteria 2423
904 Ga0495594_0062666 3300046499 Bacteria 2059
905 Ga0495594_0089797 3300046499 Bacteria 1721
906 Ga0495594_0103966 3300046499 Bacteria 1599
907 Ga0495594_0171504 3300046499 Bacteria 1234
908 Ga0495594_0318595 3300046499 Bacteria 886
909 Ga0495607_0066806 3300046501 Bacteria 2022
910 Ga0495583_0234590 3300046506 Bacteria 739
911 Ga0495606_0001411 3300046507 Bacteria 32325
912 Ga0495608_0008605 3300046511 Bacteria 7147
913 Ga0495608_0025254 3300046511 Bacteria 4055
914 Ga0495618_0009873 3300046514 Bacteria 5776
915 Ga0495618_0131119 3300046514 Bacteria 1604
916 Ga0495628_0048012 3300046516 Bacteria 3385
917 Ga0495628_0121159 3300046516 Bacteria 2006
918 Ga0495628_0141781 3300046516 Bacteria 1834
919 Ga0495628_0248742 3300046516 Bacteria 1328
920 Ga0495630_0038479 3300046517 Bacteria 3578
921 Ga0495630_0125330 3300046517 Bacteria 1949
922 Ga0495630_0533591 3300046517 Bacteria 900
923 Ga0495630_0640155 3300046517 Bacteria 814
924 Ga0495631_0072346 3300046518 Bacteria 1489
925 Ga0495632_0039105 3300046519 Bacteria 2397
926 Ga0495632_0049523 3300046519 Bacteria 2076
927 Ga0495643_0004792 3300046522 Bacteria 9334
928 Ga0495643_0138838 3300046522 Bacteria 1214
929 Ga0495666_0015388 3300046526 Bacteria 3808
930 Ga0495666_0063817 3300046526 Bacteria 1758
931 Ga0495642_0020650 3300046528 Bacteria 2589
932 Ga0495642_0084530 3300046528 Bacteria 1339
933 Ga0495642_0345111 3300046528 Bacteria 654
934 Ga0495652_0006642 3300046529 Bacteria 10741
935 Ga0495652_0045550 3300046529 Bacteria 3769
936 Ga0495652_0098154 3300046529 Bacteria 2382
937 Ga0495665_0000460 3300046531 Bacteria 20467
938 Ga0495665_0004304 3300046531 Bacteria 7692
939 Ga0495665_0004561 3300046531 Bacteria 7477
940 Ga0495640_0019296 3300046533 Bacteria 5036
941 Ga0495640_0023776 3300046533 Bacteria 4458
942 Ga0495640_0046535 3300046533 Bacteria 3005
943 Ga0495640_0085367 3300046533 Bacteria 2092
944 Ga0495640_0112180 3300046533 Bacteria 1781
945 Ga0495640_0239536 3300046533 Bacteria 1139
946 Ga0495586_0001125 3300046535 Bacteria 15048
947 Ga0495586_0001218 3300046535 Bacteria 14449
948 Ga0495586_0025026 3300046535 Bacteria 3193
949 Ga0495587_0001013 3300046536 Bacteria 18464
950 Ga0495587_0005692 3300046536 Bacteria 8126
951 Ga0495587_0023700 3300046536 Bacteria 3770
952 Ga0495587_0063030 3300046536 Bacteria 2169
953 Ga0495587_0382738 3300046536 Bacteria 782
954 Ga0495621_0258112 3300046539 Bacteria 713
955 Ga0495645_0000775 3300046543 Bacteria 21886
956 Ga0495645_0012725 3300046543 Bacteria 5937
957 Ga0495645_0017960 3300046543 Bacteria 5075
958 Ga0495645_0037901 3300046543 Bacteria 3514
959 Ga0495622_0001939 3300046557 Bacteria 10168
960 Ga0495633_0040816 3300046558 Bacteria 2209
961 Ga0495633_0151193 3300046558 Bacteria 1072
962 Ga0495633_0286303 3300046558 Bacteria 749
963 Ga0495667_0008292 3300046559 Bacteria 7045
964 Ga0495667_0009434 3300046559 Bacteria 6611
965 Ga0495667_0009720 3300046559 Bacteria 6516
966 Ga0495667_0048311 3300046559 Bacteria 2809
967 Ga0495667_0281996 3300046559 Bacteria 1054
968 Ga0495667_0347243 3300046559 Bacteria 937
969 Ga0495656_0000169 3300046615 Bacteria 23292
970 Ga0495656_0019999 3300046615 Bacteria 2592
971 Ga0495656_0032717 3300046615 Bacteria 2118
972 Ga0495668_0000889 3300046616 Bacteria 33661
973 Ga0495668_0005024 3300046616 Bacteria 9121
974 Ga0495668_0029314 3300046616 Bacteria 3110
975 Ga0495634_0002610 3300046642 Bacteria 14829
976 Ga0495634_0007951 3300046642 Bacteria 7911
977 Ga0495634_0044523 3300046642 Bacteria 3003
978 Ga0495634_0161750 3300046642 Bacteria 1411
979 Ga0495611_0098066 3300046648 Bacteria 1359
980 Ga0495625_0001780 3300046660 Bacteria 24796
981 Ga0495625_0005724 3300046660 Bacteria 11237
982 Ga0495635_0017096 3300046663 Bacteria 5064
983 Ga0495635_0038484 3300046663 Bacteria 3311
984 Ga0495635_0099851 3300046663 Bacteria 1983
985 Ga0495635_0142881 3300046663 Bacteria 1629
986 Ga0495659_0005317 3300046664 Bacteria 4049
987 Ga0495588_0000974 3300046674 Bacteria 12520
988 Ga0495588_0001165 3300046674 Bacteria 11322
989 Ga0495588_0001188 3300046674 Bacteria 11231
990 Ga0495588_0007559 3300046674 Bacteria 4952
991 Ga0495588_0008867 3300046674 Bacteria 4627
992 Ga0495588_0009018 3300046674 Bacteria 4596
993 Ga0495588_0040515 3300046674 Bacteria 2376
994 Ga0495588_0272366 3300046674 Bacteria 892
995 Ga0495657_0010059 3300046675 Bacteria 7131
996 Ga0495657_0010805 3300046675 Bacteria 6856
997 Ga0495657_0014226 3300046675 Bacteria 5846
998 Ga0495657_0014662 3300046675 Bacteria 5753
999 Ga0495657_0021307 3300046675 Bacteria 4651
1000 Ga0495657_0048926 3300046675 Bacteria 2850
1001 Ga0495657_0077779 3300046675 Bacteria 2151
1002 Ga0495657_0103380 3300046675 Bacteria 1812
1003 Ga0495657_0193430 3300046675 Bacteria 1242
1004 Ga0495599_0065683 3300046678 Bacteria 2266
1005 Ga0495599_0136012 3300046678 Bacteria 1525
1006 Ga0495623_0015016 3300046679 Bacteria 5006
1007 Ga0495623_0021270 3300046679 Bacteria 4190
1008 Ga0495623_0032147 3300046679 Bacteria 3372
1009 Ga0495623_0078857 3300046679 Bacteria 2041
1010 Ga0495623_0101117 3300046679 Bacteria 1756
1011 Ga0495623_0150802 3300046679 Bacteria 1374
1012 Ga0495623_0172212 3300046679 Bacteria 1264
1013 Ga0495646_0006103 3300046680 Bacteria 7639
1014 Ga0495646_0029588 3300046680 Bacteria 3423
1015 Ga0495646_0031555 3300046680 Bacteria 3300
1016 Ga0495613_0000273 3300046689 Bacteria 48007
1017 Ga0495613_0003050 3300046689 Bacteria 12526
1018 Ga0495613_0004146 3300046689 Bacteria 10847
1019 Ga0495613_0006281 3300046689 Bacteria 8887
1020 Ga0495613_0043362 3300046689 Bacteria 3328
1021 Ga0495613_0154869 3300046689 Bacteria 1633
1022 Ga0495613_0354873 3300046689 Bacteria 1006
1023 Ga0495624_0023877 3300046690 Bacteria 4028
1024 Ga0495624_0088196 3300046690 Bacteria 1915
1025 Ga0495624_0090190 3300046690 Bacteria 1891
1026 Ga0495670_0000803 3300046691 Bacteria 15104
1027 Ga0495670_0026591 3300046691 Bacteria 2865
1028 Ga0495670_0042256 3300046691 Bacteria 2274
1029 Ga0495670_0049455 3300046691 Bacteria 2104
1030 Ga0495671_0007907 3300046692 Bacteria 6014
1031 Ga0495649_0265248 3300046694 Bacteria 880
1032 Ga0495589_0025263 3300046794 Bacteria 3015
1033 Ga0495589_0055145 3300046794 Bacteria 1959
1034 Ga0495589_0059458 3300046794 Bacteria 1878
1035 Ga0495589_0225265 3300046794 Bacteria 880
1036 Ga0495600_0002512 3300046809 Bacteria 10536
1037 Ga0495600_0013323 3300046809 Bacteria 5163
1038 Ga0495600_0029526 3300046809 Bacteria 3550
1039 Ga0495600_0137084 3300046809 Bacteria 1589
1040 Ga0495600_0152595 3300046809 Bacteria 1495
1041 Ga0495600_0157016 3300046809 Bacteria 1471
1042 Ga0495600_0315700 3300046809 Bacteria 983
1043 Ga0495660_0102531 3300046810 Bacteria 1471
1044 Ga0495581_0000967 3300047315 Bacteria 15443
1045 Ga0495581_0003601 3300047315 Bacteria 8913
1046 Ga0495581_0006363 3300047315 Bacteria 6849
1047 Ga0495581_0007210 3300047315 Bacteria 6432
1048 Ga0495581_0040613 3300047315 Bacteria 2692
1049 Ga0495581_0107086 3300047315 Bacteria 1625
1050 Ga0495581_0197043 3300047315 Bacteria 1178
1051 Ga0495581_0312369 3300047315 Bacteria 918
1052 Ga0495604_0000551 3300047317 Bacteria 32966
1053 Ga0495604_0001127 3300047317 Bacteria 22177
1054 Ga0495604_0001365 3300047317 Bacteria 19978
1055 Ga0495604_0017009 3300047317 Bacteria 5815
1056 Ga0495604_0042287 3300047317 Bacteria 3572
1057 Ga0495604_0045416 3300047317 Bacteria 3428
1058 Ga0495604_0049635 3300047317 Bacteria 3259
1059 Ga0495604_0160608 3300047317 Bacteria 1588
1060 Ga0495604_0228154 3300047317 Bacteria 1279
1061 Ga0495636_0002615 3300047318 Bacteria 6929
1062 Ga0495636_0002725 3300047318 Bacteria 6814
1063 Ga0495636_0008686 3300047318 Bacteria 4006
1064 Ga0495636_0011336 3300047318 Bacteria 3527
1065 Ga0495636_0163441 3300047318 Bacteria 1004
1066 Ga0495674_0000635 3300047319 Bacteria 32814
1067 Ga0495674_0036424 3300047319 Bacteria 4428
1068 Ga0495674_0036585 3300047319 Bacteria 4417
1069 Ga0495674_0066904 3300047319 Bacteria 3115
1070 Ga0495674_0113486 3300047319 Bacteria 2295
1071 Ga0495676_0002154 3300047321 Bacteria 17423
1072 Ga0495676_0002263 3300047321 Bacteria 17074
1073 Ga0495676_0005627 3300047321 Bacteria 11489
1074 Ga0495676_0013922 3300047321 Bacteria 7211
1075 Ga0495676_0020569 3300047321 Bacteria 5786
1076 Ga0495676_0497516 3300047321 Bacteria 800
1077 Ga0495680_0002388 3300047322 Bacteria 19256
1078 Ga0495680_0009246 3300047322 Bacteria 8880
1079 Ga0495680_0009271 3300047322 Bacteria 8866
1080 Ga0495680_0018990 3300047322 Bacteria 5820
1081 Ga0495680_0048963 3300047322 Bacteria 3315
1082 Ga0495680_0110332 3300047322 Bacteria 2039
1083 Ga0495683_0038893 3300047323 Bacteria 2407
1084 Ga0495683_0065507 3300047323 Bacteria 1792
1085 Ga0495683_0155979 3300047323 Bacteria 1059
1086 Ga0495687_007041 3300047443 Bacteria 6733
1087 Ga0495687_010689 3300047443 Bacteria 5011
1088 Ga0495687_017184 3300047443 Bacteria 3617
1089 Ga0495687_023822 3300047443 Bacteria 2919
1090 Ga0495675_0001118 3300047444 Bacteria 16294
1091 Ga0495675_0002946 3300047444 Bacteria 10227
1092 Ga0495675_0006706 3300047444 Bacteria 7056
1093 Ga0495675_0012079 3300047444 Bacteria 5429
1094 Ga0495675_0014288 3300047444 Bacteria 5017
1095 Ga0495675_0015184 3300047444 Bacteria 4868
1096 Ga0495675_0018022 3300047444 Bacteria 4477
1097 Ga0495675_0020599 3300047444 Bacteria 4197
1098 Ga0495675_0058549 3300047444 Bacteria 2443
1099 Ga0495677_0053309 3300047445 Bacteria 1491
1100 Ga0495677_0145199 3300047445 Bacteria 912
1101 Ga0495677_0179335 3300047445 Bacteria 821
1102 Ga0495685_001134 3300047447 Bacteria 8152
1103 Ga0495685_023581 3300047447 Bacteria 2118
1104 Ga0495685_108371 3300047447 Bacteria 915
1105 Ga0495685_112928 3300047447 Bacteria 893
1106 Ga0495685_173477 3300047447 Bacteria 696
1107 Ga0495681_0001152 3300047470 Bacteria 20018
1108 Ga0495681_0034494 3300047470 Bacteria 2521
1109 Ga0495684_0011248 3300047471 Bacteria 6914
1110 Ga0495684_0025184 3300047471 Bacteria 4574
1111 Ga0495684_0028470 3300047471 Bacteria 4289
1112 Ga0495684_0209979 3300047471 Bacteria 1432
1113 Ga0495686_0054410 3300047472 Bacteria 2506
1114 Ga0495593_0010641 3300047673 Bacteria 5307
1115 Ga0495593_0046721 3300047673 Bacteria 2306
1116 Ga0495593_0069168 3300047673 Bacteria 1836
1117 Ga0495593_0073062 3300047673 Bacteria 1779
1118 Ga0495602_0022719 3300048088 Bacteria 6133
1119 Ga0495602_0026583 3300048088 Bacteria 5579
1120 Ga0495602_0044060 3300048088 Bacteria 4050
1121 Ga0495602_0099247 3300048088 Bacteria 2394
1122 Ga0495602_0131686 3300048088 Bacteria 1993
1123 Ga0495614_0001215 3300048089 Bacteria 11093
1124 Ga0495614_0001410 3300048089 Bacteria 10382
1125 Ga0495614_0012972 3300048089 Bacteria 3653
1126 Ga0495615_0065408 3300048090 Bacteria 969
1127 Ga0495626_0000177 3300048091 Bacteria 78474
1128 Ga0496100_0000911 3300048903 Bacteria 14095
1129 Ga0496100_0032814 3300048903 Bacteria 3242
1130 Ga0496100_0037132 3300048903 Bacteria 3077
1131 Ga0496101_0021719 3300048904 Bacteria 4411
1132 Ga0496101_0095054 3300048904 Bacteria 2222
1133 Ga0496101_0097715 3300048904 Bacteria 2193
1134 Ga0496101_0754977 3300048904 Bacteria 767
1135 Ga0496102_0012786 3300048905 Bacteria 7266
1136 Ga0496102_0034680 3300048905 Bacteria 4540
1137 Ga0496102_0059283 3300048905 Bacteria 3500
1138 Ga0496102_0099802 3300048905 Bacteria 2695
1139 Ga0496102_0112755 3300048905 Bacteria 2536
1140 Ga0496102_0130519 3300048905 Bacteria 2351
1141 Ga0496102_0195435 3300048905 Bacteria 1906
1142 Ga0496102_0271262 3300048905 Bacteria 1600
1143 Ga0496102_0540822 3300048905 Bacteria 1087
1144 Ga0496103_0019771 3300048906 Bacteria 4042
1145 Ga0496103_0028986 3300048906 Bacteria 3362
1146 Ga0496104_0025879 3300048907 Bacteria 5411
1147 Ga0496104_0166288 3300048907 Bacteria 2115
1148 Ga0496104_0175927 3300048907 Bacteria 2051
1149 Ga0496105_0009336 3300048908 Bacteria 7667
1150 Ga0496105_0188794 3300048908 Bacteria 1686
1151 Ga0496106_0008239 3300048909 Bacteria 7707
1152 Ga0496106_0090571 3300048909 Bacteria 2360
1153 Ga0496106_0146457 3300048909 Bacteria 1860
1154 Ga0496106_0498409 3300048909 Bacteria 978
1155 Ga0496106_0780748 3300048909 Bacteria 758
1156 Ga0496107_0000205 3300048910 Bacteria 31113
1157 Ga0496107_0116646 3300048910 Bacteria 1966
1158 Ga0496107_0258969 3300048910 Bacteria 1294
1159 Ga0496108_0020456 3300048911 Bacteria 5441
1160 Ga0496108_0036973 3300048911 Bacteria 4065
1161 Ga0496108_0045557 3300048911 Bacteria 3663
1162 Ga0496108_0102213 3300048911 Bacteria 2445
1163 Ga0496108_0105750 3300048911 Bacteria 2403
1164 Ga0496108_0109179 3300048911 Bacteria 2364
1165 Ga0496108_0190844 3300048911 Bacteria 1776
1166 Ga0496108_0229661 3300048911 Bacteria 1613
1167 Ga0496108_0250700 3300048911 Bacteria 1540
1168 Ga0496108_0667730 3300048911 Bacteria 903
1169 Ga0496109_0009721 3300048912 Bacteria 8210
1170 Ga0496109_0022836 3300048912 Bacteria 5544
1171 Ga0496109_0054007 3300048912 Bacteria 3666
1172 Ga0496109_0079929 3300048912 Bacteria 3012
1173 Ga0496109_0117934 3300048912 Bacteria 2471
1174 Ga0496109_0220563 3300048912 Bacteria 1783
1175 Ga0496109_0339284 3300048912 Bacteria 1419
1176 Ga0496110_0005126 3300048913 Bacteria 10235
1177 Ga0496110_0016932 3300048913 Bacteria 6092
1178 Ga0496110_0039744 3300048913 Bacteria 4097
1179 Ga0496110_0119347 3300048913 Bacteria 2375
1180 Ga0496110_0174061 3300048913 Bacteria 1953
1181 Ga0496110_0751103 3300048913 Bacteria 879
1182 Ga0496111_0005349 3300048914 Bacteria 8206
1183 Ga0496111_0008961 3300048914 Bacteria 6655
1184 Ga0496111_0024928 3300048914 Bacteria 4218
1185 Ga0496111_0204936 3300048914 Bacteria 1466
1186 Ga0496112_0007219 3300048915 Bacteria 9848
1187 Ga0496112_0008964 3300048915 Bacteria 8980
1188 Ga0496112_0035680 3300048915 Bacteria 4846
1189 Ga0496112_0127537 3300048915 Bacteria 2515
1190 Ga0496112_0190570 3300048915 Bacteria 2012
1191 Ga0496112_0268406 3300048915 Bacteria 1655
1192 Ga0496112_0599808 3300048915 Bacteria 1033
1193 Ga0496112_0695523 3300048915 Bacteria 945
1194 Ga0496112_1238467 3300048915 Bacteria 662
1195 Ga0496113_0041026 3300048916 Bacteria 3413
1196 Ga0496113_0077598 3300048916 Bacteria 2540
1197 Ga0496113_0384940 3300048916 Bacteria 1126
1198 Ga0496113_0993707 3300048916 Bacteria 661
1199 Ga0496114_0014248 3300048917 Bacteria 6379
1200 Ga0496114_0019637 3300048917 Bacteria 5476
1201 Ga0496114_0038080 3300048917 Bacteria 3978
1202 Ga0496114_0067983 3300048917 Bacteria 2990
1203 Ga0496114_0094465 3300048917 Bacteria 2543
1204 Ga0496114_0101740 3300048917 Bacteria 2454
1205 Ga0496114_0263634 3300048917 Bacteria 1517
1206 Ga0496114_0365143 3300048917 Bacteria 1277
1207 Ga0496115_0065507 3300048918 Bacteria 2934
1208 Ga0496115_0111067 3300048918 Bacteria 2252
1209 Ga0496115_0132050 3300048918 Bacteria 2058
1210 Ga0496115_0404174 3300048918 Bacteria 1108
1211 Ga0496115_0721576 3300048918 Bacteria 782
1212 Ga0496119_0267752 3300048922 Bacteria 855
1213 Ga0496120_0082987 3300048923 Bacteria 1731
1214 Ga0496126_0106242 3300048929 Bacteria 2450
1215 Ga0501031_0016903 3300049568 Bacteria 4738
1216 Ga0501031_0051763 3300049568 Bacteria 2675
1217 Ga0501031_0071567 3300049568 Bacteria 2258
1218 Ga0501031_0340162 3300049568 Bacteria 971
1219 Ga0501032_0001454 3300049569 Bacteria 18832
1220 Ga0501032_0003154 3300049569 Bacteria 12681
1221 Ga0501032_0018618 3300049569 Bacteria 4862
1222 Ga0501032_0030901 3300049569 Bacteria 3673
1223 Ga0501032_0038818 3300049569 Bacteria 3241
1224 Ga0501032_0050784 3300049569 Bacteria 2796
1225 Ga0501033_0002947 3300049570 Bacteria 14227
1226 Ga0501033_0006990 3300049570 Bacteria 8810
1227 Ga0501033_0124785 3300049570 Bacteria 1867
1228 Ga0501033_0136061 3300049570 Bacteria 1778
1229 Ga0501033_0177558 3300049570 Bacteria 1527
1230 Ga0501033_0211614 3300049570 Bacteria 1382
1231 Ga0501034_0000016 3300049571 Bacteria 289751
1232 Ga0501034_0004314 3300049571 Bacteria 15852
1233 Ga0501034_0021654 3300049571 Bacteria 6548
1234 Ga0501034_0028851 3300049571 Bacteria 5644
1235 Ga0501034_0041128 3300049571 Bacteria 4676
1236 Ga0501034_0214443 3300049571 Bacteria 1879
1237 Ga0501036_0005059 3300049572 Bacteria 10673
1238 Ga0501036_0017602 3300049572 Bacteria 5977
1239 Ga0501036_0052565 3300049572 Bacteria 3450
1240 Ga0501036_0110905 3300049572 Bacteria 2318
1241 Ga0501036_0162704 3300049572 Bacteria 1881
1242 Ga0501037_0007139 3300049573 Bacteria 8165
1243 Ga0501037_0007493 3300049573 Bacteria 7987
1244 Ga0501037_0026503 3300049573 Bacteria 4285
1245 Ga0501037_0071906 3300049573 Bacteria 2516
1246 Ga0501037_0715483 3300049573 Bacteria 665
1247 Ga0501038_0001253 3300049574 Bacteria 23031
1248 Ga0501038_0002908 3300049574 Bacteria 15965
1249 Ga0501038_0010618 3300049574 Bacteria 8418
1250 Ga0501038_0095809 3300049574 Bacteria 2478
1251 Ga0501038_0171721 3300049574 Bacteria 1754
1252 Ga0501038_0367635 3300049574 Bacteria 1118
1253 Ga0501038_0406827 3300049574 Bacteria 1052
1254 Ga0501039_0065480 3300049575 Bacteria 2819
1255 Ga0501039_0313513 3300049575 Bacteria 1233
1256 Ga0501040_0031903 3300049576 Bacteria 3562
1257 Ga0501041_0419939 3300049577 Bacteria 848
1258 Ga0501042_0005568 3300049578 Bacteria 8120
1259 Ga0501042_0024723 3300049578 Bacteria 4214
1260 Ga0501042_0334147 3300049578 Bacteria 1095
1261 Ga0501043_0002314 3300049579 Bacteria 16128
1262 Ga0501043_0008272 3300049579 Bacteria 8195
1263 Ga0501043_0016636 3300049579 Bacteria 5765
1264 Ga0501043_0017277 3300049579 Bacteria 5660
1265 Ga0501043_0062835 3300049579 Bacteria 2916
1266 Ga0501043_0268737 3300049579 Bacteria 1309
1267 Ga0501046_0061563 3300049580 Bacteria 2933
1268 Ga0501046_0063234 3300049580 Bacteria 2890
1269 Ga0501046_0356910 3300049580 Bacteria 1060
1270 Ga0501047_0009383 3300049581 Bacteria 9243
1271 Ga0501047_0088241 3300049581 Bacteria 2978
1272 Ga0501047_0139487 3300049581 Bacteria 2303
1273 Ga0501047_0142513 3300049581 Bacteria 2274
1274 Ga0501047_0152011 3300049581 Bacteria 2190
1275 Ga0501047_0272187 3300049581 Bacteria 1540
1276 Ga0501047_0282064 3300049581 Bacteria 1506
1277 Ga0501047_0377416 3300049581 Bacteria 1252
1278 Ga0501048_0001305 3300049582 Bacteria 18906
1279 Ga0501048_0401236 3300049582 Bacteria 980
1280 Ga0501067_0050506 3300049583 Bacteria 2304
1281 Ga0501068_0020806 3300049584 Bacteria 3828
1282 Ga0501069_0057695 3300049585 Bacteria 2165
1283 Ga0501070_0016103 3300049586 Bacteria 6284
1284 Ga0501070_0052102 3300049586 Bacteria 3397
1285 Ga0501070_0156698 3300049586 Bacteria 1878
1286 Ga0501070_0201695 3300049586 Bacteria 1633
1287 Ga0501070_0292436 3300049586 Bacteria 1328
1288 Ga0501071_0047389 3300049587 Bacteria 3087
1289 Ga0501071_0265975 3300049587 Bacteria 1296
1290 Ga0501072_0010688 3300049588 Bacteria 6990
1291 Ga0501072_0676157 3300049588 Bacteria 812
1292 Ga0501073_0079767 3300049589 Bacteria 2278
1293 Ga0501073_0105234 3300049589 Bacteria 1958
1294 Ga0501074_0002571 3300049590 Bacteria 12670
1295 Ga0501074_0068836 3300049590 Bacteria 2544
1296 Ga0501076_0039284 3300049592 Bacteria 3716
1297 Ga0501077_0098383 3300049593 Bacteria 1854
1298 Ga0501079_0234851 3300049741 Bacteria 1432
1299 Ga0501080_0336893 3300049742 Bacteria 1363
1300 Ga0501080_0613978 3300049742 Bacteria 964
1301 Ga0501083_0016959 3300049744 Bacteria 5086
1302 Ga0501083_0091404 3300049744 Bacteria 2009
1303 Ga0501035_0002181 3300049822 Bacteria 19420
1304 Ga0501035_0002597 3300049822 Bacteria 17635
1305 Ga0501035_0007069 3300049822 Bacteria 10492
1306 Ga0501035_0029299 3300049822 Bacteria 5020
1307 Ga0501035_0030189 3300049822 Bacteria 4942
1308 Ga0501035_0038568 3300049822 Bacteria 4325
1309 Ga0501035_0157119 3300049822 Bacteria 1970
1310 Ga0501044_0001412 3300049823 Bacteria 28169
1311 Ga0501044_0004634 3300049823 Bacteria 15394
1312 Ga0501044_0007364 3300049823 Bacteria 12101
1313 Ga0501044_0025701 3300049823 Bacteria 6242
1314 Ga0501044_0058708 3300049823 Bacteria 3944
1315 Ga0501044_0073541 3300049823 Bacteria 3474
1316 Ga0501044_0108568 3300049823 Bacteria 2785
1317 Ga0501044_0422714 3300049823 Bacteria 1242
1318 Ga0501045_0290429 3300049824 Bacteria 1217
1319 nmdc:mga03683_118753_c1 3300050489 Bacteria 1174
1320 nmdc:mga03n38_12344_c1 3300050490 Bacteria 3212
1321 nmdc:mga03n38_282032_c1 3300050490 Bacteria 887
1322 nmdc:mga00v17_279831_c1 3300050491 Bacteria 1083
1323 nmdc:mga0yw44_184776_c1 3300050492 Bacteria 1373
1324 nmdc:mga0yw44_222155_c1 3300050492 Bacteria 1252
1325 nmdc:mga06z11_19685_c1 3300050494 Bacteria 3108
1326 nmdc:mga06z11_630545_c1 3300050494 Bacteria 652
1327 nmdc:mga04h51_1787_c1 3300050495 Bacteria 5031
1328 nmdc:mga07m45_45972_c1 3300050496 Bacteria 2451
1329 nmdc:mga07m45_93181_c1 3300050496 Bacteria 1727
1330 nmdc:mga05p37_1009026_c1 3300050507 Bacteria 883
1331 nmdc:mga09592_488415_c1 3300050508 Bacteria 1061
1332 nmdc:mga0n895_232567_c1 3300050512 Bacteria 1871
1333 nmdc:mga0rr50_819579_c1 3300050513 Bacteria 794
1334 Ga0495601_0018173 3300053077 Bacteria 4276
1335 Ga0495601_0018368 3300053077 Bacteria 4255
1336 Ga0495612_0042562 3300053078 Bacteria 1854
1337 Ga0500610_0101202 3300053079 Bacteria 1491
1338 Ga0495595_0013512 3300053084 Bacteria 3450
1339 Ga0495619_0074515 3300053085 Bacteria 2276
1340 Ga0495619_0317097 3300053085 Bacteria 1079
1341 Ga0500578_0022512 3300053086 Bacteria 4046
1342 Ga0500646_0036317 3300053090 Bacteria 1372
1343 Ga0500583_0284352 3300053092 Bacteria 812
1344 Ga0500651_0033941 3300053093 Bacteria 3217
1345 Ga0500566_0057348 3300053094 Bacteria 2212
1346 Ga0500641_0056734 3300053096 Bacteria 1623
1347 Ga0500650_0047308 3300053098 Bacteria 1994
1348 Ga0500654_064084 3300053099 Bacteria 1853
1349 Ga0500553_171286 3300053101 Bacteria 797
1350 Ga0500560_000672 3300053107 Bacteria 5063
1351 Ga0500560_121181 3300053107 Bacteria 877
1352 Ga0500569_001048 3300053109 Bacteria 5028
1353 Ga0500628_001995 3300053129 Bacteria 3429
1354 Ga0500652_002797 3300053131 Bacteria 5268
1355 Ga0500655_019641 3300053133 Bacteria 1259
1356 Ga0500658_0048578 3300053134 Bacteria 1725
1357 Ga0500559_0010867 3300053136 Bacteria 3902
1358 Ga0500561_0001401 3300053137 Bacteria 3924
1359 Ga0500573_0065384 3300053140 Bacteria 2079
1360 Ga0500573_0090678 3300053140 Bacteria 1727
1361 Ga0500577_0110128 3300053142 Bacteria 1135
1362 Ga0500579_080724 3300053143 Bacteria 1820
1363 Ga0500579_128243 3300053143 Bacteria 1198
1364 Ga0500600_0032396 3300053149 Bacteria 3062
1365 Ga0500600_0167422 3300053149 Bacteria 1073
1366 Ga0500616_0000636 3300053153 Bacteria 42399
1367 Ga0500616_0004879 3300053153 Bacteria 9339
1368 Ga0500633_0000859 3300053160 Bacteria 5265
1369 Ga0500634_0038614 3300053161 Bacteria 2595
1370 Ga0500634_0187570 3300053161 Bacteria 923
1371 Ga0500656_007510 3300053732 Bacteria 1135
1372 Ga0500587_006152 3300053739 Bacteria 1600
1373 Ga0501084_0007644 3300054114 Bacteria 8911
1374 Ga0587077_029969 3300059493 Bacteria 1030
1375 Ga0587072_032312 3300059643 Bacteria 983
1376 Ga0501082_0008555 3300060353 Bacteria 8827
1377 Ga0501082_0016216 3300060353 Bacteria 6413
1378 Ga0466962_0003282 3300061719 Bacteria 7684
1379 Ga0466962_0064678 3300061719 Bacteria 1746
1380 Ga0466962_0210027 3300061719 Bacteria 952
1381 2501940727 2501939600 Bacteria 6907073
1382 2515497550 2515154088 Bacteria 5526283
1383 2515757290 2515154137 Bacteria 5711575
1384 2516088761 2515154203 Bacteria 5458536
1385 2537900994 2537561592 Bacteria 4348607
1386 2547405475 2547132111 Bacteria 8013147
1387 2554261272 2554235005 Bacteria 6457341
1388 2558907664 2558860112 Bacteria 9931328
1389 2559425202 2558860280 Bacteria 11429938
1390 2566996278 2565956761 Bacteria 6601618
1391 2585311575 2582581313 Bacteria 10042643
1392 2585313866 2582581314 Bacteria 11452267
1393 2586063335 2585427649 Bacteria 9053857
1394 2616902984 2616644941 Bacteria 8510691
1395 2623588786 2622736626 Bacteria 7181580
1396 2643760684 2643221548 Bacteria 8053412
1397 2643900870 2643221578 Bacteria 9213798
1398 2643946260 2643221587 Bacteria 7586415
1399 2644018134 2643221601 Bacteria 7493239
1400 2644083397 2643221613 Bacteria 4622396
1401 2644177339 2643221631 Bacteria 8168043
1402 2644266344 2643221647 Bacteria 10741251
1403 2644388031 2643221670 Bacteria 6497041
1404 2644407017 2643221673 Bacteria 9196637
1405 2644433049 2643221677 Bacteria 7584031
1406 2644441032 2643221678 Bacteria 9540101
1407 2644523993 2643221694 Bacteria 4392972
1408 2644630416 2643221714 Bacteria 9015452
1409 2644666318 2643221721 Bacteria 4486924
1410 2644668090 2643221722 Bacteria 4247614
1411 2691513777 2690315906 Bacteria 4517044
1412 2729907936 2728369276 Bacteria 5610032
1413 2738890634 2738541308 Bacteria 7020677
1414 2775658065 2775506735 Bacteria 4556596
1415 2784585931 2784132148 Bacteria 8627943
1416 2785339137 2784746763 Bacteria 9783172
1417 2785366081 2784746768 Bacteria 10036182
1418 2786667069 2786546132 Bacteria 10419719
1419 2795783039 2795385470 Bacteria 8317180
1420 2795797120 2795385472 Bacteria 6627535
1421 2808831055 2808606357 Bacteria 4466944
1422 2808846706 2808606359 Bacteria 9866990
1423 2808852317 2808606360 Bacteria 4404006
1424 2808879400 2808606366 Bacteria 4415912
1425 2808891103 2808606370 Bacteria 4942454
1426 2808896364 2808606371 Bacteria 4251511
1427 2808917330 2808606375 Bacteria 9466072
1428 2809229433 2808606448 Bacteria 8656184
1429 2811846283 2808606982 Bacteria 7791042
1430 2812321253 2811994871 Bacteria 4497550
1431 2812361678 2811994879 Bacteria 9313447
1432 2812477115 2811994917 Bacteria 7761064
1433 2816422962 2816332119 Bacteria 8120218
1434 2816511118 2816332139 Bacteria 9138787
1435 2819695723 2818991463 Bacteria 7948711
1436 2819747346 2818991472 Bacteria 10089953
1437 2831935698 2831935698 Bacteria 5963223
1438 2844852650 2844849076 Bacteria 4091819
1439 2852643204 2852635781 Bacteria 8251373
1440 2856863040 2856858025 Bacteria 7255264
1441 2857742200 2857740372 Bacteria 4782044
1442 2858907267 2858902515 Bacteria 7086037
1443 2862180816 2862178590 Bacteria 8583590
1444 2862282256 2862281513 Bacteria 9621493
1445 2862389754 2862382967 Bacteria 10317375
1446 2862512618 2862507626 Bacteria 9425308
1447 2862574705 2862574272 Bacteria 10567477
1448 2862710197 2862705112 Bacteria 6563286
1449 2863075392 2863067949 Bacteria 8541735
1450 2863410784 2863404153 Bacteria 9672205
1451 2867371808 2867369537 Bacteria 6501581
1452 2867435303 2867428634 Bacteria 9590268
1453 2867475885 2867475112 Bacteria 6909112
1454 2867511418 2867507094 Bacteria 6506033
1455 2870785023 2870782633 Bacteria 9624083
1456 2873158307 2873151551 Bacteria 8625867
1457 2875398415 2875391855 Bacteria 7600475
1458 2877684419 2877676314 Bacteria 9512378
1459 2883824529 2883821847 Bacteria 5121194
1460 2884997325 2884994152 Bacteria 4492978
1461 2887479704 2887478801 Bacteria 8972725
1462 2899362727 2899359706 Bacteria 10940472
1463 2899376475 2899370129 Bacteria 6781179
1464 2902583275 2902582711 Bacteria 6187705
1465 2904498314 2904497146 Bacteria 4731781
1466 2904540916 2904535858 Bacteria 6308016
1467 2904777674 2904776348 Bacteria 4658726
1468 2910812021 2910809715 Bacteria 4982797
1469 2912723780 2912715099 Bacteria 9460473
1470 2912726888 2912723979 Bacteria 8557534
1471 2912758147 2912757875 Bacteria 7940295
1472 2918507459 2918501144 Bacteria 8668083
1473 2919035046 2919034639 Bacteria 4763403
1474 2919059871 2919059106 Bacteria 4991624
1475 2919395589 2919391150 Bacteria 4884741
1476 2919468844 2919468124 Bacteria 9133025
1477 2919540503 2919538618 Bacteria 4677069
1478 2922555008 2922554459 Bacteria 6683962
1479 2932428357 2932426870 Bacteria 4547726
1480 2933422459 2933418574 Bacteria 4476724
1481 2935891088 2935890801 Bacteria 4593001
1482 2939601386 2939598168 Bacteria 4687164
1483 2939648760 2939647034 Bacteria 4681660
1484 2939675185 2939674588 Bacteria 4844420
1485 2945920589 2945920336 Bacteria 4501603
1486 2945943186 2945941187 Bacteria 4682474
1487 2945959023 2945956166 Bacteria 5110334
1488 2946025928 2946024296 Bacteria 3508095
1489 2946039101 2946037020 Bacteria 4900426
1490 2946045779 2946045630 Bacteria 8527308
1491 2946062862 2946059875 Bacteria 4386623
1492 2946064487 2946064051 Bacteria 8957905
1493 2946072916 2946072368 Bacteria 8999607
1494 2947224433 2947224130 Bacteria 9938529
1495 2954000488 2953998280 Bacteria 4812144
1496 2954009082 2954002825 Bacteria 9173742
1497 2954390031 2954380949 Bacteria 10050426
1498 2954682153 2954673503 Bacteria 9685905
1499 2954690771 2954682443 Bacteria 9862841
1500 2954700620 2954691527 Bacteria 10720516
1501 2954701609 2954701450 Bacteria 10834262
1502 2954719270 2954711539 Bacteria 10867210
1503 2954729242 2954721474 Bacteria 10456478
1504 2954732568 2954731030 Bacteria 10243860
1505 2954748142 2954740390 Bacteria 10229294
1506 2954751447 2954749733 Bacteria 10366972
1507 2954767265 2954759201 Bacteria 9358192
1508 2966599014 2966598605 Bacteria 7676064
1509 2974302890 2974302888 Bacteria 4369871
1510 2990045399 2990044586 Bacteria 6603797
1511 2990066890 2990059506 Bacteria 9321252
1512 2990093467 2990088156 Bacteria 6657676
1513 2995465621 2995463766 Bacteria 8577691
1514 2996228284 2996221748 Bacteria 6799777
1515 2997452412 2997451912 Bacteria 8492419
1516 3006326537 3006321560 Bacteria 8247479
1517 3006396587 3006393351 Bacteria 6615579
1518 3006490757 3006486233 Bacteria 8157040
1519 3006494051 3006493962 Bacteria 8825450
1520 649815187 649633069 Bacteria 6962533
1521 8004024712 8004021418 Bacteria 4313954
1522 8004028319 8004025490 Bacteria 4327753
1523 8008486870 8008485437 Bacteria 7198341
1524 8008564834 8008558824 Bacteria 10610750
1525 8008581520 8008574985 Bacteria 7815457
1526 8023624877 8023623736 Bacteria 8593882
1527 8025526127 8025524527 Bacteria 7197316
1528 8025537224 8025530807 Bacteria 8495698
1529 8047894486 8047893842 Bacteria 11723082
1530 8048364566 8048356638 Bacteria 11044339
1531 8048371503 8048369669 Bacteria 11666822
1532 8048380437 8048379754 Bacteria 11877923
1533 8048407554 8048406513 Bacteria 8936924
1534 8054110061 8054107350 Bacteria 5022511
1535 8054165511 8054160619 Bacteria 7783213
1536 8056214155 8056207758 Bacteria 8639239
1537 8056830523 8056829672 Bacteria 9045328
1538 Ga0495651_0005180
1539 LJQas_1000535
1540 LJQas_1002191
1541 JGI24747J21853_1009459
1542 JGI24740J21852_10041884
1543 JGI24739J22299_10048222
1544 JGI24738J21930_10029325
1545 JGI25152J39213_1000124
1546 rootH1_10013192
1547 rootH1_10112119
1548 rootH2_10005306
1549 rootH2_10036987
1550 rootL2_10002055
1551 rootH1_10088740
1552 JGI25160J50197_1017012
1553 JGI25160J50197_1026859
1554 JGI25160J50197_1033597
1555 JGI25160J50197_1048716
1556 Ga0055542_1018106
1557 Ga0065714_10116297
1558 Ga0070676_10072757
1559 Ga0070683_100073511
1560 Ga0070690_100084707
1561 Ga0070670_100225957
1562 Ga0068869_100442107
1563 Ga0070666_10064382
1564 Ga0070666_10174208
1565 Ga0070682_100060004
1566 Ga0070682_100257041
1567 Ga0068868_100317012
1568 Ga0068868_100666654
1569 Ga0070660_100069941
1570 Ga0070689_100749988
1571 Ga0070691_10239118
1572 Ga0070661_100128843
1573 Ga0070692_10110429
1574 Ga0070668_100477793
1575 Ga0070668_100623168
1576 Ga0070675_100012367
1577 Ga0070675_100051392
1578 Ga0070671_100024680
1579 Ga0070671_100255122
1580 Ga0070673_100417417
1581 Ga0070688_100090767
1582 Ga0070659_100582495
1583 Ga0070659_100742238
1584 Ga0070659_100821582
1585 Ga0070703_10011369
1586 Ga0070709_10002968
1587 Ga0070709_10064220
1588 Ga0070709_10094386
1589 Ga0070709_10301508
1590 Ga0070709_10491591
1591 Ga0070709_10677397
1592 Ga0070714_100005159
1593 Ga0070714_100063865
1594 Ga0070714_100076110
1595 Ga0070714_100184067
1596 Ga0070714_100202369
1597 Ga0070714_100328582
1598 Ga0070714_100420221
1599 Ga0070714_100473049
1600 Ga0070714_100563543
1601 Ga0070714_100676969
1602 Ga0070713_100067709
1603 Ga0070713_100107105
1604 Ga0070713_100107386
1605 Ga0070713_100111518
1606 Ga0070713_100192701
1607 Ga0070713_100308167
1608 Ga0070710_10129196
1609 Ga0070710_10225789
1610 Ga0070701_10217931
1611 Ga0070711_100034804
1612 Ga0070711_100216864
1613 Ga0070711_100303401
1614 Ga0070711_100545367
1615 Ga0070700_100147406
1616 Ga0070694_100125456
1617 Ga0070708_100026859
1618 Ga0070708_100031874
1619 Ga0070708_100699609
1620 Ga0070663_100000200
1621 Ga0070663_100094838
1622 Ga0070678_100041960
1623 Ga0070678_100044896
1624 Ga0070662_100041824
1625 Ga0070681_10220371
1626 Ga0070681_10371782
1627 Ga0070685_10022823
1628 Ga0070706_100005952
1629 Ga0070706_100062786
1630 Ga0070706_100260877
1631 Ga0070706_100301676
1632 Ga0070706_100614708
1633 Ga0070707_100021379
1634 Ga0070707_100046002
1635 Ga0070707_100277078
1636 Ga0070707_100320307
1637 Ga0070698_100015722
1638 Ga0070698_100040242
1639 Ga0070698_100059047
1640 Ga0070698_100104626
1641 Ga0070698_100502148
1642 Ga0070698_100823409
1643 Ga0070699_100004229
1644 Ga0070699_100112281
1645 Ga0070679_100020051
1646 Ga0070679_100148284
1647 Ga0070679_100991786
1648 Ga0070684_100117990
1649 Ga0070684_100123846
1650 Ga0070684_100169416
1651 Ga0070684_100726117
1652 Ga0070697_100000297
1653 Ga0070697_100249985
1654 Ga0068853_100003712
1655 Ga0068853_100050169
1656 Ga0068853_100162906
1657 Ga0068853_100299520
1658 Ga0070672_100037137
1659 Ga0070672_100288829
1660 Ga0070672_100393752
1661 Ga0070686_100052369
1662 Ga0070695_100032353
1663 Ga0070693_100048338
1664 Ga0070665_100066875
1665 Ga0070665_100135130
1666 Ga0070665_100538105
1667 Ga0070704_100123499
1668 Ga0068855_100232018
1669 Ga0070664_100952478
1670 Ga0068857_100065627
1671 Ga0068854_100019910
1672 Ga0068856_100103223
1673 Ga0068856_100118950
1674 Ga0070702_100033411
1675 Ga0068859_100304670
1676 Ga0068864_100044733
1677 Ga0068864_100189675
1678 Ga0068864_100258911
1679 Ga0068866_10050747
1680 Ga0068866_10144192
1681 Ga0068866_10163428
1682 Ga0068861_100117328
1683 Ga0068861_100176561
1684 Ga0068851_10162167
1685 Ga0068870_10006949
1686 Ga0068863_100004992
1687 Ga0068863_100032201
1688 Ga0068863_100712410
1689 Ga0068858_100074577
1690 Ga0068860_100784821
1691 Ga0068862_100031297
1692 Ga0081455_10000045
1693 Ga0081455_10062588
1694 Ga0081538_10000036
1695 Ga0081540_1001418
1696 Ga0081539_10001518
1697 Ga0081539_10002486
1698 Ga0070717_10013495
1699 Ga0070717_10019489
1700 Ga0070717_10022664
1701 Ga0070717_10044166
1702 Ga0070717_10053539
1703 Ga0070717_10200894
1704 Ga0070717_10221305
1705 Ga0070717_10314907
1706 Ga0075368_10001580
1707 Ga0075363_100001400
1708 Ga0075363_100048444
1709 Ga0075363_100125899
1710 Ga0075364_10031453
1711 Ga0075432_10185752
1712 Ga0070715_10013884
1713 Ga0070715_10106382
1714 Ga0070715_10122570
1715 Ga0070715_10135485
1716 Ga0070716_100008308
1717 Ga0070716_100093886
1718 Ga0070712_100072461
1719 Ga0070712_100125749
1720 Ga0070712_100192400
1721 Ga0070712_100195833
1722 Ga0070712_100302706
1723 Ga0070712_100736567
1724 Ga0075362_10123914
1725 Ga0075367_10002607
1726 Ga0075370_10056980
1727 Ga0075370_10096132
1728 Ga0075434_100184513
1729 Ga0068865_100039270
1730 Ga0068865_100500477
1731 Ga0097620_100304673
1732 Ga0099826_10081186
1733 Ga0075435_100022404
1734 Ga0075435_100808802
1735 Ga0099795_10012716
1736 Ga0105251_10022179
1737 Ga0105251_10024584
1738 Ga0105244_10047301
1739 Ga0105244_10220369
1740 Ga0105250_10088893
1741 Ga0105240_10078079
1742 Ga0105245_10034867
1743 Ga0105245_10384319
1744 Ga0105245_10503400
1745 Ga0105245_10625681
1746 Ga0105245_10764077
1747 Ga0105245_11653844
1748 Ga0105247_10073415
1749 Ga0105243_10050363
1750 Ga0105243_10055962
1751 Ga0105243_10347082
1752 Ga0105243_10757939
1753 Ga0105243_10842457
1754 Ga0105241_10256312
1755 Ga0105241_10596625
1756 Ga0105242_10068343
1757 Ga0105242_10075622
1758 Ga0105242_11083859
1759 Ga0105248_10056660
1760 Ga0105248_10228276
1761 Ga0105248_11403710
1762 Ga0105237_11472947
1763 Ga0105238_10245300
1764 Ga0105238_10315285
1765 Ga0105238_10903286
1766 Ga0105249_10395111
1767 Ga0105249_11358580
1768 Ga0099796_10068767
1769 Ga0105239_10276517
1770 Ga0105239_10450866
1771 Ga0105239_11025249
1772 Ga0105246_10000197
1773 Ga0105246_10002208
1774 Ga0105246_10024288
1775 Ga0105246_10051267
1776 Ga0105246_10112621
1777 Ga0105246_10207496
1778 Ga0105246_10483823
1779 Ga0157336_1001633
1780 Ga0157338_1004574
1781 Ga0157373_10001679
1782 Ga0157373_10521465
1783 Ga0157371_10025927
1784 Ga0157371_10144590
1785 Ga0157371_10579807
1786 Ga0157370_10025635
1787 Ga0157369_10009358
1788 Ga0157369_10069859
1789 Ga0157369_10086834
1790 Ga0157369_10105151
1791 Ga0157369_10297435
1792 Ga0157369_10405979
1793 Ga0157369_10927349
1794 Ga0157374_10065606
1795 Ga0157374_10217344
1796 Ga0157378_10280101
1797 Ga0157378_10445481
1798 Ga0157378_11697520
1799 Ga0163162_10034673
1800 Ga0163162_10190209
1801 Ga0163162_10701604
1802 Ga0157372_10092016
1803 Ga0157372_10426512
1804 Ga0157375_10077748
1805 Ga0157375_10159717
1806 Ga0157375_10182570
1807 Ga0157375_10679982
1808 Ga0157375_11002394
1809 Ga0157375_11457604
1810 Ga0157375_11485186
1811 Ga0163163_10019634
1812 Ga0163163_10111660
1813 Ga0163163_10883665
1814 Ga0157380_10028146
1815 Ga0182008_10001956
1816 Ga0157376_10345454
1817 Ga0157376_11086934
1818 Ga0182007_10000163
1819 Ga0183367_1012
1820 Ga0163161_10168721
1821 Ga0163161_10677782
1822 Ga0163161_10725115
1823 Ga0197907_10815515
1824 Ga0206356_11463270
1825 Ga0206356_11859014
1826 Ga0206351_10108314
1827 Ga0206351_10251250
1828 Ga0206354_10086865
1829 Ga0206354_10919820
1830 Ga0206354_11407995
1831 Ga0206353_10084704
1832 Ga0206353_10810170
1833 Ga0206353_11864166
1834 Ga0213876_10137141
1835 Ga0213875_10001662
1836 Ga0213875_10002613
1837 Ga0213875_10014186
1838 Ga0213875_10079264
1839 Ga0213875_10279945
1840 Ga0213875_10321178
1841 Ga0224712_10023797
1842 Ga0224712_10273934
1843 Ga0224572_1011013
1844 Ga0224572_1033009
1845 Ga0209148_1003971
1846 Ga0209759_1029106
1847 Ga0209129_1000067
1848 Ga0209025_1000971
1849 Ga0209758_1005907
1850 Ga0207426_1000338
1851 Ga0207426_1001520
1852 Ga0207426_1031921
1853 Ga0207426_1053126
1854 Ga0209051_1000810
1855 Ga0207697_10006382
1856 Ga0207655_1005461
1857 Ga0207655_1017475
1858 Ga0207692_10003051
1859 Ga0207692_10034193
1860 Ga0207692_10074518
1861 Ga0207692_10235530
1862 Ga0207692_10266704
1863 Ga0207692_10338471
1864 Ga0207692_10490597
1865 Ga0207642_10009380
1866 Ga0207710_10137629
1867 Ga0207688_10024482
1868 Ga0207688_10042431
1869 Ga0207688_10066415
1870 Ga0207688_10351945
1871 Ga0207680_10177279
1872 Ga0207680_10189510
1873 Ga0207647_10091661
1874 Ga0207647_10470686
1875 Ga0207685_10068604
1876 Ga0207699_10002526
1877 Ga0207699_10058070
1878 Ga0207699_10176720
1879 Ga0207699_10223185
1880 Ga0207699_10421165
1881 Ga0207699_10610499
1882 Ga0207645_10035601
1883 Ga0207643_10032287
1884 Ga0207643_10072698
1885 Ga0207705_10442043
1886 Ga0207684_10032042
1887 Ga0207684_10152822
1888 Ga0207684_10173517
1889 Ga0207684_10197793
1890 Ga0207684_10669986
1891 Ga0207684_10926337
1892 Ga0207707_10132396
1893 Ga0207693_10031316
1894 Ga0207693_10131940
1895 Ga0207693_10529986
1896 Ga0207693_10653801
1897 Ga0207663_10119125
1898 Ga0207660_10047151
1899 Ga0207662_10002144
1900 Ga0207662_10350090
1901 Ga0207657_10015855
1902 Ga0207657_10126054
1903 Ga0207646_10029891
1904 Ga0207646_10037944
1905 Ga0207646_10118462
1906 Ga0207646_10239390
1907 Ga0207646_10259932
1908 Ga0207646_10565058
1909 Ga0207646_10806877
1910 Ga0207681_10034161
1911 Ga0207694_10125335
1912 Ga0207694_10275321
1913 Ga0207694_10327174
1914 Ga0207694_10703340
1915 Ga0207659_10099983
1916 Ga0207687_10087006
1917 Ga0207687_10141219
1918 Ga0207700_10010090
1919 Ga0207700_10025873
1920 Ga0207700_10037584
1921 Ga0207700_10086010
1922 Ga0207700_10110443
1923 Ga0207700_10225305
1924 Ga0207700_10261064
1925 Ga0207700_10281996
1926 Ga0207664_10000492
1927 Ga0207664_10005718
1928 Ga0207664_10007561
1929 Ga0207664_10011017
1930 Ga0207664_10026896
1931 Ga0207664_10131302
1932 Ga0207664_10151825
1933 Ga0207664_10155014
1934 Ga0207664_10163229
1935 Ga0207664_10210545
1936 Ga0207664_10706878
1937 Ga0207690_10076202
1938 Ga0207706_10720902
1939 Ga0207686_10041336
1940 Ga0207709_10068634
1941 Ga0207709_10255051
1942 Ga0207709_10370178
1943 Ga0207709_10661869
1944 Ga0207669_10153418
1945 Ga0207669_10370234
1946 Ga0207665_10004487
1947 Ga0207665_10007373
1948 Ga0207665_10026937
1949 Ga0207665_10046112
1950 Ga0207665_10095485
1951 Ga0207691_10000484
1952 Ga0207689_10005167
1953 Ga0207661_10065552
1954 Ga0207661_10076201
1955 Ga0207667_10166731
1956 Ga0207651_10725276
1957 Ga0207712_10163796
1958 Ga0207712_10497387
1959 Ga0207668_10146609
1960 Ga0207668_10283072
1961 Ga0207668_10499011
1962 Ga0207668_10992441
1963 Ga0207640_10445065
1964 Ga0207677_11039689
1965 Ga0207639_10018681
1966 Ga0207639_10036114
1967 Ga0207678_10000087
1968 Ga0207678_10001935
1969 Ga0207678_10451178
1970 Ga0207708_10016045
1971 Ga0207708_10230133
1972 Ga0207702_10025105
1973 Ga0207702_10091051
1974 Ga0207702_10158911
1975 Ga0207702_10232033
1976 Ga0207702_10715617
1977 Ga0207641_10008662
1978 Ga0207641_10152650
1979 Ga0207648_10308167
1980 Ga0207648_11065345
1981 Ga0207676_10557413
1982 Ga0207674_10034736
1983 Ga0207674_10051731
1984 Ga0207683_10002130
1985 Ga0207683_10003875
1986 Ga0207683_10120118
1987 Ga0207698_10269218
1988 Ga0209813_10006915
1989 Ga0207428_10121699
1990 Ga0207428_10178890
1991 Ga0268266_10128891
1992 Ga0268266_10148120
1993 Ga0268266_10202262
1994 Ga0265337_1000784
1995 Ga0265337_1035017
1996 Ga0265326_10024854
1997 Ga0265319_1006043
1998 Ga0265334_10002216
1999 Ga0265318_10121994
2000 Ga0265323_10033990
2001 Ga0265336_10001403
2002 Ga0307517_10013671
2003 Ga0307515_10000050
2004 Ga0307515_10051468
2005 Ga0307515_10053114
2006 Ga0307515_10098689
2007 Ga0307515_10178784
2008 Ga0307515_10192698
2009 Ga0265338_10002384
2010 Ga0265338_10004367
2011 Ga0265338_10009574
2012 Ga0265338_10035787
2013 Ga0265324_10002386
2014 Ga0307511_10000080
2015 Ga0307511_10017601
2016 Ga0307512_10002990
2017 Ga0307512_10004801
2018 Ga0307512_10020534
2019 Ga0307512_10040788
2020 Ga0307512_10085418
2021 Ga0316180_1173122
2022 Ga0265760_10019825
2023 Ga0265332_10010221
2024 Ga0265320_10034635
2025 Ga0265325_10013623
2026 Ga0265340_10002174
2027 Ga0265316_10054485
2028 Ga0307513_10004852
2029 Ga0307513_10032771
2030 Ga0307513_10068129
2031 Ga0307513_10336719
2032 Ga0307513_10354394
2033 Ga0307509_10257602
2034 Ga0307509_10282797
2035 Ga0307509_10467457
2036 Ga0307408_100024343
2037 Ga0307408_100031030
2038 Ga0307408_100044689
2039 Ga0307408_100044843
2040 Ga0307408_100183151
2041 Ga0307408_100218449
2042 Ga0307408_100416314
2043 Ga0265313_10005878
2044 Ga0307508_10002207
2045 Ga0307508_10002455
2046 Ga0307508_10005361
2047 Ga0307508_10021648
2048 Ga0307508_10060834
2049 Ga0307508_10185418
2050 Ga0307514_10057674
2051 Ga0307514_10110476
2052 Ga0316575_10000792
2053 Ga0316579_10004707
2054 Ga0265314_10008241
2055 Ga0265342_10002853
2056 Ga0316576_10003957
2057 Ga0316578_10005456
2058 Ga0307516_10008723
2059 Ga0307516_10019872
2060 Ga0307516_10027222
2061 Ga0307516_10114073
2062 Ga0307405_10006646
2063 Ga0307405_10013737
2064 Ga0307405_10025650
2065 Ga0307405_10054318
2066 Ga0307405_10069388
2067 Ga0307405_10125904
2068 Ga0307405_10206287
2069 Ga0307405_10248983
2070 Ga0316577_10124158
2071 Ga0307413_10019132
2072 Ga0307413_10024267
2073 Ga0307413_10058885
2074 Ga0307413_10063857
2075 Ga0307518_10000218
2076 Ga0307518_10088394
2077 Ga0307518_10193780
2078 Ga0307410_10008763
2079 Ga0307410_10024914
2080 Ga0307410_10029352
2081 Ga0307410_10073165
2082 Ga0307410_10081401
2083 Ga0307410_10218504
2084 Ga0307410_10446982
2085 Ga0307406_10022720
2086 Ga0307406_10056311
2087 Ga0307407_10040658
2088 Ga0307407_10085531
2089 Ga0307407_10182627
2090 Ga0307407_10228160
2091 Ga0307412_10002052
2092 Ga0307412_10012455
2093 Ga0307412_10026891
2094 Ga0307412_10034900
2095 Ga0307412_10035432
2096 Ga0307412_10120213
2097 Ga0307412_10222366
2098 Ga0307412_10332218
2099 Ga0307412_10727583
2100 Ga0307409_100003753
2101 Ga0307409_100080222
2102 Ga0307409_100135889
2103 Ga0307409_100452060
2104 Ga0307409_100507298
2105 Ga0307409_100725174
2106 Ga0307409_100733648
2107 Ga0307409_100788252
2108 Ga0307409_101095355
2109 Ga0307416_100048766
2110 Ga0307416_100063338
2111 Ga0307416_100076375
2112 Ga0307416_100201252
2113 Ga0307416_100551146
2114 Ga0307416_101175529
2115 Ga0307414_10019805
2116 Ga0307414_10081723
2117 Ga0307414_10810406
2118 Ga0307414_10894603
2119 Ga0307411_10152122
2120 Ga0307411_10528777
2121 Ga0307415_100087668
2122 Ga0307415_100118386
2123 Ga0307415_100466896
2124 Ga0316585_10048468
2125 Ga0307507_10017996
2126 Ga0307510_10003092
2127 Ga0307510_10004930
2128 Ga0307510_10102295
2129 Ga0316214_1002649
2130 Ga0373948_0009436
2131 Ga0373958_0007085
2132 Ga0373926_0004046
2133 Ga0373926_0023231
2134 Ga0373928_0009779
2135 Ga0373934_0010825
2136 Ga0373934_0044774
2137 Ga0373940_0005225
2138 Ga0373951_0003077
2139 Ga0373951_0016358
2140 Ga0373952_0023651
2141 Ga0373923_0013974
2142 Ga0373923_0014072
2143 Ga0373923_0019408
2144 Ga0373923_0140396
2145 Ga0373923_0185487
2146 Ga0373932_0004097
2147 Ga0373936_0001422
2148 Ga0373936_0015936
2149 Ga0373936_0048790
2150 Ga0373939_0023139
2151 Ga0373941_0017473
2152 Ga0373945_0002358
2153 Ga0373945_0042879
2154 Ga0373954_0099084
2155 Ga0373954_0273548
2156 Ga0373956_0257604
2157 Ga0373957_0002120
2158 Ga0373957_0014832
2159 Ga0373957_0120377
2160 Ga0373943_0078331
2161 Ga0373946_0000398
2162 Ga0373946_0013890
2163 Ga0373955_0122713
2164 Ga0373955_0180925
2165 Ga0373962_0025650
2166 Ga0316574_0011191
2167 Ga0373924_0024697
2168 Ga0373924_0170498
2169 Ga0373935_0018810
2170 Ga0373927_0029341
2171 Ga0373927_0160328
2172 Ga0373933_0010751
2173 Ga0373933_0056005
2174 Ga0373933_0074319
2175 Ga0373947_0022659
2176 Ga0373947_0055048
2177 Ga0373947_0193285
2178 Ga0373947_0710775
2179 Ga0373937_0016715
2180 Ga0373937_0042857
2181 Ga0373937_0216172
2182 Ga0372808_007581
2183 Ga0316582_0001650
2184 Ga0316584_0020649
2185 Ga0373925_0001533
2186 Ga0373925_0015583
2187 Ga0373925_0019220
2188 Ga0373925_0027975
2189 Ga0373925_0035205
2190 Ga0373925_0084551
2191 Ga0373925_0089777
2192 Ga0373925_0503491
2193 Ga0373925_1022192
2194 Ga0373925_1045791
2195 Ga0395899_0038060
2196 Ga0395899_0044858
2197 Ga0395899_0134618
2198 Ga0395899_0275062
2199 Ga0395899_0612614
2200 Ga0395900_0032828
2201 Ga0395900_0093708
2202 Ga0395900_0110020
2203 Ga0395900_0139695
2204 Ga0395900_0203312
2205 Ga0395900_0207573
2206 Ga0395900_0631476
2207 Ga0395898_0001632
2208 Ga0395898_0002149
2209 Ga0395898_0008284
2210 Ga0395898_0020796
2211 Ga0395898_0021707
2212 Ga0395898_0036794
2213 Ga0395898_0085160
2214 Ga0395898_0095229
2215 Ga0395898_0279922
2216 Ga0395898_0604101
2217 Ga0395898_0821717
2218 Ga0395898_0916356
2219 Ga0395905_0001202
2220 Ga0395905_0116969
2221 Ga0395905_0509676
2222 Ga0436364_0150636
2223 Ga0436364_0395751
2224 Ga0436364_0531502
2225 Ga0436364_0784392
2226 Ga0436364_0919138
2227 Ga0436364_1320999
2228 Ga0436364_1362811
2229 Ga0436364_1517030
2230 Ga0395901_0001966
2231 Ga0395901_0003051
2232 Ga0395901_0027170
2233 Ga0395901_0044069
2234 Ga0395901_0177249
2235 Ga0395901_0179391
2236 Ga0395901_0260685
2237 Ga0395901_0376729
2238 Ga0400485_15671
2239 Ga0400486_02662
2240 Ga0400486_13685
2241 Ga0436365_0420689
2242 Ga0436365_1811262
2243 Ga0436360_0629473
2244 Ga0436361_0900465
2245 Ga0436362_0534645
2246 Ga0436362_0824423
2247 Ga0439436_0000844
2248 Ga0439436_0003084
2249 Ga0439436_0005353
2250 Ga0439436_0032311
2251 Ga0439439_0001593
2252 Ga0439439_0002844
2253 Ga0439439_0025811
2254 Ga0439461_0006529
2255 Ga0439466_0001635
2256 Ga0439466_0062472
2257 Ga0439466_0081549
2258 Ga0451793_0126831
2259 Ga0451795_0121483
2260 Ga0451833_0410178
2261 Ga0451837_0776717
2262 Ga0451837_1343481
2263 Ga0451841_0340527
2264 Ga0451843_1293141
2265 Ga0451843_1384929
2266 Ga0451843_1552399
2267 Ga0451853_0882312
2268 Ga0451853_2556618
2269 Ga0451853_2771047
2270 Ga0451853_3274728
2271 Ga0451853_3485447
2272 Ga0439433_0001722
2273 Ga0439433_0004646
2274 Ga0439433_0052443
2275 Ga0439442_000229
2276 Ga0439442_000270
2277 Ga0439442_043974
2278 Ga0439442_071765
2279 Ga0439448_0040106
2280 Ga0439432_003959
2281 Ga0439432_055494
2282 Ga0439432_069218
2283 Ga0439449_0000462
2284 Ga0439449_0001950
2285 Ga0439449_0014782
2286 Ga0439449_0034925
2287 Ga0439449_0069315
2288 Ga0439449_0073024
2289 Ga0439449_0139481
2290 Ga0439452_005042
2291 Ga0439457_000259
2292 Ga0439457_000484
2293 Ga0439457_006468
2294 Ga0439462_0025025
2295 Ga0439462_0026643
2296 Ga0439462_0051250
2297 Ga0450919_014088
2298 Ga0450920_010457
2299 Ga0450920_037827
2300 Ga0450894_000017
2301 Ga0450896_001345
2302 Ga0450898_001329
2303 Ga0450899_000582
2304 Ga0450903_000170
2305 Ga0450906_006430
2306 Ga0450907_002416
2307 Ga0450907_017351
2308 Ga0439458_0008360
2309 Ga0450908_002967
2310 Ga0450909_001368
2311 Ga0439434_0000397
2312 Ga0439434_0031409
2313 Ga0450918_000574
2314 Ga0450918_003347
2315 Ga0466969_0001422
2316 Ga0466969_0001882
2317 Ga0466969_0040748
2318 Ga0466969_0046972
2319 Ga0466972_0003583
2320 Ga0466972_0054977
2321 Ga0466972_0113074
2322 Ga0466972_0118593
2323 Ga0466965_0002385
2324 Ga0466965_0013515
2325 Ga0466965_0115586
2326 Ga0466965_0255202
2327 Ga0466965_0278362
2328 Ga0466966_0021627
2329 Ga0466966_0030730
2330 Ga0466966_0223787
2331 Ga0466966_0235044
2332 Ga0466961_0002971
2333 Ga0466961_0356590
2334 Ga0466963_0001086
2335 Ga0466963_0026338
2336 Ga0466963_0065138
2337 Ga0466963_0114573
2338 Ga0466963_0176137
2339 Ga0466963_0265137
2340 Ga0466964_0003028
2341 Ga0466964_0073551
2342 Ga0466964_0135643
2343 Ga0466964_0292931
2344 Ga0466971_0010428
2345 Ga0466971_0018388
2346 Ga0466971_0040993
2347 Ga0466971_0050447
2348 Ga0466968_0022011
2349 Ga0466970_0000351
2350 Ga0466970_0000945
2351 Ga0466970_0010378
2352 Ga0466970_0012006
2353 Ga0466970_0192092
2354 Ga0466970_0386280
2355 Ga0466970_0545358
2356 Ga0466957_0000810
2357 Ga0466957_0012904
2358 Ga0466960_0014836
2359 Ga0466960_0025608
2360 Ga0466960_0039396
2361 Ga0466960_0093462
2362 Ga0466960_0134497
2363 Ga0466959_0001040
2364 Ga0466959_0045253
2365 Ga0466959_0093399
2366 Ga0466959_0452473
2367 Ga0466958_0000718
2368 Ga0466958_0002027
2369 Ga0466958_0077604
2370 Ga0466958_0434519
2371 Ga0466967_0022318
2372 Ga0466967_0024594
2373 Ga0466967_0030054
2374 Ga0466967_0114113
2375 Ga0466967_0190348
2376 Ga0466967_0568248
2377 Ga0466967_0574298
2378 Ga0466967_0847801
2379 Ga0495592_0034168
2380 Ga0495592_0116406
2381 Ga0495592_0120291
2382 Ga0495603_0000289
2383 Ga0495603_0000661
2384 Ga0495603_0000674
2385 Ga0495603_0015404
2386 Ga0495603_0036433
2387 Ga0495603_0098020
2388 Ga0495629_0000707
2389 Ga0495629_0000836
2390 Ga0495629_0005889
2391 Ga0495629_0010308
2392 Ga0495629_0012702
2393 Ga0495629_0019392
2394 Ga0495629_0109965
2395 Ga0495629_0118311
2396 Ga0495629_0261512
2397 Ga0495629_0269857
2398 Ga0495641_0001407
2399 Ga0495651_0007222
2400 Ga0495651_0034250
2401 Ga0495651_0040256
2402 Ga0495651_0047527
2403 Ga0495651_0096599
2404 Ga0495651_0109519
2405 Ga0495651_0113178
2406 Ga0495653_0001977
2407 Ga0495653_0006324
2408 Ga0495653_0018018
2409 Ga0495653_0023407
2410 Ga0495653_0055310
2411 Ga0495653_0077750
2412 Ga0495653_0100670
2413 Ga0495650_0047918
2414 Ga0495580_0007396
2415 Ga0495580_0028835
2416 Ga0495582_0001725
2417 Ga0495582_0019391
2418 Ga0495582_0026659
2419 Ga0495582_0086160
2420 Ga0495639_0002961
2421 Ga0495639_0003573
2422 Ga0495639_0053154
2423 Ga0495639_0174079
2424 Ga0495662_0001446
2425 Ga0495662_0006850
2426 Ga0495662_0039735
2427 Ga0495662_0259843
2428 Ga0495664_0001216
2429 Ga0495664_0001349
2430 Ga0495664_0004093
2431 Ga0495664_0021131
2432 Ga0495664_0089126
2433 Ga0495664_0192081
2434 Ga0495664_0520604
2435 Ga0495585_0021922
2436 Ga0495585_0062706
2437 Ga0495594_0006506
2438 Ga0495594_0015830
2439 Ga0495594_0034590
2440 Ga0495594_0044987
2441 Ga0495594_0062666
2442 Ga0495594_0089797
2443 Ga0495594_0103966
2444 Ga0495594_0171504
2445 Ga0495594_0318595
2446 Ga0495607_0066806
2447 Ga0495583_0234590
2448 Ga0495606_0001411
2449 Ga0495608_0008605
2450 Ga0495608_0025254
2451 Ga0495618_0009873
2452 Ga0495618_0131119
2453 Ga0495628_0048012
2454 Ga0495628_0121159
2455 Ga0495628_0141781
2456 Ga0495628_0248742
2457 Ga0495630_0038479
2458 Ga0495630_0125330
2459 Ga0495630_0533591
2460 Ga0495630_0640155
2461 Ga0495631_0072346
2462 Ga0495632_0039105
2463 Ga0495632_0049523
2464 Ga0495643_0004792
2465 Ga0495643_0138838
2466 Ga0495666_0015388
2467 Ga0495666_0063817
2468 Ga0495642_0020650
2469 Ga0495642_0084530
2470 Ga0495642_0345111
2471 Ga0495652_0006642
2472 Ga0495652_0045550
2473 Ga0495652_0098154
2474 Ga0495665_0000460
2475 Ga0495665_0004304
2476 Ga0495665_0004561
2477 Ga0495640_0019296
2478 Ga0495640_0023776
2479 Ga0495640_0046535
2480 Ga0495640_0085367
2481 Ga0495640_0112180
2482 Ga0495640_0239536
2483 Ga0495586_0001125
2484 Ga0495586_0001218
2485 Ga0495586_0025026
2486 Ga0495587_0001013
2487 Ga0495587_0005692
2488 Ga0495587_0023700
2489 Ga0495587_0063030
2490 Ga0495587_0382738
2491 Ga0495621_0258112
2492 Ga0495645_0000775
2493 Ga0495645_0012725
2494 Ga0495645_0017960
2495 Ga0495645_0037901
2496 Ga0495622_0001939
2497 Ga0495633_0040816
2498 Ga0495633_0151193
2499 Ga0495633_0286303
2500 Ga0495667_0008292
2501 Ga0495667_0009434
2502 Ga0495667_0009720
2503 Ga0495667_0048311
2504 Ga0495667_0281996
2505 Ga0495667_0347243
2506 Ga0495656_0000169
2507 Ga0495656_0019999
2508 Ga0495656_0032717
2509 Ga0495668_0000889
2510 Ga0495668_0005024
2511 Ga0495668_0029314
2512 Ga0495634_0002610
2513 Ga0495634_0007951
2514 Ga0495634_0044523
2515 Ga0495634_0161750
2516 Ga0495611_0098066
2517 Ga0495625_0001780
2518 Ga0495625_0005724
2519 Ga0495635_0017096
2520 Ga0495635_0038484
2521 Ga0495635_0099851
2522 Ga0495635_0142881
2523 Ga0495659_0005317
2524 Ga0495588_0000974
2525 Ga0495588_0001165
2526 Ga0495588_0001188
2527 Ga0495588_0007559
2528 Ga0495588_0008867
2529 Ga0495588_0009018
2530 Ga0495588_0040515
2531 Ga0495588_0272366
2532 Ga0495657_0010059
2533 Ga0495657_0010805
2534 Ga0495657_0014226
2535 Ga0495657_0014662
2536 Ga0495657_0021307
2537 Ga0495657_0048926
2538 Ga0495657_0077779
2539 Ga0495657_0103380
2540 Ga0495657_0193430
2541 Ga0495599_0065683
2542 Ga0495599_0136012
2543 Ga0495623_0015016
2544 Ga0495623_0021270
2545 Ga0495623_0032147
2546 Ga0495623_0078857
2547 Ga0495623_0101117
2548 Ga0495623_0150802
2549 Ga0495623_0172212
2550 Ga0495646_0006103
2551 Ga0495646_0029588
2552 Ga0495646_0031555
2553 Ga0495613_0000273
2554 Ga0495613_0003050
2555 Ga0495613_0004146
2556 Ga0495613_0006281
2557 Ga0495613_0043362
2558 Ga0495613_0154869
2559 Ga0495613_0354873
2560 Ga0495624_0023877
2561 Ga0495624_0088196
2562 Ga0495624_0090190
2563 Ga0495670_0000803
2564 Ga0495670_0026591
2565 Ga0495670_0042256
2566 Ga0495670_0049455
2567 Ga0495671_0007907
2568 Ga0495649_0265248
2569 Ga0495589_0025263
2570 Ga0495589_0055145
2571 Ga0495589_0059458
2572 Ga0495589_0225265
2573 Ga0495600_0002512
2574 Ga0495600_0013323
2575 Ga0495600_0029526
2576 Ga0495600_0137084
2577 Ga0495600_0152595
2578 Ga0495600_0157016
2579 Ga0495600_0315700
2580 Ga0495660_0102531
2581 Ga0495581_0000967
2582 Ga0495581_0003601
2583 Ga0495581_0006363
2584 Ga0495581_0007210
2585 Ga0495581_0040613
2586 Ga0495581_0107086
2587 Ga0495581_0197043
2588 Ga0495581_0312369
2589 Ga0495604_0000551
2590 Ga0495604_0001127
2591 Ga0495604_0001365
2592 Ga0495604_0017009
2593 Ga0495604_0042287
2594 Ga0495604_0045416
2595 Ga0495604_0049635
2596 Ga0495604_0160608
2597 Ga0495604_0228154
2598 Ga0495636_0002615
2599 Ga0495636_0002725
2600 Ga0495636_0008686
2601 Ga0495636_0011336
2602 Ga0495636_0163441
2603 Ga0495674_0000635
2604 Ga0495674_0036424
2605 Ga0495674_0036585
2606 Ga0495674_0066904
2607 Ga0495674_0113486
2608 Ga0495676_0002154
2609 Ga0495676_0002263
2610 Ga0495676_0005627
2611 Ga0495676_0013922
2612 Ga0495676_0020569
2613 Ga0495676_0497516
2614 Ga0495680_0002388
2615 Ga0495680_0009246
2616 Ga0495680_0009271
2617 Ga0495680_0018990
2618 Ga0495680_0048963
2619 Ga0495680_0110332
2620 Ga0495683_0038893
2621 Ga0495683_0065507
2622 Ga0495683_0155979
2623 Ga0495687_007041
2624 Ga0495687_010689
2625 Ga0495687_017184
2626 Ga0495687_023822
2627 Ga0495675_0001118
2628 Ga0495675_0002946
2629 Ga0495675_0006706
2630 Ga0495675_0012079
2631 Ga0495675_0014288
2632 Ga0495675_0015184
2633 Ga0495675_0018022
2634 Ga0495675_0020599
2635 Ga0495675_0058549
2636 Ga0495677_0053309
2637 Ga0495677_0145199
2638 Ga0495677_0179335
2639 Ga0495685_001134
2640 Ga0495685_023581
2641 Ga0495685_108371
2642 Ga0495685_112928
2643 Ga0495685_173477
2644 Ga0495681_0001152
2645 Ga0495681_0034494
2646 Ga0495684_0011248
2647 Ga0495684_0025184
2648 Ga0495684_0028470
2649 Ga0495684_0209979
2650 Ga0495686_0054410
2651 Ga0495593_0010641
2652 Ga0495593_0046721
2653 Ga0495593_0069168
2654 Ga0495593_0073062
2655 Ga0495602_0022719
2656 Ga0495602_0026583
2657 Ga0495602_0044060
2658 Ga0495602_0099247
2659 Ga0495602_0131686
2660 Ga0495614_0001215
2661 Ga0495614_0001410
2662 Ga0495614_0012972
2663 Ga0495615_0065408
2664 Ga0495626_0000177
2665 Ga0496100_0000911
2666 Ga0496100_0032814
2667 Ga0496100_0037132
2668 Ga0496101_0021719
2669 Ga0496101_0095054
2670 Ga0496101_0097715
2671 Ga0496101_0754977
2672 Ga0496102_0012786
2673 Ga0496102_0034680
2674 Ga0496102_0059283
2675 Ga0496102_0099802
2676 Ga0496102_0112755
2677 Ga0496102_0130519
2678 Ga0496102_0195435
2679 Ga0496102_0271262
2680 Ga0496102_0540822
2681 Ga0496103_0019771
2682 Ga0496103_0028986
2683 Ga0496104_0025879
2684 Ga0496104_0166288
2685 Ga0496104_0175927
2686 Ga0496105_0009336
2687 Ga0496105_0188794
2688 Ga0496106_0008239
2689 Ga0496106_0090571
2690 Ga0496106_0146457
2691 Ga0496106_0498409
2692 Ga0496106_0780748
2693 Ga0496107_0000205
2694 Ga0496107_0116646
2695 Ga0496107_0258969
2696 Ga0496108_0020456
2697 Ga0496108_0036973
2698 Ga0496108_0045557
2699 Ga0496108_0102213
2700 Ga0496108_0105750
2701 Ga0496108_0109179
2702 Ga0496108_0190844
2703 Ga0496108_0229661
2704 Ga0496108_0250700
2705 Ga0496108_0667730
2706 Ga0496109_0009721
2707 Ga0496109_0022836
2708 Ga0496109_0054007
2709 Ga0496109_0079929
2710 Ga0496109_0117934
2711 Ga0496109_0220563
2712 Ga0496109_0339284
2713 Ga0496110_0005126
2714 Ga0496110_0016932
2715 Ga0496110_0039744
2716 Ga0496110_0119347
2717 Ga0496110_0174061
2718 Ga0496110_0751103
2719 Ga0496111_0005349
2720 Ga0496111_0008961
2721 Ga0496111_0024928
2722 Ga0496111_0204936
2723 Ga0496112_0007219
2724 Ga0496112_0008964
2725 Ga0496112_0035680
2726 Ga0496112_0127537
2727 Ga0496112_0190570
2728 Ga0496112_0268406
2729 Ga0496112_0599808
2730 Ga0496112_0695523
2731 Ga0496112_1238467
2732 Ga0496113_0041026
2733 Ga0496113_0077598
2734 Ga0496113_0384940
2735 Ga0496113_0993707
2736 Ga0496114_0014248
2737 Ga0496114_0019637
2738 Ga0496114_0038080
2739 Ga0496114_0067983
2740 Ga0496114_0094465
2741 Ga0496114_0101740
2742 Ga0496114_0263634
2743 Ga0496114_0365143
2744 Ga0496115_0065507
2745 Ga0496115_0111067
2746 Ga0496115_0132050
2747 Ga0496115_0404174
2748 Ga0496115_0721576
2749 Ga0496119_0267752
2750 Ga0496120_0082987
2751 Ga0496126_0106242
2752 Ga0501031_0016903
2753 Ga0501031_0051763
2754 Ga0501031_0071567
2755 Ga0501031_0340162
2756 Ga0501032_0001454
2757 Ga0501032_0003154
2758 Ga0501032_0018618
2759 Ga0501032_0030901
2760 Ga0501032_0038818
2761 Ga0501032_0050784
2762 Ga0501033_0002947
2763 Ga0501033_0006990
2764 Ga0501033_0124785
2765 Ga0501033_0136061
2766 Ga0501033_0177558
2767 Ga0501033_0211614
2768 Ga0501034_0000016
2769 Ga0501034_0004314
2770 Ga0501034_0021654
2771 Ga0501034_0028851
2772 Ga0501034_0041128
2773 Ga0501034_0214443
2774 Ga0501036_0005059
2775 Ga0501036_0017602
2776 Ga0501036_0052565
2777 Ga0501036_0110905
2778 Ga0501036_0162704
2779 Ga0501037_0007139
2780 Ga0501037_0007493
2781 Ga0501037_0026503
2782 Ga0501037_0071906
2783 Ga0501037_0715483
2784 Ga0501038_0001253
2785 Ga0501038_0002908
2786 Ga0501038_0010618
2787 Ga0501038_0095809
2788 Ga0501038_0171721
2789 Ga0501038_0367635
2790 Ga0501038_0406827
2791 Ga0501039_0065480
2792 Ga0501039_0313513
2793 Ga0501040_0031903
2794 Ga0501041_0419939
2795 Ga0501042_0005568
2796 Ga0501042_0024723
2797 Ga0501042_0334147
2798 Ga0501043_0002314
2799 Ga0501043_0008272
2800 Ga0501043_0016636
2801 Ga0501043_0017277
2802 Ga0501043_0062835
2803 Ga0501043_0268737
2804 Ga0501046_0061563
2805 Ga0501046_0063234
2806 Ga0501046_0356910
2807 Ga0501047_0009383
2808 Ga0501047_0088241
2809 Ga0501047_0139487
2810 Ga0501047_0142513
2811 Ga0501047_0152011
2812 Ga0501047_0272187
2813 Ga0501047_0282064
2814 Ga0501047_0377416
2815 Ga0501048_0001305
2816 Ga0501048_0401236
2817 Ga0501067_0050506
2818 Ga0501068_0020806
2819 Ga0501069_0057695
2820 Ga0501070_0016103
2821 Ga0501070_0052102
2822 Ga0501070_0156698
2823 Ga0501070_0201695
2824 Ga0501070_0292436
2825 Ga0501071_0047389
2826 Ga0501071_0265975
2827 Ga0501072_0010688
2828 Ga0501072_0676157
2829 Ga0501073_0079767
2830 Ga0501073_0105234
2831 Ga0501074_0002571
2832 Ga0501074_0068836
2833 Ga0501076_0039284
2834 Ga0501077_0098383
2835 Ga0501079_0234851
2836 Ga0501080_0336893
2837 Ga0501080_0613978
2838 Ga0501083_0016959
2839 Ga0501083_0091404
2840 Ga0501035_0002181
2841 Ga0501035_0002597
2842 Ga0501035_0007069
2843 Ga0501035_0029299
2844 Ga0501035_0030189
2845 Ga0501035_0038568
2846 Ga0501035_0157119
2847 Ga0501044_0001412
2848 Ga0501044_0004634
2849 Ga0501044_0007364
2850 Ga0501044_0025701
2851 Ga0501044_0058708
2852 Ga0501044_0073541
2853 Ga0501044_0108568
2854 Ga0501044_0422714
2855 Ga0501045_0290429
2856 nmdc:mga03683_118753_c1
2857 nmdc:mga03n38_12344_c1
2858 nmdc:mga03n38_282032_c1
2859 nmdc:mga00v17_279831_c1
2860 nmdc:mga0yw44_184776_c1
2861 nmdc:mga0yw44_222155_c1
2862 nmdc:mga06z11_19685_c1
2863 nmdc:mga06z11_630545_c1
2864 nmdc:mga04h51_1787_c1
2865 nmdc:mga07m45_45972_c1
2866 nmdc:mga07m45_93181_c1
2867 nmdc:mga05p37_1009026_c1
2868 nmdc:mga09592_488415_c1
2869 nmdc:mga0n895_232567_c1
2870 nmdc:mga0rr50_819579_c1
2871 Ga0495601_0018173
2872 Ga0495601_0018368
2873 Ga0495612_0042562
2874 Ga0500610_0101202
2875 Ga0495595_0013512
2876 Ga0495619_0074515
2877 Ga0495619_0317097
2878 Ga0500578_0022512
2879 Ga0500646_0036317
2880 Ga0500583_0284352
2881 Ga0500651_0033941
2882 Ga0500566_0057348
2883 Ga0500641_0056734
2884 Ga0500650_0047308
2885 Ga0500654_064084
2886 Ga0500553_171286
2887 Ga0500560_000672
2888 Ga0500560_121181
2889 Ga0500569_001048
2890 Ga0500628_001995
2891 Ga0500652_002797
2892 Ga0500655_019641
2893 Ga0500658_0048578
2894 Ga0500559_0010867
2895 Ga0500561_0001401
2896 Ga0500573_0065384
2897 Ga0500573_0090678
2898 Ga0500577_0110128
2899 Ga0500579_080724
2900 Ga0500579_128243
2901 Ga0500600_0032396
2902 Ga0500600_0167422
2903 Ga0500616_0000636
2904 Ga0500616_0004879
2905 Ga0500633_0000859
2906 Ga0500634_0038614
2907 Ga0500634_0187570
2908 Ga0500656_007510
2909 Ga0500587_006152
2910 Ga0501084_0007644
2911 Ga0587077_029969
2912 Ga0587072_032312
2913 Ga0501082_0008555
2914 Ga0501082_0016216
2915 Ga0466962_0003282
2916 Ga0466962_0064678
2917 Ga0466962_0210027
2918 2501940727
2919 2515497550
2920 2515757290
2921 2516088761
2922 2537900994
2923 2547405475
2924 2554261272
2925 2558907664
2926 2559425202
2927 2566996278
2928 2585311575
2929 2585313866
2930 2586063335
2931 2616902984
2932 2623588786
2933 2643760684
2934 2643900870
2935 2643946260
2936 2644018134
2937 2644083397
2938 2644177339
2939 2644266344
2940 2644388031
2941 2644407017
2942 2644433049
2943 2644441032
2944 2644523993
2945 2644630416
2946 2644666318
2947 2644668090
2948 2691513777
2949 2729907936
2950 2738890634
2951 2775658065
2952 2784585931
2953 2785339137
2954 2785366081
2955 2786667069
2956 2795783039
2957 2795797120
2958 2808831055
2959 2808846706
2960 2808852317
2961 2808879400
2962 2808891103
2963 2808896364
2964 2808917330
2965 2809229433
2966 2811846283
2967 2812321253
2968 2812361678
2969 2812477115
2970 2816422962
2971 2816511118
2972 2819695723
2973 2819747346
2974 2831935698
2975 2844852650
2976 2852643204
2977 2856863040
2978 2857742200
2979 2858907267
2980 2862180816
2981 2862282256
2982 2862389754
2983 2862512618
2984 2862574705
2985 2862710197
2986 2863075392
2987 2863410784
2988 2867371808
2989 2867435303
2990 2867475885
2991 2867511418
2992 2870785023
2993 2873158307
2994 2875398415
2995 2877684419
2996 2883824529
2997 2884997325
2998 2887479704
2999 2899362727
3000 2899376475
3001 2902583275
3002 2904498314
3003 2904540916
3004 2904777674
3005 2910812021
3006 2912723780
3007 2912726888
3008 2912758147
3009 2918507459
3010 2919035046
3011 2919059871
3012 2919395589
3013 2919468844
3014 2919540503
3015 2922555008
3016 2932428357
3017 2933422459
3018 2935891088
3019 2939601386
3020 2939648760
3021 2939675185
3022 2945920589
3023 2945943186
3024 2945959023
3025 2946025928
3026 2946039101
3027 2946045779
3028 2946062862
3029 2946064487
3030 2946072916
3031 2947224433
3032 2954000488
3033 2954009082
3034 2954390031
3035 2954682153
3036 2954690771
3037 2954700620
3038 2954701609
3039 2954719270
3040 2954729242
3041 2954732568
3042 2954748142
3043 2954751447
3044 2954767265
3045 2966599014
3046 2974302890
3047 2990045399
3048 2990066890
3049 2990093467
3050 2995465621
3051 2996228284
3052 2997452412
3053 3006326537
3054 3006396587
3055 3006490757
3056 3006494051
3057 649815187
3058 8004024712
3059 8004028319
3060 8008486870
3061 8008564834
3062 8008581520
3063 8023624877
3064 8025526127
3065 8025537224
3066 8047894486
3067 8048364566
3068 8048371503
3069 8048380437
3070 8048407554
3071 8054110061
3072 8054165511
3073 8056214155
3074 8056830523

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01300

Sua5_yciO_yrdC

Telomere recombination

54

230

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kk9-assembly1.cif.gz_A crystal structure of e. coli ycio 0.9552 1 200
1kk9-assembly1.cif.gz_A crystal structure of e. coli ycio 0.9506 1 200
6f89-assembly2.cif.gz_B structure of h234a/y235a p.abyssi sua5 0.8914 3 192
3aje-assembly1.cif.gz_A crystal structure of s. tokodaii sua5 complexed with l-threonine and amppnp 0.8908 1 199
6f87-assembly3.cif.gz_C crystal structure of p. abyssi sua5 complexed with l-threonine and ppi 0.8898 4 192
ID Description Score Start End Superfamily
1kk9A00 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.9504 1 200 3.90.870.10
1kk9A00 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.9227 1 200 3.90.870.10
af_Q6YZF2_76_294_3.90.870.10 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.9165 1 195 3.90.870.10
af_Q60369_7_206_3.90.870.10 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.9035 9 199 3.90.870.10
af_P9WGC9_2_211_3.90.870.10 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.9006 9 199 3.90.870.10
ID Description Score Start End GO Terms
AF-A0A1C6SAI6-F1-model_v4 tRNA threonylcarbamoyl adenosine modification protein, Sua5/YciO/YrdC/YwlC family 0.979 1 200 GO:0003725
AF-A0A3Q9L060-F1-model_v4 Threonylcarbamoyl-AMP synthase 0.9781 1 200 GO:0003725
AF-A0A5B7UKK9-F1-model_v4 Threonylcarbamoyl-AMP synthase (EC 2.7.7.87) 0.9773 1 200 GO:0003725
GO:0061710
AF-A0A6G4TWY2-F1-model_v4 Threonylcarbamoyl-AMP synthase 0.9769 1 200 GO:0003725
AF-A0A163SWA8-F1-model_v4 Threonylcarbamoyl-AMP synthase (EC 2.7.7.87) 0.9769 1 200 GO:0003725
GO:0061710

Map