F494641
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1537 | 674 | 3074 | 206 |
Family's Representative Sequence
| Representative Sequence | 3300046462|Ga0495651_0005180|Ga0495651_0005180_1333_2049 |
| Length | 238 |
| Sequence | MCPLSLTPSTADPVPKASWRRENRQLIPYARRMAKYFDVHPENPQPRTIGSVADLVRSGALVAYPTDSCFALGCQLGNREGIGRIRSVRELDDRHHFTLVCRNFAQLGQFVHIDNKVFRAIKAATPGSYTFILPATSEVPRQLLHPKKRTVGVRIPDHVVAQALLAELGEPLVSSTLLLPGEDEPMTQGWEIKERLDHVLDAVLDSGDCGTEPTTVIDFSSGDAEIVRRGAGDTARFV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 8 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 13 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 80 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 81 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 82 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 83 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 85 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 86 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 87 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 88 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 92 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 93 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 94 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 98 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 99 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 100 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 114 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Metagenome | Rhizosphere |
| 117 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 118 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 130 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 132 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 133 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 140 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 141 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 143 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 145 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 204 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 206 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 207 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 208 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 209 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 210 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 211 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 212 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 213 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 214 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 215 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 216 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 217 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 218 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 219 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 220 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 221 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 222 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 223 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 224 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 225 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 226 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 227 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 228 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 229 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 230 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 231 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 232 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 233 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 234 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 235 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 236 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 237 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 238 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 239 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 240 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 241 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 242 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 243 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 244 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 245 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 246 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 247 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 248 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 249 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 250 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 251 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 252 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 253 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 254 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 255 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 256 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 257 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 258 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 259 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 260 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 261 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 262 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 263 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 264 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 265 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 266 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 267 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 268 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 269 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 270 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 271 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 272 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 273 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 274 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 275 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 276 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 277 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 278 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 279 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 280 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 281 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 282 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 283 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 284 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 285 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 286 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 287 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 288 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 289 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 290 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 291 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 292 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 293 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 294 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 295 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 296 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 297 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 298 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 299 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 300 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 301 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 302 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 303 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 304 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 305 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 306 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 307 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 308 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 309 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 310 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 311 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 312 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 313 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 314 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 315 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 316 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 317 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 318 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 319 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 320 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 321 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 322 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 323 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 324 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 325 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 326 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 327 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 328 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 329 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 330 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 331 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 332 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 333 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 334 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 335 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 336 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 337 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 338 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 339 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 340 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 341 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 342 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 343 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 344 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 345 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 346 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 347 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 422 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 423 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 424 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 425 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 426 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 427 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 428 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 429 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 430 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 431 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 432 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 433 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 434 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 435 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 436 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 437 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 438 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 439 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 440 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 443 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 444 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 445 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 446 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 447 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 448 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 449 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 450 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 451 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 452 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 453 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 454 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 455 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 458 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 459 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 460 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 461 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 462 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 463 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 464 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 465 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 466 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 467 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 468 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 469 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 470 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 471 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 472 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 473 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 474 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 475 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 476 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 477 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 478 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 479 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 480 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 481 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 482 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 485 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 488 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 489 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 490 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 491 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 492 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 493 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 494 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 495 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 496 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 497 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 498 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 499 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 500 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 501 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 502 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 503 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 504 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 505 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 506 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 507 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 508 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 509 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 510 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 511 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 512 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 513 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 514 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 515 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 516 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 517 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 518 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 519 | 2515154088 | Salinispora arenicola CNT800 | Isolate | Rhizosphere |
| 520 | 2515154137 | Salinispora arenicola CNX482 | Isolate | Rhizosphere |
| 521 | 2515154203 | Salinispora arenicola CNR921 | Isolate | Rhizosphere |
| 522 | 2537561592 | Arthrobacter crystallopoietes BAB-32 | Isolate | Rhizosphere |
| 523 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 524 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 525 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 526 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 527 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 528 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 529 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 530 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 531 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 532 | 2622736626 | Micromonospora rhizosphaerae DSM 45431 | Isolate | Rhizosphere |
| 533 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 534 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 535 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 536 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 537 | 2643221613 | Oerskovia sp. Root22 | Isolate | Unclassified |
| 538 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 539 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 540 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 541 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 542 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 543 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 544 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 545 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 546 | 2643221721 | Oerskovia sp. Root918 | Isolate | Unclassified |
| 547 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 548 | 2690315906 | Arthrobacter sp. OY3WO11 | Isolate | Unclassified |
| 549 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 550 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 551 | 2775506735 | Arthrobacter sp. S95 1704 | Isolate | Unclassified |
| 552 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 553 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 554 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 555 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 556 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 557 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 558 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 559 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 560 | 2808606360 | Arthrobacter sp. SLBN-112 | Isolate | Unclassified |
| 561 | 2808606366 | Arthrobacter sp. SLBN-83 | Isolate | Unclassified |
| 562 | 2808606370 | Arthrobacter sp. SLBN-100 | Isolate | Unclassified |
| 563 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
| 564 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 565 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 566 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 567 | 2811994871 | Arthrobacter sp. SLBN-179 | Isolate | Unclassified |
| 568 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 569 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 570 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 571 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 572 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 573 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 574 | 2831935698 | Jishengella sp. AZ1-13 | Isolate | Unclassified |
| 575 | 2844849076 | Arthrobacter cupressi DSM 24664 | Isolate | Rhizosphere |
| 576 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 577 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 578 | 2857740372 | Paenarthrobacter sp. R-74611 | Isolate | Unclassified |
| 579 | 2858902515 | Micromonospora sp. MW-13 | Isolate | Rhizosphere |
| 580 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 581 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 582 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 583 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 584 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 585 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 586 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 587 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 588 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 589 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 590 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 591 | 2867507094 | Micromonospora zingiberis PLAI 1-1 | Isolate | Unclassified |
| 592 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 593 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 594 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 595 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 596 | 2883821847 | Microlunatus elymi KUDC0627 | Isolate | Rhizosphere |
| 597 | 2884994152 | Cellulomonas sp. H30R-01 | Isolate | Rhizosphere |
| 598 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 599 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 600 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 601 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 602 | 2904497146 | Arthrobacter sp. 1276 | Isolate | Rhizosphere |
| 603 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 604 | 2904776348 | Paenarthrobacter sp. 1092 | Isolate | Rhizosphere |
| 605 | 2910809715 | Paenarthrobacter sp. CM16 | Isolate | Unclassified |
| 606 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 607 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 608 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 609 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 610 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 611 | 2919059106 | Arthrobacter sp. 1088 | Isolate | Rhizosphere |
| 612 | 2919391150 | Arthrobacter ipis 2973 | Isolate | Unclassified |
| 613 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 614 | 2919538618 | Paenarthrobacter nitroguajacolicus 3945 | Isolate | Unclassified |
| 615 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 616 | 2932426870 | Paenarthrobacter sp. 4246 | Isolate | Rhizosphere |
| 617 | 2933418574 | Jeotgalibacillus campisalis 4120 | Isolate | Rhizosphere |
| 618 | 2935890801 | Oerskovia enterophila 3230 | Isolate | Rhizosphere |
| 619 | 2939598168 | Arthrobacter sp. 754 | Isolate | Rhizosphere |
| 620 | 2939647034 | Arthrobacter sp. 2762 | Isolate | Rhizosphere |
| 621 | 2939674588 | Arthrobacter bambusae 3552 | Isolate | Rhizosphere |
| 622 | 2945920336 | Pseudarthrobacter siccitolerans W1I3 | Isolate | Rhizosphere |
| 623 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 624 | 2945956166 | Arthrobacter globiformus W2I3 | Isolate | Rhizosphere |
| 625 | 2946024296 | Arthrobacter woluwensis W4I2 | Isolate | Rhizosphere |
| 626 | 2946037020 | Arthrobacter sp. W4I7 | Isolate | Rhizosphere |
| 627 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 628 | 2946059875 | Arthrobacter sp. SLBN-112 | Isolate | Rhizosphere |
| 629 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 630 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 631 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 632 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
| 633 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 634 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 635 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 636 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 637 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 638 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 639 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 640 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 641 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 642 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 643 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 644 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 645 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 646 | 2974302888 | Pseudarthrobacter sp. SORGH_AS 212 | Isolate | Unclassified |
| 647 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 648 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 649 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 650 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 651 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 652 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 653 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 654 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 655 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 656 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 657 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 658 | 8004021418 | Arthrobacter sp. SDTb3-6 | Isolate | Rhizosphere |
| 659 | 8004025490 | Arthrobacter wenxiniae AETb3-4 | Isolate | Rhizosphere |
| 660 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 661 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 662 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 663 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 664 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 665 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 666 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 667 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 668 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 669 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 670 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 671 | 8054107350 | Arthrobacter rhizosphaerae CCNWLXL 1-35 | Isolate | Rhizosphere |
| 672 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 673 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
| 674 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.68 |
| Metatranscriptomes | 1.11 |
| Isolates | 10.21 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.49 |
| Nodule | 0.26 |
| Rhizoplane | 5.66 |
| Rhizosphere | 79.38 |
| Stem | 0 |
| Stem Tuber | 0.07 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495651_0005180 | 3300046462 | Bacteria | 9945 |
| 2 | LJQas_1000535 | 3300000549 | Bacteria | 6242 |
| 3 | LJQas_1002191 | 3300000549 | Bacteria | 2757 |
| 4 | JGI24747J21853_1009459 | 3300001978 | Bacteria | 964 |
| 5 | JGI24740J21852_10041884 | 3300001979 | Bacteria | 1376 |
| 6 | JGI24739J22299_10048222 | 3300001989 | Bacteria | 1386 |
| 7 | JGI24738J21930_10029325 | 3300002075 | Bacteria | 1125 |
| 8 | JGI25152J39213_1000124 | 3300002773 | Bacteria | 52334 |
| 9 | rootH1_10013192 | 3300003316 | Bacteria | 3047 |
| 10 | rootH1_10112119 | 3300003316 | Bacteria | 2763 |
| 11 | rootH2_10005306 | 3300003320 | Bacteria | 8319 |
| 12 | rootH2_10036987 | 3300003320 | Bacteria | 4189 |
| 13 | rootL2_10002055 | 3300003322 | Bacteria | 8705 |
| 14 | rootH1_10088740 | 3300003323 | Bacteria | 3739 |
| 15 | JGI25160J50197_1017012 | 3300003354 | Bacteria | 2320 |
| 16 | JGI25160J50197_1026859 | 3300003354 | Bacteria | 1579 |
| 17 | JGI25160J50197_1033597 | 3300003354 | Bacteria | 1288 |
| 18 | JGI25160J50197_1048716 | 3300003354 | Bacteria | 913 |
| 19 | Ga0055542_1018106 | 3300003762 | Bacteria | 1075 |
| 20 | Ga0065714_10116297 | 3300005288 | Bacteria | 1405 |
| 21 | Ga0070676_10072757 | 3300005328 | Bacteria | 2067 |
| 22 | Ga0070683_100073511 | 3300005329 | Bacteria | 3192 |
| 23 | Ga0070690_100084707 | 3300005330 | Bacteria | 2078 |
| 24 | Ga0070670_100225957 | 3300005331 | Bacteria | 1629 |
| 25 | Ga0068869_100442107 | 3300005334 | Bacteria | 1076 |
| 26 | Ga0070666_10064382 | 3300005335 | Bacteria | 2487 |
| 27 | Ga0070666_10174208 | 3300005335 | Bacteria | 1508 |
| 28 | Ga0070682_100060004 | 3300005337 | Bacteria | 2404 |
| 29 | Ga0070682_100257041 | 3300005337 | Bacteria | 1262 |
| 30 | Ga0068868_100317012 | 3300005338 | Bacteria | 1327 |
| 31 | Ga0068868_100666654 | 3300005338 | Bacteria | 928 |
| 32 | Ga0070660_100069941 | 3300005339 | Bacteria | 2738 |
| 33 | Ga0070689_100749988 | 3300005340 | Bacteria | 855 |
| 34 | Ga0070691_10239118 | 3300005341 | Bacteria | 969 |
| 35 | Ga0070661_100128843 | 3300005344 | Bacteria | 1899 |
| 36 | Ga0070692_10110429 | 3300005345 | Bacteria | 1520 |
| 37 | Ga0070668_100477793 | 3300005347 | Bacteria | 1076 |
| 38 | Ga0070668_100623168 | 3300005347 | Bacteria | 946 |
| 39 | Ga0070675_100012367 | 3300005354 | Bacteria | 6689 |
| 40 | Ga0070675_100051392 | 3300005354 | Bacteria | 3387 |
| 41 | Ga0070671_100024680 | 3300005355 | Bacteria | 4925 |
| 42 | Ga0070671_100255122 | 3300005355 | Bacteria | 1490 |
| 43 | Ga0070673_100417417 | 3300005364 | Bacteria | 1202 |
| 44 | Ga0070688_100090767 | 3300005365 | Bacteria | 1996 |
| 45 | Ga0070659_100582495 | 3300005366 | Bacteria | 960 |
| 46 | Ga0070659_100742238 | 3300005366 | Bacteria | 851 |
| 47 | Ga0070659_100821582 | 3300005366 | Bacteria | 809 |
| 48 | Ga0070703_10011369 | 3300005406 | Bacteria | 2514 |
| 49 | Ga0070709_10002968 | 3300005434 | Bacteria | 9134 |
| 50 | Ga0070709_10064220 | 3300005434 | Bacteria | 2347 |
| 51 | Ga0070709_10094386 | 3300005434 | Bacteria | 1979 |
| 52 | Ga0070709_10301508 | 3300005434 | Bacteria | 1170 |
| 53 | Ga0070709_10491591 | 3300005434 | Bacteria | 931 |
| 54 | Ga0070709_10677397 | 3300005434 | Bacteria | 801 |
| 55 | Ga0070714_100005159 | 3300005435 | Bacteria | 9942 |
| 56 | Ga0070714_100063865 | 3300005435 | Bacteria | 3167 |
| 57 | Ga0070714_100076110 | 3300005435 | Bacteria | 2913 |
| 58 | Ga0070714_100184067 | 3300005435 | Bacteria | 1902 |
| 59 | Ga0070714_100202369 | 3300005435 | Bacteria | 1817 |
| 60 | Ga0070714_100328582 | 3300005435 | Bacteria | 1431 |
| 61 | Ga0070714_100420221 | 3300005435 | Bacteria | 1266 |
| 62 | Ga0070714_100473049 | 3300005435 | Bacteria | 1192 |
| 63 | Ga0070714_100563543 | 3300005435 | Bacteria | 1091 |
| 64 | Ga0070714_100676969 | 3300005435 | Bacteria | 994 |
| 65 | Ga0070713_100067709 | 3300005436 | Bacteria | 3007 |
| 66 | Ga0070713_100107105 | 3300005436 | Bacteria | 2431 |
| 67 | Ga0070713_100107386 | 3300005436 | Bacteria | 2428 |
| 68 | Ga0070713_100111518 | 3300005436 | Bacteria | 2386 |
| 69 | Ga0070713_100192701 | 3300005436 | Bacteria | 1838 |
| 70 | Ga0070713_100308167 | 3300005436 | Bacteria | 1459 |
| 71 | Ga0070710_10129196 | 3300005437 | Bacteria | 1538 |
| 72 | Ga0070710_10225789 | 3300005437 | Bacteria | 1193 |
| 73 | Ga0070701_10217931 | 3300005438 | Bacteria | 1137 |
| 74 | Ga0070711_100034804 | 3300005439 | Bacteria | 3362 |
| 75 | Ga0070711_100216864 | 3300005439 | Bacteria | 1485 |
| 76 | Ga0070711_100303401 | 3300005439 | Bacteria | 1270 |
| 77 | Ga0070711_100545367 | 3300005439 | Bacteria | 961 |
| 78 | Ga0070700_100147406 | 3300005441 | Bacteria | 1606 |
| 79 | Ga0070694_100125456 | 3300005444 | Bacteria | 1847 |
| 80 | Ga0070708_100026859 | 3300005445 | Bacteria | 4932 |
| 81 | Ga0070708_100031874 | 3300005445 | Bacteria | 4566 |
| 82 | Ga0070708_100699609 | 3300005445 | Bacteria | 954 |
| 83 | Ga0070663_100000200 | 3300005455 | Bacteria | 29769 |
| 84 | Ga0070663_100094838 | 3300005455 | Bacteria | 2216 |
| 85 | Ga0070678_100041960 | 3300005456 | Bacteria | 3248 |
| 86 | Ga0070678_100044896 | 3300005456 | Bacteria | 3158 |
| 87 | Ga0070662_100041824 | 3300005457 | Bacteria | 3272 |
| 88 | Ga0070681_10220371 | 3300005458 | Bacteria | 1812 |
| 89 | Ga0070681_10371782 | 3300005458 | Bacteria | 1340 |
| 90 | Ga0070685_10022823 | 3300005466 | Bacteria | 3417 |
| 91 | Ga0070706_100005952 | 3300005467 | Bacteria | 11536 |
| 92 | Ga0070706_100062786 | 3300005467 | Bacteria | 3433 |
| 93 | Ga0070706_100260877 | 3300005467 | Bacteria | 1617 |
| 94 | Ga0070706_100301676 | 3300005467 | Bacteria | 1494 |
| 95 | Ga0070706_100614708 | 3300005467 | Bacteria | 1009 |
| 96 | Ga0070707_100021379 | 3300005468 | Bacteria | 6114 |
| 97 | Ga0070707_100046002 | 3300005468 | Bacteria | 4176 |
| 98 | Ga0070707_100277078 | 3300005468 | Bacteria | 1630 |
| 99 | Ga0070707_100320307 | 3300005468 | Bacteria | 1507 |
| 100 | Ga0070698_100015722 | 3300005471 | Bacteria | 7992 |
| 101 | Ga0070698_100040242 | 3300005471 | Bacteria | 4805 |
| 102 | Ga0070698_100059047 | 3300005471 | Bacteria | 3875 |
| 103 | Ga0070698_100104626 | 3300005471 | Bacteria | 2800 |
| 104 | Ga0070698_100502148 | 3300005471 | Bacteria | 1151 |
| 105 | Ga0070698_100823409 | 3300005471 | Bacteria | 873 |
| 106 | Ga0070699_100004229 | 3300005518 | Bacteria | 12695 |
| 107 | Ga0070699_100112281 | 3300005518 | Bacteria | 2394 |
| 108 | Ga0070679_100020051 | 3300005530 | Bacteria | 6516 |
| 109 | Ga0070679_100148284 | 3300005530 | Bacteria | 2323 |
| 110 | Ga0070679_100991786 | 3300005530 | Bacteria | 784 |
| 111 | Ga0070684_100117990 | 3300005535 | Bacteria | 2384 |
| 112 | Ga0070684_100123846 | 3300005535 | Bacteria | 2327 |
| 113 | Ga0070684_100169416 | 3300005535 | Bacteria | 1983 |
| 114 | Ga0070684_100726117 | 3300005535 | Bacteria | 927 |
| 115 | Ga0070697_100000297 | 3300005536 | Bacteria | 39837 |
| 116 | Ga0070697_100249985 | 3300005536 | Bacteria | 1516 |
| 117 | Ga0068853_100003712 | 3300005539 | Bacteria | 11725 |
| 118 | Ga0068853_100050169 | 3300005539 | Bacteria | 3589 |
| 119 | Ga0068853_100162906 | 3300005539 | Bacteria | 2013 |
| 120 | Ga0068853_100299520 | 3300005539 | Bacteria | 1486 |
| 121 | Ga0070672_100037137 | 3300005543 | Bacteria | 3715 |
| 122 | Ga0070672_100288829 | 3300005543 | Bacteria | 1388 |
| 123 | Ga0070672_100393752 | 3300005543 | Bacteria | 1186 |
| 124 | Ga0070686_100052369 | 3300005544 | Bacteria | 2602 |
| 125 | Ga0070695_100032353 | 3300005545 | Bacteria | 3269 |
| 126 | Ga0070693_100048338 | 3300005547 | Bacteria | 2422 |
| 127 | Ga0070665_100066875 | 3300005548 | Bacteria | 3605 |
| 128 | Ga0070665_100135130 | 3300005548 | Bacteria | 2468 |
| 129 | Ga0070665_100538105 | 3300005548 | Bacteria | 1180 |
| 130 | Ga0070704_100123499 | 3300005549 | Bacteria | 1993 |
| 131 | Ga0068855_100232018 | 3300005563 | Bacteria | 2066 |
| 132 | Ga0070664_100952478 | 3300005564 | Bacteria | 806 |
| 133 | Ga0068857_100065627 | 3300005577 | Bacteria | 3228 |
| 134 | Ga0068854_100019910 | 3300005578 | Bacteria | 4530 |
| 135 | Ga0068856_100103223 | 3300005614 | Bacteria | 2845 |
| 136 | Ga0068856_100118950 | 3300005614 | Bacteria | 2643 |
| 137 | Ga0070702_100033411 | 3300005615 | Bacteria | 2829 |
| 138 | Ga0068859_100304670 | 3300005617 | Bacteria | 1687 |
| 139 | Ga0068864_100044733 | 3300005618 | Bacteria | 3796 |
| 140 | Ga0068864_100189675 | 3300005618 | Bacteria | 1884 |
| 141 | Ga0068864_100258911 | 3300005618 | Bacteria | 1618 |
| 142 | Ga0068866_10050747 | 3300005718 | Bacteria | 2108 |
| 143 | Ga0068866_10144192 | 3300005718 | Bacteria | 1371 |
| 144 | Ga0068866_10163428 | 3300005718 | Bacteria | 1300 |
| 145 | Ga0068861_100117328 | 3300005719 | Bacteria | 2142 |
| 146 | Ga0068861_100176561 | 3300005719 | Bacteria | 1774 |
| 147 | Ga0068851_10162167 | 3300005834 | Bacteria | 1229 |
| 148 | Ga0068870_10006949 | 3300005840 | Bacteria | 5020 |
| 149 | Ga0068863_100004992 | 3300005841 | Bacteria | 13079 |
| 150 | Ga0068863_100032201 | 3300005841 | Bacteria | 4997 |
| 151 | Ga0068863_100712410 | 3300005841 | Bacteria | 998 |
| 152 | Ga0068858_100074577 | 3300005842 | Bacteria | 3150 |
| 153 | Ga0068860_100784821 | 3300005843 | Bacteria | 965 |
| 154 | Ga0068862_100031297 | 3300005844 | Bacteria | 4490 |
| 155 | Ga0081455_10000045 | 3300005937 | Bacteria | 128603 |
| 156 | Ga0081455_10062588 | 3300005937 | Bacteria | 3126 |
| 157 | Ga0081538_10000036 | 3300005981 | Bacteria | 119944 |
| 158 | Ga0081540_1001418 | 3300005983 | Bacteria | 20736 |
| 159 | Ga0081539_10001518 | 3300005985 | Bacteria | 38975 |
| 160 | Ga0081539_10002486 | 3300005985 | Bacteria | 25922 |
| 161 | Ga0070717_10013495 | 3300006028 | Bacteria | 6262 |
| 162 | Ga0070717_10019489 | 3300006028 | Bacteria | 5320 |
| 163 | Ga0070717_10022664 | 3300006028 | Bacteria | 4966 |
| 164 | Ga0070717_10044166 | 3300006028 | Bacteria | 3639 |
| 165 | Ga0070717_10053539 | 3300006028 | Bacteria | 3327 |
| 166 | Ga0070717_10200894 | 3300006028 | Bacteria | 1746 |
| 167 | Ga0070717_10221305 | 3300006028 | Bacteria | 1664 |
| 168 | Ga0070717_10314907 | 3300006028 | Bacteria | 1393 |
| 169 | Ga0075368_10001580 | 3300006042 | Bacteria | 7310 |
| 170 | Ga0075363_100001400 | 3300006048 | Bacteria | 9113 |
| 171 | Ga0075363_100048444 | 3300006048 | Bacteria | 2260 |
| 172 | Ga0075363_100125899 | 3300006048 | Bacteria | 1434 |
| 173 | Ga0075364_10031453 | 3300006051 | Bacteria | 3410 |
| 174 | Ga0075432_10185752 | 3300006058 | Bacteria | 815 |
| 175 | Ga0070715_10013884 | 3300006163 | Bacteria | 2969 |
| 176 | Ga0070715_10106382 | 3300006163 | Bacteria | 1316 |
| 177 | Ga0070715_10122570 | 3300006163 | Bacteria | 1241 |
| 178 | Ga0070715_10135485 | 3300006163 | Bacteria | 1190 |
| 179 | Ga0070716_100008308 | 3300006173 | Bacteria | 5150 |
| 180 | Ga0070716_100093886 | 3300006173 | Bacteria | 1822 |
| 181 | Ga0070712_100072461 | 3300006175 | Bacteria | 2468 |
| 182 | Ga0070712_100125749 | 3300006175 | Bacteria | 1936 |
| 183 | Ga0070712_100192400 | 3300006175 | Bacteria | 1597 |
| 184 | Ga0070712_100195833 | 3300006175 | Bacteria | 1584 |
| 185 | Ga0070712_100302706 | 3300006175 | Bacteria | 1294 |
| 186 | Ga0070712_100736567 | 3300006175 | Bacteria | 843 |
| 187 | Ga0075362_10123914 | 3300006177 | Bacteria | 1225 |
| 188 | Ga0075367_10002607 | 3300006178 | Bacteria | 8283 |
| 189 | Ga0075370_10056980 | 3300006353 | Bacteria | 2221 |
| 190 | Ga0075370_10096132 | 3300006353 | Bacteria | 1712 |
| 191 | Ga0075434_100184513 | 3300006871 | Bacteria | 2107 |
| 192 | Ga0068865_100039270 | 3300006881 | Bacteria | 3210 |
| 193 | Ga0068865_100500477 | 3300006881 | Bacteria | 1013 |
| 194 | Ga0097620_100304673 | 3300006931 | Bacteria | 1687 |
| 195 | Ga0099826_10081186 | 3300006948 | Bacteria | 2019 |
| 196 | Ga0075435_100022404 | 3300007076 | Bacteria | 4874 |
| 197 | Ga0075435_100808802 | 3300007076 | Bacteria | 816 |
| 198 | Ga0099795_10012716 | 3300007788 | Bacteria | 2561 |
| 199 | Ga0105251_10022179 | 3300009011 | Bacteria | 3302 |
| 200 | Ga0105251_10024584 | 3300009011 | Bacteria | 3092 |
| 201 | Ga0105244_10047301 | 3300009036 | Bacteria | 2207 |
| 202 | Ga0105244_10220369 | 3300009036 | Bacteria | 890 |
| 203 | Ga0105250_10088893 | 3300009092 | Bacteria | 1255 |
| 204 | Ga0105240_10078079 | 3300009093 | Bacteria | 4078 |
| 205 | Ga0105245_10034867 | 3300009098 | Bacteria | 4464 |
| 206 | Ga0105245_10384319 | 3300009098 | Bacteria | 1399 |
| 207 | Ga0105245_10503400 | 3300009098 | Bacteria | 1228 |
| 208 | Ga0105245_10625681 | 3300009098 | Bacteria | 1105 |
| 209 | Ga0105245_10764077 | 3300009098 | Bacteria | 1003 |
| 210 | Ga0105245_11653844 | 3300009098 | Bacteria | 692 |
| 211 | Ga0105247_10073415 | 3300009101 | Bacteria | 2143 |
| 212 | Ga0105243_10050363 | 3300009148 | Bacteria | 3290 |
| 213 | Ga0105243_10055962 | 3300009148 | Bacteria | 3135 |
| 214 | Ga0105243_10347082 | 3300009148 | Bacteria | 1361 |
| 215 | Ga0105243_10757939 | 3300009148 | Bacteria | 952 |
| 216 | Ga0105243_10842457 | 3300009148 | Bacteria | 907 |
| 217 | Ga0105241_10256312 | 3300009174 | Bacteria | 1485 |
| 218 | Ga0105241_10596625 | 3300009174 | Bacteria | 997 |
| 219 | Ga0105242_10068343 | 3300009176 | Bacteria | 2939 |
| 220 | Ga0105242_10075622 | 3300009176 | Bacteria | 2805 |
| 221 | Ga0105242_11083859 | 3300009176 | Bacteria | 814 |
| 222 | Ga0105248_10056660 | 3300009177 | Bacteria | 4397 |
| 223 | Ga0105248_10228276 | 3300009177 | Bacteria | 2095 |
| 224 | Ga0105248_11403710 | 3300009177 | Bacteria | 790 |
| 225 | Ga0105237_11472947 | 3300009545 | Bacteria | 687 |
| 226 | Ga0105238_10245300 | 3300009551 | Bacteria | 1769 |
| 227 | Ga0105238_10315285 | 3300009551 | Bacteria | 1549 |
| 228 | Ga0105238_10903286 | 3300009551 | Bacteria | 902 |
| 229 | Ga0105249_10395111 | 3300009553 | Bacteria | 1412 |
| 230 | Ga0105249_11358580 | 3300009553 | Bacteria | 782 |
| 231 | Ga0099796_10068767 | 3300010159 | Bacteria | 1273 |
| 232 | Ga0105239_10276517 | 3300010375 | Bacteria | 1889 |
| 233 | Ga0105239_10450866 | 3300010375 | Bacteria | 1459 |
| 234 | Ga0105239_11025249 | 3300010375 | Bacteria | 949 |
| 235 | Ga0105246_10000197 | 3300011119 | Bacteria | 30217 |
| 236 | Ga0105246_10002208 | 3300011119 | Bacteria | 11745 |
| 237 | Ga0105246_10024288 | 3300011119 | Bacteria | 3936 |
| 238 | Ga0105246_10051267 | 3300011119 | Bacteria | 2833 |
| 239 | Ga0105246_10112621 | 3300011119 | Bacteria | 2001 |
| 240 | Ga0105246_10207496 | 3300011119 | Bacteria | 1527 |
| 241 | Ga0105246_10483823 | 3300011119 | Bacteria | 1048 |
| 242 | Ga0157336_1001633 | 3300012477 | Bacteria | 1182 |
| 243 | Ga0157338_1004574 | 3300012515 | Bacteria | 1203 |
| 244 | Ga0157373_10001679 | 3300013100 | Bacteria | 16898 |
| 245 | Ga0157373_10521465 | 3300013100 | Bacteria | 860 |
| 246 | Ga0157371_10025927 | 3300013102 | Bacteria | 4265 |
| 247 | Ga0157371_10144590 | 3300013102 | Bacteria | 1694 |
| 248 | Ga0157371_10579807 | 3300013102 | Bacteria | 833 |
| 249 | Ga0157370_10025635 | 3300013104 | Bacteria | 5835 |
| 250 | Ga0157369_10009358 | 3300013105 | Bacteria | 11204 |
| 251 | Ga0157369_10069859 | 3300013105 | Bacteria | 3773 |
| 252 | Ga0157369_10086834 | 3300013105 | Bacteria | 3341 |
| 253 | Ga0157369_10105151 | 3300013105 | Bacteria | 3005 |
| 254 | Ga0157369_10297435 | 3300013105 | Bacteria | 1680 |
| 255 | Ga0157369_10405979 | 3300013105 | Bacteria | 1413 |
| 256 | Ga0157369_10927349 | 3300013105 | Bacteria | 893 |
| 257 | Ga0157374_10065606 | 3300013296 | Bacteria | 3410 |
| 258 | Ga0157374_10217344 | 3300013296 | Bacteria | 1875 |
| 259 | Ga0157378_10280101 | 3300013297 | Bacteria | 1607 |
| 260 | Ga0157378_10445481 | 3300013297 | Bacteria | 1284 |
| 261 | Ga0157378_11697520 | 3300013297 | Bacteria | 678 |
| 262 | Ga0163162_10034673 | 3300013306 | Bacteria | 5023 |
| 263 | Ga0163162_10190209 | 3300013306 | Bacteria | 2180 |
| 264 | Ga0163162_10701604 | 3300013306 | Bacteria | 1133 |
| 265 | Ga0157372_10092016 | 3300013307 | Bacteria | 3449 |
| 266 | Ga0157372_10426512 | 3300013307 | Bacteria | 1545 |
| 267 | Ga0157375_10077748 | 3300013308 | Bacteria | 3349 |
| 268 | Ga0157375_10159717 | 3300013308 | Bacteria | 2395 |
| 269 | Ga0157375_10182570 | 3300013308 | Bacteria | 2250 |
| 270 | Ga0157375_10679982 | 3300013308 | Bacteria | 1184 |
| 271 | Ga0157375_11002394 | 3300013308 | Bacteria | 975 |
| 272 | Ga0157375_11457604 | 3300013308 | Bacteria | 807 |
| 273 | Ga0157375_11485186 | 3300013308 | Bacteria | 800 |
| 274 | Ga0163163_10019634 | 3300014325 | Bacteria | 6348 |
| 275 | Ga0163163_10111660 | 3300014325 | Bacteria | 2762 |
| 276 | Ga0163163_10883665 | 3300014325 | Bacteria | 957 |
| 277 | Ga0157380_10028146 | 3300014326 | Bacteria | 4281 |
| 278 | Ga0182008_10001956 | 3300014497 | Bacteria | 13238 |
| 279 | Ga0157376_10345454 | 3300014969 | Bacteria | 1422 |
| 280 | Ga0157376_11086934 | 3300014969 | Bacteria | 825 |
| 281 | Ga0182007_10000163 | 3300015262 | Bacteria | 46066 |
| 282 | Ga0183367_1012 | 3300015688 | Bacteria | 347438 |
| 283 | Ga0163161_10168721 | 3300017792 | Bacteria | 1672 |
| 284 | Ga0163161_10677782 | 3300017792 | Bacteria | 857 |
| 285 | Ga0163161_10725115 | 3300017792 | Bacteria | 830 |
| 286 | Ga0197907_10815515 | 3300020069 | Bacteria | 1242 |
| 287 | Ga0206356_11463270 | 3300020070 | Bacteria | 683 |
| 288 | Ga0206356_11859014 | 3300020070 | Bacteria | 1109 |
| 289 | Ga0206351_10108314 | 3300020077 | Bacteria | 873 |
| 290 | Ga0206351_10251250 | 3300020077 | Bacteria | 771 |
| 291 | Ga0206354_10086865 | 3300020081 | Bacteria | 1812 |
| 292 | Ga0206354_10919820 | 3300020081 | Bacteria | 786 |
| 293 | Ga0206354_11407995 | 3300020081 | Bacteria | 937 |
| 294 | Ga0206353_10084704 | 3300020082 | Bacteria | 1015 |
| 295 | Ga0206353_10810170 | 3300020082 | Bacteria | 1647 |
| 296 | Ga0206353_11864166 | 3300020082 | Bacteria | 4286 |
| 297 | Ga0213876_10137141 | 3300021384 | Bacteria | 1301 |
| 298 | Ga0213875_10001662 | 3300021388 | Bacteria | 14016 |
| 299 | Ga0213875_10002613 | 3300021388 | Bacteria | 10689 |
| 300 | Ga0213875_10014186 | 3300021388 | Bacteria | 3893 |
| 301 | Ga0213875_10079264 | 3300021388 | Bacteria | 1532 |
| 302 | Ga0213875_10279945 | 3300021388 | Bacteria | 788 |
| 303 | Ga0213875_10321178 | 3300021388 | Bacteria | 734 |
| 304 | Ga0224712_10023797 | 3300022467 | Bacteria | 2131 |
| 305 | Ga0224712_10273934 | 3300022467 | Bacteria | 784 |
| 306 | Ga0224572_1011013 | 3300024225 | Bacteria | 1708 |
| 307 | Ga0224572_1033009 | 3300024225 | Bacteria | 985 |
| 308 | Ga0209148_1003971 | 3300025254 | Bacteria | 3798 |
| 309 | Ga0209759_1029106 | 3300025256 | Bacteria | 1113 |
| 310 | Ga0209129_1000067 | 3300025258 | Bacteria | 219974 |
| 311 | Ga0209025_1000971 | 3300025294 | Bacteria | 42988 |
| 312 | Ga0209758_1005907 | 3300025297 | Bacteria | 9111 |
| 313 | Ga0207426_1000338 | 3300025302 | Bacteria | 88019 |
| 314 | Ga0207426_1001520 | 3300025302 | Bacteria | 18903 |
| 315 | Ga0207426_1031921 | 3300025302 | Bacteria | 1714 |
| 316 | Ga0207426_1053126 | 3300025302 | Bacteria | 1197 |
| 317 | Ga0209051_1000810 | 3300025303 | Bacteria | 32584 |
| 318 | Ga0207697_10006382 | 3300025315 | Bacteria | 5341 |
| 319 | Ga0207655_1005461 | 3300025728 | Bacteria | 8633 |
| 320 | Ga0207655_1017475 | 3300025728 | Bacteria | 3866 |
| 321 | Ga0207692_10003051 | 3300025898 | Bacteria | 6499 |
| 322 | Ga0207692_10034193 | 3300025898 | Bacteria | 2459 |
| 323 | Ga0207692_10074518 | 3300025898 | Bacteria | 1798 |
| 324 | Ga0207692_10235530 | 3300025898 | Bacteria | 1091 |
| 325 | Ga0207692_10266704 | 3300025898 | Bacteria | 1031 |
| 326 | Ga0207692_10338471 | 3300025898 | Bacteria | 925 |
| 327 | Ga0207692_10490597 | 3300025898 | Bacteria | 778 |
| 328 | Ga0207642_10009380 | 3300025899 | Bacteria | 3401 |
| 329 | Ga0207710_10137629 | 3300025900 | Bacteria | 1177 |
| 330 | Ga0207688_10024482 | 3300025901 | Bacteria | 3311 |
| 331 | Ga0207688_10042431 | 3300025901 | Bacteria | 2532 |
| 332 | Ga0207688_10066415 | 3300025901 | Bacteria | 2040 |
| 333 | Ga0207688_10351945 | 3300025901 | Bacteria | 908 |
| 334 | Ga0207680_10177279 | 3300025903 | Bacteria | 1439 |
| 335 | Ga0207680_10189510 | 3300025903 | Bacteria | 1395 |
| 336 | Ga0207647_10091661 | 3300025904 | Bacteria | 1812 |
| 337 | Ga0207647_10470686 | 3300025904 | Bacteria | 703 |
| 338 | Ga0207685_10068604 | 3300025905 | Bacteria | 1429 |
| 339 | Ga0207699_10002526 | 3300025906 | Bacteria | 8638 |
| 340 | Ga0207699_10058070 | 3300025906 | Bacteria | 2313 |
| 341 | Ga0207699_10176720 | 3300025906 | Bacteria | 1432 |
| 342 | Ga0207699_10223185 | 3300025906 | Bacteria | 1287 |
| 343 | Ga0207699_10421165 | 3300025906 | Bacteria | 954 |
| 344 | Ga0207699_10610499 | 3300025906 | Bacteria | 795 |
| 345 | Ga0207645_10035601 | 3300025907 | Bacteria | 3197 |
| 346 | Ga0207643_10032287 | 3300025908 | Bacteria | 2924 |
| 347 | Ga0207643_10072698 | 3300025908 | Bacteria | 1981 |
| 348 | Ga0207705_10442043 | 3300025909 | Bacteria | 1008 |
| 349 | Ga0207684_10032042 | 3300025910 | Bacteria | 4471 |
| 350 | Ga0207684_10152822 | 3300025910 | Bacteria | 1986 |
| 351 | Ga0207684_10173517 | 3300025910 | Bacteria | 1858 |
| 352 | Ga0207684_10197793 | 3300025910 | Bacteria | 1734 |
| 353 | Ga0207684_10669986 | 3300025910 | Bacteria | 883 |
| 354 | Ga0207684_10926337 | 3300025910 | Bacteria | 731 |
| 355 | Ga0207707_10132396 | 3300025912 | Bacteria | 2181 |
| 356 | Ga0207693_10031316 | 3300025915 | Bacteria | 4202 |
| 357 | Ga0207693_10131940 | 3300025915 | Bacteria | 1964 |
| 358 | Ga0207693_10529986 | 3300025915 | Bacteria | 919 |
| 359 | Ga0207693_10653801 | 3300025915 | Bacteria | 816 |
| 360 | Ga0207663_10119125 | 3300025916 | Bacteria | 1804 |
| 361 | Ga0207660_10047151 | 3300025917 | Bacteria | 3044 |
| 362 | Ga0207662_10002144 | 3300025918 | Bacteria | 9824 |
| 363 | Ga0207662_10350090 | 3300025918 | Bacteria | 992 |
| 364 | Ga0207657_10015855 | 3300025919 | Bacteria | 7282 |
| 365 | Ga0207657_10126054 | 3300025919 | Bacteria | 2103 |
| 366 | Ga0207646_10029891 | 3300025922 | Bacteria | 4946 |
| 367 | Ga0207646_10037944 | 3300025922 | Bacteria | 4342 |
| 368 | Ga0207646_10118462 | 3300025922 | Bacteria | 2378 |
| 369 | Ga0207646_10239390 | 3300025922 | Bacteria | 1639 |
| 370 | Ga0207646_10259932 | 3300025922 | Bacteria | 1569 |
| 371 | Ga0207646_10565058 | 3300025922 | Bacteria | 1022 |
| 372 | Ga0207646_10806877 | 3300025922 | Bacteria | 836 |
| 373 | Ga0207681_10034161 | 3300025923 | Bacteria | 3341 |
| 374 | Ga0207694_10125335 | 3300025924 | Bacteria | 2054 |
| 375 | Ga0207694_10275321 | 3300025924 | Bacteria | 1381 |
| 376 | Ga0207694_10327174 | 3300025924 | Bacteria | 1266 |
| 377 | Ga0207694_10703340 | 3300025924 | Bacteria | 852 |
| 378 | Ga0207659_10099983 | 3300025926 | Bacteria | 2185 |
| 379 | Ga0207687_10087006 | 3300025927 | Bacteria | 2270 |
| 380 | Ga0207687_10141219 | 3300025927 | Bacteria | 1827 |
| 381 | Ga0207700_10010090 | 3300025928 | Bacteria | 5938 |
| 382 | Ga0207700_10025873 | 3300025928 | Bacteria | 4083 |
| 383 | Ga0207700_10037584 | 3300025928 | Bacteria | 3507 |
| 384 | Ga0207700_10086010 | 3300025928 | Bacteria | 2469 |
| 385 | Ga0207700_10110443 | 3300025928 | Bacteria | 2211 |
| 386 | Ga0207700_10225305 | 3300025928 | Bacteria | 1591 |
| 387 | Ga0207700_10261064 | 3300025928 | Bacteria | 1483 |
| 388 | Ga0207700_10281996 | 3300025928 | Bacteria | 1429 |
| 389 | Ga0207664_10000492 | 3300025929 | Bacteria | 28137 |
| 390 | Ga0207664_10005718 | 3300025929 | Bacteria | 8501 |
| 391 | Ga0207664_10007561 | 3300025929 | Bacteria | 7541 |
| 392 | Ga0207664_10011017 | 3300025929 | Bacteria | 6405 |
| 393 | Ga0207664_10026896 | 3300025929 | Bacteria | 4354 |
| 394 | Ga0207664_10131302 | 3300025929 | Bacteria | 2109 |
| 395 | Ga0207664_10151825 | 3300025929 | Bacteria | 1968 |
| 396 | Ga0207664_10155014 | 3300025929 | Bacteria | 1949 |
| 397 | Ga0207664_10163229 | 3300025929 | Bacteria | 1901 |
| 398 | Ga0207664_10210545 | 3300025929 | Bacteria | 1682 |
| 399 | Ga0207664_10706878 | 3300025929 | Bacteria | 906 |
| 400 | Ga0207690_10076202 | 3300025932 | Bacteria | 2328 |
| 401 | Ga0207706_10720902 | 3300025933 | Bacteria | 851 |
| 402 | Ga0207686_10041336 | 3300025934 | Bacteria | 2810 |
| 403 | Ga0207709_10068634 | 3300025935 | Bacteria | 2241 |
| 404 | Ga0207709_10255051 | 3300025935 | Bacteria | 1283 |
| 405 | Ga0207709_10370178 | 3300025935 | Bacteria | 1087 |
| 406 | Ga0207709_10661869 | 3300025935 | Bacteria | 832 |
| 407 | Ga0207669_10153418 | 3300025937 | Bacteria | 1617 |
| 408 | Ga0207669_10370234 | 3300025937 | Bacteria | 1113 |
| 409 | Ga0207665_10004487 | 3300025939 | Bacteria | 9263 |
| 410 | Ga0207665_10007373 | 3300025939 | Bacteria | 7270 |
| 411 | Ga0207665_10026937 | 3300025939 | Bacteria | 3797 |
| 412 | Ga0207665_10046112 | 3300025939 | Bacteria | 2920 |
| 413 | Ga0207665_10095485 | 3300025939 | Bacteria | 2066 |
| 414 | Ga0207691_10000484 | 3300025940 | Bacteria | 39400 |
| 415 | Ga0207689_10005167 | 3300025942 | Bacteria | 11725 |
| 416 | Ga0207661_10065552 | 3300025944 | Bacteria | 2949 |
| 417 | Ga0207661_10076201 | 3300025944 | Bacteria | 2754 |
| 418 | Ga0207667_10166731 | 3300025949 | Bacteria | 2264 |
| 419 | Ga0207651_10725276 | 3300025960 | Bacteria | 877 |
| 420 | Ga0207712_10163796 | 3300025961 | Bacteria | 1731 |
| 421 | Ga0207712_10497387 | 3300025961 | Bacteria | 1042 |
| 422 | Ga0207668_10146609 | 3300025972 | Bacteria | 1822 |
| 423 | Ga0207668_10283072 | 3300025972 | Bacteria | 1361 |
| 424 | Ga0207668_10499011 | 3300025972 | Bacteria | 1047 |
| 425 | Ga0207668_10992441 | 3300025972 | Bacteria | 750 |
| 426 | Ga0207640_10445065 | 3300025981 | Bacteria | 1066 |
| 427 | Ga0207677_11039689 | 3300026023 | Bacteria | 744 |
| 428 | Ga0207639_10018681 | 3300026041 | Bacteria | 4930 |
| 429 | Ga0207639_10036114 | 3300026041 | Bacteria | 3660 |
| 430 | Ga0207678_10000087 | 3300026067 | Bacteria | 76296 |
| 431 | Ga0207678_10001935 | 3300026067 | Bacteria | 18899 |
| 432 | Ga0207678_10451178 | 3300026067 | Bacteria | 1118 |
| 433 | Ga0207708_10016045 | 3300026075 | Bacteria | 5626 |
| 434 | Ga0207708_10230133 | 3300026075 | Bacteria | 1488 |
| 435 | Ga0207702_10025105 | 3300026078 | Bacteria | 4943 |
| 436 | Ga0207702_10091051 | 3300026078 | Bacteria | 2670 |
| 437 | Ga0207702_10158911 | 3300026078 | Bacteria | 2063 |
| 438 | Ga0207702_10232033 | 3300026078 | Bacteria | 1725 |
| 439 | Ga0207702_10715617 | 3300026078 | Bacteria | 987 |
| 440 | Ga0207641_10008662 | 3300026088 | Bacteria | 8402 |
| 441 | Ga0207641_10152650 | 3300026088 | Bacteria | 2093 |
| 442 | Ga0207648_10308167 | 3300026089 | Bacteria | 1421 |
| 443 | Ga0207648_11065345 | 3300026089 | Bacteria | 758 |
| 444 | Ga0207676_10557413 | 3300026095 | Bacteria | 1095 |
| 445 | Ga0207674_10034736 | 3300026116 | Bacteria | 5267 |
| 446 | Ga0207674_10051731 | 3300026116 | Bacteria | 4192 |
| 447 | Ga0207683_10002130 | 3300026121 | Bacteria | 17397 |
| 448 | Ga0207683_10003875 | 3300026121 | Bacteria | 12975 |
| 449 | Ga0207683_10120118 | 3300026121 | Bacteria | 2359 |
| 450 | Ga0207698_10269218 | 3300026142 | Bacteria | 1570 |
| 451 | Ga0209813_10006915 | 3300027866 | Bacteria | 2815 |
| 452 | Ga0207428_10121699 | 3300027907 | Bacteria | 2001 |
| 453 | Ga0207428_10178890 | 3300027907 | Bacteria | 1603 |
| 454 | Ga0268266_10128891 | 3300028379 | Bacteria | 2261 |
| 455 | Ga0268266_10148120 | 3300028379 | Bacteria | 2113 |
| 456 | Ga0268266_10202262 | 3300028379 | Bacteria | 1818 |
| 457 | Ga0265337_1000784 | 3300028556 | Bacteria | 16711 |
| 458 | Ga0265337_1035017 | 3300028556 | Bacteria | 1473 |
| 459 | Ga0265326_10024854 | 3300028558 | Bacteria | 1708 |
| 460 | Ga0265319_1006043 | 3300028563 | Bacteria | 5681 |
| 461 | Ga0265334_10002216 | 3300028573 | Bacteria | 9147 |
| 462 | Ga0265318_10121994 | 3300028577 | Bacteria | 958 |
| 463 | Ga0265323_10033990 | 3300028653 | Bacteria | 1885 |
| 464 | Ga0265336_10001403 | 3300028666 | Bacteria | 11120 |
| 465 | Ga0307517_10013671 | 3300028786 | Bacteria | 11001 |
| 466 | Ga0307515_10000050 | 3300028794 | Bacteria | 275624 |
| 467 | Ga0307515_10051468 | 3300028794 | Bacteria | 6139 |
| 468 | Ga0307515_10053114 | 3300028794 | Bacteria | 5988 |
| 469 | Ga0307515_10098689 | 3300028794 | Bacteria | 3554 |
| 470 | Ga0307515_10178784 | 3300028794 | Bacteria | 2081 |
| 471 | Ga0307515_10192698 | 3300028794 | Bacteria | 1942 |
| 472 | Ga0265338_10002384 | 3300028800 | Bacteria | 28309 |
| 473 | Ga0265338_10004367 | 3300028800 | Bacteria | 19136 |
| 474 | Ga0265338_10009574 | 3300028800 | Bacteria | 11524 |
| 475 | Ga0265338_10035787 | 3300028800 | Bacteria | 4763 |
| 476 | Ga0265324_10002386 | 3300029957 | Bacteria | 9671 |
| 477 | Ga0307511_10000080 | 3300030521 | Bacteria | 80604 |
| 478 | Ga0307511_10017601 | 3300030521 | Bacteria | 6851 |
| 479 | Ga0307512_10002990 | 3300030522 | Bacteria | 20379 |
| 480 | Ga0307512_10004801 | 3300030522 | Bacteria | 14517 |
| 481 | Ga0307512_10020534 | 3300030522 | Bacteria | 5972 |
| 482 | Ga0307512_10040788 | 3300030522 | Bacteria | 3868 |
| 483 | Ga0307512_10085418 | 3300030522 | Bacteria | 2236 |
| 484 | Ga0316180_1173122 | 3300030736 | Bacteria | 1116 |
| 485 | Ga0265760_10019825 | 3300031090 | Bacteria | 1939 |
| 486 | Ga0265332_10010221 | 3300031238 | Bacteria | 4176 |
| 487 | Ga0265320_10034635 | 3300031240 | Bacteria | 2566 |
| 488 | Ga0265325_10013623 | 3300031241 | Bacteria | 4623 |
| 489 | Ga0265340_10002174 | 3300031247 | Bacteria | 11232 |
| 490 | Ga0265316_10054485 | 3300031344 | Bacteria | 3131 |
| 491 | Ga0307513_10004852 | 3300031456 | Bacteria | 17855 |
| 492 | Ga0307513_10032771 | 3300031456 | Bacteria | 5853 |
| 493 | Ga0307513_10068129 | 3300031456 | Bacteria | 3729 |
| 494 | Ga0307513_10336719 | 3300031456 | Bacteria | 1261 |
| 495 | Ga0307513_10354394 | 3300031456 | Bacteria | 1214 |
| 496 | Ga0307509_10257602 | 3300031507 | Bacteria | 1522 |
| 497 | Ga0307509_10282797 | 3300031507 | Bacteria | 1419 |
| 498 | Ga0307509_10467457 | 3300031507 | Bacteria | 952 |
| 499 | Ga0307408_100024343 | 3300031548 | Bacteria | 4133 |
| 500 | Ga0307408_100031030 | 3300031548 | Bacteria | 3717 |
| 501 | Ga0307408_100044689 | 3300031548 | Bacteria | 3158 |
| 502 | Ga0307408_100044843 | 3300031548 | Bacteria | 3154 |
| 503 | Ga0307408_100183151 | 3300031548 | Bacteria | 1681 |
| 504 | Ga0307408_100218449 | 3300031548 | Bacteria | 1554 |
| 505 | Ga0307408_100416314 | 3300031548 | Bacteria | 1157 |
| 506 | Ga0265313_10005878 | 3300031595 | Bacteria | 8897 |
| 507 | Ga0307508_10002207 | 3300031616 | Bacteria | 20770 |
| 508 | Ga0307508_10002455 | 3300031616 | Bacteria | 19546 |
| 509 | Ga0307508_10005361 | 3300031616 | Bacteria | 12212 |
| 510 | Ga0307508_10021648 | 3300031616 | Bacteria | 5846 |
| 511 | Ga0307508_10060834 | 3300031616 | Bacteria | 3338 |
| 512 | Ga0307508_10185418 | 3300031616 | Bacteria | 1683 |
| 513 | Ga0307514_10057674 | 3300031649 | Bacteria | 2973 |
| 514 | Ga0307514_10110476 | 3300031649 | Bacteria | 1948 |
| 515 | Ga0316575_10000792 | 3300031665 | Bacteria | 9594 |
| 516 | Ga0316579_10004707 | 3300031691 | Bacteria | 5443 |
| 517 | Ga0265314_10008241 | 3300031711 | Bacteria | 8948 |
| 518 | Ga0265342_10002853 | 3300031712 | Bacteria | 14586 |
| 519 | Ga0316576_10003957 | 3300031727 | Bacteria | 8803 |
| 520 | Ga0316578_10005456 | 3300031728 | Bacteria | 6171 |
| 521 | Ga0307516_10008723 | 3300031730 | Bacteria | 11404 |
| 522 | Ga0307516_10019872 | 3300031730 | Bacteria | 6944 |
| 523 | Ga0307516_10027222 | 3300031730 | Bacteria | 5798 |
| 524 | Ga0307516_10114073 | 3300031730 | Bacteria | 2500 |
| 525 | Ga0307405_10006646 | 3300031731 | Bacteria | 5707 |
| 526 | Ga0307405_10013737 | 3300031731 | Bacteria | 4328 |
| 527 | Ga0307405_10025650 | 3300031731 | Bacteria | 3388 |
| 528 | Ga0307405_10054318 | 3300031731 | Bacteria | 2500 |
| 529 | Ga0307405_10069388 | 3300031731 | Bacteria | 2259 |
| 530 | Ga0307405_10125904 | 3300031731 | Bacteria | 1761 |
| 531 | Ga0307405_10206287 | 3300031731 | Bacteria | 1431 |
| 532 | Ga0307405_10248983 | 3300031731 | Bacteria | 1321 |
| 533 | Ga0316577_10124158 | 3300031733 | Bacteria | 1451 |
| 534 | Ga0307413_10019132 | 3300031824 | Bacteria | 3610 |
| 535 | Ga0307413_10024267 | 3300031824 | Bacteria | 3303 |
| 536 | Ga0307413_10058885 | 3300031824 | Bacteria | 2357 |
| 537 | Ga0307413_10063857 | 3300031824 | Bacteria | 2285 |
| 538 | Ga0307518_10000218 | 3300031838 | Bacteria | 43271 |
| 539 | Ga0307518_10088394 | 3300031838 | Bacteria | 2232 |
| 540 | Ga0307518_10193780 | 3300031838 | Bacteria | 1358 |
| 541 | Ga0307410_10008763 | 3300031852 | Bacteria | 5632 |
| 542 | Ga0307410_10024914 | 3300031852 | Bacteria | 3745 |
| 543 | Ga0307410_10029352 | 3300031852 | Bacteria | 3502 |
| 544 | Ga0307410_10073165 | 3300031852 | Bacteria | 2382 |
| 545 | Ga0307410_10081401 | 3300031852 | Bacteria | 2274 |
| 546 | Ga0307410_10218504 | 3300031852 | Bacteria | 1465 |
| 547 | Ga0307410_10446982 | 3300031852 | Bacteria | 1053 |
| 548 | Ga0307406_10022720 | 3300031901 | Bacteria | 3723 |
| 549 | Ga0307406_10056311 | 3300031901 | Bacteria | 2517 |
| 550 | Ga0307407_10040658 | 3300031903 | Bacteria | 2595 |
| 551 | Ga0307407_10085531 | 3300031903 | Bacteria | 1919 |
| 552 | Ga0307407_10182627 | 3300031903 | Bacteria | 1391 |
| 553 | Ga0307407_10228160 | 3300031903 | Bacteria | 1263 |
| 554 | Ga0307412_10002052 | 3300031911 | Bacteria | 11174 |
| 555 | Ga0307412_10012455 | 3300031911 | Bacteria | 4959 |
| 556 | Ga0307412_10026891 | 3300031911 | Bacteria | 3582 |
| 557 | Ga0307412_10034900 | 3300031911 | Bacteria | 3209 |
| 558 | Ga0307412_10035432 | 3300031911 | Bacteria | 3189 |
| 559 | Ga0307412_10120213 | 3300031911 | Bacteria | 1890 |
| 560 | Ga0307412_10222366 | 3300031911 | Bacteria | 1448 |
| 561 | Ga0307412_10332218 | 3300031911 | Bacteria | 1213 |
| 562 | Ga0307412_10727583 | 3300031911 | Bacteria | 854 |
| 563 | Ga0307409_100003753 | 3300031995 | Bacteria | 8350 |
| 564 | Ga0307409_100080222 | 3300031995 | Bacteria | 2632 |
| 565 | Ga0307409_100135889 | 3300031995 | Bacteria | 2110 |
| 566 | Ga0307409_100452060 | 3300031995 | Bacteria | 1240 |
| 567 | Ga0307409_100507298 | 3300031995 | Bacteria | 1176 |
| 568 | Ga0307409_100725174 | 3300031995 | Bacteria | 996 |
| 569 | Ga0307409_100733648 | 3300031995 | Bacteria | 990 |
| 570 | Ga0307409_100788252 | 3300031995 | Bacteria | 957 |
| 571 | Ga0307409_101095355 | 3300031995 | Bacteria | 817 |
| 572 | Ga0307416_100048766 | 3300032002 | Bacteria | 3362 |
| 573 | Ga0307416_100063338 | 3300032002 | Bacteria | 3028 |
| 574 | Ga0307416_100076375 | 3300032002 | Bacteria | 2807 |
| 575 | Ga0307416_100201252 | 3300032002 | Bacteria | 1890 |
| 576 | Ga0307416_100551146 | 3300032002 | Bacteria | 1226 |
| 577 | Ga0307416_101175529 | 3300032002 | Bacteria | 872 |
| 578 | Ga0307414_10019805 | 3300032004 | Bacteria | 4179 |
| 579 | Ga0307414_10081723 | 3300032004 | Bacteria | 2367 |
| 580 | Ga0307414_10810406 | 3300032004 | Bacteria | 854 |
| 581 | Ga0307414_10894603 | 3300032004 | Bacteria | 814 |
| 582 | Ga0307411_10152122 | 3300032005 | Bacteria | 1721 |
| 583 | Ga0307411_10528777 | 3300032005 | Bacteria | 1002 |
| 584 | Ga0307415_100087668 | 3300032126 | Bacteria | 2243 |
| 585 | Ga0307415_100118386 | 3300032126 | Bacteria | 1980 |
| 586 | Ga0307415_100466896 | 3300032126 | Bacteria | 1095 |
| 587 | Ga0316585_10048468 | 3300032137 | Bacteria | 1361 |
| 588 | Ga0307507_10017996 | 3300033179 | Bacteria | 8074 |
| 589 | Ga0307510_10003092 | 3300033180 | Bacteria | 19240 |
| 590 | Ga0307510_10004930 | 3300033180 | Bacteria | 15799 |
| 591 | Ga0307510_10102295 | 3300033180 | Bacteria | 2648 |
| 592 | Ga0316214_1002649 | 3300033545 | Bacteria | 2209 |
| 593 | Ga0373948_0009436 | 3300034817 | Bacteria | 1682 |
| 594 | Ga0373958_0007085 | 3300034819 | Bacteria | 1773 |
| 595 | Ga0373926_0004046 | 3300035083 | Bacteria | 4783 |
| 596 | Ga0373926_0023231 | 3300035083 | Bacteria | 2153 |
| 597 | Ga0373928_0009779 | 3300035084 | Bacteria | 1877 |
| 598 | Ga0373934_0010825 | 3300035086 | Bacteria | 3427 |
| 599 | Ga0373934_0044774 | 3300035086 | Bacteria | 1749 |
| 600 | Ga0373940_0005225 | 3300035088 | Bacteria | 2799 |
| 601 | Ga0373951_0003077 | 3300035091 | Bacteria | 4115 |
| 602 | Ga0373951_0016358 | 3300035091 | Bacteria | 1673 |
| 603 | Ga0373952_0023651 | 3300035092 | Bacteria | 1314 |
| 604 | Ga0373923_0013974 | 3300035111 | Bacteria | 3006 |
| 605 | Ga0373923_0014072 | 3300035111 | Bacteria | 2997 |
| 606 | Ga0373923_0019408 | 3300035111 | Bacteria | 2632 |
| 607 | Ga0373923_0140396 | 3300035111 | Bacteria | 1092 |
| 608 | Ga0373923_0185487 | 3300035111 | Bacteria | 957 |
| 609 | Ga0373932_0004097 | 3300035112 | Bacteria | 3464 |
| 610 | Ga0373936_0001422 | 3300035113 | Bacteria | 8700 |
| 611 | Ga0373936_0015936 | 3300035113 | Bacteria | 2884 |
| 612 | Ga0373936_0048790 | 3300035113 | Bacteria | 1710 |
| 613 | Ga0373939_0023139 | 3300035114 | Bacteria | 1719 |
| 614 | Ga0373941_0017473 | 3300035115 | Bacteria | 1966 |
| 615 | Ga0373945_0002358 | 3300035116 | Bacteria | 5928 |
| 616 | Ga0373945_0042879 | 3300035116 | Bacteria | 1640 |
| 617 | Ga0373954_0099084 | 3300035118 | Bacteria | 1405 |
| 618 | Ga0373954_0273548 | 3300035118 | Bacteria | 832 |
| 619 | Ga0373956_0257604 | 3300035119 | Bacteria | 829 |
| 620 | Ga0373957_0002120 | 3300035120 | Bacteria | 5579 |
| 621 | Ga0373957_0014832 | 3300035120 | Bacteria | 2670 |
| 622 | Ga0373957_0120377 | 3300035120 | Bacteria | 1062 |
| 623 | Ga0373943_0078331 | 3300035170 | Bacteria | 1689 |
| 624 | Ga0373946_0000398 | 3300035171 | Bacteria | 14160 |
| 625 | Ga0373946_0013890 | 3300035171 | Bacteria | 3031 |
| 626 | Ga0373955_0122713 | 3300035172 | Bacteria | 1511 |
| 627 | Ga0373955_0180925 | 3300035172 | Bacteria | 1251 |
| 628 | Ga0373962_0025650 | 3300035242 | Bacteria | 1584 |
| 629 | Ga0316574_0011191 | 3300035398 | Bacteria | 5092 |
| 630 | Ga0373924_0024697 | 3300035410 | Bacteria | 2370 |
| 631 | Ga0373924_0170498 | 3300035410 | Bacteria | 956 |
| 632 | Ga0373935_0018810 | 3300035692 | Bacteria | 4208 |
| 633 | Ga0373927_0029341 | 3300035695 | Bacteria | 3584 |
| 634 | Ga0373927_0160328 | 3300035695 | Bacteria | 1473 |
| 635 | Ga0373933_0010751 | 3300035724 | Bacteria | 5022 |
| 636 | Ga0373933_0056005 | 3300035724 | Bacteria | 2366 |
| 637 | Ga0373933_0074319 | 3300035724 | Bacteria | 2072 |
| 638 | Ga0373947_0022659 | 3300035725 | Bacteria | 3644 |
| 639 | Ga0373947_0055048 | 3300035725 | Bacteria | 2402 |
| 640 | Ga0373947_0193285 | 3300035725 | Bacteria | 1328 |
| 641 | Ga0373947_0710775 | 3300035725 | Bacteria | 686 |
| 642 | Ga0373937_0016715 | 3300036401 | Bacteria | 6520 |
| 643 | Ga0373937_0042857 | 3300036401 | Bacteria | 4130 |
| 644 | Ga0373937_0216172 | 3300036401 | Bacteria | 1804 |
| 645 | Ga0372808_007581 | 3300036459 | Bacteria | 1487 |
| 646 | Ga0316582_0001650 | 3300036647 | Bacteria | 9986 |
| 647 | Ga0316584_0020649 | 3300036712 | Bacteria | 4779 |
| 648 | Ga0373925_0001533 | 3300037068 | Bacteria | 19714 |
| 649 | Ga0373925_0015583 | 3300037068 | Bacteria | 5500 |
| 650 | Ga0373925_0019220 | 3300037068 | Bacteria | 4968 |
| 651 | Ga0373925_0027975 | 3300037068 | Bacteria | 4128 |
| 652 | Ga0373925_0035205 | 3300037068 | Bacteria | 3693 |
| 653 | Ga0373925_0084551 | 3300037068 | Bacteria | 2418 |
| 654 | Ga0373925_0089777 | 3300037068 | Bacteria | 2348 |
| 655 | Ga0373925_0503491 | 3300037068 | Bacteria | 994 |
| 656 | Ga0373925_1022192 | 3300037068 | Bacteria | 680 |
| 657 | Ga0373925_1045791 | 3300037068 | Bacteria | 672 |
| 658 | Ga0395899_0038060 | 3300037312 | Bacteria | 3604 |
| 659 | Ga0395899_0044858 | 3300037312 | Bacteria | 3293 |
| 660 | Ga0395899_0134618 | 3300037312 | Bacteria | 1762 |
| 661 | Ga0395899_0275062 | 3300037312 | Bacteria | 1147 |
| 662 | Ga0395899_0612614 | 3300037312 | Bacteria | 692 |
| 663 | Ga0395900_0032828 | 3300037418 | Bacteria | 5339 |
| 664 | Ga0395900_0093708 | 3300037418 | Bacteria | 3085 |
| 665 | Ga0395900_0110020 | 3300037418 | Bacteria | 2831 |
| 666 | Ga0395900_0139695 | 3300037418 | Bacteria | 2481 |
| 667 | Ga0395900_0203312 | 3300037418 | Bacteria | 2003 |
| 668 | Ga0395900_0207573 | 3300037418 | Bacteria | 1979 |
| 669 | Ga0395900_0631476 | 3300037418 | Bacteria | 1009 |
| 670 | Ga0395898_0001632 | 3300037466 | Bacteria | 30376 |
| 671 | Ga0395898_0002149 | 3300037466 | Bacteria | 24274 |
| 672 | Ga0395898_0008284 | 3300037466 | Bacteria | 10991 |
| 673 | Ga0395898_0020796 | 3300037466 | Bacteria | 6660 |
| 674 | Ga0395898_0021707 | 3300037466 | Bacteria | 6507 |
| 675 | Ga0395898_0036794 | 3300037466 | Bacteria | 4858 |
| 676 | Ga0395898_0085160 | 3300037466 | Bacteria | 3046 |
| 677 | Ga0395898_0095229 | 3300037466 | Bacteria | 2861 |
| 678 | Ga0395898_0279922 | 3300037466 | Bacteria | 1591 |
| 679 | Ga0395898_0604101 | 3300037466 | Bacteria | 1040 |
| 680 | Ga0395898_0821717 | 3300037466 | Bacteria | 869 |
| 681 | Ga0395898_0916356 | 3300037466 | Bacteria | 814 |
| 682 | Ga0395905_0001202 | 3300037471 | Bacteria | 32359 |
| 683 | Ga0395905_0116969 | 3300037471 | Bacteria | 2505 |
| 684 | Ga0395905_0509676 | 3300037471 | Bacteria | 1103 |
| 685 | Ga0436364_0150636 | 3300037853 | Bacteria | 12283 |
| 686 | Ga0436364_0395751 | 3300037853 | Bacteria | 17578 |
| 687 | Ga0436364_0531502 | 3300037853 | Bacteria | 2071 |
| 688 | Ga0436364_0784392 | 3300037853 | Bacteria | 1369 |
| 689 | Ga0436364_0919138 | 3300037853 | Bacteria | 7564 |
| 690 | Ga0436364_1320999 | 3300037853 | Bacteria | 6137 |
| 691 | Ga0436364_1362811 | 3300037853 | Bacteria | 2337 |
| 692 | Ga0436364_1517030 | 3300037853 | Bacteria | 99478 |
| 693 | Ga0395901_0001966 | 3300038443 | Bacteria | 21141 |
| 694 | Ga0395901_0003051 | 3300038443 | Bacteria | 16874 |
| 695 | Ga0395901_0027170 | 3300038443 | Bacteria | 5879 |
| 696 | Ga0395901_0044069 | 3300038443 | Bacteria | 4627 |
| 697 | Ga0395901_0177249 | 3300038443 | Bacteria | 2235 |
| 698 | Ga0395901_0179391 | 3300038443 | Bacteria | 2221 |
| 699 | Ga0395901_0260685 | 3300038443 | Bacteria | 1804 |
| 700 | Ga0395901_0376729 | 3300038443 | Bacteria | 1461 |
| 701 | Ga0400485_15671 | 3300038735 | Bacteria | 29558 |
| 702 | Ga0400486_02662 | 3300038742 | Bacteria | 74467 |
| 703 | Ga0400486_13685 | 3300038742 | Bacteria | 2581 |
| 704 | Ga0436365_0420689 | 3300039437 | Bacteria | 1212 |
| 705 | Ga0436365_1811262 | 3300039437 | Bacteria | 5047 |
| 706 | Ga0436360_0629473 | 3300039438 | Bacteria | 709 |
| 707 | Ga0436361_0900465 | 3300039447 | Bacteria | 24867 |
| 708 | Ga0436362_0534645 | 3300039453 | Bacteria | 919 |
| 709 | Ga0436362_0824423 | 3300039453 | Bacteria | 925 |
| 710 | Ga0439436_0000844 | 3300041404 | Bacteria | 8373 |
| 711 | Ga0439436_0003084 | 3300041404 | Bacteria | 5051 |
| 712 | Ga0439436_0005353 | 3300041404 | Bacteria | 3937 |
| 713 | Ga0439436_0032311 | 3300041404 | Bacteria | 1518 |
| 714 | Ga0439439_0001593 | 3300041406 | Bacteria | 4576 |
| 715 | Ga0439439_0002844 | 3300041406 | Bacteria | 3741 |
| 716 | Ga0439439_0025811 | 3300041406 | Bacteria | 1480 |
| 717 | Ga0439461_0006529 | 3300041410 | Bacteria | 2035 |
| 718 | Ga0439466_0001635 | 3300041411 | Bacteria | 8770 |
| 719 | Ga0439466_0062472 | 3300041411 | Bacteria | 1197 |
| 720 | Ga0439466_0081549 | 3300041411 | Bacteria | 1020 |
| 721 | Ga0451793_0126831 | 3300041452 | Bacteria | 4440 |
| 722 | Ga0451795_0121483 | 3300041456 | Bacteria | 2342 |
| 723 | Ga0451833_0410178 | 3300041491 | Bacteria | 659 |
| 724 | Ga0451837_0776717 | 3300041494 | Bacteria | 1799 |
| 725 | Ga0451837_1343481 | 3300041494 | Bacteria | 1246 |
| 726 | Ga0451841_0340527 | 3300041498 | Bacteria | 1040 |
| 727 | Ga0451843_1293141 | 3300041509 | Bacteria | 1959 |
| 728 | Ga0451843_1384929 | 3300041509 | Bacteria | 1694 |
| 729 | Ga0451843_1552399 | 3300041509 | Bacteria | 1753 |
| 730 | Ga0451853_0882312 | 3300041512 | Bacteria | 1113 |
| 731 | Ga0451853_2556618 | 3300041512 | Bacteria | 1396 |
| 732 | Ga0451853_2771047 | 3300041512 | Bacteria | 1626 |
| 733 | Ga0451853_3274728 | 3300041512 | Bacteria | 921 |
| 734 | Ga0451853_3485447 | 3300041512 | Bacteria | 2192 |
| 735 | Ga0439433_0001722 | 3300041999 | Bacteria | 4544 |
| 736 | Ga0439433_0004646 | 3300041999 | Bacteria | 2950 |
| 737 | Ga0439433_0052443 | 3300041999 | Bacteria | 963 |
| 738 | Ga0439442_000229 | 3300042002 | Bacteria | 13772 |
| 739 | Ga0439442_000270 | 3300042002 | Bacteria | 12664 |
| 740 | Ga0439442_043974 | 3300042002 | Bacteria | 941 |
| 741 | Ga0439442_071765 | 3300042002 | Bacteria | 738 |
| 742 | Ga0439448_0040106 | 3300042005 | Bacteria | 1511 |
| 743 | Ga0439432_003959 | 3300042006 | Bacteria | 5448 |
| 744 | Ga0439432_055494 | 3300042006 | Bacteria | 1229 |
| 745 | Ga0439432_069218 | 3300042006 | Bacteria | 1078 |
| 746 | Ga0439449_0000462 | 3300042007 | Bacteria | 15170 |
| 747 | Ga0439449_0001950 | 3300042007 | Bacteria | 8099 |
| 748 | Ga0439449_0014782 | 3300042007 | Bacteria | 2933 |
| 749 | Ga0439449_0034925 | 3300042007 | Bacteria | 1872 |
| 750 | Ga0439449_0069315 | 3300042007 | Bacteria | 1300 |
| 751 | Ga0439449_0073024 | 3300042007 | Bacteria | 1264 |
| 752 | Ga0439449_0139481 | 3300042007 | Bacteria | 902 |
| 753 | Ga0439452_005042 | 3300042010 | Bacteria | 4312 |
| 754 | Ga0439457_000259 | 3300042014 | Bacteria | 14444 |
| 755 | Ga0439457_000484 | 3300042014 | Bacteria | 11509 |
| 756 | Ga0439457_006468 | 3300042014 | Bacteria | 2869 |
| 757 | Ga0439462_0025025 | 3300042015 | Bacteria | 1570 |
| 758 | Ga0439462_0026643 | 3300042015 | Bacteria | 1524 |
| 759 | Ga0439462_0051250 | 3300042015 | Bacteria | 1109 |
| 760 | Ga0450919_014088 | 3300042121 | Bacteria | 903 |
| 761 | Ga0450920_010457 | 3300042122 | Bacteria | 1721 |
| 762 | Ga0450920_037827 | 3300042122 | Bacteria | 959 |
| 763 | Ga0450894_000017 | 3300042131 | Bacteria | 23709 |
| 764 | Ga0450896_001345 | 3300042133 | Bacteria | 2993 |
| 765 | Ga0450898_001329 | 3300042134 | Bacteria | 3228 |
| 766 | Ga0450899_000582 | 3300042135 | Bacteria | 4151 |
| 767 | Ga0450903_000170 | 3300042138 | Bacteria | 14266 |
| 768 | Ga0450906_006430 | 3300042145 | Bacteria | 2373 |
| 769 | Ga0450907_002416 | 3300042146 | Bacteria | 3566 |
| 770 | Ga0450907_017351 | 3300042146 | Bacteria | 1200 |
| 771 | Ga0439458_0008360 | 3300042157 | Bacteria | 2304 |
| 772 | Ga0450908_002967 | 3300042184 | Bacteria | 3306 |
| 773 | Ga0450909_001368 | 3300042185 | Bacteria | 3388 |
| 774 | Ga0439434_0000397 | 3300042435 | Bacteria | 12414 |
| 775 | Ga0439434_0031409 | 3300042435 | Bacteria | 1614 |
| 776 | Ga0450918_000574 | 3300042531 | Bacteria | 7815 |
| 777 | Ga0450918_003347 | 3300042531 | Bacteria | 2979 |
| 778 | Ga0466969_0001422 | 3300044656 | Bacteria | 12919 |
| 779 | Ga0466969_0001882 | 3300044656 | Bacteria | 11220 |
| 780 | Ga0466969_0040748 | 3300044656 | Bacteria | 2326 |
| 781 | Ga0466969_0046972 | 3300044656 | Bacteria | 2138 |
| 782 | Ga0466972_0003583 | 3300044658 | Bacteria | 7719 |
| 783 | Ga0466972_0054977 | 3300044658 | Bacteria | 1915 |
| 784 | Ga0466972_0113074 | 3300044658 | Bacteria | 1282 |
| 785 | Ga0466972_0118593 | 3300044658 | Bacteria | 1248 |
| 786 | Ga0466965_0002385 | 3300044683 | Bacteria | 7966 |
| 787 | Ga0466965_0013515 | 3300044683 | Bacteria | 3853 |
| 788 | Ga0466965_0115586 | 3300044683 | Bacteria | 1382 |
| 789 | Ga0466965_0255202 | 3300044683 | Bacteria | 941 |
| 790 | Ga0466965_0278362 | 3300044683 | Bacteria | 903 |
| 791 | Ga0466966_0021627 | 3300044684 | Bacteria | 4223 |
| 792 | Ga0466966_0030730 | 3300044684 | Bacteria | 3484 |
| 793 | Ga0466966_0223787 | 3300044684 | Bacteria | 1135 |
| 794 | Ga0466966_0235044 | 3300044684 | Bacteria | 1105 |
| 795 | Ga0466961_0002971 | 3300044693 | Bacteria | 10527 |
| 796 | Ga0466961_0356590 | 3300044693 | Bacteria | 890 |
| 797 | Ga0466963_0001086 | 3300044694 | Bacteria | 14185 |
| 798 | Ga0466963_0026338 | 3300044694 | Bacteria | 3718 |
| 799 | Ga0466963_0065138 | 3300044694 | Bacteria | 2442 |
| 800 | Ga0466963_0114573 | 3300044694 | Bacteria | 1852 |
| 801 | Ga0466963_0176137 | 3300044694 | Bacteria | 1492 |
| 802 | Ga0466963_0265137 | 3300044694 | Bacteria | 1206 |
| 803 | Ga0466964_0003028 | 3300044706 | Bacteria | 6096 |
| 804 | Ga0466964_0073551 | 3300044706 | Bacteria | 1451 |
| 805 | Ga0466964_0135643 | 3300044706 | Bacteria | 1126 |
| 806 | Ga0466964_0292931 | 3300044706 | Bacteria | 818 |
| 807 | Ga0466971_0010428 | 3300044719 | Bacteria | 4060 |
| 808 | Ga0466971_0018388 | 3300044719 | Bacteria | 3095 |
| 809 | Ga0466971_0040993 | 3300044719 | Bacteria | 2080 |
| 810 | Ga0466971_0050447 | 3300044719 | Bacteria | 1873 |
| 811 | Ga0466968_0022011 | 3300044735 | Bacteria | 2587 |
| 812 | Ga0466970_0000351 | 3300044765 | Bacteria | 22339 |
| 813 | Ga0466970_0000945 | 3300044765 | Bacteria | 14039 |
| 814 | Ga0466970_0010378 | 3300044765 | Bacteria | 4728 |
| 815 | Ga0466970_0012006 | 3300044765 | Bacteria | 4423 |
| 816 | Ga0466970_0192092 | 3300044765 | Bacteria | 1135 |
| 817 | Ga0466970_0386280 | 3300044765 | Bacteria | 797 |
| 818 | Ga0466970_0545358 | 3300044765 | Bacteria | 670 |
| 819 | Ga0466957_0000810 | 3300044842 | Bacteria | 15942 |
| 820 | Ga0466957_0012904 | 3300044842 | Bacteria | 4842 |
| 821 | Ga0466960_0014836 | 3300044901 | Bacteria | 3347 |
| 822 | Ga0466960_0025608 | 3300044901 | Bacteria | 2671 |
| 823 | Ga0466960_0039396 | 3300044901 | Bacteria | 2228 |
| 824 | Ga0466960_0093462 | 3300044901 | Bacteria | 1537 |
| 825 | Ga0466960_0134497 | 3300044901 | Bacteria | 1308 |
| 826 | Ga0466959_0001040 | 3300045049 | Bacteria | 16627 |
| 827 | Ga0466959_0045253 | 3300045049 | Bacteria | 3241 |
| 828 | Ga0466959_0093399 | 3300045049 | Bacteria | 2159 |
| 829 | Ga0466959_0452473 | 3300045049 | Bacteria | 870 |
| 830 | Ga0466958_0000718 | 3300045836 | Bacteria | 14480 |
| 831 | Ga0466958_0002027 | 3300045836 | Bacteria | 9994 |
| 832 | Ga0466958_0077604 | 3300045836 | Bacteria | 2040 |
| 833 | Ga0466958_0434519 | 3300045836 | Bacteria | 849 |
| 834 | Ga0466967_0022318 | 3300045976 | Bacteria | 5162 |
| 835 | Ga0466967_0024594 | 3300045976 | Bacteria | 4954 |
| 836 | Ga0466967_0030054 | 3300045976 | Bacteria | 4555 |
| 837 | Ga0466967_0114113 | 3300045976 | Bacteria | 2487 |
| 838 | Ga0466967_0190348 | 3300045976 | Bacteria | 1938 |
| 839 | Ga0466967_0568248 | 3300045976 | Bacteria | 1117 |
| 840 | Ga0466967_0574298 | 3300045976 | Bacteria | 1111 |
| 841 | Ga0466967_0847801 | 3300045976 | Bacteria | 908 |
| 842 | Ga0495592_0034168 | 3300046454 | Bacteria | 3833 |
| 843 | Ga0495592_0116406 | 3300046454 | Bacteria | 1886 |
| 844 | Ga0495592_0120291 | 3300046454 | Bacteria | 1848 |
| 845 | Ga0495603_0000289 | 3300046455 | Bacteria | 26710 |
| 846 | Ga0495603_0000661 | 3300046455 | Bacteria | 19477 |
| 847 | Ga0495603_0000674 | 3300046455 | Bacteria | 19370 |
| 848 | Ga0495603_0015404 | 3300046455 | Bacteria | 4626 |
| 849 | Ga0495603_0036433 | 3300046455 | Bacteria | 2954 |
| 850 | Ga0495603_0098020 | 3300046455 | Bacteria | 1712 |
| 851 | Ga0495629_0000707 | 3300046459 | Bacteria | 27008 |
| 852 | Ga0495629_0000836 | 3300046459 | Bacteria | 24977 |
| 853 | Ga0495629_0005889 | 3300046459 | Bacteria | 9135 |
| 854 | Ga0495629_0010308 | 3300046459 | Bacteria | 6809 |
| 855 | Ga0495629_0012702 | 3300046459 | Bacteria | 6097 |
| 856 | Ga0495629_0019392 | 3300046459 | Bacteria | 4859 |
| 857 | Ga0495629_0109965 | 3300046459 | Bacteria | 1921 |
| 858 | Ga0495629_0118311 | 3300046459 | Bacteria | 1846 |
| 859 | Ga0495629_0261512 | 3300046459 | Bacteria | 1189 |
| 860 | Ga0495629_0269857 | 3300046459 | Bacteria | 1169 |
| 861 | Ga0495641_0001407 | 3300046461 | Bacteria | 20458 |
| 862 | Ga0495651_0007222 | 3300046462 | Bacteria | 8492 |
| 863 | Ga0495651_0034250 | 3300046462 | Bacteria | 3958 |
| 864 | Ga0495651_0040256 | 3300046462 | Bacteria | 3635 |
| 865 | Ga0495651_0047527 | 3300046462 | Bacteria | 3318 |
| 866 | Ga0495651_0096599 | 3300046462 | Bacteria | 2207 |
| 867 | Ga0495651_0109519 | 3300046462 | Bacteria | 2044 |
| 868 | Ga0495651_0113178 | 3300046462 | Bacteria | 2003 |
| 869 | Ga0495653_0001977 | 3300046463 | Bacteria | 16126 |
| 870 | Ga0495653_0006324 | 3300046463 | Bacteria | 9719 |
| 871 | Ga0495653_0018018 | 3300046463 | Bacteria | 5740 |
| 872 | Ga0495653_0023407 | 3300046463 | Bacteria | 4991 |
| 873 | Ga0495653_0055310 | 3300046463 | Bacteria | 3028 |
| 874 | Ga0495653_0077750 | 3300046463 | Bacteria | 2463 |
| 875 | Ga0495653_0100670 | 3300046463 | Bacteria | 2094 |
| 876 | Ga0495650_0047918 | 3300046471 | Bacteria | 1784 |
| 877 | Ga0495580_0007396 | 3300046472 | Bacteria | 8832 |
| 878 | Ga0495580_0028835 | 3300046472 | Bacteria | 4033 |
| 879 | Ga0495582_0001725 | 3300046473 | Bacteria | 12330 |
| 880 | Ga0495582_0019391 | 3300046473 | Bacteria | 3718 |
| 881 | Ga0495582_0026659 | 3300046473 | Bacteria | 3168 |
| 882 | Ga0495582_0086160 | 3300046473 | Bacteria | 1748 |
| 883 | Ga0495639_0002961 | 3300046475 | Bacteria | 7390 |
| 884 | Ga0495639_0003573 | 3300046475 | Bacteria | 6705 |
| 885 | Ga0495639_0053154 | 3300046475 | Bacteria | 1845 |
| 886 | Ga0495639_0174079 | 3300046475 | Bacteria | 1046 |
| 887 | Ga0495662_0001446 | 3300046476 | Bacteria | 11748 |
| 888 | Ga0495662_0006850 | 3300046476 | Bacteria | 5668 |
| 889 | Ga0495662_0039735 | 3300046476 | Bacteria | 2272 |
| 890 | Ga0495662_0259843 | 3300046476 | Bacteria | 855 |
| 891 | Ga0495664_0001216 | 3300046477 | Bacteria | 13471 |
| 892 | Ga0495664_0001349 | 3300046477 | Bacteria | 12925 |
| 893 | Ga0495664_0004093 | 3300046477 | Bacteria | 7957 |
| 894 | Ga0495664_0021131 | 3300046477 | Bacteria | 3760 |
| 895 | Ga0495664_0089126 | 3300046477 | Bacteria | 1854 |
| 896 | Ga0495664_0192081 | 3300046477 | Bacteria | 1237 |
| 897 | Ga0495664_0520604 | 3300046477 | Bacteria | 710 |
| 898 | Ga0495585_0021922 | 3300046492 | Bacteria | 3667 |
| 899 | Ga0495585_0062706 | 3300046492 | Bacteria | 2042 |
| 900 | Ga0495594_0006506 | 3300046499 | Bacteria | 6013 |
| 901 | Ga0495594_0015830 | 3300046499 | Bacteria | 3967 |
| 902 | Ga0495594_0034590 | 3300046499 | Bacteria | 2749 |
| 903 | Ga0495594_0044987 | 3300046499 | Bacteria | 2423 |
| 904 | Ga0495594_0062666 | 3300046499 | Bacteria | 2059 |
| 905 | Ga0495594_0089797 | 3300046499 | Bacteria | 1721 |
| 906 | Ga0495594_0103966 | 3300046499 | Bacteria | 1599 |
| 907 | Ga0495594_0171504 | 3300046499 | Bacteria | 1234 |
| 908 | Ga0495594_0318595 | 3300046499 | Bacteria | 886 |
| 909 | Ga0495607_0066806 | 3300046501 | Bacteria | 2022 |
| 910 | Ga0495583_0234590 | 3300046506 | Bacteria | 739 |
| 911 | Ga0495606_0001411 | 3300046507 | Bacteria | 32325 |
| 912 | Ga0495608_0008605 | 3300046511 | Bacteria | 7147 |
| 913 | Ga0495608_0025254 | 3300046511 | Bacteria | 4055 |
| 914 | Ga0495618_0009873 | 3300046514 | Bacteria | 5776 |
| 915 | Ga0495618_0131119 | 3300046514 | Bacteria | 1604 |
| 916 | Ga0495628_0048012 | 3300046516 | Bacteria | 3385 |
| 917 | Ga0495628_0121159 | 3300046516 | Bacteria | 2006 |
| 918 | Ga0495628_0141781 | 3300046516 | Bacteria | 1834 |
| 919 | Ga0495628_0248742 | 3300046516 | Bacteria | 1328 |
| 920 | Ga0495630_0038479 | 3300046517 | Bacteria | 3578 |
| 921 | Ga0495630_0125330 | 3300046517 | Bacteria | 1949 |
| 922 | Ga0495630_0533591 | 3300046517 | Bacteria | 900 |
| 923 | Ga0495630_0640155 | 3300046517 | Bacteria | 814 |
| 924 | Ga0495631_0072346 | 3300046518 | Bacteria | 1489 |
| 925 | Ga0495632_0039105 | 3300046519 | Bacteria | 2397 |
| 926 | Ga0495632_0049523 | 3300046519 | Bacteria | 2076 |
| 927 | Ga0495643_0004792 | 3300046522 | Bacteria | 9334 |
| 928 | Ga0495643_0138838 | 3300046522 | Bacteria | 1214 |
| 929 | Ga0495666_0015388 | 3300046526 | Bacteria | 3808 |
| 930 | Ga0495666_0063817 | 3300046526 | Bacteria | 1758 |
| 931 | Ga0495642_0020650 | 3300046528 | Bacteria | 2589 |
| 932 | Ga0495642_0084530 | 3300046528 | Bacteria | 1339 |
| 933 | Ga0495642_0345111 | 3300046528 | Bacteria | 654 |
| 934 | Ga0495652_0006642 | 3300046529 | Bacteria | 10741 |
| 935 | Ga0495652_0045550 | 3300046529 | Bacteria | 3769 |
| 936 | Ga0495652_0098154 | 3300046529 | Bacteria | 2382 |
| 937 | Ga0495665_0000460 | 3300046531 | Bacteria | 20467 |
| 938 | Ga0495665_0004304 | 3300046531 | Bacteria | 7692 |
| 939 | Ga0495665_0004561 | 3300046531 | Bacteria | 7477 |
| 940 | Ga0495640_0019296 | 3300046533 | Bacteria | 5036 |
| 941 | Ga0495640_0023776 | 3300046533 | Bacteria | 4458 |
| 942 | Ga0495640_0046535 | 3300046533 | Bacteria | 3005 |
| 943 | Ga0495640_0085367 | 3300046533 | Bacteria | 2092 |
| 944 | Ga0495640_0112180 | 3300046533 | Bacteria | 1781 |
| 945 | Ga0495640_0239536 | 3300046533 | Bacteria | 1139 |
| 946 | Ga0495586_0001125 | 3300046535 | Bacteria | 15048 |
| 947 | Ga0495586_0001218 | 3300046535 | Bacteria | 14449 |
| 948 | Ga0495586_0025026 | 3300046535 | Bacteria | 3193 |
| 949 | Ga0495587_0001013 | 3300046536 | Bacteria | 18464 |
| 950 | Ga0495587_0005692 | 3300046536 | Bacteria | 8126 |
| 951 | Ga0495587_0023700 | 3300046536 | Bacteria | 3770 |
| 952 | Ga0495587_0063030 | 3300046536 | Bacteria | 2169 |
| 953 | Ga0495587_0382738 | 3300046536 | Bacteria | 782 |
| 954 | Ga0495621_0258112 | 3300046539 | Bacteria | 713 |
| 955 | Ga0495645_0000775 | 3300046543 | Bacteria | 21886 |
| 956 | Ga0495645_0012725 | 3300046543 | Bacteria | 5937 |
| 957 | Ga0495645_0017960 | 3300046543 | Bacteria | 5075 |
| 958 | Ga0495645_0037901 | 3300046543 | Bacteria | 3514 |
| 959 | Ga0495622_0001939 | 3300046557 | Bacteria | 10168 |
| 960 | Ga0495633_0040816 | 3300046558 | Bacteria | 2209 |
| 961 | Ga0495633_0151193 | 3300046558 | Bacteria | 1072 |
| 962 | Ga0495633_0286303 | 3300046558 | Bacteria | 749 |
| 963 | Ga0495667_0008292 | 3300046559 | Bacteria | 7045 |
| 964 | Ga0495667_0009434 | 3300046559 | Bacteria | 6611 |
| 965 | Ga0495667_0009720 | 3300046559 | Bacteria | 6516 |
| 966 | Ga0495667_0048311 | 3300046559 | Bacteria | 2809 |
| 967 | Ga0495667_0281996 | 3300046559 | Bacteria | 1054 |
| 968 | Ga0495667_0347243 | 3300046559 | Bacteria | 937 |
| 969 | Ga0495656_0000169 | 3300046615 | Bacteria | 23292 |
| 970 | Ga0495656_0019999 | 3300046615 | Bacteria | 2592 |
| 971 | Ga0495656_0032717 | 3300046615 | Bacteria | 2118 |
| 972 | Ga0495668_0000889 | 3300046616 | Bacteria | 33661 |
| 973 | Ga0495668_0005024 | 3300046616 | Bacteria | 9121 |
| 974 | Ga0495668_0029314 | 3300046616 | Bacteria | 3110 |
| 975 | Ga0495634_0002610 | 3300046642 | Bacteria | 14829 |
| 976 | Ga0495634_0007951 | 3300046642 | Bacteria | 7911 |
| 977 | Ga0495634_0044523 | 3300046642 | Bacteria | 3003 |
| 978 | Ga0495634_0161750 | 3300046642 | Bacteria | 1411 |
| 979 | Ga0495611_0098066 | 3300046648 | Bacteria | 1359 |
| 980 | Ga0495625_0001780 | 3300046660 | Bacteria | 24796 |
| 981 | Ga0495625_0005724 | 3300046660 | Bacteria | 11237 |
| 982 | Ga0495635_0017096 | 3300046663 | Bacteria | 5064 |
| 983 | Ga0495635_0038484 | 3300046663 | Bacteria | 3311 |
| 984 | Ga0495635_0099851 | 3300046663 | Bacteria | 1983 |
| 985 | Ga0495635_0142881 | 3300046663 | Bacteria | 1629 |
| 986 | Ga0495659_0005317 | 3300046664 | Bacteria | 4049 |
| 987 | Ga0495588_0000974 | 3300046674 | Bacteria | 12520 |
| 988 | Ga0495588_0001165 | 3300046674 | Bacteria | 11322 |
| 989 | Ga0495588_0001188 | 3300046674 | Bacteria | 11231 |
| 990 | Ga0495588_0007559 | 3300046674 | Bacteria | 4952 |
| 991 | Ga0495588_0008867 | 3300046674 | Bacteria | 4627 |
| 992 | Ga0495588_0009018 | 3300046674 | Bacteria | 4596 |
| 993 | Ga0495588_0040515 | 3300046674 | Bacteria | 2376 |
| 994 | Ga0495588_0272366 | 3300046674 | Bacteria | 892 |
| 995 | Ga0495657_0010059 | 3300046675 | Bacteria | 7131 |
| 996 | Ga0495657_0010805 | 3300046675 | Bacteria | 6856 |
| 997 | Ga0495657_0014226 | 3300046675 | Bacteria | 5846 |
| 998 | Ga0495657_0014662 | 3300046675 | Bacteria | 5753 |
| 999 | Ga0495657_0021307 | 3300046675 | Bacteria | 4651 |
| 1000 | Ga0495657_0048926 | 3300046675 | Bacteria | 2850 |
| 1001 | Ga0495657_0077779 | 3300046675 | Bacteria | 2151 |
| 1002 | Ga0495657_0103380 | 3300046675 | Bacteria | 1812 |
| 1003 | Ga0495657_0193430 | 3300046675 | Bacteria | 1242 |
| 1004 | Ga0495599_0065683 | 3300046678 | Bacteria | 2266 |
| 1005 | Ga0495599_0136012 | 3300046678 | Bacteria | 1525 |
| 1006 | Ga0495623_0015016 | 3300046679 | Bacteria | 5006 |
| 1007 | Ga0495623_0021270 | 3300046679 | Bacteria | 4190 |
| 1008 | Ga0495623_0032147 | 3300046679 | Bacteria | 3372 |
| 1009 | Ga0495623_0078857 | 3300046679 | Bacteria | 2041 |
| 1010 | Ga0495623_0101117 | 3300046679 | Bacteria | 1756 |
| 1011 | Ga0495623_0150802 | 3300046679 | Bacteria | 1374 |
| 1012 | Ga0495623_0172212 | 3300046679 | Bacteria | 1264 |
| 1013 | Ga0495646_0006103 | 3300046680 | Bacteria | 7639 |
| 1014 | Ga0495646_0029588 | 3300046680 | Bacteria | 3423 |
| 1015 | Ga0495646_0031555 | 3300046680 | Bacteria | 3300 |
| 1016 | Ga0495613_0000273 | 3300046689 | Bacteria | 48007 |
| 1017 | Ga0495613_0003050 | 3300046689 | Bacteria | 12526 |
| 1018 | Ga0495613_0004146 | 3300046689 | Bacteria | 10847 |
| 1019 | Ga0495613_0006281 | 3300046689 | Bacteria | 8887 |
| 1020 | Ga0495613_0043362 | 3300046689 | Bacteria | 3328 |
| 1021 | Ga0495613_0154869 | 3300046689 | Bacteria | 1633 |
| 1022 | Ga0495613_0354873 | 3300046689 | Bacteria | 1006 |
| 1023 | Ga0495624_0023877 | 3300046690 | Bacteria | 4028 |
| 1024 | Ga0495624_0088196 | 3300046690 | Bacteria | 1915 |
| 1025 | Ga0495624_0090190 | 3300046690 | Bacteria | 1891 |
| 1026 | Ga0495670_0000803 | 3300046691 | Bacteria | 15104 |
| 1027 | Ga0495670_0026591 | 3300046691 | Bacteria | 2865 |
| 1028 | Ga0495670_0042256 | 3300046691 | Bacteria | 2274 |
| 1029 | Ga0495670_0049455 | 3300046691 | Bacteria | 2104 |
| 1030 | Ga0495671_0007907 | 3300046692 | Bacteria | 6014 |
| 1031 | Ga0495649_0265248 | 3300046694 | Bacteria | 880 |
| 1032 | Ga0495589_0025263 | 3300046794 | Bacteria | 3015 |
| 1033 | Ga0495589_0055145 | 3300046794 | Bacteria | 1959 |
| 1034 | Ga0495589_0059458 | 3300046794 | Bacteria | 1878 |
| 1035 | Ga0495589_0225265 | 3300046794 | Bacteria | 880 |
| 1036 | Ga0495600_0002512 | 3300046809 | Bacteria | 10536 |
| 1037 | Ga0495600_0013323 | 3300046809 | Bacteria | 5163 |
| 1038 | Ga0495600_0029526 | 3300046809 | Bacteria | 3550 |
| 1039 | Ga0495600_0137084 | 3300046809 | Bacteria | 1589 |
| 1040 | Ga0495600_0152595 | 3300046809 | Bacteria | 1495 |
| 1041 | Ga0495600_0157016 | 3300046809 | Bacteria | 1471 |
| 1042 | Ga0495600_0315700 | 3300046809 | Bacteria | 983 |
| 1043 | Ga0495660_0102531 | 3300046810 | Bacteria | 1471 |
| 1044 | Ga0495581_0000967 | 3300047315 | Bacteria | 15443 |
| 1045 | Ga0495581_0003601 | 3300047315 | Bacteria | 8913 |
| 1046 | Ga0495581_0006363 | 3300047315 | Bacteria | 6849 |
| 1047 | Ga0495581_0007210 | 3300047315 | Bacteria | 6432 |
| 1048 | Ga0495581_0040613 | 3300047315 | Bacteria | 2692 |
| 1049 | Ga0495581_0107086 | 3300047315 | Bacteria | 1625 |
| 1050 | Ga0495581_0197043 | 3300047315 | Bacteria | 1178 |
| 1051 | Ga0495581_0312369 | 3300047315 | Bacteria | 918 |
| 1052 | Ga0495604_0000551 | 3300047317 | Bacteria | 32966 |
| 1053 | Ga0495604_0001127 | 3300047317 | Bacteria | 22177 |
| 1054 | Ga0495604_0001365 | 3300047317 | Bacteria | 19978 |
| 1055 | Ga0495604_0017009 | 3300047317 | Bacteria | 5815 |
| 1056 | Ga0495604_0042287 | 3300047317 | Bacteria | 3572 |
| 1057 | Ga0495604_0045416 | 3300047317 | Bacteria | 3428 |
| 1058 | Ga0495604_0049635 | 3300047317 | Bacteria | 3259 |
| 1059 | Ga0495604_0160608 | 3300047317 | Bacteria | 1588 |
| 1060 | Ga0495604_0228154 | 3300047317 | Bacteria | 1279 |
| 1061 | Ga0495636_0002615 | 3300047318 | Bacteria | 6929 |
| 1062 | Ga0495636_0002725 | 3300047318 | Bacteria | 6814 |
| 1063 | Ga0495636_0008686 | 3300047318 | Bacteria | 4006 |
| 1064 | Ga0495636_0011336 | 3300047318 | Bacteria | 3527 |
| 1065 | Ga0495636_0163441 | 3300047318 | Bacteria | 1004 |
| 1066 | Ga0495674_0000635 | 3300047319 | Bacteria | 32814 |
| 1067 | Ga0495674_0036424 | 3300047319 | Bacteria | 4428 |
| 1068 | Ga0495674_0036585 | 3300047319 | Bacteria | 4417 |
| 1069 | Ga0495674_0066904 | 3300047319 | Bacteria | 3115 |
| 1070 | Ga0495674_0113486 | 3300047319 | Bacteria | 2295 |
| 1071 | Ga0495676_0002154 | 3300047321 | Bacteria | 17423 |
| 1072 | Ga0495676_0002263 | 3300047321 | Bacteria | 17074 |
| 1073 | Ga0495676_0005627 | 3300047321 | Bacteria | 11489 |
| 1074 | Ga0495676_0013922 | 3300047321 | Bacteria | 7211 |
| 1075 | Ga0495676_0020569 | 3300047321 | Bacteria | 5786 |
| 1076 | Ga0495676_0497516 | 3300047321 | Bacteria | 800 |
| 1077 | Ga0495680_0002388 | 3300047322 | Bacteria | 19256 |
| 1078 | Ga0495680_0009246 | 3300047322 | Bacteria | 8880 |
| 1079 | Ga0495680_0009271 | 3300047322 | Bacteria | 8866 |
| 1080 | Ga0495680_0018990 | 3300047322 | Bacteria | 5820 |
| 1081 | Ga0495680_0048963 | 3300047322 | Bacteria | 3315 |
| 1082 | Ga0495680_0110332 | 3300047322 | Bacteria | 2039 |
| 1083 | Ga0495683_0038893 | 3300047323 | Bacteria | 2407 |
| 1084 | Ga0495683_0065507 | 3300047323 | Bacteria | 1792 |
| 1085 | Ga0495683_0155979 | 3300047323 | Bacteria | 1059 |
| 1086 | Ga0495687_007041 | 3300047443 | Bacteria | 6733 |
| 1087 | Ga0495687_010689 | 3300047443 | Bacteria | 5011 |
| 1088 | Ga0495687_017184 | 3300047443 | Bacteria | 3617 |
| 1089 | Ga0495687_023822 | 3300047443 | Bacteria | 2919 |
| 1090 | Ga0495675_0001118 | 3300047444 | Bacteria | 16294 |
| 1091 | Ga0495675_0002946 | 3300047444 | Bacteria | 10227 |
| 1092 | Ga0495675_0006706 | 3300047444 | Bacteria | 7056 |
| 1093 | Ga0495675_0012079 | 3300047444 | Bacteria | 5429 |
| 1094 | Ga0495675_0014288 | 3300047444 | Bacteria | 5017 |
| 1095 | Ga0495675_0015184 | 3300047444 | Bacteria | 4868 |
| 1096 | Ga0495675_0018022 | 3300047444 | Bacteria | 4477 |
| 1097 | Ga0495675_0020599 | 3300047444 | Bacteria | 4197 |
| 1098 | Ga0495675_0058549 | 3300047444 | Bacteria | 2443 |
| 1099 | Ga0495677_0053309 | 3300047445 | Bacteria | 1491 |
| 1100 | Ga0495677_0145199 | 3300047445 | Bacteria | 912 |
| 1101 | Ga0495677_0179335 | 3300047445 | Bacteria | 821 |
| 1102 | Ga0495685_001134 | 3300047447 | Bacteria | 8152 |
| 1103 | Ga0495685_023581 | 3300047447 | Bacteria | 2118 |
| 1104 | Ga0495685_108371 | 3300047447 | Bacteria | 915 |
| 1105 | Ga0495685_112928 | 3300047447 | Bacteria | 893 |
| 1106 | Ga0495685_173477 | 3300047447 | Bacteria | 696 |
| 1107 | Ga0495681_0001152 | 3300047470 | Bacteria | 20018 |
| 1108 | Ga0495681_0034494 | 3300047470 | Bacteria | 2521 |
| 1109 | Ga0495684_0011248 | 3300047471 | Bacteria | 6914 |
| 1110 | Ga0495684_0025184 | 3300047471 | Bacteria | 4574 |
| 1111 | Ga0495684_0028470 | 3300047471 | Bacteria | 4289 |
| 1112 | Ga0495684_0209979 | 3300047471 | Bacteria | 1432 |
| 1113 | Ga0495686_0054410 | 3300047472 | Bacteria | 2506 |
| 1114 | Ga0495593_0010641 | 3300047673 | Bacteria | 5307 |
| 1115 | Ga0495593_0046721 | 3300047673 | Bacteria | 2306 |
| 1116 | Ga0495593_0069168 | 3300047673 | Bacteria | 1836 |
| 1117 | Ga0495593_0073062 | 3300047673 | Bacteria | 1779 |
| 1118 | Ga0495602_0022719 | 3300048088 | Bacteria | 6133 |
| 1119 | Ga0495602_0026583 | 3300048088 | Bacteria | 5579 |
| 1120 | Ga0495602_0044060 | 3300048088 | Bacteria | 4050 |
| 1121 | Ga0495602_0099247 | 3300048088 | Bacteria | 2394 |
| 1122 | Ga0495602_0131686 | 3300048088 | Bacteria | 1993 |
| 1123 | Ga0495614_0001215 | 3300048089 | Bacteria | 11093 |
| 1124 | Ga0495614_0001410 | 3300048089 | Bacteria | 10382 |
| 1125 | Ga0495614_0012972 | 3300048089 | Bacteria | 3653 |
| 1126 | Ga0495615_0065408 | 3300048090 | Bacteria | 969 |
| 1127 | Ga0495626_0000177 | 3300048091 | Bacteria | 78474 |
| 1128 | Ga0496100_0000911 | 3300048903 | Bacteria | 14095 |
| 1129 | Ga0496100_0032814 | 3300048903 | Bacteria | 3242 |
| 1130 | Ga0496100_0037132 | 3300048903 | Bacteria | 3077 |
| 1131 | Ga0496101_0021719 | 3300048904 | Bacteria | 4411 |
| 1132 | Ga0496101_0095054 | 3300048904 | Bacteria | 2222 |
| 1133 | Ga0496101_0097715 | 3300048904 | Bacteria | 2193 |
| 1134 | Ga0496101_0754977 | 3300048904 | Bacteria | 767 |
| 1135 | Ga0496102_0012786 | 3300048905 | Bacteria | 7266 |
| 1136 | Ga0496102_0034680 | 3300048905 | Bacteria | 4540 |
| 1137 | Ga0496102_0059283 | 3300048905 | Bacteria | 3500 |
| 1138 | Ga0496102_0099802 | 3300048905 | Bacteria | 2695 |
| 1139 | Ga0496102_0112755 | 3300048905 | Bacteria | 2536 |
| 1140 | Ga0496102_0130519 | 3300048905 | Bacteria | 2351 |
| 1141 | Ga0496102_0195435 | 3300048905 | Bacteria | 1906 |
| 1142 | Ga0496102_0271262 | 3300048905 | Bacteria | 1600 |
| 1143 | Ga0496102_0540822 | 3300048905 | Bacteria | 1087 |
| 1144 | Ga0496103_0019771 | 3300048906 | Bacteria | 4042 |
| 1145 | Ga0496103_0028986 | 3300048906 | Bacteria | 3362 |
| 1146 | Ga0496104_0025879 | 3300048907 | Bacteria | 5411 |
| 1147 | Ga0496104_0166288 | 3300048907 | Bacteria | 2115 |
| 1148 | Ga0496104_0175927 | 3300048907 | Bacteria | 2051 |
| 1149 | Ga0496105_0009336 | 3300048908 | Bacteria | 7667 |
| 1150 | Ga0496105_0188794 | 3300048908 | Bacteria | 1686 |
| 1151 | Ga0496106_0008239 | 3300048909 | Bacteria | 7707 |
| 1152 | Ga0496106_0090571 | 3300048909 | Bacteria | 2360 |
| 1153 | Ga0496106_0146457 | 3300048909 | Bacteria | 1860 |
| 1154 | Ga0496106_0498409 | 3300048909 | Bacteria | 978 |
| 1155 | Ga0496106_0780748 | 3300048909 | Bacteria | 758 |
| 1156 | Ga0496107_0000205 | 3300048910 | Bacteria | 31113 |
| 1157 | Ga0496107_0116646 | 3300048910 | Bacteria | 1966 |
| 1158 | Ga0496107_0258969 | 3300048910 | Bacteria | 1294 |
| 1159 | Ga0496108_0020456 | 3300048911 | Bacteria | 5441 |
| 1160 | Ga0496108_0036973 | 3300048911 | Bacteria | 4065 |
| 1161 | Ga0496108_0045557 | 3300048911 | Bacteria | 3663 |
| 1162 | Ga0496108_0102213 | 3300048911 | Bacteria | 2445 |
| 1163 | Ga0496108_0105750 | 3300048911 | Bacteria | 2403 |
| 1164 | Ga0496108_0109179 | 3300048911 | Bacteria | 2364 |
| 1165 | Ga0496108_0190844 | 3300048911 | Bacteria | 1776 |
| 1166 | Ga0496108_0229661 | 3300048911 | Bacteria | 1613 |
| 1167 | Ga0496108_0250700 | 3300048911 | Bacteria | 1540 |
| 1168 | Ga0496108_0667730 | 3300048911 | Bacteria | 903 |
| 1169 | Ga0496109_0009721 | 3300048912 | Bacteria | 8210 |
| 1170 | Ga0496109_0022836 | 3300048912 | Bacteria | 5544 |
| 1171 | Ga0496109_0054007 | 3300048912 | Bacteria | 3666 |
| 1172 | Ga0496109_0079929 | 3300048912 | Bacteria | 3012 |
| 1173 | Ga0496109_0117934 | 3300048912 | Bacteria | 2471 |
| 1174 | Ga0496109_0220563 | 3300048912 | Bacteria | 1783 |
| 1175 | Ga0496109_0339284 | 3300048912 | Bacteria | 1419 |
| 1176 | Ga0496110_0005126 | 3300048913 | Bacteria | 10235 |
| 1177 | Ga0496110_0016932 | 3300048913 | Bacteria | 6092 |
| 1178 | Ga0496110_0039744 | 3300048913 | Bacteria | 4097 |
| 1179 | Ga0496110_0119347 | 3300048913 | Bacteria | 2375 |
| 1180 | Ga0496110_0174061 | 3300048913 | Bacteria | 1953 |
| 1181 | Ga0496110_0751103 | 3300048913 | Bacteria | 879 |
| 1182 | Ga0496111_0005349 | 3300048914 | Bacteria | 8206 |
| 1183 | Ga0496111_0008961 | 3300048914 | Bacteria | 6655 |
| 1184 | Ga0496111_0024928 | 3300048914 | Bacteria | 4218 |
| 1185 | Ga0496111_0204936 | 3300048914 | Bacteria | 1466 |
| 1186 | Ga0496112_0007219 | 3300048915 | Bacteria | 9848 |
| 1187 | Ga0496112_0008964 | 3300048915 | Bacteria | 8980 |
| 1188 | Ga0496112_0035680 | 3300048915 | Bacteria | 4846 |
| 1189 | Ga0496112_0127537 | 3300048915 | Bacteria | 2515 |
| 1190 | Ga0496112_0190570 | 3300048915 | Bacteria | 2012 |
| 1191 | Ga0496112_0268406 | 3300048915 | Bacteria | 1655 |
| 1192 | Ga0496112_0599808 | 3300048915 | Bacteria | 1033 |
| 1193 | Ga0496112_0695523 | 3300048915 | Bacteria | 945 |
| 1194 | Ga0496112_1238467 | 3300048915 | Bacteria | 662 |
| 1195 | Ga0496113_0041026 | 3300048916 | Bacteria | 3413 |
| 1196 | Ga0496113_0077598 | 3300048916 | Bacteria | 2540 |
| 1197 | Ga0496113_0384940 | 3300048916 | Bacteria | 1126 |
| 1198 | Ga0496113_0993707 | 3300048916 | Bacteria | 661 |
| 1199 | Ga0496114_0014248 | 3300048917 | Bacteria | 6379 |
| 1200 | Ga0496114_0019637 | 3300048917 | Bacteria | 5476 |
| 1201 | Ga0496114_0038080 | 3300048917 | Bacteria | 3978 |
| 1202 | Ga0496114_0067983 | 3300048917 | Bacteria | 2990 |
| 1203 | Ga0496114_0094465 | 3300048917 | Bacteria | 2543 |
| 1204 | Ga0496114_0101740 | 3300048917 | Bacteria | 2454 |
| 1205 | Ga0496114_0263634 | 3300048917 | Bacteria | 1517 |
| 1206 | Ga0496114_0365143 | 3300048917 | Bacteria | 1277 |
| 1207 | Ga0496115_0065507 | 3300048918 | Bacteria | 2934 |
| 1208 | Ga0496115_0111067 | 3300048918 | Bacteria | 2252 |
| 1209 | Ga0496115_0132050 | 3300048918 | Bacteria | 2058 |
| 1210 | Ga0496115_0404174 | 3300048918 | Bacteria | 1108 |
| 1211 | Ga0496115_0721576 | 3300048918 | Bacteria | 782 |
| 1212 | Ga0496119_0267752 | 3300048922 | Bacteria | 855 |
| 1213 | Ga0496120_0082987 | 3300048923 | Bacteria | 1731 |
| 1214 | Ga0496126_0106242 | 3300048929 | Bacteria | 2450 |
| 1215 | Ga0501031_0016903 | 3300049568 | Bacteria | 4738 |
| 1216 | Ga0501031_0051763 | 3300049568 | Bacteria | 2675 |
| 1217 | Ga0501031_0071567 | 3300049568 | Bacteria | 2258 |
| 1218 | Ga0501031_0340162 | 3300049568 | Bacteria | 971 |
| 1219 | Ga0501032_0001454 | 3300049569 | Bacteria | 18832 |
| 1220 | Ga0501032_0003154 | 3300049569 | Bacteria | 12681 |
| 1221 | Ga0501032_0018618 | 3300049569 | Bacteria | 4862 |
| 1222 | Ga0501032_0030901 | 3300049569 | Bacteria | 3673 |
| 1223 | Ga0501032_0038818 | 3300049569 | Bacteria | 3241 |
| 1224 | Ga0501032_0050784 | 3300049569 | Bacteria | 2796 |
| 1225 | Ga0501033_0002947 | 3300049570 | Bacteria | 14227 |
| 1226 | Ga0501033_0006990 | 3300049570 | Bacteria | 8810 |
| 1227 | Ga0501033_0124785 | 3300049570 | Bacteria | 1867 |
| 1228 | Ga0501033_0136061 | 3300049570 | Bacteria | 1778 |
| 1229 | Ga0501033_0177558 | 3300049570 | Bacteria | 1527 |
| 1230 | Ga0501033_0211614 | 3300049570 | Bacteria | 1382 |
| 1231 | Ga0501034_0000016 | 3300049571 | Bacteria | 289751 |
| 1232 | Ga0501034_0004314 | 3300049571 | Bacteria | 15852 |
| 1233 | Ga0501034_0021654 | 3300049571 | Bacteria | 6548 |
| 1234 | Ga0501034_0028851 | 3300049571 | Bacteria | 5644 |
| 1235 | Ga0501034_0041128 | 3300049571 | Bacteria | 4676 |
| 1236 | Ga0501034_0214443 | 3300049571 | Bacteria | 1879 |
| 1237 | Ga0501036_0005059 | 3300049572 | Bacteria | 10673 |
| 1238 | Ga0501036_0017602 | 3300049572 | Bacteria | 5977 |
| 1239 | Ga0501036_0052565 | 3300049572 | Bacteria | 3450 |
| 1240 | Ga0501036_0110905 | 3300049572 | Bacteria | 2318 |
| 1241 | Ga0501036_0162704 | 3300049572 | Bacteria | 1881 |
| 1242 | Ga0501037_0007139 | 3300049573 | Bacteria | 8165 |
| 1243 | Ga0501037_0007493 | 3300049573 | Bacteria | 7987 |
| 1244 | Ga0501037_0026503 | 3300049573 | Bacteria | 4285 |
| 1245 | Ga0501037_0071906 | 3300049573 | Bacteria | 2516 |
| 1246 | Ga0501037_0715483 | 3300049573 | Bacteria | 665 |
| 1247 | Ga0501038_0001253 | 3300049574 | Bacteria | 23031 |
| 1248 | Ga0501038_0002908 | 3300049574 | Bacteria | 15965 |
| 1249 | Ga0501038_0010618 | 3300049574 | Bacteria | 8418 |
| 1250 | Ga0501038_0095809 | 3300049574 | Bacteria | 2478 |
| 1251 | Ga0501038_0171721 | 3300049574 | Bacteria | 1754 |
| 1252 | Ga0501038_0367635 | 3300049574 | Bacteria | 1118 |
| 1253 | Ga0501038_0406827 | 3300049574 | Bacteria | 1052 |
| 1254 | Ga0501039_0065480 | 3300049575 | Bacteria | 2819 |
| 1255 | Ga0501039_0313513 | 3300049575 | Bacteria | 1233 |
| 1256 | Ga0501040_0031903 | 3300049576 | Bacteria | 3562 |
| 1257 | Ga0501041_0419939 | 3300049577 | Bacteria | 848 |
| 1258 | Ga0501042_0005568 | 3300049578 | Bacteria | 8120 |
| 1259 | Ga0501042_0024723 | 3300049578 | Bacteria | 4214 |
| 1260 | Ga0501042_0334147 | 3300049578 | Bacteria | 1095 |
| 1261 | Ga0501043_0002314 | 3300049579 | Bacteria | 16128 |
| 1262 | Ga0501043_0008272 | 3300049579 | Bacteria | 8195 |
| 1263 | Ga0501043_0016636 | 3300049579 | Bacteria | 5765 |
| 1264 | Ga0501043_0017277 | 3300049579 | Bacteria | 5660 |
| 1265 | Ga0501043_0062835 | 3300049579 | Bacteria | 2916 |
| 1266 | Ga0501043_0268737 | 3300049579 | Bacteria | 1309 |
| 1267 | Ga0501046_0061563 | 3300049580 | Bacteria | 2933 |
| 1268 | Ga0501046_0063234 | 3300049580 | Bacteria | 2890 |
| 1269 | Ga0501046_0356910 | 3300049580 | Bacteria | 1060 |
| 1270 | Ga0501047_0009383 | 3300049581 | Bacteria | 9243 |
| 1271 | Ga0501047_0088241 | 3300049581 | Bacteria | 2978 |
| 1272 | Ga0501047_0139487 | 3300049581 | Bacteria | 2303 |
| 1273 | Ga0501047_0142513 | 3300049581 | Bacteria | 2274 |
| 1274 | Ga0501047_0152011 | 3300049581 | Bacteria | 2190 |
| 1275 | Ga0501047_0272187 | 3300049581 | Bacteria | 1540 |
| 1276 | Ga0501047_0282064 | 3300049581 | Bacteria | 1506 |
| 1277 | Ga0501047_0377416 | 3300049581 | Bacteria | 1252 |
| 1278 | Ga0501048_0001305 | 3300049582 | Bacteria | 18906 |
| 1279 | Ga0501048_0401236 | 3300049582 | Bacteria | 980 |
| 1280 | Ga0501067_0050506 | 3300049583 | Bacteria | 2304 |
| 1281 | Ga0501068_0020806 | 3300049584 | Bacteria | 3828 |
| 1282 | Ga0501069_0057695 | 3300049585 | Bacteria | 2165 |
| 1283 | Ga0501070_0016103 | 3300049586 | Bacteria | 6284 |
| 1284 | Ga0501070_0052102 | 3300049586 | Bacteria | 3397 |
| 1285 | Ga0501070_0156698 | 3300049586 | Bacteria | 1878 |
| 1286 | Ga0501070_0201695 | 3300049586 | Bacteria | 1633 |
| 1287 | Ga0501070_0292436 | 3300049586 | Bacteria | 1328 |
| 1288 | Ga0501071_0047389 | 3300049587 | Bacteria | 3087 |
| 1289 | Ga0501071_0265975 | 3300049587 | Bacteria | 1296 |
| 1290 | Ga0501072_0010688 | 3300049588 | Bacteria | 6990 |
| 1291 | Ga0501072_0676157 | 3300049588 | Bacteria | 812 |
| 1292 | Ga0501073_0079767 | 3300049589 | Bacteria | 2278 |
| 1293 | Ga0501073_0105234 | 3300049589 | Bacteria | 1958 |
| 1294 | Ga0501074_0002571 | 3300049590 | Bacteria | 12670 |
| 1295 | Ga0501074_0068836 | 3300049590 | Bacteria | 2544 |
| 1296 | Ga0501076_0039284 | 3300049592 | Bacteria | 3716 |
| 1297 | Ga0501077_0098383 | 3300049593 | Bacteria | 1854 |
| 1298 | Ga0501079_0234851 | 3300049741 | Bacteria | 1432 |
| 1299 | Ga0501080_0336893 | 3300049742 | Bacteria | 1363 |
| 1300 | Ga0501080_0613978 | 3300049742 | Bacteria | 964 |
| 1301 | Ga0501083_0016959 | 3300049744 | Bacteria | 5086 |
| 1302 | Ga0501083_0091404 | 3300049744 | Bacteria | 2009 |
| 1303 | Ga0501035_0002181 | 3300049822 | Bacteria | 19420 |
| 1304 | Ga0501035_0002597 | 3300049822 | Bacteria | 17635 |
| 1305 | Ga0501035_0007069 | 3300049822 | Bacteria | 10492 |
| 1306 | Ga0501035_0029299 | 3300049822 | Bacteria | 5020 |
| 1307 | Ga0501035_0030189 | 3300049822 | Bacteria | 4942 |
| 1308 | Ga0501035_0038568 | 3300049822 | Bacteria | 4325 |
| 1309 | Ga0501035_0157119 | 3300049822 | Bacteria | 1970 |
| 1310 | Ga0501044_0001412 | 3300049823 | Bacteria | 28169 |
| 1311 | Ga0501044_0004634 | 3300049823 | Bacteria | 15394 |
| 1312 | Ga0501044_0007364 | 3300049823 | Bacteria | 12101 |
| 1313 | Ga0501044_0025701 | 3300049823 | Bacteria | 6242 |
| 1314 | Ga0501044_0058708 | 3300049823 | Bacteria | 3944 |
| 1315 | Ga0501044_0073541 | 3300049823 | Bacteria | 3474 |
| 1316 | Ga0501044_0108568 | 3300049823 | Bacteria | 2785 |
| 1317 | Ga0501044_0422714 | 3300049823 | Bacteria | 1242 |
| 1318 | Ga0501045_0290429 | 3300049824 | Bacteria | 1217 |
| 1319 | nmdc:mga03683_118753_c1 | 3300050489 | Bacteria | 1174 |
| 1320 | nmdc:mga03n38_12344_c1 | 3300050490 | Bacteria | 3212 |
| 1321 | nmdc:mga03n38_282032_c1 | 3300050490 | Bacteria | 887 |
| 1322 | nmdc:mga00v17_279831_c1 | 3300050491 | Bacteria | 1083 |
| 1323 | nmdc:mga0yw44_184776_c1 | 3300050492 | Bacteria | 1373 |
| 1324 | nmdc:mga0yw44_222155_c1 | 3300050492 | Bacteria | 1252 |
| 1325 | nmdc:mga06z11_19685_c1 | 3300050494 | Bacteria | 3108 |
| 1326 | nmdc:mga06z11_630545_c1 | 3300050494 | Bacteria | 652 |
| 1327 | nmdc:mga04h51_1787_c1 | 3300050495 | Bacteria | 5031 |
| 1328 | nmdc:mga07m45_45972_c1 | 3300050496 | Bacteria | 2451 |
| 1329 | nmdc:mga07m45_93181_c1 | 3300050496 | Bacteria | 1727 |
| 1330 | nmdc:mga05p37_1009026_c1 | 3300050507 | Bacteria | 883 |
| 1331 | nmdc:mga09592_488415_c1 | 3300050508 | Bacteria | 1061 |
| 1332 | nmdc:mga0n895_232567_c1 | 3300050512 | Bacteria | 1871 |
| 1333 | nmdc:mga0rr50_819579_c1 | 3300050513 | Bacteria | 794 |
| 1334 | Ga0495601_0018173 | 3300053077 | Bacteria | 4276 |
| 1335 | Ga0495601_0018368 | 3300053077 | Bacteria | 4255 |
| 1336 | Ga0495612_0042562 | 3300053078 | Bacteria | 1854 |
| 1337 | Ga0500610_0101202 | 3300053079 | Bacteria | 1491 |
| 1338 | Ga0495595_0013512 | 3300053084 | Bacteria | 3450 |
| 1339 | Ga0495619_0074515 | 3300053085 | Bacteria | 2276 |
| 1340 | Ga0495619_0317097 | 3300053085 | Bacteria | 1079 |
| 1341 | Ga0500578_0022512 | 3300053086 | Bacteria | 4046 |
| 1342 | Ga0500646_0036317 | 3300053090 | Bacteria | 1372 |
| 1343 | Ga0500583_0284352 | 3300053092 | Bacteria | 812 |
| 1344 | Ga0500651_0033941 | 3300053093 | Bacteria | 3217 |
| 1345 | Ga0500566_0057348 | 3300053094 | Bacteria | 2212 |
| 1346 | Ga0500641_0056734 | 3300053096 | Bacteria | 1623 |
| 1347 | Ga0500650_0047308 | 3300053098 | Bacteria | 1994 |
| 1348 | Ga0500654_064084 | 3300053099 | Bacteria | 1853 |
| 1349 | Ga0500553_171286 | 3300053101 | Bacteria | 797 |
| 1350 | Ga0500560_000672 | 3300053107 | Bacteria | 5063 |
| 1351 | Ga0500560_121181 | 3300053107 | Bacteria | 877 |
| 1352 | Ga0500569_001048 | 3300053109 | Bacteria | 5028 |
| 1353 | Ga0500628_001995 | 3300053129 | Bacteria | 3429 |
| 1354 | Ga0500652_002797 | 3300053131 | Bacteria | 5268 |
| 1355 | Ga0500655_019641 | 3300053133 | Bacteria | 1259 |
| 1356 | Ga0500658_0048578 | 3300053134 | Bacteria | 1725 |
| 1357 | Ga0500559_0010867 | 3300053136 | Bacteria | 3902 |
| 1358 | Ga0500561_0001401 | 3300053137 | Bacteria | 3924 |
| 1359 | Ga0500573_0065384 | 3300053140 | Bacteria | 2079 |
| 1360 | Ga0500573_0090678 | 3300053140 | Bacteria | 1727 |
| 1361 | Ga0500577_0110128 | 3300053142 | Bacteria | 1135 |
| 1362 | Ga0500579_080724 | 3300053143 | Bacteria | 1820 |
| 1363 | Ga0500579_128243 | 3300053143 | Bacteria | 1198 |
| 1364 | Ga0500600_0032396 | 3300053149 | Bacteria | 3062 |
| 1365 | Ga0500600_0167422 | 3300053149 | Bacteria | 1073 |
| 1366 | Ga0500616_0000636 | 3300053153 | Bacteria | 42399 |
| 1367 | Ga0500616_0004879 | 3300053153 | Bacteria | 9339 |
| 1368 | Ga0500633_0000859 | 3300053160 | Bacteria | 5265 |
| 1369 | Ga0500634_0038614 | 3300053161 | Bacteria | 2595 |
| 1370 | Ga0500634_0187570 | 3300053161 | Bacteria | 923 |
| 1371 | Ga0500656_007510 | 3300053732 | Bacteria | 1135 |
| 1372 | Ga0500587_006152 | 3300053739 | Bacteria | 1600 |
| 1373 | Ga0501084_0007644 | 3300054114 | Bacteria | 8911 |
| 1374 | Ga0587077_029969 | 3300059493 | Bacteria | 1030 |
| 1375 | Ga0587072_032312 | 3300059643 | Bacteria | 983 |
| 1376 | Ga0501082_0008555 | 3300060353 | Bacteria | 8827 |
| 1377 | Ga0501082_0016216 | 3300060353 | Bacteria | 6413 |
| 1378 | Ga0466962_0003282 | 3300061719 | Bacteria | 7684 |
| 1379 | Ga0466962_0064678 | 3300061719 | Bacteria | 1746 |
| 1380 | Ga0466962_0210027 | 3300061719 | Bacteria | 952 |
| 1381 | 2501940727 | 2501939600 | Bacteria | 6907073 |
| 1382 | 2515497550 | 2515154088 | Bacteria | 5526283 |
| 1383 | 2515757290 | 2515154137 | Bacteria | 5711575 |
| 1384 | 2516088761 | 2515154203 | Bacteria | 5458536 |
| 1385 | 2537900994 | 2537561592 | Bacteria | 4348607 |
| 1386 | 2547405475 | 2547132111 | Bacteria | 8013147 |
| 1387 | 2554261272 | 2554235005 | Bacteria | 6457341 |
| 1388 | 2558907664 | 2558860112 | Bacteria | 9931328 |
| 1389 | 2559425202 | 2558860280 | Bacteria | 11429938 |
| 1390 | 2566996278 | 2565956761 | Bacteria | 6601618 |
| 1391 | 2585311575 | 2582581313 | Bacteria | 10042643 |
| 1392 | 2585313866 | 2582581314 | Bacteria | 11452267 |
| 1393 | 2586063335 | 2585427649 | Bacteria | 9053857 |
| 1394 | 2616902984 | 2616644941 | Bacteria | 8510691 |
| 1395 | 2623588786 | 2622736626 | Bacteria | 7181580 |
| 1396 | 2643760684 | 2643221548 | Bacteria | 8053412 |
| 1397 | 2643900870 | 2643221578 | Bacteria | 9213798 |
| 1398 | 2643946260 | 2643221587 | Bacteria | 7586415 |
| 1399 | 2644018134 | 2643221601 | Bacteria | 7493239 |
| 1400 | 2644083397 | 2643221613 | Bacteria | 4622396 |
| 1401 | 2644177339 | 2643221631 | Bacteria | 8168043 |
| 1402 | 2644266344 | 2643221647 | Bacteria | 10741251 |
| 1403 | 2644388031 | 2643221670 | Bacteria | 6497041 |
| 1404 | 2644407017 | 2643221673 | Bacteria | 9196637 |
| 1405 | 2644433049 | 2643221677 | Bacteria | 7584031 |
| 1406 | 2644441032 | 2643221678 | Bacteria | 9540101 |
| 1407 | 2644523993 | 2643221694 | Bacteria | 4392972 |
| 1408 | 2644630416 | 2643221714 | Bacteria | 9015452 |
| 1409 | 2644666318 | 2643221721 | Bacteria | 4486924 |
| 1410 | 2644668090 | 2643221722 | Bacteria | 4247614 |
| 1411 | 2691513777 | 2690315906 | Bacteria | 4517044 |
| 1412 | 2729907936 | 2728369276 | Bacteria | 5610032 |
| 1413 | 2738890634 | 2738541308 | Bacteria | 7020677 |
| 1414 | 2775658065 | 2775506735 | Bacteria | 4556596 |
| 1415 | 2784585931 | 2784132148 | Bacteria | 8627943 |
| 1416 | 2785339137 | 2784746763 | Bacteria | 9783172 |
| 1417 | 2785366081 | 2784746768 | Bacteria | 10036182 |
| 1418 | 2786667069 | 2786546132 | Bacteria | 10419719 |
| 1419 | 2795783039 | 2795385470 | Bacteria | 8317180 |
| 1420 | 2795797120 | 2795385472 | Bacteria | 6627535 |
| 1421 | 2808831055 | 2808606357 | Bacteria | 4466944 |
| 1422 | 2808846706 | 2808606359 | Bacteria | 9866990 |
| 1423 | 2808852317 | 2808606360 | Bacteria | 4404006 |
| 1424 | 2808879400 | 2808606366 | Bacteria | 4415912 |
| 1425 | 2808891103 | 2808606370 | Bacteria | 4942454 |
| 1426 | 2808896364 | 2808606371 | Bacteria | 4251511 |
| 1427 | 2808917330 | 2808606375 | Bacteria | 9466072 |
| 1428 | 2809229433 | 2808606448 | Bacteria | 8656184 |
| 1429 | 2811846283 | 2808606982 | Bacteria | 7791042 |
| 1430 | 2812321253 | 2811994871 | Bacteria | 4497550 |
| 1431 | 2812361678 | 2811994879 | Bacteria | 9313447 |
| 1432 | 2812477115 | 2811994917 | Bacteria | 7761064 |
| 1433 | 2816422962 | 2816332119 | Bacteria | 8120218 |
| 1434 | 2816511118 | 2816332139 | Bacteria | 9138787 |
| 1435 | 2819695723 | 2818991463 | Bacteria | 7948711 |
| 1436 | 2819747346 | 2818991472 | Bacteria | 10089953 |
| 1437 | 2831935698 | 2831935698 | Bacteria | 5963223 |
| 1438 | 2844852650 | 2844849076 | Bacteria | 4091819 |
| 1439 | 2852643204 | 2852635781 | Bacteria | 8251373 |
| 1440 | 2856863040 | 2856858025 | Bacteria | 7255264 |
| 1441 | 2857742200 | 2857740372 | Bacteria | 4782044 |
| 1442 | 2858907267 | 2858902515 | Bacteria | 7086037 |
| 1443 | 2862180816 | 2862178590 | Bacteria | 8583590 |
| 1444 | 2862282256 | 2862281513 | Bacteria | 9621493 |
| 1445 | 2862389754 | 2862382967 | Bacteria | 10317375 |
| 1446 | 2862512618 | 2862507626 | Bacteria | 9425308 |
| 1447 | 2862574705 | 2862574272 | Bacteria | 10567477 |
| 1448 | 2862710197 | 2862705112 | Bacteria | 6563286 |
| 1449 | 2863075392 | 2863067949 | Bacteria | 8541735 |
| 1450 | 2863410784 | 2863404153 | Bacteria | 9672205 |
| 1451 | 2867371808 | 2867369537 | Bacteria | 6501581 |
| 1452 | 2867435303 | 2867428634 | Bacteria | 9590268 |
| 1453 | 2867475885 | 2867475112 | Bacteria | 6909112 |
| 1454 | 2867511418 | 2867507094 | Bacteria | 6506033 |
| 1455 | 2870785023 | 2870782633 | Bacteria | 9624083 |
| 1456 | 2873158307 | 2873151551 | Bacteria | 8625867 |
| 1457 | 2875398415 | 2875391855 | Bacteria | 7600475 |
| 1458 | 2877684419 | 2877676314 | Bacteria | 9512378 |
| 1459 | 2883824529 | 2883821847 | Bacteria | 5121194 |
| 1460 | 2884997325 | 2884994152 | Bacteria | 4492978 |
| 1461 | 2887479704 | 2887478801 | Bacteria | 8972725 |
| 1462 | 2899362727 | 2899359706 | Bacteria | 10940472 |
| 1463 | 2899376475 | 2899370129 | Bacteria | 6781179 |
| 1464 | 2902583275 | 2902582711 | Bacteria | 6187705 |
| 1465 | 2904498314 | 2904497146 | Bacteria | 4731781 |
| 1466 | 2904540916 | 2904535858 | Bacteria | 6308016 |
| 1467 | 2904777674 | 2904776348 | Bacteria | 4658726 |
| 1468 | 2910812021 | 2910809715 | Bacteria | 4982797 |
| 1469 | 2912723780 | 2912715099 | Bacteria | 9460473 |
| 1470 | 2912726888 | 2912723979 | Bacteria | 8557534 |
| 1471 | 2912758147 | 2912757875 | Bacteria | 7940295 |
| 1472 | 2918507459 | 2918501144 | Bacteria | 8668083 |
| 1473 | 2919035046 | 2919034639 | Bacteria | 4763403 |
| 1474 | 2919059871 | 2919059106 | Bacteria | 4991624 |
| 1475 | 2919395589 | 2919391150 | Bacteria | 4884741 |
| 1476 | 2919468844 | 2919468124 | Bacteria | 9133025 |
| 1477 | 2919540503 | 2919538618 | Bacteria | 4677069 |
| 1478 | 2922555008 | 2922554459 | Bacteria | 6683962 |
| 1479 | 2932428357 | 2932426870 | Bacteria | 4547726 |
| 1480 | 2933422459 | 2933418574 | Bacteria | 4476724 |
| 1481 | 2935891088 | 2935890801 | Bacteria | 4593001 |
| 1482 | 2939601386 | 2939598168 | Bacteria | 4687164 |
| 1483 | 2939648760 | 2939647034 | Bacteria | 4681660 |
| 1484 | 2939675185 | 2939674588 | Bacteria | 4844420 |
| 1485 | 2945920589 | 2945920336 | Bacteria | 4501603 |
| 1486 | 2945943186 | 2945941187 | Bacteria | 4682474 |
| 1487 | 2945959023 | 2945956166 | Bacteria | 5110334 |
| 1488 | 2946025928 | 2946024296 | Bacteria | 3508095 |
| 1489 | 2946039101 | 2946037020 | Bacteria | 4900426 |
| 1490 | 2946045779 | 2946045630 | Bacteria | 8527308 |
| 1491 | 2946062862 | 2946059875 | Bacteria | 4386623 |
| 1492 | 2946064487 | 2946064051 | Bacteria | 8957905 |
| 1493 | 2946072916 | 2946072368 | Bacteria | 8999607 |
| 1494 | 2947224433 | 2947224130 | Bacteria | 9938529 |
| 1495 | 2954000488 | 2953998280 | Bacteria | 4812144 |
| 1496 | 2954009082 | 2954002825 | Bacteria | 9173742 |
| 1497 | 2954390031 | 2954380949 | Bacteria | 10050426 |
| 1498 | 2954682153 | 2954673503 | Bacteria | 9685905 |
| 1499 | 2954690771 | 2954682443 | Bacteria | 9862841 |
| 1500 | 2954700620 | 2954691527 | Bacteria | 10720516 |
| 1501 | 2954701609 | 2954701450 | Bacteria | 10834262 |
| 1502 | 2954719270 | 2954711539 | Bacteria | 10867210 |
| 1503 | 2954729242 | 2954721474 | Bacteria | 10456478 |
| 1504 | 2954732568 | 2954731030 | Bacteria | 10243860 |
| 1505 | 2954748142 | 2954740390 | Bacteria | 10229294 |
| 1506 | 2954751447 | 2954749733 | Bacteria | 10366972 |
| 1507 | 2954767265 | 2954759201 | Bacteria | 9358192 |
| 1508 | 2966599014 | 2966598605 | Bacteria | 7676064 |
| 1509 | 2974302890 | 2974302888 | Bacteria | 4369871 |
| 1510 | 2990045399 | 2990044586 | Bacteria | 6603797 |
| 1511 | 2990066890 | 2990059506 | Bacteria | 9321252 |
| 1512 | 2990093467 | 2990088156 | Bacteria | 6657676 |
| 1513 | 2995465621 | 2995463766 | Bacteria | 8577691 |
| 1514 | 2996228284 | 2996221748 | Bacteria | 6799777 |
| 1515 | 2997452412 | 2997451912 | Bacteria | 8492419 |
| 1516 | 3006326537 | 3006321560 | Bacteria | 8247479 |
| 1517 | 3006396587 | 3006393351 | Bacteria | 6615579 |
| 1518 | 3006490757 | 3006486233 | Bacteria | 8157040 |
| 1519 | 3006494051 | 3006493962 | Bacteria | 8825450 |
| 1520 | 649815187 | 649633069 | Bacteria | 6962533 |
| 1521 | 8004024712 | 8004021418 | Bacteria | 4313954 |
| 1522 | 8004028319 | 8004025490 | Bacteria | 4327753 |
| 1523 | 8008486870 | 8008485437 | Bacteria | 7198341 |
| 1524 | 8008564834 | 8008558824 | Bacteria | 10610750 |
| 1525 | 8008581520 | 8008574985 | Bacteria | 7815457 |
| 1526 | 8023624877 | 8023623736 | Bacteria | 8593882 |
| 1527 | 8025526127 | 8025524527 | Bacteria | 7197316 |
| 1528 | 8025537224 | 8025530807 | Bacteria | 8495698 |
| 1529 | 8047894486 | 8047893842 | Bacteria | 11723082 |
| 1530 | 8048364566 | 8048356638 | Bacteria | 11044339 |
| 1531 | 8048371503 | 8048369669 | Bacteria | 11666822 |
| 1532 | 8048380437 | 8048379754 | Bacteria | 11877923 |
| 1533 | 8048407554 | 8048406513 | Bacteria | 8936924 |
| 1534 | 8054110061 | 8054107350 | Bacteria | 5022511 |
| 1535 | 8054165511 | 8054160619 | Bacteria | 7783213 |
| 1536 | 8056214155 | 8056207758 | Bacteria | 8639239 |
| 1537 | 8056830523 | 8056829672 | Bacteria | 9045328 |
| 1538 | Ga0495651_0005180 | |||
| 1539 | LJQas_1000535 | |||
| 1540 | LJQas_1002191 | |||
| 1541 | JGI24747J21853_1009459 | |||
| 1542 | JGI24740J21852_10041884 | |||
| 1543 | JGI24739J22299_10048222 | |||
| 1544 | JGI24738J21930_10029325 | |||
| 1545 | JGI25152J39213_1000124 | |||
| 1546 | rootH1_10013192 | |||
| 1547 | rootH1_10112119 | |||
| 1548 | rootH2_10005306 | |||
| 1549 | rootH2_10036987 | |||
| 1550 | rootL2_10002055 | |||
| 1551 | rootH1_10088740 | |||
| 1552 | JGI25160J50197_1017012 | |||
| 1553 | JGI25160J50197_1026859 | |||
| 1554 | JGI25160J50197_1033597 | |||
| 1555 | JGI25160J50197_1048716 | |||
| 1556 | Ga0055542_1018106 | |||
| 1557 | Ga0065714_10116297 | |||
| 1558 | Ga0070676_10072757 | |||
| 1559 | Ga0070683_100073511 | |||
| 1560 | Ga0070690_100084707 | |||
| 1561 | Ga0070670_100225957 | |||
| 1562 | Ga0068869_100442107 | |||
| 1563 | Ga0070666_10064382 | |||
| 1564 | Ga0070666_10174208 | |||
| 1565 | Ga0070682_100060004 | |||
| 1566 | Ga0070682_100257041 | |||
| 1567 | Ga0068868_100317012 | |||
| 1568 | Ga0068868_100666654 | |||
| 1569 | Ga0070660_100069941 | |||
| 1570 | Ga0070689_100749988 | |||
| 1571 | Ga0070691_10239118 | |||
| 1572 | Ga0070661_100128843 | |||
| 1573 | Ga0070692_10110429 | |||
| 1574 | Ga0070668_100477793 | |||
| 1575 | Ga0070668_100623168 | |||
| 1576 | Ga0070675_100012367 | |||
| 1577 | Ga0070675_100051392 | |||
| 1578 | Ga0070671_100024680 | |||
| 1579 | Ga0070671_100255122 | |||
| 1580 | Ga0070673_100417417 | |||
| 1581 | Ga0070688_100090767 | |||
| 1582 | Ga0070659_100582495 | |||
| 1583 | Ga0070659_100742238 | |||
| 1584 | Ga0070659_100821582 | |||
| 1585 | Ga0070703_10011369 | |||
| 1586 | Ga0070709_10002968 | |||
| 1587 | Ga0070709_10064220 | |||
| 1588 | Ga0070709_10094386 | |||
| 1589 | Ga0070709_10301508 | |||
| 1590 | Ga0070709_10491591 | |||
| 1591 | Ga0070709_10677397 | |||
| 1592 | Ga0070714_100005159 | |||
| 1593 | Ga0070714_100063865 | |||
| 1594 | Ga0070714_100076110 | |||
| 1595 | Ga0070714_100184067 | |||
| 1596 | Ga0070714_100202369 | |||
| 1597 | Ga0070714_100328582 | |||
| 1598 | Ga0070714_100420221 | |||
| 1599 | Ga0070714_100473049 | |||
| 1600 | Ga0070714_100563543 | |||
| 1601 | Ga0070714_100676969 | |||
| 1602 | Ga0070713_100067709 | |||
| 1603 | Ga0070713_100107105 | |||
| 1604 | Ga0070713_100107386 | |||
| 1605 | Ga0070713_100111518 | |||
| 1606 | Ga0070713_100192701 | |||
| 1607 | Ga0070713_100308167 | |||
| 1608 | Ga0070710_10129196 | |||
| 1609 | Ga0070710_10225789 | |||
| 1610 | Ga0070701_10217931 | |||
| 1611 | Ga0070711_100034804 | |||
| 1612 | Ga0070711_100216864 | |||
| 1613 | Ga0070711_100303401 | |||
| 1614 | Ga0070711_100545367 | |||
| 1615 | Ga0070700_100147406 | |||
| 1616 | Ga0070694_100125456 | |||
| 1617 | Ga0070708_100026859 | |||
| 1618 | Ga0070708_100031874 | |||
| 1619 | Ga0070708_100699609 | |||
| 1620 | Ga0070663_100000200 | |||
| 1621 | Ga0070663_100094838 | |||
| 1622 | Ga0070678_100041960 | |||
| 1623 | Ga0070678_100044896 | |||
| 1624 | Ga0070662_100041824 | |||
| 1625 | Ga0070681_10220371 | |||
| 1626 | Ga0070681_10371782 | |||
| 1627 | Ga0070685_10022823 | |||
| 1628 | Ga0070706_100005952 | |||
| 1629 | Ga0070706_100062786 | |||
| 1630 | Ga0070706_100260877 | |||
| 1631 | Ga0070706_100301676 | |||
| 1632 | Ga0070706_100614708 | |||
| 1633 | Ga0070707_100021379 | |||
| 1634 | Ga0070707_100046002 | |||
| 1635 | Ga0070707_100277078 | |||
| 1636 | Ga0070707_100320307 | |||
| 1637 | Ga0070698_100015722 | |||
| 1638 | Ga0070698_100040242 | |||
| 1639 | Ga0070698_100059047 | |||
| 1640 | Ga0070698_100104626 | |||
| 1641 | Ga0070698_100502148 | |||
| 1642 | Ga0070698_100823409 | |||
| 1643 | Ga0070699_100004229 | |||
| 1644 | Ga0070699_100112281 | |||
| 1645 | Ga0070679_100020051 | |||
| 1646 | Ga0070679_100148284 | |||
| 1647 | Ga0070679_100991786 | |||
| 1648 | Ga0070684_100117990 | |||
| 1649 | Ga0070684_100123846 | |||
| 1650 | Ga0070684_100169416 | |||
| 1651 | Ga0070684_100726117 | |||
| 1652 | Ga0070697_100000297 | |||
| 1653 | Ga0070697_100249985 | |||
| 1654 | Ga0068853_100003712 | |||
| 1655 | Ga0068853_100050169 | |||
| 1656 | Ga0068853_100162906 | |||
| 1657 | Ga0068853_100299520 | |||
| 1658 | Ga0070672_100037137 | |||
| 1659 | Ga0070672_100288829 | |||
| 1660 | Ga0070672_100393752 | |||
| 1661 | Ga0070686_100052369 | |||
| 1662 | Ga0070695_100032353 | |||
| 1663 | Ga0070693_100048338 | |||
| 1664 | Ga0070665_100066875 | |||
| 1665 | Ga0070665_100135130 | |||
| 1666 | Ga0070665_100538105 | |||
| 1667 | Ga0070704_100123499 | |||
| 1668 | Ga0068855_100232018 | |||
| 1669 | Ga0070664_100952478 | |||
| 1670 | Ga0068857_100065627 | |||
| 1671 | Ga0068854_100019910 | |||
| 1672 | Ga0068856_100103223 | |||
| 1673 | Ga0068856_100118950 | |||
| 1674 | Ga0070702_100033411 | |||
| 1675 | Ga0068859_100304670 | |||
| 1676 | Ga0068864_100044733 | |||
| 1677 | Ga0068864_100189675 | |||
| 1678 | Ga0068864_100258911 | |||
| 1679 | Ga0068866_10050747 | |||
| 1680 | Ga0068866_10144192 | |||
| 1681 | Ga0068866_10163428 | |||
| 1682 | Ga0068861_100117328 | |||
| 1683 | Ga0068861_100176561 | |||
| 1684 | Ga0068851_10162167 | |||
| 1685 | Ga0068870_10006949 | |||
| 1686 | Ga0068863_100004992 | |||
| 1687 | Ga0068863_100032201 | |||
| 1688 | Ga0068863_100712410 | |||
| 1689 | Ga0068858_100074577 | |||
| 1690 | Ga0068860_100784821 | |||
| 1691 | Ga0068862_100031297 | |||
| 1692 | Ga0081455_10000045 | |||
| 1693 | Ga0081455_10062588 | |||
| 1694 | Ga0081538_10000036 | |||
| 1695 | Ga0081540_1001418 | |||
| 1696 | Ga0081539_10001518 | |||
| 1697 | Ga0081539_10002486 | |||
| 1698 | Ga0070717_10013495 | |||
| 1699 | Ga0070717_10019489 | |||
| 1700 | Ga0070717_10022664 | |||
| 1701 | Ga0070717_10044166 | |||
| 1702 | Ga0070717_10053539 | |||
| 1703 | Ga0070717_10200894 | |||
| 1704 | Ga0070717_10221305 | |||
| 1705 | Ga0070717_10314907 | |||
| 1706 | Ga0075368_10001580 | |||
| 1707 | Ga0075363_100001400 | |||
| 1708 | Ga0075363_100048444 | |||
| 1709 | Ga0075363_100125899 | |||
| 1710 | Ga0075364_10031453 | |||
| 1711 | Ga0075432_10185752 | |||
| 1712 | Ga0070715_10013884 | |||
| 1713 | Ga0070715_10106382 | |||
| 1714 | Ga0070715_10122570 | |||
| 1715 | Ga0070715_10135485 | |||
| 1716 | Ga0070716_100008308 | |||
| 1717 | Ga0070716_100093886 | |||
| 1718 | Ga0070712_100072461 | |||
| 1719 | Ga0070712_100125749 | |||
| 1720 | Ga0070712_100192400 | |||
| 1721 | Ga0070712_100195833 | |||
| 1722 | Ga0070712_100302706 | |||
| 1723 | Ga0070712_100736567 | |||
| 1724 | Ga0075362_10123914 | |||
| 1725 | Ga0075367_10002607 | |||
| 1726 | Ga0075370_10056980 | |||
| 1727 | Ga0075370_10096132 | |||
| 1728 | Ga0075434_100184513 | |||
| 1729 | Ga0068865_100039270 | |||
| 1730 | Ga0068865_100500477 | |||
| 1731 | Ga0097620_100304673 | |||
| 1732 | Ga0099826_10081186 | |||
| 1733 | Ga0075435_100022404 | |||
| 1734 | Ga0075435_100808802 | |||
| 1735 | Ga0099795_10012716 | |||
| 1736 | Ga0105251_10022179 | |||
| 1737 | Ga0105251_10024584 | |||
| 1738 | Ga0105244_10047301 | |||
| 1739 | Ga0105244_10220369 | |||
| 1740 | Ga0105250_10088893 | |||
| 1741 | Ga0105240_10078079 | |||
| 1742 | Ga0105245_10034867 | |||
| 1743 | Ga0105245_10384319 | |||
| 1744 | Ga0105245_10503400 | |||
| 1745 | Ga0105245_10625681 | |||
| 1746 | Ga0105245_10764077 | |||
| 1747 | Ga0105245_11653844 | |||
| 1748 | Ga0105247_10073415 | |||
| 1749 | Ga0105243_10050363 | |||
| 1750 | Ga0105243_10055962 | |||
| 1751 | Ga0105243_10347082 | |||
| 1752 | Ga0105243_10757939 | |||
| 1753 | Ga0105243_10842457 | |||
| 1754 | Ga0105241_10256312 | |||
| 1755 | Ga0105241_10596625 | |||
| 1756 | Ga0105242_10068343 | |||
| 1757 | Ga0105242_10075622 | |||
| 1758 | Ga0105242_11083859 | |||
| 1759 | Ga0105248_10056660 | |||
| 1760 | Ga0105248_10228276 | |||
| 1761 | Ga0105248_11403710 | |||
| 1762 | Ga0105237_11472947 | |||
| 1763 | Ga0105238_10245300 | |||
| 1764 | Ga0105238_10315285 | |||
| 1765 | Ga0105238_10903286 | |||
| 1766 | Ga0105249_10395111 | |||
| 1767 | Ga0105249_11358580 | |||
| 1768 | Ga0099796_10068767 | |||
| 1769 | Ga0105239_10276517 | |||
| 1770 | Ga0105239_10450866 | |||
| 1771 | Ga0105239_11025249 | |||
| 1772 | Ga0105246_10000197 | |||
| 1773 | Ga0105246_10002208 | |||
| 1774 | Ga0105246_10024288 | |||
| 1775 | Ga0105246_10051267 | |||
| 1776 | Ga0105246_10112621 | |||
| 1777 | Ga0105246_10207496 | |||
| 1778 | Ga0105246_10483823 | |||
| 1779 | Ga0157336_1001633 | |||
| 1780 | Ga0157338_1004574 | |||
| 1781 | Ga0157373_10001679 | |||
| 1782 | Ga0157373_10521465 | |||
| 1783 | Ga0157371_10025927 | |||
| 1784 | Ga0157371_10144590 | |||
| 1785 | Ga0157371_10579807 | |||
| 1786 | Ga0157370_10025635 | |||
| 1787 | Ga0157369_10009358 | |||
| 1788 | Ga0157369_10069859 | |||
| 1789 | Ga0157369_10086834 | |||
| 1790 | Ga0157369_10105151 | |||
| 1791 | Ga0157369_10297435 | |||
| 1792 | Ga0157369_10405979 | |||
| 1793 | Ga0157369_10927349 | |||
| 1794 | Ga0157374_10065606 | |||
| 1795 | Ga0157374_10217344 | |||
| 1796 | Ga0157378_10280101 | |||
| 1797 | Ga0157378_10445481 | |||
| 1798 | Ga0157378_11697520 | |||
| 1799 | Ga0163162_10034673 | |||
| 1800 | Ga0163162_10190209 | |||
| 1801 | Ga0163162_10701604 | |||
| 1802 | Ga0157372_10092016 | |||
| 1803 | Ga0157372_10426512 | |||
| 1804 | Ga0157375_10077748 | |||
| 1805 | Ga0157375_10159717 | |||
| 1806 | Ga0157375_10182570 | |||
| 1807 | Ga0157375_10679982 | |||
| 1808 | Ga0157375_11002394 | |||
| 1809 | Ga0157375_11457604 | |||
| 1810 | Ga0157375_11485186 | |||
| 1811 | Ga0163163_10019634 | |||
| 1812 | Ga0163163_10111660 | |||
| 1813 | Ga0163163_10883665 | |||
| 1814 | Ga0157380_10028146 | |||
| 1815 | Ga0182008_10001956 | |||
| 1816 | Ga0157376_10345454 | |||
| 1817 | Ga0157376_11086934 | |||
| 1818 | Ga0182007_10000163 | |||
| 1819 | Ga0183367_1012 | |||
| 1820 | Ga0163161_10168721 | |||
| 1821 | Ga0163161_10677782 | |||
| 1822 | Ga0163161_10725115 | |||
| 1823 | Ga0197907_10815515 | |||
| 1824 | Ga0206356_11463270 | |||
| 1825 | Ga0206356_11859014 | |||
| 1826 | Ga0206351_10108314 | |||
| 1827 | Ga0206351_10251250 | |||
| 1828 | Ga0206354_10086865 | |||
| 1829 | Ga0206354_10919820 | |||
| 1830 | Ga0206354_11407995 | |||
| 1831 | Ga0206353_10084704 | |||
| 1832 | Ga0206353_10810170 | |||
| 1833 | Ga0206353_11864166 | |||
| 1834 | Ga0213876_10137141 | |||
| 1835 | Ga0213875_10001662 | |||
| 1836 | Ga0213875_10002613 | |||
| 1837 | Ga0213875_10014186 | |||
| 1838 | Ga0213875_10079264 | |||
| 1839 | Ga0213875_10279945 | |||
| 1840 | Ga0213875_10321178 | |||
| 1841 | Ga0224712_10023797 | |||
| 1842 | Ga0224712_10273934 | |||
| 1843 | Ga0224572_1011013 | |||
| 1844 | Ga0224572_1033009 | |||
| 1845 | Ga0209148_1003971 | |||
| 1846 | Ga0209759_1029106 | |||
| 1847 | Ga0209129_1000067 | |||
| 1848 | Ga0209025_1000971 | |||
| 1849 | Ga0209758_1005907 | |||
| 1850 | Ga0207426_1000338 | |||
| 1851 | Ga0207426_1001520 | |||
| 1852 | Ga0207426_1031921 | |||
| 1853 | Ga0207426_1053126 | |||
| 1854 | Ga0209051_1000810 | |||
| 1855 | Ga0207697_10006382 | |||
| 1856 | Ga0207655_1005461 | |||
| 1857 | Ga0207655_1017475 | |||
| 1858 | Ga0207692_10003051 | |||
| 1859 | Ga0207692_10034193 | |||
| 1860 | Ga0207692_10074518 | |||
| 1861 | Ga0207692_10235530 | |||
| 1862 | Ga0207692_10266704 | |||
| 1863 | Ga0207692_10338471 | |||
| 1864 | Ga0207692_10490597 | |||
| 1865 | Ga0207642_10009380 | |||
| 1866 | Ga0207710_10137629 | |||
| 1867 | Ga0207688_10024482 | |||
| 1868 | Ga0207688_10042431 | |||
| 1869 | Ga0207688_10066415 | |||
| 1870 | Ga0207688_10351945 | |||
| 1871 | Ga0207680_10177279 | |||
| 1872 | Ga0207680_10189510 | |||
| 1873 | Ga0207647_10091661 | |||
| 1874 | Ga0207647_10470686 | |||
| 1875 | Ga0207685_10068604 | |||
| 1876 | Ga0207699_10002526 | |||
| 1877 | Ga0207699_10058070 | |||
| 1878 | Ga0207699_10176720 | |||
| 1879 | Ga0207699_10223185 | |||
| 1880 | Ga0207699_10421165 | |||
| 1881 | Ga0207699_10610499 | |||
| 1882 | Ga0207645_10035601 | |||
| 1883 | Ga0207643_10032287 | |||
| 1884 | Ga0207643_10072698 | |||
| 1885 | Ga0207705_10442043 | |||
| 1886 | Ga0207684_10032042 | |||
| 1887 | Ga0207684_10152822 | |||
| 1888 | Ga0207684_10173517 | |||
| 1889 | Ga0207684_10197793 | |||
| 1890 | Ga0207684_10669986 | |||
| 1891 | Ga0207684_10926337 | |||
| 1892 | Ga0207707_10132396 | |||
| 1893 | Ga0207693_10031316 | |||
| 1894 | Ga0207693_10131940 | |||
| 1895 | Ga0207693_10529986 | |||
| 1896 | Ga0207693_10653801 | |||
| 1897 | Ga0207663_10119125 | |||
| 1898 | Ga0207660_10047151 | |||
| 1899 | Ga0207662_10002144 | |||
| 1900 | Ga0207662_10350090 | |||
| 1901 | Ga0207657_10015855 | |||
| 1902 | Ga0207657_10126054 | |||
| 1903 | Ga0207646_10029891 | |||
| 1904 | Ga0207646_10037944 | |||
| 1905 | Ga0207646_10118462 | |||
| 1906 | Ga0207646_10239390 | |||
| 1907 | Ga0207646_10259932 | |||
| 1908 | Ga0207646_10565058 | |||
| 1909 | Ga0207646_10806877 | |||
| 1910 | Ga0207681_10034161 | |||
| 1911 | Ga0207694_10125335 | |||
| 1912 | Ga0207694_10275321 | |||
| 1913 | Ga0207694_10327174 | |||
| 1914 | Ga0207694_10703340 | |||
| 1915 | Ga0207659_10099983 | |||
| 1916 | Ga0207687_10087006 | |||
| 1917 | Ga0207687_10141219 | |||
| 1918 | Ga0207700_10010090 | |||
| 1919 | Ga0207700_10025873 | |||
| 1920 | Ga0207700_10037584 | |||
| 1921 | Ga0207700_10086010 | |||
| 1922 | Ga0207700_10110443 | |||
| 1923 | Ga0207700_10225305 | |||
| 1924 | Ga0207700_10261064 | |||
| 1925 | Ga0207700_10281996 | |||
| 1926 | Ga0207664_10000492 | |||
| 1927 | Ga0207664_10005718 | |||
| 1928 | Ga0207664_10007561 | |||
| 1929 | Ga0207664_10011017 | |||
| 1930 | Ga0207664_10026896 | |||
| 1931 | Ga0207664_10131302 | |||
| 1932 | Ga0207664_10151825 | |||
| 1933 | Ga0207664_10155014 | |||
| 1934 | Ga0207664_10163229 | |||
| 1935 | Ga0207664_10210545 | |||
| 1936 | Ga0207664_10706878 | |||
| 1937 | Ga0207690_10076202 | |||
| 1938 | Ga0207706_10720902 | |||
| 1939 | Ga0207686_10041336 | |||
| 1940 | Ga0207709_10068634 | |||
| 1941 | Ga0207709_10255051 | |||
| 1942 | Ga0207709_10370178 | |||
| 1943 | Ga0207709_10661869 | |||
| 1944 | Ga0207669_10153418 | |||
| 1945 | Ga0207669_10370234 | |||
| 1946 | Ga0207665_10004487 | |||
| 1947 | Ga0207665_10007373 | |||
| 1948 | Ga0207665_10026937 | |||
| 1949 | Ga0207665_10046112 | |||
| 1950 | Ga0207665_10095485 | |||
| 1951 | Ga0207691_10000484 | |||
| 1952 | Ga0207689_10005167 | |||
| 1953 | Ga0207661_10065552 | |||
| 1954 | Ga0207661_10076201 | |||
| 1955 | Ga0207667_10166731 | |||
| 1956 | Ga0207651_10725276 | |||
| 1957 | Ga0207712_10163796 | |||
| 1958 | Ga0207712_10497387 | |||
| 1959 | Ga0207668_10146609 | |||
| 1960 | Ga0207668_10283072 | |||
| 1961 | Ga0207668_10499011 | |||
| 1962 | Ga0207668_10992441 | |||
| 1963 | Ga0207640_10445065 | |||
| 1964 | Ga0207677_11039689 | |||
| 1965 | Ga0207639_10018681 | |||
| 1966 | Ga0207639_10036114 | |||
| 1967 | Ga0207678_10000087 | |||
| 1968 | Ga0207678_10001935 | |||
| 1969 | Ga0207678_10451178 | |||
| 1970 | Ga0207708_10016045 | |||
| 1971 | Ga0207708_10230133 | |||
| 1972 | Ga0207702_10025105 | |||
| 1973 | Ga0207702_10091051 | |||
| 1974 | Ga0207702_10158911 | |||
| 1975 | Ga0207702_10232033 | |||
| 1976 | Ga0207702_10715617 | |||
| 1977 | Ga0207641_10008662 | |||
| 1978 | Ga0207641_10152650 | |||
| 1979 | Ga0207648_10308167 | |||
| 1980 | Ga0207648_11065345 | |||
| 1981 | Ga0207676_10557413 | |||
| 1982 | Ga0207674_10034736 | |||
| 1983 | Ga0207674_10051731 | |||
| 1984 | Ga0207683_10002130 | |||
| 1985 | Ga0207683_10003875 | |||
| 1986 | Ga0207683_10120118 | |||
| 1987 | Ga0207698_10269218 | |||
| 1988 | Ga0209813_10006915 | |||
| 1989 | Ga0207428_10121699 | |||
| 1990 | Ga0207428_10178890 | |||
| 1991 | Ga0268266_10128891 | |||
| 1992 | Ga0268266_10148120 | |||
| 1993 | Ga0268266_10202262 | |||
| 1994 | Ga0265337_1000784 | |||
| 1995 | Ga0265337_1035017 | |||
| 1996 | Ga0265326_10024854 | |||
| 1997 | Ga0265319_1006043 | |||
| 1998 | Ga0265334_10002216 | |||
| 1999 | Ga0265318_10121994 | |||
| 2000 | Ga0265323_10033990 | |||
| 2001 | Ga0265336_10001403 | |||
| 2002 | Ga0307517_10013671 | |||
| 2003 | Ga0307515_10000050 | |||
| 2004 | Ga0307515_10051468 | |||
| 2005 | Ga0307515_10053114 | |||
| 2006 | Ga0307515_10098689 | |||
| 2007 | Ga0307515_10178784 | |||
| 2008 | Ga0307515_10192698 | |||
| 2009 | Ga0265338_10002384 | |||
| 2010 | Ga0265338_10004367 | |||
| 2011 | Ga0265338_10009574 | |||
| 2012 | Ga0265338_10035787 | |||
| 2013 | Ga0265324_10002386 | |||
| 2014 | Ga0307511_10000080 | |||
| 2015 | Ga0307511_10017601 | |||
| 2016 | Ga0307512_10002990 | |||
| 2017 | Ga0307512_10004801 | |||
| 2018 | Ga0307512_10020534 | |||
| 2019 | Ga0307512_10040788 | |||
| 2020 | Ga0307512_10085418 | |||
| 2021 | Ga0316180_1173122 | |||
| 2022 | Ga0265760_10019825 | |||
| 2023 | Ga0265332_10010221 | |||
| 2024 | Ga0265320_10034635 | |||
| 2025 | Ga0265325_10013623 | |||
| 2026 | Ga0265340_10002174 | |||
| 2027 | Ga0265316_10054485 | |||
| 2028 | Ga0307513_10004852 | |||
| 2029 | Ga0307513_10032771 | |||
| 2030 | Ga0307513_10068129 | |||
| 2031 | Ga0307513_10336719 | |||
| 2032 | Ga0307513_10354394 | |||
| 2033 | Ga0307509_10257602 | |||
| 2034 | Ga0307509_10282797 | |||
| 2035 | Ga0307509_10467457 | |||
| 2036 | Ga0307408_100024343 | |||
| 2037 | Ga0307408_100031030 | |||
| 2038 | Ga0307408_100044689 | |||
| 2039 | Ga0307408_100044843 | |||
| 2040 | Ga0307408_100183151 | |||
| 2041 | Ga0307408_100218449 | |||
| 2042 | Ga0307408_100416314 | |||
| 2043 | Ga0265313_10005878 | |||
| 2044 | Ga0307508_10002207 | |||
| 2045 | Ga0307508_10002455 | |||
| 2046 | Ga0307508_10005361 | |||
| 2047 | Ga0307508_10021648 | |||
| 2048 | Ga0307508_10060834 | |||
| 2049 | Ga0307508_10185418 | |||
| 2050 | Ga0307514_10057674 | |||
| 2051 | Ga0307514_10110476 | |||
| 2052 | Ga0316575_10000792 | |||
| 2053 | Ga0316579_10004707 | |||
| 2054 | Ga0265314_10008241 | |||
| 2055 | Ga0265342_10002853 | |||
| 2056 | Ga0316576_10003957 | |||
| 2057 | Ga0316578_10005456 | |||
| 2058 | Ga0307516_10008723 | |||
| 2059 | Ga0307516_10019872 | |||
| 2060 | Ga0307516_10027222 | |||
| 2061 | Ga0307516_10114073 | |||
| 2062 | Ga0307405_10006646 | |||
| 2063 | Ga0307405_10013737 | |||
| 2064 | Ga0307405_10025650 | |||
| 2065 | Ga0307405_10054318 | |||
| 2066 | Ga0307405_10069388 | |||
| 2067 | Ga0307405_10125904 | |||
| 2068 | Ga0307405_10206287 | |||
| 2069 | Ga0307405_10248983 | |||
| 2070 | Ga0316577_10124158 | |||
| 2071 | Ga0307413_10019132 | |||
| 2072 | Ga0307413_10024267 | |||
| 2073 | Ga0307413_10058885 | |||
| 2074 | Ga0307413_10063857 | |||
| 2075 | Ga0307518_10000218 | |||
| 2076 | Ga0307518_10088394 | |||
| 2077 | Ga0307518_10193780 | |||
| 2078 | Ga0307410_10008763 | |||
| 2079 | Ga0307410_10024914 | |||
| 2080 | Ga0307410_10029352 | |||
| 2081 | Ga0307410_10073165 | |||
| 2082 | Ga0307410_10081401 | |||
| 2083 | Ga0307410_10218504 | |||
| 2084 | Ga0307410_10446982 | |||
| 2085 | Ga0307406_10022720 | |||
| 2086 | Ga0307406_10056311 | |||
| 2087 | Ga0307407_10040658 | |||
| 2088 | Ga0307407_10085531 | |||
| 2089 | Ga0307407_10182627 | |||
| 2090 | Ga0307407_10228160 | |||
| 2091 | Ga0307412_10002052 | |||
| 2092 | Ga0307412_10012455 | |||
| 2093 | Ga0307412_10026891 | |||
| 2094 | Ga0307412_10034900 | |||
| 2095 | Ga0307412_10035432 | |||
| 2096 | Ga0307412_10120213 | |||
| 2097 | Ga0307412_10222366 | |||
| 2098 | Ga0307412_10332218 | |||
| 2099 | Ga0307412_10727583 | |||
| 2100 | Ga0307409_100003753 | |||
| 2101 | Ga0307409_100080222 | |||
| 2102 | Ga0307409_100135889 | |||
| 2103 | Ga0307409_100452060 | |||
| 2104 | Ga0307409_100507298 | |||
| 2105 | Ga0307409_100725174 | |||
| 2106 | Ga0307409_100733648 | |||
| 2107 | Ga0307409_100788252 | |||
| 2108 | Ga0307409_101095355 | |||
| 2109 | Ga0307416_100048766 | |||
| 2110 | Ga0307416_100063338 | |||
| 2111 | Ga0307416_100076375 | |||
| 2112 | Ga0307416_100201252 | |||
| 2113 | Ga0307416_100551146 | |||
| 2114 | Ga0307416_101175529 | |||
| 2115 | Ga0307414_10019805 | |||
| 2116 | Ga0307414_10081723 | |||
| 2117 | Ga0307414_10810406 | |||
| 2118 | Ga0307414_10894603 | |||
| 2119 | Ga0307411_10152122 | |||
| 2120 | Ga0307411_10528777 | |||
| 2121 | Ga0307415_100087668 | |||
| 2122 | Ga0307415_100118386 | |||
| 2123 | Ga0307415_100466896 | |||
| 2124 | Ga0316585_10048468 | |||
| 2125 | Ga0307507_10017996 | |||
| 2126 | Ga0307510_10003092 | |||
| 2127 | Ga0307510_10004930 | |||
| 2128 | Ga0307510_10102295 | |||
| 2129 | Ga0316214_1002649 | |||
| 2130 | Ga0373948_0009436 | |||
| 2131 | Ga0373958_0007085 | |||
| 2132 | Ga0373926_0004046 | |||
| 2133 | Ga0373926_0023231 | |||
| 2134 | Ga0373928_0009779 | |||
| 2135 | Ga0373934_0010825 | |||
| 2136 | Ga0373934_0044774 | |||
| 2137 | Ga0373940_0005225 | |||
| 2138 | Ga0373951_0003077 | |||
| 2139 | Ga0373951_0016358 | |||
| 2140 | Ga0373952_0023651 | |||
| 2141 | Ga0373923_0013974 | |||
| 2142 | Ga0373923_0014072 | |||
| 2143 | Ga0373923_0019408 | |||
| 2144 | Ga0373923_0140396 | |||
| 2145 | Ga0373923_0185487 | |||
| 2146 | Ga0373932_0004097 | |||
| 2147 | Ga0373936_0001422 | |||
| 2148 | Ga0373936_0015936 | |||
| 2149 | Ga0373936_0048790 | |||
| 2150 | Ga0373939_0023139 | |||
| 2151 | Ga0373941_0017473 | |||
| 2152 | Ga0373945_0002358 | |||
| 2153 | Ga0373945_0042879 | |||
| 2154 | Ga0373954_0099084 | |||
| 2155 | Ga0373954_0273548 | |||
| 2156 | Ga0373956_0257604 | |||
| 2157 | Ga0373957_0002120 | |||
| 2158 | Ga0373957_0014832 | |||
| 2159 | Ga0373957_0120377 | |||
| 2160 | Ga0373943_0078331 | |||
| 2161 | Ga0373946_0000398 | |||
| 2162 | Ga0373946_0013890 | |||
| 2163 | Ga0373955_0122713 | |||
| 2164 | Ga0373955_0180925 | |||
| 2165 | Ga0373962_0025650 | |||
| 2166 | Ga0316574_0011191 | |||
| 2167 | Ga0373924_0024697 | |||
| 2168 | Ga0373924_0170498 | |||
| 2169 | Ga0373935_0018810 | |||
| 2170 | Ga0373927_0029341 | |||
| 2171 | Ga0373927_0160328 | |||
| 2172 | Ga0373933_0010751 | |||
| 2173 | Ga0373933_0056005 | |||
| 2174 | Ga0373933_0074319 | |||
| 2175 | Ga0373947_0022659 | |||
| 2176 | Ga0373947_0055048 | |||
| 2177 | Ga0373947_0193285 | |||
| 2178 | Ga0373947_0710775 | |||
| 2179 | Ga0373937_0016715 | |||
| 2180 | Ga0373937_0042857 | |||
| 2181 | Ga0373937_0216172 | |||
| 2182 | Ga0372808_007581 | |||
| 2183 | Ga0316582_0001650 | |||
| 2184 | Ga0316584_0020649 | |||
| 2185 | Ga0373925_0001533 | |||
| 2186 | Ga0373925_0015583 | |||
| 2187 | Ga0373925_0019220 | |||
| 2188 | Ga0373925_0027975 | |||
| 2189 | Ga0373925_0035205 | |||
| 2190 | Ga0373925_0084551 | |||
| 2191 | Ga0373925_0089777 | |||
| 2192 | Ga0373925_0503491 | |||
| 2193 | Ga0373925_1022192 | |||
| 2194 | Ga0373925_1045791 | |||
| 2195 | Ga0395899_0038060 | |||
| 2196 | Ga0395899_0044858 | |||
| 2197 | Ga0395899_0134618 | |||
| 2198 | Ga0395899_0275062 | |||
| 2199 | Ga0395899_0612614 | |||
| 2200 | Ga0395900_0032828 | |||
| 2201 | Ga0395900_0093708 | |||
| 2202 | Ga0395900_0110020 | |||
| 2203 | Ga0395900_0139695 | |||
| 2204 | Ga0395900_0203312 | |||
| 2205 | Ga0395900_0207573 | |||
| 2206 | Ga0395900_0631476 | |||
| 2207 | Ga0395898_0001632 | |||
| 2208 | Ga0395898_0002149 | |||
| 2209 | Ga0395898_0008284 | |||
| 2210 | Ga0395898_0020796 | |||
| 2211 | Ga0395898_0021707 | |||
| 2212 | Ga0395898_0036794 | |||
| 2213 | Ga0395898_0085160 | |||
| 2214 | Ga0395898_0095229 | |||
| 2215 | Ga0395898_0279922 | |||
| 2216 | Ga0395898_0604101 | |||
| 2217 | Ga0395898_0821717 | |||
| 2218 | Ga0395898_0916356 | |||
| 2219 | Ga0395905_0001202 | |||
| 2220 | Ga0395905_0116969 | |||
| 2221 | Ga0395905_0509676 | |||
| 2222 | Ga0436364_0150636 | |||
| 2223 | Ga0436364_0395751 | |||
| 2224 | Ga0436364_0531502 | |||
| 2225 | Ga0436364_0784392 | |||
| 2226 | Ga0436364_0919138 | |||
| 2227 | Ga0436364_1320999 | |||
| 2228 | Ga0436364_1362811 | |||
| 2229 | Ga0436364_1517030 | |||
| 2230 | Ga0395901_0001966 | |||
| 2231 | Ga0395901_0003051 | |||
| 2232 | Ga0395901_0027170 | |||
| 2233 | Ga0395901_0044069 | |||
| 2234 | Ga0395901_0177249 | |||
| 2235 | Ga0395901_0179391 | |||
| 2236 | Ga0395901_0260685 | |||
| 2237 | Ga0395901_0376729 | |||
| 2238 | Ga0400485_15671 | |||
| 2239 | Ga0400486_02662 | |||
| 2240 | Ga0400486_13685 | |||
| 2241 | Ga0436365_0420689 | |||
| 2242 | Ga0436365_1811262 | |||
| 2243 | Ga0436360_0629473 | |||
| 2244 | Ga0436361_0900465 | |||
| 2245 | Ga0436362_0534645 | |||
| 2246 | Ga0436362_0824423 | |||
| 2247 | Ga0439436_0000844 | |||
| 2248 | Ga0439436_0003084 | |||
| 2249 | Ga0439436_0005353 | |||
| 2250 | Ga0439436_0032311 | |||
| 2251 | Ga0439439_0001593 | |||
| 2252 | Ga0439439_0002844 | |||
| 2253 | Ga0439439_0025811 | |||
| 2254 | Ga0439461_0006529 | |||
| 2255 | Ga0439466_0001635 | |||
| 2256 | Ga0439466_0062472 | |||
| 2257 | Ga0439466_0081549 | |||
| 2258 | Ga0451793_0126831 | |||
| 2259 | Ga0451795_0121483 | |||
| 2260 | Ga0451833_0410178 | |||
| 2261 | Ga0451837_0776717 | |||
| 2262 | Ga0451837_1343481 | |||
| 2263 | Ga0451841_0340527 | |||
| 2264 | Ga0451843_1293141 | |||
| 2265 | Ga0451843_1384929 | |||
| 2266 | Ga0451843_1552399 | |||
| 2267 | Ga0451853_0882312 | |||
| 2268 | Ga0451853_2556618 | |||
| 2269 | Ga0451853_2771047 | |||
| 2270 | Ga0451853_3274728 | |||
| 2271 | Ga0451853_3485447 | |||
| 2272 | Ga0439433_0001722 | |||
| 2273 | Ga0439433_0004646 | |||
| 2274 | Ga0439433_0052443 | |||
| 2275 | Ga0439442_000229 | |||
| 2276 | Ga0439442_000270 | |||
| 2277 | Ga0439442_043974 | |||
| 2278 | Ga0439442_071765 | |||
| 2279 | Ga0439448_0040106 | |||
| 2280 | Ga0439432_003959 | |||
| 2281 | Ga0439432_055494 | |||
| 2282 | Ga0439432_069218 | |||
| 2283 | Ga0439449_0000462 | |||
| 2284 | Ga0439449_0001950 | |||
| 2285 | Ga0439449_0014782 | |||
| 2286 | Ga0439449_0034925 | |||
| 2287 | Ga0439449_0069315 | |||
| 2288 | Ga0439449_0073024 | |||
| 2289 | Ga0439449_0139481 | |||
| 2290 | Ga0439452_005042 | |||
| 2291 | Ga0439457_000259 | |||
| 2292 | Ga0439457_000484 | |||
| 2293 | Ga0439457_006468 | |||
| 2294 | Ga0439462_0025025 | |||
| 2295 | Ga0439462_0026643 | |||
| 2296 | Ga0439462_0051250 | |||
| 2297 | Ga0450919_014088 | |||
| 2298 | Ga0450920_010457 | |||
| 2299 | Ga0450920_037827 | |||
| 2300 | Ga0450894_000017 | |||
| 2301 | Ga0450896_001345 | |||
| 2302 | Ga0450898_001329 | |||
| 2303 | Ga0450899_000582 | |||
| 2304 | Ga0450903_000170 | |||
| 2305 | Ga0450906_006430 | |||
| 2306 | Ga0450907_002416 | |||
| 2307 | Ga0450907_017351 | |||
| 2308 | Ga0439458_0008360 | |||
| 2309 | Ga0450908_002967 | |||
| 2310 | Ga0450909_001368 | |||
| 2311 | Ga0439434_0000397 | |||
| 2312 | Ga0439434_0031409 | |||
| 2313 | Ga0450918_000574 | |||
| 2314 | Ga0450918_003347 | |||
| 2315 | Ga0466969_0001422 | |||
| 2316 | Ga0466969_0001882 | |||
| 2317 | Ga0466969_0040748 | |||
| 2318 | Ga0466969_0046972 | |||
| 2319 | Ga0466972_0003583 | |||
| 2320 | Ga0466972_0054977 | |||
| 2321 | Ga0466972_0113074 | |||
| 2322 | Ga0466972_0118593 | |||
| 2323 | Ga0466965_0002385 | |||
| 2324 | Ga0466965_0013515 | |||
| 2325 | Ga0466965_0115586 | |||
| 2326 | Ga0466965_0255202 | |||
| 2327 | Ga0466965_0278362 | |||
| 2328 | Ga0466966_0021627 | |||
| 2329 | Ga0466966_0030730 | |||
| 2330 | Ga0466966_0223787 | |||
| 2331 | Ga0466966_0235044 | |||
| 2332 | Ga0466961_0002971 | |||
| 2333 | Ga0466961_0356590 | |||
| 2334 | Ga0466963_0001086 | |||
| 2335 | Ga0466963_0026338 | |||
| 2336 | Ga0466963_0065138 | |||
| 2337 | Ga0466963_0114573 | |||
| 2338 | Ga0466963_0176137 | |||
| 2339 | Ga0466963_0265137 | |||
| 2340 | Ga0466964_0003028 | |||
| 2341 | Ga0466964_0073551 | |||
| 2342 | Ga0466964_0135643 | |||
| 2343 | Ga0466964_0292931 | |||
| 2344 | Ga0466971_0010428 | |||
| 2345 | Ga0466971_0018388 | |||
| 2346 | Ga0466971_0040993 | |||
| 2347 | Ga0466971_0050447 | |||
| 2348 | Ga0466968_0022011 | |||
| 2349 | Ga0466970_0000351 | |||
| 2350 | Ga0466970_0000945 | |||
| 2351 | Ga0466970_0010378 | |||
| 2352 | Ga0466970_0012006 | |||
| 2353 | Ga0466970_0192092 | |||
| 2354 | Ga0466970_0386280 | |||
| 2355 | Ga0466970_0545358 | |||
| 2356 | Ga0466957_0000810 | |||
| 2357 | Ga0466957_0012904 | |||
| 2358 | Ga0466960_0014836 | |||
| 2359 | Ga0466960_0025608 | |||
| 2360 | Ga0466960_0039396 | |||
| 2361 | Ga0466960_0093462 | |||
| 2362 | Ga0466960_0134497 | |||
| 2363 | Ga0466959_0001040 | |||
| 2364 | Ga0466959_0045253 | |||
| 2365 | Ga0466959_0093399 | |||
| 2366 | Ga0466959_0452473 | |||
| 2367 | Ga0466958_0000718 | |||
| 2368 | Ga0466958_0002027 | |||
| 2369 | Ga0466958_0077604 | |||
| 2370 | Ga0466958_0434519 | |||
| 2371 | Ga0466967_0022318 | |||
| 2372 | Ga0466967_0024594 | |||
| 2373 | Ga0466967_0030054 | |||
| 2374 | Ga0466967_0114113 | |||
| 2375 | Ga0466967_0190348 | |||
| 2376 | Ga0466967_0568248 | |||
| 2377 | Ga0466967_0574298 | |||
| 2378 | Ga0466967_0847801 | |||
| 2379 | Ga0495592_0034168 | |||
| 2380 | Ga0495592_0116406 | |||
| 2381 | Ga0495592_0120291 | |||
| 2382 | Ga0495603_0000289 | |||
| 2383 | Ga0495603_0000661 | |||
| 2384 | Ga0495603_0000674 | |||
| 2385 | Ga0495603_0015404 | |||
| 2386 | Ga0495603_0036433 | |||
| 2387 | Ga0495603_0098020 | |||
| 2388 | Ga0495629_0000707 | |||
| 2389 | Ga0495629_0000836 | |||
| 2390 | Ga0495629_0005889 | |||
| 2391 | Ga0495629_0010308 | |||
| 2392 | Ga0495629_0012702 | |||
| 2393 | Ga0495629_0019392 | |||
| 2394 | Ga0495629_0109965 | |||
| 2395 | Ga0495629_0118311 | |||
| 2396 | Ga0495629_0261512 | |||
| 2397 | Ga0495629_0269857 | |||
| 2398 | Ga0495641_0001407 | |||
| 2399 | Ga0495651_0007222 | |||
| 2400 | Ga0495651_0034250 | |||
| 2401 | Ga0495651_0040256 | |||
| 2402 | Ga0495651_0047527 | |||
| 2403 | Ga0495651_0096599 | |||
| 2404 | Ga0495651_0109519 | |||
| 2405 | Ga0495651_0113178 | |||
| 2406 | Ga0495653_0001977 | |||
| 2407 | Ga0495653_0006324 | |||
| 2408 | Ga0495653_0018018 | |||
| 2409 | Ga0495653_0023407 | |||
| 2410 | Ga0495653_0055310 | |||
| 2411 | Ga0495653_0077750 | |||
| 2412 | Ga0495653_0100670 | |||
| 2413 | Ga0495650_0047918 | |||
| 2414 | Ga0495580_0007396 | |||
| 2415 | Ga0495580_0028835 | |||
| 2416 | Ga0495582_0001725 | |||
| 2417 | Ga0495582_0019391 | |||
| 2418 | Ga0495582_0026659 | |||
| 2419 | Ga0495582_0086160 | |||
| 2420 | Ga0495639_0002961 | |||
| 2421 | Ga0495639_0003573 | |||
| 2422 | Ga0495639_0053154 | |||
| 2423 | Ga0495639_0174079 | |||
| 2424 | Ga0495662_0001446 | |||
| 2425 | Ga0495662_0006850 | |||
| 2426 | Ga0495662_0039735 | |||
| 2427 | Ga0495662_0259843 | |||
| 2428 | Ga0495664_0001216 | |||
| 2429 | Ga0495664_0001349 | |||
| 2430 | Ga0495664_0004093 | |||
| 2431 | Ga0495664_0021131 | |||
| 2432 | Ga0495664_0089126 | |||
| 2433 | Ga0495664_0192081 | |||
| 2434 | Ga0495664_0520604 | |||
| 2435 | Ga0495585_0021922 | |||
| 2436 | Ga0495585_0062706 | |||
| 2437 | Ga0495594_0006506 | |||
| 2438 | Ga0495594_0015830 | |||
| 2439 | Ga0495594_0034590 | |||
| 2440 | Ga0495594_0044987 | |||
| 2441 | Ga0495594_0062666 | |||
| 2442 | Ga0495594_0089797 | |||
| 2443 | Ga0495594_0103966 | |||
| 2444 | Ga0495594_0171504 | |||
| 2445 | Ga0495594_0318595 | |||
| 2446 | Ga0495607_0066806 | |||
| 2447 | Ga0495583_0234590 | |||
| 2448 | Ga0495606_0001411 | |||
| 2449 | Ga0495608_0008605 | |||
| 2450 | Ga0495608_0025254 | |||
| 2451 | Ga0495618_0009873 | |||
| 2452 | Ga0495618_0131119 | |||
| 2453 | Ga0495628_0048012 | |||
| 2454 | Ga0495628_0121159 | |||
| 2455 | Ga0495628_0141781 | |||
| 2456 | Ga0495628_0248742 | |||
| 2457 | Ga0495630_0038479 | |||
| 2458 | Ga0495630_0125330 | |||
| 2459 | Ga0495630_0533591 | |||
| 2460 | Ga0495630_0640155 | |||
| 2461 | Ga0495631_0072346 | |||
| 2462 | Ga0495632_0039105 | |||
| 2463 | Ga0495632_0049523 | |||
| 2464 | Ga0495643_0004792 | |||
| 2465 | Ga0495643_0138838 | |||
| 2466 | Ga0495666_0015388 | |||
| 2467 | Ga0495666_0063817 | |||
| 2468 | Ga0495642_0020650 | |||
| 2469 | Ga0495642_0084530 | |||
| 2470 | Ga0495642_0345111 | |||
| 2471 | Ga0495652_0006642 | |||
| 2472 | Ga0495652_0045550 | |||
| 2473 | Ga0495652_0098154 | |||
| 2474 | Ga0495665_0000460 | |||
| 2475 | Ga0495665_0004304 | |||
| 2476 | Ga0495665_0004561 | |||
| 2477 | Ga0495640_0019296 | |||
| 2478 | Ga0495640_0023776 | |||
| 2479 | Ga0495640_0046535 | |||
| 2480 | Ga0495640_0085367 | |||
| 2481 | Ga0495640_0112180 | |||
| 2482 | Ga0495640_0239536 | |||
| 2483 | Ga0495586_0001125 | |||
| 2484 | Ga0495586_0001218 | |||
| 2485 | Ga0495586_0025026 | |||
| 2486 | Ga0495587_0001013 | |||
| 2487 | Ga0495587_0005692 | |||
| 2488 | Ga0495587_0023700 | |||
| 2489 | Ga0495587_0063030 | |||
| 2490 | Ga0495587_0382738 | |||
| 2491 | Ga0495621_0258112 | |||
| 2492 | Ga0495645_0000775 | |||
| 2493 | Ga0495645_0012725 | |||
| 2494 | Ga0495645_0017960 | |||
| 2495 | Ga0495645_0037901 | |||
| 2496 | Ga0495622_0001939 | |||
| 2497 | Ga0495633_0040816 | |||
| 2498 | Ga0495633_0151193 | |||
| 2499 | Ga0495633_0286303 | |||
| 2500 | Ga0495667_0008292 | |||
| 2501 | Ga0495667_0009434 | |||
| 2502 | Ga0495667_0009720 | |||
| 2503 | Ga0495667_0048311 | |||
| 2504 | Ga0495667_0281996 | |||
| 2505 | Ga0495667_0347243 | |||
| 2506 | Ga0495656_0000169 | |||
| 2507 | Ga0495656_0019999 | |||
| 2508 | Ga0495656_0032717 | |||
| 2509 | Ga0495668_0000889 | |||
| 2510 | Ga0495668_0005024 | |||
| 2511 | Ga0495668_0029314 | |||
| 2512 | Ga0495634_0002610 | |||
| 2513 | Ga0495634_0007951 | |||
| 2514 | Ga0495634_0044523 | |||
| 2515 | Ga0495634_0161750 | |||
| 2516 | Ga0495611_0098066 | |||
| 2517 | Ga0495625_0001780 | |||
| 2518 | Ga0495625_0005724 | |||
| 2519 | Ga0495635_0017096 | |||
| 2520 | Ga0495635_0038484 | |||
| 2521 | Ga0495635_0099851 | |||
| 2522 | Ga0495635_0142881 | |||
| 2523 | Ga0495659_0005317 | |||
| 2524 | Ga0495588_0000974 | |||
| 2525 | Ga0495588_0001165 | |||
| 2526 | Ga0495588_0001188 | |||
| 2527 | Ga0495588_0007559 | |||
| 2528 | Ga0495588_0008867 | |||
| 2529 | Ga0495588_0009018 | |||
| 2530 | Ga0495588_0040515 | |||
| 2531 | Ga0495588_0272366 | |||
| 2532 | Ga0495657_0010059 | |||
| 2533 | Ga0495657_0010805 | |||
| 2534 | Ga0495657_0014226 | |||
| 2535 | Ga0495657_0014662 | |||
| 2536 | Ga0495657_0021307 | |||
| 2537 | Ga0495657_0048926 | |||
| 2538 | Ga0495657_0077779 | |||
| 2539 | Ga0495657_0103380 | |||
| 2540 | Ga0495657_0193430 | |||
| 2541 | Ga0495599_0065683 | |||
| 2542 | Ga0495599_0136012 | |||
| 2543 | Ga0495623_0015016 | |||
| 2544 | Ga0495623_0021270 | |||
| 2545 | Ga0495623_0032147 | |||
| 2546 | Ga0495623_0078857 | |||
| 2547 | Ga0495623_0101117 | |||
| 2548 | Ga0495623_0150802 | |||
| 2549 | Ga0495623_0172212 | |||
| 2550 | Ga0495646_0006103 | |||
| 2551 | Ga0495646_0029588 | |||
| 2552 | Ga0495646_0031555 | |||
| 2553 | Ga0495613_0000273 | |||
| 2554 | Ga0495613_0003050 | |||
| 2555 | Ga0495613_0004146 | |||
| 2556 | Ga0495613_0006281 | |||
| 2557 | Ga0495613_0043362 | |||
| 2558 | Ga0495613_0154869 | |||
| 2559 | Ga0495613_0354873 | |||
| 2560 | Ga0495624_0023877 | |||
| 2561 | Ga0495624_0088196 | |||
| 2562 | Ga0495624_0090190 | |||
| 2563 | Ga0495670_0000803 | |||
| 2564 | Ga0495670_0026591 | |||
| 2565 | Ga0495670_0042256 | |||
| 2566 | Ga0495670_0049455 | |||
| 2567 | Ga0495671_0007907 | |||
| 2568 | Ga0495649_0265248 | |||
| 2569 | Ga0495589_0025263 | |||
| 2570 | Ga0495589_0055145 | |||
| 2571 | Ga0495589_0059458 | |||
| 2572 | Ga0495589_0225265 | |||
| 2573 | Ga0495600_0002512 | |||
| 2574 | Ga0495600_0013323 | |||
| 2575 | Ga0495600_0029526 | |||
| 2576 | Ga0495600_0137084 | |||
| 2577 | Ga0495600_0152595 | |||
| 2578 | Ga0495600_0157016 | |||
| 2579 | Ga0495600_0315700 | |||
| 2580 | Ga0495660_0102531 | |||
| 2581 | Ga0495581_0000967 | |||
| 2582 | Ga0495581_0003601 | |||
| 2583 | Ga0495581_0006363 | |||
| 2584 | Ga0495581_0007210 | |||
| 2585 | Ga0495581_0040613 | |||
| 2586 | Ga0495581_0107086 | |||
| 2587 | Ga0495581_0197043 | |||
| 2588 | Ga0495581_0312369 | |||
| 2589 | Ga0495604_0000551 | |||
| 2590 | Ga0495604_0001127 | |||
| 2591 | Ga0495604_0001365 | |||
| 2592 | Ga0495604_0017009 | |||
| 2593 | Ga0495604_0042287 | |||
| 2594 | Ga0495604_0045416 | |||
| 2595 | Ga0495604_0049635 | |||
| 2596 | Ga0495604_0160608 | |||
| 2597 | Ga0495604_0228154 | |||
| 2598 | Ga0495636_0002615 | |||
| 2599 | Ga0495636_0002725 | |||
| 2600 | Ga0495636_0008686 | |||
| 2601 | Ga0495636_0011336 | |||
| 2602 | Ga0495636_0163441 | |||
| 2603 | Ga0495674_0000635 | |||
| 2604 | Ga0495674_0036424 | |||
| 2605 | Ga0495674_0036585 | |||
| 2606 | Ga0495674_0066904 | |||
| 2607 | Ga0495674_0113486 | |||
| 2608 | Ga0495676_0002154 | |||
| 2609 | Ga0495676_0002263 | |||
| 2610 | Ga0495676_0005627 | |||
| 2611 | Ga0495676_0013922 | |||
| 2612 | Ga0495676_0020569 | |||
| 2613 | Ga0495676_0497516 | |||
| 2614 | Ga0495680_0002388 | |||
| 2615 | Ga0495680_0009246 | |||
| 2616 | Ga0495680_0009271 | |||
| 2617 | Ga0495680_0018990 | |||
| 2618 | Ga0495680_0048963 | |||
| 2619 | Ga0495680_0110332 | |||
| 2620 | Ga0495683_0038893 | |||
| 2621 | Ga0495683_0065507 | |||
| 2622 | Ga0495683_0155979 | |||
| 2623 | Ga0495687_007041 | |||
| 2624 | Ga0495687_010689 | |||
| 2625 | Ga0495687_017184 | |||
| 2626 | Ga0495687_023822 | |||
| 2627 | Ga0495675_0001118 | |||
| 2628 | Ga0495675_0002946 | |||
| 2629 | Ga0495675_0006706 | |||
| 2630 | Ga0495675_0012079 | |||
| 2631 | Ga0495675_0014288 | |||
| 2632 | Ga0495675_0015184 | |||
| 2633 | Ga0495675_0018022 | |||
| 2634 | Ga0495675_0020599 | |||
| 2635 | Ga0495675_0058549 | |||
| 2636 | Ga0495677_0053309 | |||
| 2637 | Ga0495677_0145199 | |||
| 2638 | Ga0495677_0179335 | |||
| 2639 | Ga0495685_001134 | |||
| 2640 | Ga0495685_023581 | |||
| 2641 | Ga0495685_108371 | |||
| 2642 | Ga0495685_112928 | |||
| 2643 | Ga0495685_173477 | |||
| 2644 | Ga0495681_0001152 | |||
| 2645 | Ga0495681_0034494 | |||
| 2646 | Ga0495684_0011248 | |||
| 2647 | Ga0495684_0025184 | |||
| 2648 | Ga0495684_0028470 | |||
| 2649 | Ga0495684_0209979 | |||
| 2650 | Ga0495686_0054410 | |||
| 2651 | Ga0495593_0010641 | |||
| 2652 | Ga0495593_0046721 | |||
| 2653 | Ga0495593_0069168 | |||
| 2654 | Ga0495593_0073062 | |||
| 2655 | Ga0495602_0022719 | |||
| 2656 | Ga0495602_0026583 | |||
| 2657 | Ga0495602_0044060 | |||
| 2658 | Ga0495602_0099247 | |||
| 2659 | Ga0495602_0131686 | |||
| 2660 | Ga0495614_0001215 | |||
| 2661 | Ga0495614_0001410 | |||
| 2662 | Ga0495614_0012972 | |||
| 2663 | Ga0495615_0065408 | |||
| 2664 | Ga0495626_0000177 | |||
| 2665 | Ga0496100_0000911 | |||
| 2666 | Ga0496100_0032814 | |||
| 2667 | Ga0496100_0037132 | |||
| 2668 | Ga0496101_0021719 | |||
| 2669 | Ga0496101_0095054 | |||
| 2670 | Ga0496101_0097715 | |||
| 2671 | Ga0496101_0754977 | |||
| 2672 | Ga0496102_0012786 | |||
| 2673 | Ga0496102_0034680 | |||
| 2674 | Ga0496102_0059283 | |||
| 2675 | Ga0496102_0099802 | |||
| 2676 | Ga0496102_0112755 | |||
| 2677 | Ga0496102_0130519 | |||
| 2678 | Ga0496102_0195435 | |||
| 2679 | Ga0496102_0271262 | |||
| 2680 | Ga0496102_0540822 | |||
| 2681 | Ga0496103_0019771 | |||
| 2682 | Ga0496103_0028986 | |||
| 2683 | Ga0496104_0025879 | |||
| 2684 | Ga0496104_0166288 | |||
| 2685 | Ga0496104_0175927 | |||
| 2686 | Ga0496105_0009336 | |||
| 2687 | Ga0496105_0188794 | |||
| 2688 | Ga0496106_0008239 | |||
| 2689 | Ga0496106_0090571 | |||
| 2690 | Ga0496106_0146457 | |||
| 2691 | Ga0496106_0498409 | |||
| 2692 | Ga0496106_0780748 | |||
| 2693 | Ga0496107_0000205 | |||
| 2694 | Ga0496107_0116646 | |||
| 2695 | Ga0496107_0258969 | |||
| 2696 | Ga0496108_0020456 | |||
| 2697 | Ga0496108_0036973 | |||
| 2698 | Ga0496108_0045557 | |||
| 2699 | Ga0496108_0102213 | |||
| 2700 | Ga0496108_0105750 | |||
| 2701 | Ga0496108_0109179 | |||
| 2702 | Ga0496108_0190844 | |||
| 2703 | Ga0496108_0229661 | |||
| 2704 | Ga0496108_0250700 | |||
| 2705 | Ga0496108_0667730 | |||
| 2706 | Ga0496109_0009721 | |||
| 2707 | Ga0496109_0022836 | |||
| 2708 | Ga0496109_0054007 | |||
| 2709 | Ga0496109_0079929 | |||
| 2710 | Ga0496109_0117934 | |||
| 2711 | Ga0496109_0220563 | |||
| 2712 | Ga0496109_0339284 | |||
| 2713 | Ga0496110_0005126 | |||
| 2714 | Ga0496110_0016932 | |||
| 2715 | Ga0496110_0039744 | |||
| 2716 | Ga0496110_0119347 | |||
| 2717 | Ga0496110_0174061 | |||
| 2718 | Ga0496110_0751103 | |||
| 2719 | Ga0496111_0005349 | |||
| 2720 | Ga0496111_0008961 | |||
| 2721 | Ga0496111_0024928 | |||
| 2722 | Ga0496111_0204936 | |||
| 2723 | Ga0496112_0007219 | |||
| 2724 | Ga0496112_0008964 | |||
| 2725 | Ga0496112_0035680 | |||
| 2726 | Ga0496112_0127537 | |||
| 2727 | Ga0496112_0190570 | |||
| 2728 | Ga0496112_0268406 | |||
| 2729 | Ga0496112_0599808 | |||
| 2730 | Ga0496112_0695523 | |||
| 2731 | Ga0496112_1238467 | |||
| 2732 | Ga0496113_0041026 | |||
| 2733 | Ga0496113_0077598 | |||
| 2734 | Ga0496113_0384940 | |||
| 2735 | Ga0496113_0993707 | |||
| 2736 | Ga0496114_0014248 | |||
| 2737 | Ga0496114_0019637 | |||
| 2738 | Ga0496114_0038080 | |||
| 2739 | Ga0496114_0067983 | |||
| 2740 | Ga0496114_0094465 | |||
| 2741 | Ga0496114_0101740 | |||
| 2742 | Ga0496114_0263634 | |||
| 2743 | Ga0496114_0365143 | |||
| 2744 | Ga0496115_0065507 | |||
| 2745 | Ga0496115_0111067 | |||
| 2746 | Ga0496115_0132050 | |||
| 2747 | Ga0496115_0404174 | |||
| 2748 | Ga0496115_0721576 | |||
| 2749 | Ga0496119_0267752 | |||
| 2750 | Ga0496120_0082987 | |||
| 2751 | Ga0496126_0106242 | |||
| 2752 | Ga0501031_0016903 | |||
| 2753 | Ga0501031_0051763 | |||
| 2754 | Ga0501031_0071567 | |||
| 2755 | Ga0501031_0340162 | |||
| 2756 | Ga0501032_0001454 | |||
| 2757 | Ga0501032_0003154 | |||
| 2758 | Ga0501032_0018618 | |||
| 2759 | Ga0501032_0030901 | |||
| 2760 | Ga0501032_0038818 | |||
| 2761 | Ga0501032_0050784 | |||
| 2762 | Ga0501033_0002947 | |||
| 2763 | Ga0501033_0006990 | |||
| 2764 | Ga0501033_0124785 | |||
| 2765 | Ga0501033_0136061 | |||
| 2766 | Ga0501033_0177558 | |||
| 2767 | Ga0501033_0211614 | |||
| 2768 | Ga0501034_0000016 | |||
| 2769 | Ga0501034_0004314 | |||
| 2770 | Ga0501034_0021654 | |||
| 2771 | Ga0501034_0028851 | |||
| 2772 | Ga0501034_0041128 | |||
| 2773 | Ga0501034_0214443 | |||
| 2774 | Ga0501036_0005059 | |||
| 2775 | Ga0501036_0017602 | |||
| 2776 | Ga0501036_0052565 | |||
| 2777 | Ga0501036_0110905 | |||
| 2778 | Ga0501036_0162704 | |||
| 2779 | Ga0501037_0007139 | |||
| 2780 | Ga0501037_0007493 | |||
| 2781 | Ga0501037_0026503 | |||
| 2782 | Ga0501037_0071906 | |||
| 2783 | Ga0501037_0715483 | |||
| 2784 | Ga0501038_0001253 | |||
| 2785 | Ga0501038_0002908 | |||
| 2786 | Ga0501038_0010618 | |||
| 2787 | Ga0501038_0095809 | |||
| 2788 | Ga0501038_0171721 | |||
| 2789 | Ga0501038_0367635 | |||
| 2790 | Ga0501038_0406827 | |||
| 2791 | Ga0501039_0065480 | |||
| 2792 | Ga0501039_0313513 | |||
| 2793 | Ga0501040_0031903 | |||
| 2794 | Ga0501041_0419939 | |||
| 2795 | Ga0501042_0005568 | |||
| 2796 | Ga0501042_0024723 | |||
| 2797 | Ga0501042_0334147 | |||
| 2798 | Ga0501043_0002314 | |||
| 2799 | Ga0501043_0008272 | |||
| 2800 | Ga0501043_0016636 | |||
| 2801 | Ga0501043_0017277 | |||
| 2802 | Ga0501043_0062835 | |||
| 2803 | Ga0501043_0268737 | |||
| 2804 | Ga0501046_0061563 | |||
| 2805 | Ga0501046_0063234 | |||
| 2806 | Ga0501046_0356910 | |||
| 2807 | Ga0501047_0009383 | |||
| 2808 | Ga0501047_0088241 | |||
| 2809 | Ga0501047_0139487 | |||
| 2810 | Ga0501047_0142513 | |||
| 2811 | Ga0501047_0152011 | |||
| 2812 | Ga0501047_0272187 | |||
| 2813 | Ga0501047_0282064 | |||
| 2814 | Ga0501047_0377416 | |||
| 2815 | Ga0501048_0001305 | |||
| 2816 | Ga0501048_0401236 | |||
| 2817 | Ga0501067_0050506 | |||
| 2818 | Ga0501068_0020806 | |||
| 2819 | Ga0501069_0057695 | |||
| 2820 | Ga0501070_0016103 | |||
| 2821 | Ga0501070_0052102 | |||
| 2822 | Ga0501070_0156698 | |||
| 2823 | Ga0501070_0201695 | |||
| 2824 | Ga0501070_0292436 | |||
| 2825 | Ga0501071_0047389 | |||
| 2826 | Ga0501071_0265975 | |||
| 2827 | Ga0501072_0010688 | |||
| 2828 | Ga0501072_0676157 | |||
| 2829 | Ga0501073_0079767 | |||
| 2830 | Ga0501073_0105234 | |||
| 2831 | Ga0501074_0002571 | |||
| 2832 | Ga0501074_0068836 | |||
| 2833 | Ga0501076_0039284 | |||
| 2834 | Ga0501077_0098383 | |||
| 2835 | Ga0501079_0234851 | |||
| 2836 | Ga0501080_0336893 | |||
| 2837 | Ga0501080_0613978 | |||
| 2838 | Ga0501083_0016959 | |||
| 2839 | Ga0501083_0091404 | |||
| 2840 | Ga0501035_0002181 | |||
| 2841 | Ga0501035_0002597 | |||
| 2842 | Ga0501035_0007069 | |||
| 2843 | Ga0501035_0029299 | |||
| 2844 | Ga0501035_0030189 | |||
| 2845 | Ga0501035_0038568 | |||
| 2846 | Ga0501035_0157119 | |||
| 2847 | Ga0501044_0001412 | |||
| 2848 | Ga0501044_0004634 | |||
| 2849 | Ga0501044_0007364 | |||
| 2850 | Ga0501044_0025701 | |||
| 2851 | Ga0501044_0058708 | |||
| 2852 | Ga0501044_0073541 | |||
| 2853 | Ga0501044_0108568 | |||
| 2854 | Ga0501044_0422714 | |||
| 2855 | Ga0501045_0290429 | |||
| 2856 | nmdc:mga03683_118753_c1 | |||
| 2857 | nmdc:mga03n38_12344_c1 | |||
| 2858 | nmdc:mga03n38_282032_c1 | |||
| 2859 | nmdc:mga00v17_279831_c1 | |||
| 2860 | nmdc:mga0yw44_184776_c1 | |||
| 2861 | nmdc:mga0yw44_222155_c1 | |||
| 2862 | nmdc:mga06z11_19685_c1 | |||
| 2863 | nmdc:mga06z11_630545_c1 | |||
| 2864 | nmdc:mga04h51_1787_c1 | |||
| 2865 | nmdc:mga07m45_45972_c1 | |||
| 2866 | nmdc:mga07m45_93181_c1 | |||
| 2867 | nmdc:mga05p37_1009026_c1 | |||
| 2868 | nmdc:mga09592_488415_c1 | |||
| 2869 | nmdc:mga0n895_232567_c1 | |||
| 2870 | nmdc:mga0rr50_819579_c1 | |||
| 2871 | Ga0495601_0018173 | |||
| 2872 | Ga0495601_0018368 | |||
| 2873 | Ga0495612_0042562 | |||
| 2874 | Ga0500610_0101202 | |||
| 2875 | Ga0495595_0013512 | |||
| 2876 | Ga0495619_0074515 | |||
| 2877 | Ga0495619_0317097 | |||
| 2878 | Ga0500578_0022512 | |||
| 2879 | Ga0500646_0036317 | |||
| 2880 | Ga0500583_0284352 | |||
| 2881 | Ga0500651_0033941 | |||
| 2882 | Ga0500566_0057348 | |||
| 2883 | Ga0500641_0056734 | |||
| 2884 | Ga0500650_0047308 | |||
| 2885 | Ga0500654_064084 | |||
| 2886 | Ga0500553_171286 | |||
| 2887 | Ga0500560_000672 | |||
| 2888 | Ga0500560_121181 | |||
| 2889 | Ga0500569_001048 | |||
| 2890 | Ga0500628_001995 | |||
| 2891 | Ga0500652_002797 | |||
| 2892 | Ga0500655_019641 | |||
| 2893 | Ga0500658_0048578 | |||
| 2894 | Ga0500559_0010867 | |||
| 2895 | Ga0500561_0001401 | |||
| 2896 | Ga0500573_0065384 | |||
| 2897 | Ga0500573_0090678 | |||
| 2898 | Ga0500577_0110128 | |||
| 2899 | Ga0500579_080724 | |||
| 2900 | Ga0500579_128243 | |||
| 2901 | Ga0500600_0032396 | |||
| 2902 | Ga0500600_0167422 | |||
| 2903 | Ga0500616_0000636 | |||
| 2904 | Ga0500616_0004879 | |||
| 2905 | Ga0500633_0000859 | |||
| 2906 | Ga0500634_0038614 | |||
| 2907 | Ga0500634_0187570 | |||
| 2908 | Ga0500656_007510 | |||
| 2909 | Ga0500587_006152 | |||
| 2910 | Ga0501084_0007644 | |||
| 2911 | Ga0587077_029969 | |||
| 2912 | Ga0587072_032312 | |||
| 2913 | Ga0501082_0008555 | |||
| 2914 | Ga0501082_0016216 | |||
| 2915 | Ga0466962_0003282 | |||
| 2916 | Ga0466962_0064678 | |||
| 2917 | Ga0466962_0210027 | |||
| 2918 | 2501940727 | |||
| 2919 | 2515497550 | |||
| 2920 | 2515757290 | |||
| 2921 | 2516088761 | |||
| 2922 | 2537900994 | |||
| 2923 | 2547405475 | |||
| 2924 | 2554261272 | |||
| 2925 | 2558907664 | |||
| 2926 | 2559425202 | |||
| 2927 | 2566996278 | |||
| 2928 | 2585311575 | |||
| 2929 | 2585313866 | |||
| 2930 | 2586063335 | |||
| 2931 | 2616902984 | |||
| 2932 | 2623588786 | |||
| 2933 | 2643760684 | |||
| 2934 | 2643900870 | |||
| 2935 | 2643946260 | |||
| 2936 | 2644018134 | |||
| 2937 | 2644083397 | |||
| 2938 | 2644177339 | |||
| 2939 | 2644266344 | |||
| 2940 | 2644388031 | |||
| 2941 | 2644407017 | |||
| 2942 | 2644433049 | |||
| 2943 | 2644441032 | |||
| 2944 | 2644523993 | |||
| 2945 | 2644630416 | |||
| 2946 | 2644666318 | |||
| 2947 | 2644668090 | |||
| 2948 | 2691513777 | |||
| 2949 | 2729907936 | |||
| 2950 | 2738890634 | |||
| 2951 | 2775658065 | |||
| 2952 | 2784585931 | |||
| 2953 | 2785339137 | |||
| 2954 | 2785366081 | |||
| 2955 | 2786667069 | |||
| 2956 | 2795783039 | |||
| 2957 | 2795797120 | |||
| 2958 | 2808831055 | |||
| 2959 | 2808846706 | |||
| 2960 | 2808852317 | |||
| 2961 | 2808879400 | |||
| 2962 | 2808891103 | |||
| 2963 | 2808896364 | |||
| 2964 | 2808917330 | |||
| 2965 | 2809229433 | |||
| 2966 | 2811846283 | |||
| 2967 | 2812321253 | |||
| 2968 | 2812361678 | |||
| 2969 | 2812477115 | |||
| 2970 | 2816422962 | |||
| 2971 | 2816511118 | |||
| 2972 | 2819695723 | |||
| 2973 | 2819747346 | |||
| 2974 | 2831935698 | |||
| 2975 | 2844852650 | |||
| 2976 | 2852643204 | |||
| 2977 | 2856863040 | |||
| 2978 | 2857742200 | |||
| 2979 | 2858907267 | |||
| 2980 | 2862180816 | |||
| 2981 | 2862282256 | |||
| 2982 | 2862389754 | |||
| 2983 | 2862512618 | |||
| 2984 | 2862574705 | |||
| 2985 | 2862710197 | |||
| 2986 | 2863075392 | |||
| 2987 | 2863410784 | |||
| 2988 | 2867371808 | |||
| 2989 | 2867435303 | |||
| 2990 | 2867475885 | |||
| 2991 | 2867511418 | |||
| 2992 | 2870785023 | |||
| 2993 | 2873158307 | |||
| 2994 | 2875398415 | |||
| 2995 | 2877684419 | |||
| 2996 | 2883824529 | |||
| 2997 | 2884997325 | |||
| 2998 | 2887479704 | |||
| 2999 | 2899362727 | |||
| 3000 | 2899376475 | |||
| 3001 | 2902583275 | |||
| 3002 | 2904498314 | |||
| 3003 | 2904540916 | |||
| 3004 | 2904777674 | |||
| 3005 | 2910812021 | |||
| 3006 | 2912723780 | |||
| 3007 | 2912726888 | |||
| 3008 | 2912758147 | |||
| 3009 | 2918507459 | |||
| 3010 | 2919035046 | |||
| 3011 | 2919059871 | |||
| 3012 | 2919395589 | |||
| 3013 | 2919468844 | |||
| 3014 | 2919540503 | |||
| 3015 | 2922555008 | |||
| 3016 | 2932428357 | |||
| 3017 | 2933422459 | |||
| 3018 | 2935891088 | |||
| 3019 | 2939601386 | |||
| 3020 | 2939648760 | |||
| 3021 | 2939675185 | |||
| 3022 | 2945920589 | |||
| 3023 | 2945943186 | |||
| 3024 | 2945959023 | |||
| 3025 | 2946025928 | |||
| 3026 | 2946039101 | |||
| 3027 | 2946045779 | |||
| 3028 | 2946062862 | |||
| 3029 | 2946064487 | |||
| 3030 | 2946072916 | |||
| 3031 | 2947224433 | |||
| 3032 | 2954000488 | |||
| 3033 | 2954009082 | |||
| 3034 | 2954390031 | |||
| 3035 | 2954682153 | |||
| 3036 | 2954690771 | |||
| 3037 | 2954700620 | |||
| 3038 | 2954701609 | |||
| 3039 | 2954719270 | |||
| 3040 | 2954729242 | |||
| 3041 | 2954732568 | |||
| 3042 | 2954748142 | |||
| 3043 | 2954751447 | |||
| 3044 | 2954767265 | |||
| 3045 | 2966599014 | |||
| 3046 | 2974302890 | |||
| 3047 | 2990045399 | |||
| 3048 | 2990066890 | |||
| 3049 | 2990093467 | |||
| 3050 | 2995465621 | |||
| 3051 | 2996228284 | |||
| 3052 | 2997452412 | |||
| 3053 | 3006326537 | |||
| 3054 | 3006396587 | |||
| 3055 | 3006490757 | |||
| 3056 | 3006494051 | |||
| 3057 | 649815187 | |||
| 3058 | 8004024712 | |||
| 3059 | 8004028319 | |||
| 3060 | 8008486870 | |||
| 3061 | 8008564834 | |||
| 3062 | 8008581520 | |||
| 3063 | 8023624877 | |||
| 3064 | 8025526127 | |||
| 3065 | 8025537224 | |||
| 3066 | 8047894486 | |||
| 3067 | 8048364566 | |||
| 3068 | 8048371503 | |||
| 3069 | 8048380437 | |||
| 3070 | 8048407554 | |||
| 3071 | 8054110061 | |||
| 3072 | 8054165511 | |||
| 3073 | 8056214155 | |||
| 3074 | 8056830523 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1kk9-assembly1.cif.gz_A | crystal structure of e. coli ycio | 0.9552 | 1 | 200 |
| 1kk9-assembly1.cif.gz_A | crystal structure of e. coli ycio | 0.9506 | 1 | 200 |
| 6f89-assembly2.cif.gz_B | structure of h234a/y235a p.abyssi sua5 | 0.8914 | 3 | 192 |
| 3aje-assembly1.cif.gz_A | crystal structure of s. tokodaii sua5 complexed with l-threonine and amppnp | 0.8908 | 1 | 199 |
| 6f87-assembly3.cif.gz_C | crystal structure of p. abyssi sua5 complexed with l-threonine and ppi | 0.8898 | 4 | 192 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1kk9A00 | Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase | 0.9504 | 1 | 200 | 3.90.870.10 |
| 1kk9A00 | Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase | 0.9227 | 1 | 200 | 3.90.870.10 |
| af_Q6YZF2_76_294_3.90.870.10 | Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase | 0.9165 | 1 | 195 | 3.90.870.10 |
| af_Q60369_7_206_3.90.870.10 | Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase | 0.9035 | 9 | 199 | 3.90.870.10 |
| af_P9WGC9_2_211_3.90.870.10 | Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase | 0.9006 | 9 | 199 | 3.90.870.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1C6SAI6-F1-model_v4 | tRNA threonylcarbamoyl adenosine modification protein, Sua5/YciO/YrdC/YwlC family | 0.979 | 1 | 200 |
GO:0003725
|
| AF-A0A3Q9L060-F1-model_v4 | Threonylcarbamoyl-AMP synthase | 0.9781 | 1 | 200 |
GO:0003725
|
| AF-A0A5B7UKK9-F1-model_v4 | Threonylcarbamoyl-AMP synthase (EC 2.7.7.87) | 0.9773 | 1 | 200 |
GO:0003725
GO:0061710 |
| AF-A0A6G4TWY2-F1-model_v4 | Threonylcarbamoyl-AMP synthase | 0.9769 | 1 | 200 |
GO:0003725
|
| AF-A0A163SWA8-F1-model_v4 | Threonylcarbamoyl-AMP synthase (EC 2.7.7.87) | 0.9769 | 1 | 200 |
GO:0003725
GO:0061710 |