F494584
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1528 | 454 | 1528 | 49 |
Family's Representative Sequence
| Representative Sequence | 3300042876|Ga0451577_0078362|Ga0451577_0078362_1637_1813 |
| Length | 58 |
| Sequence | LGANLKEVAMLNTIAVVLIILWLLGLVTSYTLGGFIHILLVIAXXXXLLRVIRGKPPL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 6 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 7 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 8 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 9 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 10 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 14 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 15 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 16 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 17 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 18 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 19 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 20 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 21 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 22 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 24 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 33 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 68 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 77 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 85 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 87 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 88 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 89 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 91 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 92 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 93 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 94 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 95 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 96 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 97 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 98 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 99 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 100 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 101 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 102 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 103 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 105 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 106 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 107 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 108 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 109 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 110 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 112 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 113 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 114 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 115 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 116 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 117 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 118 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 119 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 120 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 121 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 123 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 124 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 125 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 142 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300019162 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 158 | 3300019190 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 159 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 160 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 161 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 162 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 163 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 164 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 165 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 166 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 167 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 168 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 169 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 170 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 171 | 3300023672 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 172 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 245 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 246 | 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Metagenome | Rhizosphere |
| 247 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 251 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 252 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 253 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 254 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 255 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 256 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 257 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 258 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 259 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 260 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 261 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 262 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 263 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 264 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 265 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 266 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 267 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 268 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 269 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 270 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 271 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 272 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 273 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 274 | 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 275 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 276 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 277 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 278 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 279 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 280 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 281 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 282 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 283 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 284 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 285 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 286 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 287 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 288 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 289 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 290 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 291 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 292 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 293 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 294 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 295 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 296 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 297 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 298 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 299 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 300 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 301 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 302 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 303 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 304 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 305 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 306 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 307 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 308 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 309 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 310 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 311 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 312 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 313 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 314 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 348 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 349 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 350 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 351 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 352 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 353 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 354 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 356 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 357 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 358 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 359 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 360 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 361 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 362 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 363 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 364 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 365 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 399 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 410 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 411 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 412 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 413 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 414 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 415 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 416 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 417 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 418 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 419 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 420 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 421 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 422 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 423 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 424 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 425 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 426 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 427 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 428 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 429 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 430 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 431 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 432 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 433 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 434 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 435 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 436 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 437 | 3300059631 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 438 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 439 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 440 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 441 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 442 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 443 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 444 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 445 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 446 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 447 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 448 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 449 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 450 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 451 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 452 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 453 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.64 |
| Metatranscriptomes | 9.36 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.65 |
| Nodule | 0 |
| Rhizoplane | 2.36 |
| Rhizosphere | 96.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.92 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_14242384 | 2162886012 | Unclassified | 826 |
| 2 | MBSR1b_contig_8201409 | 2162886012 | Unclassified | 1149 |
| 3 | JGI24746J21847_1029963 | 3300001977 | Bacteria | 750 |
| 4 | JGI24746J21847_1043975 | 3300001977 | Bacteria | 623 |
| 5 | JGI24737J22298_10024215 | 3300001990 | Bacteria | 1922 |
| 6 | JGI24743J22301_10006758 | 3300001991 | Bacteria | 1967 |
| 7 | JGI24750J21931_1028019 | 3300002070 | Bacteria | 817 |
| 8 | JGI24745J21846_1020836 | 3300002073 | Bacteria | 770 |
| 9 | JGI24749J21850_1070969 | 3300002076 | Bacteria | 538 |
| 10 | JGI24035J26624_1004495 | 3300002126 | Unclassified | 1325 |
| 11 | JGI24035J26624_1005983 | 3300002126 | Bacteria | 1170 |
| 12 | JGI24033J26618_1012705 | 3300002155 | Bacteria | 1016 |
| 13 | JGI25150J39212_1003133 | 3300002774 | Bacteria | 3940 |
| 14 | rootH1_10117195 | 3300003323 | Bacteria | 2045 |
| 15 | rootH1_10386370 | 3300003323 | Bacteria | 1316 |
| 16 | Ga0007416J51690_1082995 | 3300003577 | Unclassified | 568 |
| 17 | Ga0007416J51690_1087572 | 3300003577 | Unclassified | 515 |
| 18 | Ga0007429J51699_1116211 | 3300003579 | Unclassified | 542 |
| 19 | Ga0032354_1066680 | 3300003693 | Unclassified | 1500 |
| 20 | Ga0006780_1035515 | 3300003735 | Unclassified | 665 |
| 21 | JGI25405J52794_10002815 | 3300003911 | Unclassified | 3018 |
| 22 | JGI25405J52794_10091519 | 3300003911 | Bacteria | 674 |
| 23 | Ga0058859_10573809 | 3300004798 | Unclassified | 578 |
| 24 | Ga0058863_11637505 | 3300004799 | Unclassified | 528 |
| 25 | Ga0058861_12064034 | 3300004800 | Unclassified | 513 |
| 26 | Ga0058860_10830546 | 3300004801 | Unclassified | 573 |
| 27 | Ga0058860_11908751 | 3300004801 | Unclassified | 788 |
| 28 | Ga0058862_10065783 | 3300004803 | Unclassified | 595 |
| 29 | Ga0065704_10458354 | 3300005289 | Unclassified | 699 |
| 30 | Ga0065704_10507344 | 3300005289 | Bacteria | 663 |
| 31 | Ga0065712_10048891 | 3300005290 | Unclassified | 727 |
| 32 | Ga0065712_10069346 | 3300005290 | Bacteria | 7486 |
| 33 | Ga0065712_10240498 | 3300005290 | Unclassified | 985 |
| 34 | Ga0065712_10259197 | 3300005290 | Unclassified | 941 |
| 35 | Ga0065715_10001014 | 3300005293 | Bacteria | 7370 |
| 36 | Ga0065715_10102904 | 3300005293 | Bacteria | 3073 |
| 37 | Ga0065715_10182618 | 3300005293 | Bacteria | 1466 |
| 38 | Ga0065715_10290619 | 3300005293 | Unclassified | 1046 |
| 39 | Ga0065715_10372329 | 3300005293 | Unclassified | 919 |
| 40 | Ga0065715_10674335 | 3300005293 | Unclassified | 665 |
| 41 | Ga0065707_10046903 | 3300005295 | Bacteria | 936 |
| 42 | Ga0065707_10087756 | 3300005295 | Bacteria | 4900 |
| 43 | Ga0065707_10374149 | 3300005295 | Unclassified | 886 |
| 44 | Ga0065707_10674810 | 3300005295 | Bacteria | 651 |
| 45 | Ga0070658_10076572 | 3300005327 | Bacteria | 2743 |
| 46 | Ga0070658_10095655 | 3300005327 | Bacteria | 2452 |
| 47 | Ga0070658_11807841 | 3300005327 | Bacteria | 528 |
| 48 | Ga0070676_10000418 | 3300005328 | Bacteria | 20037 |
| 49 | Ga0070676_10522339 | 3300005328 | Bacteria | 846 |
| 50 | Ga0070676_10623758 | 3300005328 | Unclassified | 780 |
| 51 | Ga0070676_10801171 | 3300005328 | Viruses | 695 |
| 52 | Ga0070676_10853742 | 3300005328 | Bacteria | 675 |
| 53 | Ga0070683_100010649 | 3300005329 | Bacteria | 7905 |
| 54 | Ga0070683_100017263 | 3300005329 | Bacteria | 6377 |
| 55 | Ga0070683_100027215 | 3300005329 | Bacteria | 5156 |
| 56 | Ga0070683_100079856 | 3300005329 | Bacteria | 3062 |
| 57 | Ga0070683_100134395 | 3300005329 | Bacteria | 2342 |
| 58 | Ga0070683_100343424 | 3300005329 | Bacteria | 1421 |
| 59 | Ga0070683_100883903 | 3300005329 | Bacteria | 857 |
| 60 | Ga0070690_100043378 | 3300005330 | Unclassified | 2852 |
| 61 | Ga0070690_100558308 | 3300005330 | Unclassified | 864 |
| 62 | Ga0070670_100011058 | 3300005331 | Bacteria | 7711 |
| 63 | Ga0070670_100074116 | 3300005331 | Bacteria | 2923 |
| 64 | Ga0070677_10007365 | 3300005333 | Bacteria | 3670 |
| 65 | Ga0068869_100054842 | 3300005334 | Bacteria | 2903 |
| 66 | Ga0068869_100203957 | 3300005334 | Bacteria | 1560 |
| 67 | Ga0068869_100254504 | 3300005334 | Bacteria | 1404 |
| 68 | Ga0068869_100945966 | 3300005334 | Unclassified | 748 |
| 69 | Ga0068869_101202165 | 3300005334 | Unclassified | 666 |
| 70 | Ga0068869_101935665 | 3300005334 | Unclassified | 529 |
| 71 | Ga0070666_10005575 | 3300005335 | Bacteria | 7721 |
| 72 | Ga0070666_10016515 | 3300005335 | Bacteria | 4722 |
| 73 | Ga0070666_10127985 | 3300005335 | Bacteria | 1763 |
| 74 | Ga0070666_11180931 | 3300005335 | Bacteria | 570 |
| 75 | Ga0070680_100300048 | 3300005336 | Bacteria | 1362 |
| 76 | Ga0070680_100859935 | 3300005336 | Unclassified | 782 |
| 77 | Ga0070682_100055437 | 3300005337 | Bacteria | 2489 |
| 78 | Ga0068868_100003887 | 3300005338 | Bacteria | 10437 |
| 79 | Ga0068868_100022957 | 3300005338 | Bacteria | 4717 |
| 80 | Ga0068868_100031456 | 3300005338 | Bacteria | 4076 |
| 81 | Ga0068868_100035075 | 3300005338 | Bacteria | 3876 |
| 82 | Ga0068868_100175841 | 3300005338 | Bacteria | 1774 |
| 83 | Ga0068868_101119674 | 3300005338 | Bacteria | 725 |
| 84 | Ga0068868_101215670 | 3300005338 | Unclassified | 697 |
| 85 | Ga0070660_100012509 | 3300005339 | Bacteria | 6062 |
| 86 | Ga0070660_100258012 | 3300005339 | Unclassified | 1423 |
| 87 | Ga0070660_100315672 | 3300005339 | Bacteria | 1283 |
| 88 | Ga0070689_100000951 | 3300005340 | Bacteria | 18036 |
| 89 | Ga0070689_100008894 | 3300005340 | Bacteria | 7100 |
| 90 | Ga0070689_100056957 | 3300005340 | Bacteria | 3032 |
| 91 | Ga0070689_100088561 | 3300005340 | Bacteria | 2437 |
| 92 | Ga0070691_10243083 | 3300005341 | Bacteria | 962 |
| 93 | Ga0070691_10456613 | 3300005341 | Bacteria | 730 |
| 94 | Ga0070687_100000361 | 3300005343 | Bacteria | 15538 |
| 95 | Ga0070687_100021338 | 3300005343 | Bacteria | 3042 |
| 96 | Ga0070687_100040095 | 3300005343 | Unclassified | 2358 |
| 97 | Ga0070661_100006977 | 3300005344 | Bacteria | 7797 |
| 98 | Ga0070661_100030810 | 3300005344 | Bacteria | 3876 |
| 99 | Ga0070661_100033886 | 3300005344 | Bacteria | 3702 |
| 100 | Ga0070661_100694709 | 3300005344 | Bacteria | 829 |
| 101 | Ga0070692_10644261 | 3300005345 | Bacteria | 706 |
| 102 | Ga0070692_10715442 | 3300005345 | Bacteria | 675 |
| 103 | Ga0070668_100001339 | 3300005347 | Bacteria | 17602 |
| 104 | Ga0070668_100011324 | 3300005347 | Bacteria | 6644 |
| 105 | Ga0070668_100087415 | 3300005347 | Bacteria | 2453 |
| 106 | Ga0070669_100003769 | 3300005353 | Bacteria | 10950 |
| 107 | Ga0070669_100010101 | 3300005353 | Bacteria | 6714 |
| 108 | Ga0070669_100062749 | 3300005353 | Bacteria | 2733 |
| 109 | Ga0070669_100665988 | 3300005353 | Unclassified | 877 |
| 110 | Ga0070669_101335342 | 3300005353 | Bacteria | 621 |
| 111 | Ga0070675_100000360 | 3300005354 | Bacteria | 30832 |
| 112 | Ga0070675_100004745 | 3300005354 | Bacteria | 10373 |
| 113 | Ga0070675_100112789 | 3300005354 | Unclassified | 2302 |
| 114 | Ga0070671_100002249 | 3300005355 | Bacteria | 14908 |
| 115 | Ga0070671_100067121 | 3300005355 | Bacteria | 2990 |
| 116 | Ga0070671_100102517 | 3300005355 | Bacteria | 2401 |
| 117 | Ga0070671_100211683 | 3300005355 | Bacteria | 1644 |
| 118 | Ga0070671_101486856 | 3300005355 | Unclassified | 599 |
| 119 | Ga0070671_101751211 | 3300005355 | Unclassified | 552 |
| 120 | Ga0070671_101848539 | 3300005355 | Unclassified | 537 |
| 121 | Ga0070671_102113366 | 3300005355 | Bacteria | 502 |
| 122 | Ga0070674_100009313 | 3300005356 | Bacteria | 5879 |
| 123 | Ga0070674_101635160 | 3300005356 | Unclassified | 581 |
| 124 | Ga0070674_101795797 | 3300005356 | Unclassified | 556 |
| 125 | Ga0070673_100059046 | 3300005364 | Bacteria | 3035 |
| 126 | Ga0070673_100068950 | 3300005364 | Unclassified | 2833 |
| 127 | Ga0070673_100169580 | 3300005364 | Unclassified | 1862 |
| 128 | Ga0070673_100170740 | 3300005364 | Bacteria | 1856 |
| 129 | Ga0070673_100941656 | 3300005364 | Unclassified | 802 |
| 130 | Ga0070688_100018693 | 3300005365 | Bacteria | 4004 |
| 131 | Ga0070688_100071906 | 3300005365 | Bacteria | 2215 |
| 132 | Ga0070688_100207675 | 3300005365 | Bacteria | 1373 |
| 133 | Ga0070659_100001731 | 3300005366 | Bacteria | 15673 |
| 134 | Ga0070659_100065735 | 3300005366 | Bacteria | 2872 |
| 135 | Ga0070659_100191439 | 3300005366 | Bacteria | 1681 |
| 136 | Ga0070659_101927678 | 3300005366 | Unclassified | 530 |
| 137 | Ga0070667_100001138 | 3300005367 | Bacteria | 24198 |
| 138 | Ga0070667_100003924 | 3300005367 | Bacteria | 12635 |
| 139 | Ga0070667_100120314 | 3300005367 | Unclassified | 2283 |
| 140 | Ga0070667_100377286 | 3300005367 | Unclassified | 1287 |
| 141 | Ga0070667_101261312 | 3300005367 | Bacteria | 692 |
| 142 | Ga0070703_10129289 | 3300005406 | Bacteria | 926 |
| 143 | Ga0070709_10097351 | 3300005434 | Unclassified | 1953 |
| 144 | Ga0070709_10115928 | 3300005434 | Bacteria | 1808 |
| 145 | Ga0070709_10134276 | 3300005434 | Unclassified | 1693 |
| 146 | Ga0070709_10426617 | 3300005434 | Bacteria | 995 |
| 147 | Ga0070709_10426931 | 3300005434 | Unclassified | 994 |
| 148 | Ga0070714_100028342 | 3300005435 | Unclassified | 4645 |
| 149 | Ga0070714_100475561 | 3300005435 | Unclassified | 1189 |
| 150 | Ga0070714_100648771 | 3300005435 | Bacteria | 1016 |
| 151 | Ga0070714_101336297 | 3300005435 | Unclassified | 700 |
| 152 | Ga0070713_100047807 | 3300005436 | Bacteria | 3519 |
| 153 | Ga0070713_100678121 | 3300005436 | Unclassified | 983 |
| 154 | Ga0070710_10051355 | 3300005437 | Unclassified | 2314 |
| 155 | Ga0070710_10994818 | 3300005437 | Unclassified | 611 |
| 156 | Ga0070710_11494080 | 3300005437 | Unclassified | 507 |
| 157 | Ga0070701_10027101 | 3300005438 | Unclassified | 2803 |
| 158 | Ga0070701_10410704 | 3300005438 | Bacteria | 860 |
| 159 | Ga0070711_101121249 | 3300005439 | Unclassified | 678 |
| 160 | Ga0070711_102060469 | 3300005439 | Unclassified | 502 |
| 161 | Ga0070705_100047803 | 3300005440 | Bacteria | 2475 |
| 162 | Ga0070705_100066937 | 3300005440 | Bacteria | 2156 |
| 163 | Ga0070705_100074876 | 3300005440 | Bacteria | 2060 |
| 164 | Ga0070705_100138765 | 3300005440 | Bacteria | 1597 |
| 165 | Ga0070705_100563672 | 3300005440 | Bacteria | 875 |
| 166 | Ga0070705_100589801 | 3300005440 | Bacteria | 858 |
| 167 | Ga0070705_100864064 | 3300005440 | Bacteria | 725 |
| 168 | Ga0070705_101957723 | 3300005440 | Unclassified | 500 |
| 169 | Ga0070700_100009155 | 3300005441 | Bacteria | 5427 |
| 170 | Ga0070700_100102198 | 3300005441 | Bacteria | 1890 |
| 171 | Ga0070700_101559147 | 3300005441 | Bacteria | 563 |
| 172 | Ga0070694_100050845 | 3300005444 | Bacteria | 2795 |
| 173 | Ga0070694_100074804 | 3300005444 | Bacteria | 2342 |
| 174 | Ga0070694_100666426 | 3300005444 | Bacteria | 843 |
| 175 | Ga0070694_100828183 | 3300005444 | Bacteria | 760 |
| 176 | Ga0070694_100853483 | 3300005444 | Bacteria | 749 |
| 177 | Ga0070708_100012156 | 3300005445 | Bacteria | 7018 |
| 178 | Ga0070708_100114605 | 3300005445 | Bacteria | 2480 |
| 179 | Ga0070708_100205571 | 3300005445 | Bacteria | 1844 |
| 180 | Ga0070708_100738985 | 3300005445 | Bacteria | 925 |
| 181 | Ga0070708_100895387 | 3300005445 | Bacteria | 833 |
| 182 | Ga0070708_101623374 | 3300005445 | Unclassified | 602 |
| 183 | Ga0070663_100159601 | 3300005455 | Bacteria | 1735 |
| 184 | Ga0070678_101290683 | 3300005456 | Unclassified | 679 |
| 185 | Ga0070678_102057956 | 3300005456 | Unclassified | 540 |
| 186 | Ga0070662_100000570 | 3300005457 | Bacteria | 22495 |
| 187 | Ga0070662_100006539 | 3300005457 | Bacteria | 7520 |
| 188 | Ga0070662_100016016 | 3300005457 | Bacteria | 5030 |
| 189 | Ga0070662_100105636 | 3300005457 | Bacteria | 2138 |
| 190 | Ga0070681_10014963 | 3300005458 | Bacteria | 7715 |
| 191 | Ga0070681_10075591 | 3300005458 | Bacteria | 3328 |
| 192 | Ga0068867_100025103 | 3300005459 | Bacteria | 4275 |
| 193 | Ga0068867_100169271 | 3300005459 | Bacteria | 1729 |
| 194 | Ga0068867_100701556 | 3300005459 | Bacteria | 893 |
| 195 | Ga0068867_100945807 | 3300005459 | Bacteria | 778 |
| 196 | Ga0068867_101424476 | 3300005459 | Unclassified | 643 |
| 197 | Ga0070685_10034317 | 3300005466 | Bacteria | 2857 |
| 198 | Ga0070706_100021634 | 3300005467 | Bacteria | 5923 |
| 199 | Ga0070706_100201862 | 3300005467 | Bacteria | 1857 |
| 200 | Ga0070706_100428084 | 3300005467 | Bacteria | 1232 |
| 201 | Ga0070706_100573863 | 3300005467 | Unclassified | 1049 |
| 202 | Ga0070706_100829556 | 3300005467 | Bacteria | 855 |
| 203 | Ga0070706_101135363 | 3300005467 | Bacteria | 719 |
| 204 | Ga0070707_100007972 | 3300005468 | Bacteria | 9837 |
| 205 | Ga0070707_100098485 | 3300005468 | Unclassified | 2832 |
| 206 | Ga0070707_100146787 | 3300005468 | Bacteria | 2296 |
| 207 | Ga0070707_100354881 | 3300005468 | Bacteria | 1424 |
| 208 | Ga0070707_101004367 | 3300005468 | Bacteria | 800 |
| 209 | Ga0070707_101289453 | 3300005468 | Unclassified | 697 |
| 210 | Ga0070707_101433484 | 3300005468 | Bacteria | 657 |
| 211 | Ga0070698_100045677 | 3300005471 | Bacteria | 4482 |
| 212 | Ga0070698_100180208 | 3300005471 | Bacteria | 2051 |
| 213 | Ga0070698_101228981 | 3300005471 | Unclassified | 699 |
| 214 | Ga0070698_101537069 | 3300005471 | Bacteria | 617 |
| 215 | Ga0070698_101985517 | 3300005471 | Bacteria | 535 |
| 216 | Ga0070698_102180058 | 3300005471 | Bacteria | 508 |
| 217 | Ga0070699_100012669 | 3300005518 | Bacteria | 7273 |
| 218 | Ga0070699_100181860 | 3300005518 | Bacteria | 1866 |
| 219 | Ga0070699_100713643 | 3300005518 | Unclassified | 916 |
| 220 | Ga0070699_101330689 | 3300005518 | Bacteria | 659 |
| 221 | Ga0070699_101361395 | 3300005518 | Unclassified | 651 |
| 222 | Ga0070699_102158714 | 3300005518 | Bacteria | 508 |
| 223 | Ga0070679_100002344 | 3300005530 | Bacteria | 17138 |
| 224 | Ga0070679_100004021 | 3300005530 | Bacteria | 13549 |
| 225 | Ga0070679_100623111 | 3300005530 | Bacteria | 1022 |
| 226 | Ga0070679_101453141 | 3300005530 | Bacteria | 632 |
| 227 | Ga0070684_100000110 | 3300005535 | Bacteria | 53697 |
| 228 | Ga0070684_100000523 | 3300005535 | Bacteria | 26285 |
| 229 | Ga0070684_100015073 | 3300005535 | Bacteria | 6282 |
| 230 | Ga0070684_100070037 | 3300005535 | Bacteria | 3085 |
| 231 | Ga0070684_100071702 | 3300005535 | Bacteria | 3048 |
| 232 | Ga0070684_100105770 | 3300005535 | Bacteria | 2518 |
| 233 | Ga0070684_100265868 | 3300005535 | Bacteria | 1569 |
| 234 | Ga0070684_101072016 | 3300005535 | Bacteria | 757 |
| 235 | Ga0070697_100003151 | 3300005536 | Bacteria | 12680 |
| 236 | Ga0070697_100075581 | 3300005536 | Bacteria | 2769 |
| 237 | Ga0070697_100081548 | 3300005536 | Bacteria | 2666 |
| 238 | Ga0070697_101062637 | 3300005536 | Unclassified | 720 |
| 239 | Ga0070697_101217611 | 3300005536 | Bacteria | 671 |
| 240 | Ga0070697_101302716 | 3300005536 | Unclassified | 648 |
| 241 | Ga0068853_100002222 | 3300005539 | Bacteria | 14509 |
| 242 | Ga0068853_100011324 | 3300005539 | Bacteria | 7242 |
| 243 | Ga0068853_100024353 | 3300005539 | Bacteria | 5073 |
| 244 | Ga0068853_100109926 | 3300005539 | Bacteria | 2448 |
| 245 | Ga0070672_100005622 | 3300005543 | Bacteria | 8339 |
| 246 | Ga0070672_100221563 | 3300005543 | Bacteria | 1587 |
| 247 | Ga0070672_100269157 | 3300005543 | Unclassified | 1438 |
| 248 | Ga0070686_100006667 | 3300005544 | Bacteria | 6429 |
| 249 | Ga0070686_100052436 | 3300005544 | Bacteria | 2601 |
| 250 | Ga0070686_100140984 | 3300005544 | Bacteria | 1678 |
| 251 | Ga0070686_100354272 | 3300005544 | Bacteria | 1104 |
| 252 | Ga0070686_100594547 | 3300005544 | Unclassified | 871 |
| 253 | Ga0070686_101267599 | 3300005544 | Unclassified | 614 |
| 254 | Ga0070695_100001859 | 3300005545 | Bacteria | 11921 |
| 255 | Ga0070695_100506255 | 3300005545 | Bacteria | 935 |
| 256 | Ga0070695_100752721 | 3300005545 | Bacteria | 777 |
| 257 | Ga0070695_101899311 | 3300005545 | Unclassified | 500 |
| 258 | Ga0070696_100061380 | 3300005546 | Bacteria | 2630 |
| 259 | Ga0070696_100594979 | 3300005546 | Unclassified | 891 |
| 260 | Ga0070696_100781220 | 3300005546 | Bacteria | 785 |
| 261 | Ga0070696_101515178 | 3300005546 | Unclassified | 574 |
| 262 | Ga0070696_101739384 | 3300005546 | Bacteria | 538 |
| 263 | Ga0070693_100414386 | 3300005547 | Bacteria | 937 |
| 264 | Ga0070665_100031101 | 3300005548 | Bacteria | 5373 |
| 265 | Ga0070665_100045170 | 3300005548 | Bacteria | 4424 |
| 266 | Ga0070665_100422681 | 3300005548 | Bacteria | 1341 |
| 267 | Ga0070665_101128229 | 3300005548 | Bacteria | 795 |
| 268 | Ga0070704_100044846 | 3300005549 | Bacteria | 3075 |
| 269 | Ga0070704_100102942 | 3300005549 | Bacteria | 2156 |
| 270 | Ga0070704_100200404 | 3300005549 | Bacteria | 1611 |
| 271 | Ga0070704_100511688 | 3300005549 | Bacteria | 1043 |
| 272 | Ga0070704_100580010 | 3300005549 | Unclassified | 983 |
| 273 | Ga0070704_101724708 | 3300005549 | Bacteria | 579 |
| 274 | Ga0068855_100009737 | 3300005563 | Bacteria | 11593 |
| 275 | Ga0068855_100033699 | 3300005563 | Bacteria | 6110 |
| 276 | Ga0068855_100116447 | 3300005563 | Bacteria | 3063 |
| 277 | Ga0070664_100061800 | 3300005564 | Bacteria | 3193 |
| 278 | Ga0070664_100175364 | 3300005564 | Bacteria | 1903 |
| 279 | Ga0070664_100198634 | 3300005564 | Bacteria | 1789 |
| 280 | Ga0070664_100337093 | 3300005564 | Bacteria | 1369 |
| 281 | Ga0070664_100522606 | 3300005564 | Unclassified | 1096 |
| 282 | Ga0068857_100035905 | 3300005577 | Bacteria | 4391 |
| 283 | Ga0068857_100154280 | 3300005577 | Unclassified | 2082 |
| 284 | Ga0068857_100220699 | 3300005577 | Bacteria | 1731 |
| 285 | Ga0068857_100323360 | 3300005577 | Bacteria | 1425 |
| 286 | Ga0068857_100994560 | 3300005577 | Bacteria | 807 |
| 287 | Ga0068857_101416477 | 3300005577 | Bacteria | 676 |
| 288 | Ga0068857_102259923 | 3300005577 | Bacteria | 534 |
| 289 | Ga0068857_102300266 | 3300005577 | Unclassified | 529 |
| 290 | Ga0068854_100049779 | 3300005578 | Bacteria | 2995 |
| 291 | Ga0068854_100055299 | 3300005578 | Bacteria | 2856 |
| 292 | Ga0068854_100151666 | 3300005578 | Bacteria | 1788 |
| 293 | Ga0068854_100609558 | 3300005578 | Unclassified | 933 |
| 294 | Ga0068856_100003860 | 3300005614 | Bacteria | 15040 |
| 295 | Ga0068856_100031074 | 3300005614 | Bacteria | 5223 |
| 296 | Ga0068856_100130357 | 3300005614 | Bacteria | 2519 |
| 297 | Ga0068856_100199016 | 3300005614 | Bacteria | 2018 |
| 298 | Ga0068856_100305611 | 3300005614 | Unclassified | 1608 |
| 299 | Ga0070702_100025832 | 3300005615 | Unclassified | 3151 |
| 300 | Ga0070702_100605280 | 3300005615 | Bacteria | 822 |
| 301 | Ga0070702_100992685 | 3300005615 | Bacteria | 664 |
| 302 | Ga0070702_101722606 | 3300005615 | Bacteria | 521 |
| 303 | Ga0068852_100009188 | 3300005616 | Bacteria | 7325 |
| 304 | Ga0068852_100035207 | 3300005616 | Bacteria | 4174 |
| 305 | Ga0068852_100067942 | 3300005616 | Unclassified | 3117 |
| 306 | Ga0068852_100195988 | 3300005616 | Bacteria | 1909 |
| 307 | Ga0068852_100295585 | 3300005616 | Bacteria | 1566 |
| 308 | Ga0068852_100425841 | 3300005616 | Unclassified | 1310 |
| 309 | Ga0068852_100613478 | 3300005616 | Bacteria | 1093 |
| 310 | Ga0068859_100023227 | 3300005617 | Bacteria | 6223 |
| 311 | Ga0068859_100045876 | 3300005617 | Bacteria | 4390 |
| 312 | Ga0068859_100063366 | 3300005617 | Bacteria | 3728 |
| 313 | Ga0068859_100070965 | 3300005617 | Bacteria | 3518 |
| 314 | Ga0068859_100114165 | 3300005617 | Bacteria | 2765 |
| 315 | Ga0068859_100202971 | 3300005617 | Bacteria | 2067 |
| 316 | Ga0068859_100420258 | 3300005617 | Unclassified | 1433 |
| 317 | Ga0068859_100453774 | 3300005617 | Bacteria | 1378 |
| 318 | Ga0068859_101826801 | 3300005617 | Unclassified | 671 |
| 319 | Ga0068864_100003454 | 3300005618 | Bacteria | 13051 |
| 320 | Ga0068864_100095270 | 3300005618 | Unclassified | 2632 |
| 321 | Ga0068864_100276103 | 3300005618 | Bacteria | 1567 |
| 322 | Ga0068864_100276154 | 3300005618 | Bacteria | 1567 |
| 323 | Ga0068864_101146903 | 3300005618 | Bacteria | 775 |
| 324 | Ga0068864_101169306 | 3300005618 | Bacteria | 767 |
| 325 | Ga0068864_102530584 | 3300005618 | Unclassified | 519 |
| 326 | Ga0068866_10009452 | 3300005718 | Bacteria | 4140 |
| 327 | Ga0068866_10361479 | 3300005718 | Bacteria | 925 |
| 328 | Ga0068866_10428845 | 3300005718 | Unclassified | 859 |
| 329 | Ga0068861_100048419 | 3300005719 | Bacteria | 3213 |
| 330 | Ga0068861_100054073 | 3300005719 | Unclassified | 3057 |
| 331 | Ga0068861_100069321 | 3300005719 | Bacteria | 2728 |
| 332 | Ga0068861_100077089 | 3300005719 | Bacteria | 2599 |
| 333 | Ga0068861_100124289 | 3300005719 | Bacteria | 2085 |
| 334 | Ga0068861_100478422 | 3300005719 | Bacteria | 1121 |
| 335 | Ga0068861_102125696 | 3300005719 | Unclassified | 562 |
| 336 | Ga0068861_102564558 | 3300005719 | Bacteria | 513 |
| 337 | Ga0068851_10007988 | 3300005834 | Bacteria | 4878 |
| 338 | Ga0068851_10029576 | 3300005834 | Bacteria | 2713 |
| 339 | Ga0068851_10042166 | 3300005834 | Bacteria | 2297 |
| 340 | Ga0068851_10191976 | 3300005834 | Bacteria | 1136 |
| 341 | Ga0068851_10256774 | 3300005834 | Bacteria | 993 |
| 342 | Ga0068870_10034678 | 3300005840 | Unclassified | 2583 |
| 343 | Ga0068870_10576209 | 3300005840 | Bacteria | 761 |
| 344 | Ga0068863_100000974 | 3300005841 | Bacteria | 28785 |
| 345 | Ga0068863_100007127 | 3300005841 | Bacteria | 10964 |
| 346 | Ga0068863_100106002 | 3300005841 | Unclassified | 2674 |
| 347 | Ga0068863_100157606 | 3300005841 | Bacteria | 2174 |
| 348 | Ga0068863_100235298 | 3300005841 | Bacteria | 1767 |
| 349 | Ga0068863_100272384 | 3300005841 | Bacteria | 1639 |
| 350 | Ga0068863_100853902 | 3300005841 | Bacteria | 909 |
| 351 | Ga0068863_101001834 | 3300005841 | Bacteria | 838 |
| 352 | Ga0068858_100002623 | 3300005842 | Bacteria | 18113 |
| 353 | Ga0068858_100012503 | 3300005842 | Bacteria | 8007 |
| 354 | Ga0068858_100062288 | 3300005842 | Bacteria | 3449 |
| 355 | Ga0068858_100077532 | 3300005842 | Unclassified | 3087 |
| 356 | Ga0068858_100178109 | 3300005842 | Bacteria | 2006 |
| 357 | Ga0068858_100327128 | 3300005842 | Bacteria | 1466 |
| 358 | Ga0068858_101950348 | 3300005842 | Unclassified | 580 |
| 359 | Ga0068860_100001412 | 3300005843 | Bacteria | 26033 |
| 360 | Ga0068860_100004098 | 3300005843 | Bacteria | 14935 |
| 361 | Ga0068860_100005238 | 3300005843 | Bacteria | 13169 |
| 362 | Ga0068860_100025320 | 3300005843 | Bacteria | 5726 |
| 363 | Ga0068860_100027817 | 3300005843 | Bacteria | 5445 |
| 364 | Ga0068860_100197113 | 3300005843 | Bacteria | 1951 |
| 365 | Ga0068860_100405120 | 3300005843 | Bacteria | 1350 |
| 366 | Ga0068860_101448991 | 3300005843 | Unclassified | 708 |
| 367 | Ga0068862_100013065 | 3300005844 | Bacteria | 6868 |
| 368 | Ga0068862_100023721 | 3300005844 | Bacteria | 5142 |
| 369 | Ga0068862_100095688 | 3300005844 | Bacteria | 2591 |
| 370 | Ga0068862_100957557 | 3300005844 | Bacteria | 844 |
| 371 | Ga0068862_101757105 | 3300005844 | Bacteria | 629 |
| 372 | Ga0068862_102311646 | 3300005844 | Unclassified | 549 |
| 373 | Ga0081455_10000385 | 3300005937 | Bacteria | 58366 |
| 374 | Ga0081455_10001418 | 3300005937 | Bacteria | 29680 |
| 375 | Ga0081455_10057581 | 3300005937 | Bacteria | 3293 |
| 376 | Ga0081455_10059526 | 3300005937 | Bacteria | 3225 |
| 377 | Ga0081455_10165062 | 3300005937 | Unclassified | 1693 |
| 378 | Ga0081455_10639067 | 3300005937 | Bacteria | 687 |
| 379 | Ga0081455_10706022 | 3300005937 | Bacteria | 642 |
| 380 | Ga0081455_10885070 | 3300005937 | Unclassified | 556 |
| 381 | Ga0081455_10993195 | 3300005937 | Unclassified | 520 |
| 382 | Ga0081539_10057340 | 3300005985 | Bacteria | 2156 |
| 383 | Ga0081539_10131913 | 3300005985 | Bacteria | 1226 |
| 384 | Ga0070717_10029027 | 3300006028 | Unclassified | 4434 |
| 385 | Ga0070717_10739641 | 3300006028 | Unclassified | 894 |
| 386 | Ga0070717_10768654 | 3300006028 | Bacteria | 876 |
| 387 | Ga0075363_100216542 | 3300006048 | Bacteria | 1097 |
| 388 | Ga0070715_10019964 | 3300006163 | Unclassified | 2577 |
| 389 | Ga0070715_10024870 | 3300006163 | Bacteria | 2366 |
| 390 | Ga0070715_10311046 | 3300006163 | Unclassified | 846 |
| 391 | Ga0070715_10441016 | 3300006163 | Unclassified | 733 |
| 392 | Ga0070715_11088471 | 3300006163 | Unclassified | 503 |
| 393 | Ga0070716_100068870 | 3300006173 | Bacteria | 2072 |
| 394 | Ga0070716_100261331 | 3300006173 | Unclassified | 1185 |
| 395 | Ga0070716_100836321 | 3300006173 | Unclassified | 716 |
| 396 | Ga0070716_101406932 | 3300006173 | Unclassified | 567 |
| 397 | Ga0070712_100000422 | 3300006175 | Bacteria | 24266 |
| 398 | Ga0070712_100065633 | 3300006175 | Unclassified | 2577 |
| 399 | Ga0070712_100099079 | 3300006175 | Bacteria | 2151 |
| 400 | Ga0070712_101054375 | 3300006175 | Bacteria | 705 |
| 401 | Ga0070712_101724361 | 3300006175 | Bacteria | 548 |
| 402 | Ga0075367_10048417 | 3300006178 | Bacteria | 2504 |
| 403 | Ga0075366_10126873 | 3300006195 | Bacteria | 1539 |
| 404 | Ga0075366_10844090 | 3300006195 | Unclassified | 570 |
| 405 | Ga0097621_100001221 | 3300006237 | Bacteria | 17801 |
| 406 | Ga0097621_100032768 | 3300006237 | Bacteria | 4132 |
| 407 | Ga0097621_100039388 | 3300006237 | Bacteria | 3796 |
| 408 | Ga0097621_100082439 | 3300006237 | Bacteria | 2678 |
| 409 | Ga0097621_100115447 | 3300006237 | Bacteria | 2272 |
| 410 | Ga0097621_100544276 | 3300006237 | Unclassified | 1056 |
| 411 | Ga0097621_101517081 | 3300006237 | Unclassified | 636 |
| 412 | Ga0075370_10295510 | 3300006353 | Unclassified | 963 |
| 413 | Ga0068871_100000577 | 3300006358 | Bacteria | 25108 |
| 414 | Ga0068871_100010141 | 3300006358 | Bacteria | 6858 |
| 415 | Ga0068871_100024331 | 3300006358 | Bacteria | 4695 |
| 416 | Ga0068871_100059020 | 3300006358 | Bacteria | 3125 |
| 417 | Ga0068871_100097617 | 3300006358 | Bacteria | 2456 |
| 418 | Ga0068871_101077505 | 3300006358 | Unclassified | 751 |
| 419 | Ga0075428_100036788 | 3300006844 | Bacteria | 5390 |
| 420 | Ga0075428_100113690 | 3300006844 | Bacteria | 2949 |
| 421 | Ga0075428_100341508 | 3300006844 | Bacteria | 1608 |
| 422 | Ga0075428_100396864 | 3300006844 | Bacteria | 1478 |
| 423 | Ga0075428_101699616 | 3300006844 | Unclassified | 658 |
| 424 | Ga0075428_101810421 | 3300006844 | Unclassified | 635 |
| 425 | Ga0075430_100014611 | 3300006846 | Bacteria | 6687 |
| 426 | Ga0075430_100326437 | 3300006846 | Bacteria | 1268 |
| 427 | Ga0075430_100842435 | 3300006846 | Unclassified | 756 |
| 428 | Ga0075431_100063943 | 3300006847 | Bacteria | 3798 |
| 429 | Ga0075431_100105891 | 3300006847 | Unclassified | 2901 |
| 430 | Ga0075431_101211909 | 3300006847 | Unclassified | 717 |
| 431 | Ga0075431_101235827 | 3300006847 | Unclassified | 709 |
| 432 | Ga0075431_102190820 | 3300006847 | Unclassified | 507 |
| 433 | Ga0075433_10014786 | 3300006852 | Bacteria | 6388 |
| 434 | Ga0075433_10148874 | 3300006852 | Bacteria | 2082 |
| 435 | Ga0075433_10154580 | 3300006852 | Bacteria | 2041 |
| 436 | Ga0075433_10234774 | 3300006852 | Bacteria | 1628 |
| 437 | Ga0075433_10865416 | 3300006852 | Unclassified | 789 |
| 438 | Ga0075434_100017000 | 3300006871 | Bacteria | 6999 |
| 439 | Ga0075434_100025317 | 3300006871 | Bacteria | 5806 |
| 440 | Ga0075434_100978976 | 3300006871 | Bacteria | 860 |
| 441 | Ga0075434_101727921 | 3300006871 | Unclassified | 633 |
| 442 | Ga0075434_102179227 | 3300006871 | Unclassified | 558 |
| 443 | Ga0075434_102309116 | 3300006871 | Unclassified | 541 |
| 444 | Ga0075429_100060513 | 3300006880 | Bacteria | 3298 |
| 445 | Ga0075429_100129943 | 3300006880 | Unclassified | 2203 |
| 446 | Ga0075429_100153736 | 3300006880 | Bacteria | 2015 |
| 447 | Ga0075429_100433546 | 3300006880 | Bacteria | 1151 |
| 448 | Ga0075429_101072315 | 3300006880 | Bacteria | 704 |
| 449 | Ga0068865_100028781 | 3300006881 | Unclassified | 3680 |
| 450 | Ga0068865_100407035 | 3300006881 | Bacteria | 1115 |
| 451 | Ga0068865_101081183 | 3300006881 | Unclassified | 706 |
| 452 | Ga0075436_100166357 | 3300006914 | Bacteria | 1556 |
| 453 | Ga0075436_100721614 | 3300006914 | Unclassified | 739 |
| 454 | Ga0097620_100023227 | 3300006931 | Bacteria | 6223 |
| 455 | Ga0097620_100045876 | 3300006931 | Bacteria | 4390 |
| 456 | Ga0097620_100063366 | 3300006931 | Bacteria | 3728 |
| 457 | Ga0097620_100070969 | 3300006931 | Bacteria | 3518 |
| 458 | Ga0097620_100114166 | 3300006931 | Bacteria | 2765 |
| 459 | Ga0097620_100202947 | 3300006931 | Bacteria | 2067 |
| 460 | Ga0097620_100420319 | 3300006931 | Unclassified | 1433 |
| 461 | Ga0097620_100453800 | 3300006931 | Bacteria | 1378 |
| 462 | Ga0097620_101826261 | 3300006931 | Unclassified | 671 |
| 463 | Ga0075435_100033669 | 3300007076 | Unclassified | 4053 |
| 464 | Ga0075435_101580545 | 3300007076 | Unclassified | 575 |
| 465 | Ga0075435_101709217 | 3300007076 | Unclassified | 552 |
| 466 | Ga0075435_101767320 | 3300007076 | Unclassified | 543 |
| 467 | Ga0099794_10584615 | 3300007265 | Bacteria | 591 |
| 468 | Ga0099795_10560745 | 3300007788 | Bacteria | 539 |
| 469 | Ga0105251_10115959 | 3300009011 | Bacteria | 1218 |
| 470 | Ga0105251_10146368 | 3300009011 | Bacteria | 1068 |
| 471 | Ga0105251_10264346 | 3300009011 | Bacteria | 777 |
| 472 | Ga0105250_10153247 | 3300009092 | Unclassified | 960 |
| 473 | Ga0105240_10000873 | 3300009093 | Bacteria | 54313 |
| 474 | Ga0105240_10001323 | 3300009093 | Bacteria | 42757 |
| 475 | Ga0105240_10021506 | 3300009093 | Bacteria | 8578 |
| 476 | Ga0105240_10365894 | 3300009093 | Bacteria | 1632 |
| 477 | Ga0105240_11446721 | 3300009093 | Bacteria | 721 |
| 478 | Ga0111539_10000371 | 3300009094 | Bacteria | 55543 |
| 479 | Ga0111539_10027156 | 3300009094 | Bacteria | 6991 |
| 480 | Ga0111539_10081568 | 3300009094 | Bacteria | 3804 |
| 481 | Ga0111539_10126374 | 3300009094 | Bacteria | 2996 |
| 482 | Ga0111539_10264066 | 3300009094 | Bacteria | 2004 |
| 483 | Ga0111539_10396414 | 3300009094 | Bacteria | 1607 |
| 484 | Ga0111539_10675155 | 3300009094 | Unclassified | 1203 |
| 485 | Ga0111539_10738954 | 3300009094 | Unclassified | 1145 |
| 486 | Ga0111539_13284353 | 3300009094 | Unclassified | 521 |
| 487 | Ga0105245_10001718 | 3300009098 | Bacteria | 19959 |
| 488 | Ga0105245_10003144 | 3300009098 | Bacteria | 14772 |
| 489 | Ga0105245_10057252 | 3300009098 | Bacteria | 3505 |
| 490 | Ga0105245_10070000 | 3300009098 | Bacteria | 3182 |
| 491 | Ga0105245_10080585 | 3300009098 | Bacteria | 2974 |
| 492 | Ga0105245_10466852 | 3300009098 | Bacteria | 1273 |
| 493 | Ga0105245_10474382 | 3300009098 | Bacteria | 1263 |
| 494 | Ga0105245_10931796 | 3300009098 | Unclassified | 911 |
| 495 | Ga0105245_11195087 | 3300009098 | Unclassified | 808 |
| 496 | Ga0105247_10001246 | 3300009101 | Bacteria | 18878 |
| 497 | Ga0105247_10031295 | 3300009101 | Bacteria | 3229 |
| 498 | Ga0105247_10091105 | 3300009101 | Unclassified | 1936 |
| 499 | Ga0105247_10092475 | 3300009101 | Bacteria | 1921 |
| 500 | Ga0105247_10131636 | 3300009101 | Bacteria | 1631 |
| 501 | Ga0105247_11504603 | 3300009101 | Unclassified | 549 |
| 502 | Ga0114129_10093669 | 3300009147 | Bacteria | 4161 |
| 503 | Ga0114129_10124261 | 3300009147 | Bacteria | 3549 |
| 504 | Ga0114129_10169692 | 3300009147 | Bacteria | 2975 |
| 505 | Ga0114129_10365195 | 3300009147 | Bacteria | 1909 |
| 506 | Ga0114129_10371602 | 3300009147 | Bacteria | 1890 |
| 507 | Ga0114129_10517222 | 3300009147 | Bacteria | 1557 |
| 508 | Ga0114129_11735592 | 3300009147 | Unclassified | 761 |
| 509 | Ga0114129_12264923 | 3300009147 | Unclassified | 653 |
| 510 | Ga0105243_10018079 | 3300009148 | Bacteria | 5334 |
| 511 | Ga0105243_10053838 | 3300009148 | Bacteria | 3193 |
| 512 | Ga0105243_10058538 | 3300009148 | Bacteria | 3071 |
| 513 | Ga0105243_11070589 | 3300009148 | Unclassified | 813 |
| 514 | Ga0105243_12059440 | 3300009148 | Bacteria | 606 |
| 515 | Ga0105241_10000983 | 3300009174 | Bacteria | 21600 |
| 516 | Ga0105241_10001736 | 3300009174 | Bacteria | 16550 |
| 517 | Ga0105241_10003627 | 3300009174 | Bacteria | 11470 |
| 518 | Ga0105241_10036225 | 3300009174 | Bacteria | 3712 |
| 519 | Ga0105241_10112990 | 3300009174 | Bacteria | 2177 |
| 520 | Ga0105241_10145484 | 3300009174 | Bacteria | 1934 |
| 521 | Ga0105241_10875101 | 3300009174 | Bacteria | 832 |
| 522 | Ga0105242_10018099 | 3300009176 | Bacteria | 5504 |
| 523 | Ga0105242_10072872 | 3300009176 | Bacteria | 2854 |
| 524 | Ga0105242_10213464 | 3300009176 | Bacteria | 1721 |
| 525 | Ga0105242_10264618 | 3300009176 | Bacteria | 1555 |
| 526 | Ga0105242_10634426 | 3300009176 | Bacteria | 1037 |
| 527 | Ga0105242_11221675 | 3300009176 | Bacteria | 772 |
| 528 | Ga0105242_12839912 | 3300009176 | Unclassified | 535 |
| 529 | Ga0105248_10001935 | 3300009177 | Bacteria | 23010 |
| 530 | Ga0105248_10014763 | 3300009177 | Bacteria | 8601 |
| 531 | Ga0105248_10020929 | 3300009177 | Bacteria | 7250 |
| 532 | Ga0105248_10143487 | 3300009177 | Bacteria | 2694 |
| 533 | Ga0105248_10282450 | 3300009177 | Unclassified | 1869 |
| 534 | Ga0105248_10363488 | 3300009177 | Bacteria | 1629 |
| 535 | Ga0105248_10432666 | 3300009177 | Bacteria | 1482 |
| 536 | Ga0105248_10459845 | 3300009177 | Bacteria | 1435 |
| 537 | Ga0105248_11149280 | 3300009177 | Bacteria | 878 |
| 538 | Ga0105248_11300185 | 3300009177 | Bacteria | 823 |
| 539 | Ga0105248_11448541 | 3300009177 | Bacteria | 777 |
| 540 | Ga0105248_12284891 | 3300009177 | Unclassified | 616 |
| 541 | Ga0105237_10000686 | 3300009545 | Bacteria | 46922 |
| 542 | Ga0105237_10015100 | 3300009545 | Bacteria | 8049 |
| 543 | Ga0105237_10398531 | 3300009545 | Bacteria | 1381 |
| 544 | Ga0105237_10459718 | 3300009545 | Unclassified | 1279 |
| 545 | Ga0105237_10486843 | 3300009545 | Bacteria | 1240 |
| 546 | Ga0105237_10669503 | 3300009545 | Unclassified | 1044 |
| 547 | Ga0105237_12786388 | 3300009545 | Unclassified | 500 |
| 548 | Ga0105238_10000083 | 3300009551 | Bacteria | 107423 |
| 549 | Ga0105238_10001184 | 3300009551 | Bacteria | 26230 |
| 550 | Ga0105238_10001626 | 3300009551 | Bacteria | 22494 |
| 551 | Ga0105238_10019760 | 3300009551 | Bacteria | 6859 |
| 552 | Ga0105238_10041026 | 3300009551 | Bacteria | 4689 |
| 553 | Ga0105238_10436546 | 3300009551 | Bacteria | 1305 |
| 554 | Ga0105238_10602847 | 3300009551 | Bacteria | 1106 |
| 555 | Ga0105249_10000609 | 3300009553 | Bacteria | 32611 |
| 556 | Ga0105249_10013478 | 3300009553 | Bacteria | 7218 |
| 557 | Ga0105249_10078094 | 3300009553 | Bacteria | 3071 |
| 558 | Ga0105249_10083043 | 3300009553 | Bacteria | 2981 |
| 559 | Ga0105249_10787145 | 3300009553 | Bacteria | 1015 |
| 560 | Ga0105249_11496378 | 3300009553 | Unclassified | 747 |
| 561 | Ga0105249_12591396 | 3300009553 | Bacteria | 579 |
| 562 | Ga0105249_12754685 | 3300009553 | Unclassified | 563 |
| 563 | Ga0105239_10002607 | 3300010375 | Bacteria | 22823 |
| 564 | Ga0105239_10004332 | 3300010375 | Bacteria | 17003 |
| 565 | Ga0105239_10016054 | 3300010375 | Bacteria | 8287 |
| 566 | Ga0105239_10026115 | 3300010375 | Bacteria | 6429 |
| 567 | Ga0105239_10042846 | 3300010375 | Bacteria | 4960 |
| 568 | Ga0105239_10301373 | 3300010375 | Bacteria | 1805 |
| 569 | Ga0105239_13054485 | 3300010375 | Bacteria | 545 |
| 570 | Ga0105239_13079762 | 3300010375 | Unclassified | 543 |
| 571 | Ga0105246_10000993 | 3300011119 | Bacteria | 16283 |
| 572 | Ga0157337_1032241 | 3300012483 | Unclassified | 542 |
| 573 | Ga0157373_10083360 | 3300013100 | Unclassified | 2253 |
| 574 | Ga0157373_10339331 | 3300013100 | Bacteria | 1071 |
| 575 | Ga0157371_10121362 | 3300013102 | Unclassified | 1858 |
| 576 | Ga0157371_10656553 | 3300013102 | Unclassified | 783 |
| 577 | Ga0157370_10208379 | 3300013104 | Bacteria | 1812 |
| 578 | Ga0157369_10004527 | 3300013105 | Bacteria | 16357 |
| 579 | Ga0157369_10119802 | 3300013105 | Bacteria | 2793 |
| 580 | Ga0157369_10121335 | 3300013105 | Bacteria | 2773 |
| 581 | Ga0157369_11311204 | 3300013105 | Bacteria | 738 |
| 582 | Ga0157374_10006274 | 3300013296 | Bacteria | 10080 |
| 583 | Ga0157374_10011199 | 3300013296 | Bacteria | 7754 |
| 584 | Ga0157374_10011244 | 3300013296 | Bacteria | 7741 |
| 585 | Ga0157374_10030653 | 3300013296 | Bacteria | 4886 |
| 586 | Ga0157374_10033159 | 3300013296 | Bacteria | 4710 |
| 587 | Ga0157374_10146488 | 3300013296 | Unclassified | 2294 |
| 588 | Ga0157374_10516282 | 3300013296 | Bacteria | 1200 |
| 589 | Ga0157374_11578708 | 3300013296 | Unclassified | 680 |
| 590 | Ga0157378_10004372 | 3300013297 | Bacteria | 12437 |
| 591 | Ga0157378_10013267 | 3300013297 | Bacteria | 7203 |
| 592 | Ga0157378_10059049 | 3300013297 | Bacteria | 3421 |
| 593 | Ga0157378_10065400 | 3300013297 | Unclassified | 3255 |
| 594 | Ga0157378_10127879 | 3300013297 | Bacteria | 2349 |
| 595 | Ga0157378_10300240 | 3300013297 | Bacteria | 1554 |
| 596 | Ga0157378_10435786 | 3300013297 | Bacteria | 1298 |
| 597 | Ga0157378_10724458 | 3300013297 | Bacteria | 1016 |
| 598 | Ga0157378_11203652 | 3300013297 | Unclassified | 797 |
| 599 | Ga0157378_11394101 | 3300013297 | Bacteria | 744 |
| 600 | Ga0157378_13294199 | 3300013297 | Bacteria | 502 |
| 601 | Ga0157378_13302765 | 3300013297 | Unclassified | 501 |
| 602 | Ga0163162_10002560 | 3300013306 | Bacteria | 17209 |
| 603 | Ga0163162_10003473 | 3300013306 | Bacteria | 15059 |
| 604 | Ga0163162_10006012 | 3300013306 | Bacteria | 11746 |
| 605 | Ga0163162_10073177 | 3300013306 | Bacteria | 3483 |
| 606 | Ga0163162_10080847 | 3300013306 | Bacteria | 3319 |
| 607 | Ga0163162_10177007 | 3300013306 | Bacteria | 2259 |
| 608 | Ga0163162_10217998 | 3300013306 | Bacteria | 2038 |
| 609 | Ga0163162_10263694 | 3300013306 | Bacteria | 1854 |
| 610 | Ga0163162_11031310 | 3300013306 | Bacteria | 931 |
| 611 | Ga0157372_10012613 | 3300013307 | Bacteria | 8999 |
| 612 | Ga0157372_10012966 | 3300013307 | Bacteria | 8889 |
| 613 | Ga0157372_10025051 | 3300013307 | Bacteria | 6483 |
| 614 | Ga0157372_10027734 | 3300013307 | Bacteria | 6172 |
| 615 | Ga0157372_10045286 | 3300013307 | Bacteria | 4879 |
| 616 | Ga0157372_11258751 | 3300013307 | Unclassified | 854 |
| 617 | Ga0157375_10000912 | 3300013308 | Bacteria | 25698 |
| 618 | Ga0157375_10028226 | 3300013308 | Bacteria | 5257 |
| 619 | Ga0157375_10088269 | 3300013308 | Bacteria | 3155 |
| 620 | Ga0157375_10842351 | 3300013308 | Bacteria | 1064 |
| 621 | Ga0157375_11665472 | 3300013308 | Bacteria | 755 |
| 622 | Ga0157375_11777540 | 3300013308 | Bacteria | 731 |
| 623 | Ga0163163_10000990 | 3300014325 | Bacteria | 24033 |
| 624 | Ga0163163_10029024 | 3300014325 | Bacteria | 5318 |
| 625 | Ga0163163_10062006 | 3300014325 | Bacteria | 3705 |
| 626 | Ga0163163_10848919 | 3300014325 | Bacteria | 977 |
| 627 | Ga0163163_11732179 | 3300014325 | Unclassified | 685 |
| 628 | Ga0157380_10009132 | 3300014326 | Bacteria | 7090 |
| 629 | Ga0157380_10088504 | 3300014326 | Bacteria | 2548 |
| 630 | Ga0157380_10098522 | 3300014326 | Unclassified | 2429 |
| 631 | Ga0157380_10150515 | 3300014326 | Unclassified | 2011 |
| 632 | Ga0157380_10359334 | 3300014326 | Bacteria | 1366 |
| 633 | Ga0157380_10797490 | 3300014326 | Bacteria | 961 |
| 634 | Ga0157380_11234724 | 3300014326 | Bacteria | 792 |
| 635 | Ga0157377_10059755 | 3300014745 | Bacteria | 2174 |
| 636 | Ga0157377_10249782 | 3300014745 | Bacteria | 1149 |
| 637 | Ga0157377_10964884 | 3300014745 | Bacteria | 643 |
| 638 | Ga0157379_10002598 | 3300014968 | Bacteria | 15178 |
| 639 | Ga0157379_10014161 | 3300014968 | Bacteria | 6994 |
| 640 | Ga0157379_10015911 | 3300014968 | Bacteria | 6612 |
| 641 | Ga0157379_10020313 | 3300014968 | Bacteria | 5872 |
| 642 | Ga0157379_10127549 | 3300014968 | Unclassified | 2289 |
| 643 | Ga0157379_10637578 | 3300014968 | Bacteria | 997 |
| 644 | Ga0157379_11695101 | 3300014968 | Unclassified | 619 |
| 645 | Ga0157379_12032556 | 3300014968 | Unclassified | 568 |
| 646 | Ga0157376_10002690 | 3300014969 | Bacteria | 12092 |
| 647 | Ga0157376_10032695 | 3300014969 | Bacteria | 4179 |
| 648 | Ga0157376_10136351 | 3300014969 | Bacteria | 2196 |
| 649 | Ga0157376_10499856 | 3300014969 | Bacteria | 1195 |
| 650 | Ga0157376_10967481 | 3300014969 | Bacteria | 872 |
| 651 | Ga0157376_11026982 | 3300014969 | Bacteria | 848 |
| 652 | Ga0163161_10029282 | 3300017792 | Bacteria | 3914 |
| 653 | Ga0163161_10168841 | 3300017792 | Unclassified | 1672 |
| 654 | Ga0163161_10272827 | 3300017792 | Bacteria | 1324 |
| 655 | Ga0184597_129778 | 3300019162 | Unclassified | 586 |
| 656 | Ga0184600_121265 | 3300019190 | Unclassified | 658 |
| 657 | Ga0197907_10324399 | 3300020069 | Unclassified | 723 |
| 658 | Ga0197907_11250092 | 3300020069 | Bacteria | 837 |
| 659 | Ga0197907_11279047 | 3300020069 | Unclassified | 565 |
| 660 | Ga0197907_11386164 | 3300020069 | Unclassified | 595 |
| 661 | Ga0206356_10516644 | 3300020070 | Bacteria | 640 |
| 662 | Ga0206356_10715572 | 3300020070 | Unclassified | 785 |
| 663 | Ga0206356_10844135 | 3300020070 | Bacteria | 1061 |
| 664 | Ga0206356_11132424 | 3300020070 | Unclassified | 533 |
| 665 | Ga0206356_11161235 | 3300020070 | Unclassified | 562 |
| 666 | Ga0206356_11205819 | 3300020070 | Unclassified | 900 |
| 667 | Ga0206356_11215637 | 3300020070 | Unclassified | 570 |
| 668 | Ga0206349_1297786 | 3300020075 | Unclassified | 570 |
| 669 | Ga0206349_1835108 | 3300020075 | Unclassified | 723 |
| 670 | Ga0206349_1874035 | 3300020075 | Unclassified | 557 |
| 671 | Ga0206349_1917504 | 3300020075 | Bacteria | 765 |
| 672 | Ga0206349_1919281 | 3300020075 | Unclassified | 568 |
| 673 | Ga0206355_1256411 | 3300020076 | Unclassified | 557 |
| 674 | Ga0206355_1258114 | 3300020076 | Bacteria | 636 |
| 675 | Ga0206355_1262814 | 3300020076 | Unclassified | 572 |
| 676 | Ga0206355_1268818 | 3300020076 | Bacteria | 776 |
| 677 | Ga0206355_1451817 | 3300020076 | Unclassified | 778 |
| 678 | Ga0206355_1687652 | 3300020076 | Bacteria | 1238 |
| 679 | Ga0206351_10188504 | 3300020077 | Unclassified | 578 |
| 680 | Ga0206351_10405074 | 3300020077 | Unclassified | 574 |
| 681 | Ga0206351_10700374 | 3300020077 | Bacteria | 528 |
| 682 | Ga0206351_10906423 | 3300020077 | Bacteria | 713 |
| 683 | Ga0206351_10908887 | 3300020077 | Bacteria | 576 |
| 684 | Ga0206351_10957061 | 3300020077 | Unclassified | 614 |
| 685 | Ga0206352_10782869 | 3300020078 | Unclassified | 572 |
| 686 | Ga0206352_10893130 | 3300020078 | Bacteria | 1344 |
| 687 | Ga0206352_11038743 | 3300020078 | Unclassified | 869 |
| 688 | Ga0206352_11169670 | 3300020078 | Unclassified | 616 |
| 689 | Ga0206352_11252282 | 3300020078 | Unclassified | 588 |
| 690 | Ga0206352_11295039 | 3300020078 | Unclassified | 972 |
| 691 | Ga0206352_11342208 | 3300020078 | Unclassified | 577 |
| 692 | Ga0206350_10525024 | 3300020080 | Bacteria | 658 |
| 693 | Ga0206350_10561742 | 3300020080 | Bacteria | 663 |
| 694 | Ga0206350_10744426 | 3300020080 | Unclassified | 662 |
| 695 | Ga0206350_11634810 | 3300020080 | Unclassified | 559 |
| 696 | Ga0206354_10491623 | 3300020081 | Bacteria | 652 |
| 697 | Ga0206354_11121875 | 3300020081 | Bacteria | 590 |
| 698 | Ga0206354_11697218 | 3300020081 | Unclassified | 554 |
| 699 | Ga0206353_10553268 | 3300020082 | Unclassified | 654 |
| 700 | Ga0206353_11160635 | 3300020082 | Unclassified | 785 |
| 701 | Ga0206353_11160646 | 3300020082 | Bacteria | 613 |
| 702 | Ga0206353_11283297 | 3300020082 | Unclassified | 559 |
| 703 | Ga0206353_11811571 | 3300020082 | Unclassified | 578 |
| 704 | Ga0154015_1019451 | 3300020610 | Unclassified | 866 |
| 705 | Ga0154015_1270677 | 3300020610 | Unclassified | 531 |
| 706 | Ga0154015_1314901 | 3300020610 | Bacteria | 528 |
| 707 | Ga0213876_10215943 | 3300021384 | Bacteria | 1020 |
| 708 | Ga0224712_10180851 | 3300022467 | Bacteria | 950 |
| 709 | Ga0224712_10253323 | 3300022467 | Bacteria | 814 |
| 710 | Ga0224712_10271147 | 3300022467 | Bacteria | 788 |
| 711 | Ga0224712_10282527 | 3300022467 | Bacteria | 773 |
| 712 | Ga0224712_10522227 | 3300022467 | Unclassified | 575 |
| 713 | Ga0224712_10579271 | 3300022467 | Unclassified | 547 |
| 714 | Ga0247553_100118 | 3300023672 | Bacteria | 2272 |
| 715 | Ga0207666_1010013 | 3300025271 | Bacteria | 1291 |
| 716 | Ga0207666_1020265 | 3300025271 | Unclassified | 975 |
| 717 | Ga0207697_10000006 | 3300025315 | Bacteria | 82632 |
| 718 | Ga0207697_10000780 | 3300025315 | Bacteria | 18048 |
| 719 | Ga0207697_10002440 | 3300025315 | Bacteria | 9638 |
| 720 | Ga0207697_10376224 | 3300025315 | Bacteria | 631 |
| 721 | Ga0207656_10019971 | 3300025321 | Bacteria | 2656 |
| 722 | Ga0207656_10067747 | 3300025321 | Bacteria | 1580 |
| 723 | Ga0207656_10106207 | 3300025321 | Unclassified | 1292 |
| 724 | Ga0207656_10230723 | 3300025321 | Bacteria | 902 |
| 725 | Ga0207656_10306886 | 3300025321 | Unclassified | 786 |
| 726 | Ga0207696_1115898 | 3300025711 | Unclassified | 724 |
| 727 | Ga0207653_10004397 | 3300025885 | Bacteria | 4422 |
| 728 | Ga0207653_10227564 | 3300025885 | Bacteria | 710 |
| 729 | Ga0207682_10003312 | 3300025893 | Bacteria | 7034 |
| 730 | Ga0207692_10024648 | 3300025898 | Unclassified | 2800 |
| 731 | Ga0207692_10032655 | 3300025898 | Bacteria | 2503 |
| 732 | Ga0207692_10265768 | 3300025898 | Bacteria | 1033 |
| 733 | Ga0207692_10806008 | 3300025898 | Bacteria | 614 |
| 734 | Ga0207642_10004743 | 3300025899 | Bacteria | 4390 |
| 735 | Ga0207642_10503365 | 3300025899 | Bacteria | 742 |
| 736 | Ga0207710_10000831 | 3300025900 | Bacteria | 16688 |
| 737 | Ga0207710_10048282 | 3300025900 | Unclassified | 1905 |
| 738 | Ga0207710_10180517 | 3300025900 | Bacteria | 1035 |
| 739 | Ga0207710_10191476 | 3300025900 | Bacteria | 1007 |
| 740 | Ga0207688_10005241 | 3300025901 | Bacteria | 7046 |
| 741 | Ga0207688_10355584 | 3300025901 | Unclassified | 903 |
| 742 | Ga0207688_11000942 | 3300025901 | Unclassified | 528 |
| 743 | Ga0207680_10010390 | 3300025903 | Bacteria | 4655 |
| 744 | Ga0207680_10108407 | 3300025903 | Bacteria | 1797 |
| 745 | Ga0207680_10488712 | 3300025903 | Bacteria | 876 |
| 746 | Ga0207680_10966284 | 3300025903 | Bacteria | 610 |
| 747 | Ga0207647_10026420 | 3300025904 | Unclassified | 3799 |
| 748 | Ga0207647_10045450 | 3300025904 | Bacteria | 2740 |
| 749 | Ga0207647_10150472 | 3300025904 | Unclassified | 1361 |
| 750 | Ga0207685_10018562 | 3300025905 | Bacteria | 2273 |
| 751 | Ga0207685_10342396 | 3300025905 | Bacteria | 752 |
| 752 | Ga0207685_10658975 | 3300025905 | Unclassified | 567 |
| 753 | Ga0207699_10033122 | 3300025906 | Bacteria | 2918 |
| 754 | Ga0207699_10271497 | 3300025906 | Unclassified | 1175 |
| 755 | Ga0207699_10396846 | 3300025906 | Unclassified | 982 |
| 756 | Ga0207699_10467861 | 3300025906 | Unclassified | 906 |
| 757 | Ga0207699_10619847 | 3300025906 | Bacteria | 789 |
| 758 | Ga0207699_11282786 | 3300025906 | Unclassified | 542 |
| 759 | Ga0207699_11325765 | 3300025906 | Unclassified | 533 |
| 760 | Ga0207645_10000071 | 3300025907 | Bacteria | 72725 |
| 761 | Ga0207645_10002340 | 3300025907 | Bacteria | 14953 |
| 762 | Ga0207645_10024039 | 3300025907 | Bacteria | 3954 |
| 763 | Ga0207645_10232344 | 3300025907 | Bacteria | 1217 |
| 764 | Ga0207645_10886918 | 3300025907 | Bacteria | 606 |
| 765 | Ga0207643_10001825 | 3300025908 | Bacteria | 11822 |
| 766 | Ga0207705_10044589 | 3300025909 | Bacteria | 3187 |
| 767 | Ga0207705_10086494 | 3300025909 | Bacteria | 2291 |
| 768 | Ga0207705_10160274 | 3300025909 | Bacteria | 1690 |
| 769 | Ga0207705_10275115 | 3300025909 | Bacteria | 1288 |
| 770 | Ga0207684_10000032 | 3300025910 | Bacteria | 293234 |
| 771 | Ga0207684_10003246 | 3300025910 | Bacteria | 15950 |
| 772 | Ga0207684_10011152 | 3300025910 | Bacteria | 7868 |
| 773 | Ga0207684_10075694 | 3300025910 | Bacteria | 2861 |
| 774 | Ga0207684_10119835 | 3300025910 | Bacteria | 2256 |
| 775 | Ga0207684_11006226 | 3300025910 | Unclassified | 697 |
| 776 | Ga0207684_11297323 | 3300025910 | Unclassified | 600 |
| 777 | Ga0207654_10000023 | 3300025911 | Bacteria | 161401 |
| 778 | Ga0207654_10000668 | 3300025911 | Bacteria | 19386 |
| 779 | Ga0207654_10000858 | 3300025911 | Bacteria | 16815 |
| 780 | Ga0207654_10024153 | 3300025911 | Bacteria | 3265 |
| 781 | Ga0207654_10230781 | 3300025911 | Bacteria | 1232 |
| 782 | Ga0207654_10342235 | 3300025911 | Bacteria | 1028 |
| 783 | Ga0207654_10453387 | 3300025911 | Bacteria | 900 |
| 784 | Ga0207654_11385674 | 3300025911 | Unclassified | 513 |
| 785 | Ga0207654_11450163 | 3300025911 | Bacteria | 501 |
| 786 | Ga0207707_10018524 | 3300025912 | Bacteria | 6069 |
| 787 | Ga0207707_10027394 | 3300025912 | Bacteria | 4984 |
| 788 | Ga0207707_10188095 | 3300025912 | Bacteria | 1802 |
| 789 | Ga0207707_10519191 | 3300025912 | Bacteria | 1014 |
| 790 | Ga0207695_10000113 | 3300025913 | Bacteria | 247240 |
| 791 | Ga0207695_10000188 | 3300025913 | Bacteria | 178721 |
| 792 | Ga0207695_10000338 | 3300025913 | Bacteria | 110289 |
| 793 | Ga0207695_10030295 | 3300025913 | Bacteria | 5959 |
| 794 | Ga0207695_10110382 | 3300025913 | Bacteria | 2731 |
| 795 | Ga0207695_10125368 | 3300025913 | Bacteria | 2531 |
| 796 | Ga0207695_11266651 | 3300025913 | Bacteria | 618 |
| 797 | Ga0207671_10000145 | 3300025914 | Bacteria | 109306 |
| 798 | Ga0207671_10000506 | 3300025914 | Bacteria | 52834 |
| 799 | Ga0207671_10209158 | 3300025914 | Bacteria | 1525 |
| 800 | Ga0207671_10271655 | 3300025914 | Unclassified | 1336 |
| 801 | Ga0207671_10336731 | 3300025914 | Bacteria | 1195 |
| 802 | Ga0207671_11011833 | 3300025914 | Bacteria | 655 |
| 803 | Ga0207671_11045780 | 3300025914 | Unclassified | 642 |
| 804 | Ga0207693_10000509 | 3300025915 | Bacteria | 35091 |
| 805 | Ga0207693_10005034 | 3300025915 | Bacteria | 11094 |
| 806 | Ga0207693_10035797 | 3300025915 | Bacteria | 3914 |
| 807 | Ga0207693_10177522 | 3300025915 | Bacteria | 1676 |
| 808 | Ga0207693_10312386 | 3300025915 | Unclassified | 1231 |
| 809 | Ga0207693_11049377 | 3300025915 | Unclassified | 621 |
| 810 | Ga0207663_10006497 | 3300025916 | Bacteria | 5987 |
| 811 | Ga0207663_10293696 | 3300025916 | Bacteria | 1211 |
| 812 | Ga0207663_10460865 | 3300025916 | Unclassified | 982 |
| 813 | Ga0207663_10772164 | 3300025916 | Bacteria | 764 |
| 814 | Ga0207660_10009241 | 3300025917 | Bacteria | 6378 |
| 815 | Ga0207660_10872097 | 3300025917 | Bacteria | 734 |
| 816 | Ga0207660_10981310 | 3300025917 | Bacteria | 689 |
| 817 | Ga0207660_11566210 | 3300025917 | Unclassified | 532 |
| 818 | Ga0207662_10000982 | 3300025918 | Bacteria | 13288 |
| 819 | Ga0207662_10031481 | 3300025918 | Bacteria | 3083 |
| 820 | Ga0207662_10073670 | 3300025918 | Unclassified | 2072 |
| 821 | Ga0207662_10305736 | 3300025918 | Bacteria | 1058 |
| 822 | Ga0207657_10224725 | 3300025919 | Bacteria | 1503 |
| 823 | Ga0207657_10525388 | 3300025919 | Bacteria | 926 |
| 824 | Ga0207657_10683319 | 3300025919 | Unclassified | 798 |
| 825 | Ga0207657_10755408 | 3300025919 | Unclassified | 753 |
| 826 | Ga0207657_11366482 | 3300025919 | Unclassified | 533 |
| 827 | Ga0207649_10019388 | 3300025920 | Bacteria | 3887 |
| 828 | Ga0207649_10021494 | 3300025920 | Bacteria | 3716 |
| 829 | Ga0207649_10053841 | 3300025920 | Bacteria | 2502 |
| 830 | Ga0207649_10131767 | 3300025920 | Bacteria | 1699 |
| 831 | Ga0207649_10946755 | 3300025920 | Bacteria | 676 |
| 832 | Ga0207652_10001839 | 3300025921 | Bacteria | 18406 |
| 833 | Ga0207652_10014955 | 3300025921 | Bacteria | 6294 |
| 834 | Ga0207652_10913376 | 3300025921 | Bacteria | 775 |
| 835 | Ga0207646_10056597 | 3300025922 | Bacteria | 3504 |
| 836 | Ga0207646_10061224 | 3300025922 | Bacteria | 3360 |
| 837 | Ga0207646_10064592 | 3300025922 | Bacteria | 3267 |
| 838 | Ga0207646_10371726 | 3300025922 | Unclassified | 1292 |
| 839 | Ga0207646_10747916 | 3300025922 | Bacteria | 872 |
| 840 | Ga0207646_10897852 | 3300025922 | Bacteria | 786 |
| 841 | Ga0207681_10011809 | 3300025923 | Bacteria | 5373 |
| 842 | Ga0207681_10018647 | 3300025923 | Bacteria | 4374 |
| 843 | Ga0207681_10020853 | 3300025923 | Bacteria | 4159 |
| 844 | Ga0207681_11409261 | 3300025923 | Bacteria | 585 |
| 845 | Ga0207681_11489715 | 3300025923 | Unclassified | 567 |
| 846 | Ga0207694_10000076 | 3300025924 | Bacteria | 113436 |
| 847 | Ga0207694_10000085 | 3300025924 | Bacteria | 108662 |
| 848 | Ga0207694_10001059 | 3300025924 | Bacteria | 23946 |
| 849 | Ga0207694_10005101 | 3300025924 | Bacteria | 10146 |
| 850 | Ga0207694_10012774 | 3300025924 | Bacteria | 6327 |
| 851 | Ga0207694_10244570 | 3300025924 | Bacteria | 1467 |
| 852 | Ga0207694_10322145 | 3300025924 | Bacteria | 1276 |
| 853 | Ga0207694_10534474 | 3300025924 | Unclassified | 983 |
| 854 | Ga0207694_11122480 | 3300025924 | Unclassified | 665 |
| 855 | Ga0207694_11367276 | 3300025924 | Bacteria | 599 |
| 856 | Ga0207650_10008426 | 3300025925 | Bacteria | 7037 |
| 857 | Ga0207650_10028473 | 3300025925 | Bacteria | 4007 |
| 858 | Ga0207650_10638442 | 3300025925 | Bacteria | 897 |
| 859 | Ga0207659_10011630 | 3300025926 | Bacteria | 5567 |
| 860 | Ga0207659_10018061 | 3300025926 | Bacteria | 4617 |
| 861 | Ga0207659_10230470 | 3300025926 | Bacteria | 1494 |
| 862 | Ga0207687_10007183 | 3300025927 | Bacteria | 7343 |
| 863 | Ga0207687_10069733 | 3300025927 | Bacteria | 2508 |
| 864 | Ga0207687_10075565 | 3300025927 | Unclassified | 2418 |
| 865 | Ga0207687_10085461 | 3300025927 | Bacteria | 2289 |
| 866 | Ga0207687_10104912 | 3300025927 | Bacteria | 2087 |
| 867 | Ga0207687_10398889 | 3300025927 | Bacteria | 1131 |
| 868 | Ga0207687_10536014 | 3300025927 | Unclassified | 981 |
| 869 | Ga0207700_10050602 | 3300025928 | Bacteria | 3097 |
| 870 | Ga0207700_10688130 | 3300025928 | Unclassified | 912 |
| 871 | Ga0207664_10140945 | 3300025929 | Bacteria | 2039 |
| 872 | Ga0207664_10298205 | 3300025929 | Unclassified | 1417 |
| 873 | Ga0207664_10447526 | 3300025929 | Unclassified | 1153 |
| 874 | Ga0207664_11013951 | 3300025929 | Bacteria | 744 |
| 875 | Ga0207644_10001426 | 3300025931 | Bacteria | 15395 |
| 876 | Ga0207644_10041382 | 3300025931 | Unclassified | 3259 |
| 877 | Ga0207644_10056522 | 3300025931 | Bacteria | 2832 |
| 878 | Ga0207644_10074074 | 3300025931 | Bacteria | 2498 |
| 879 | Ga0207644_10116851 | 3300025931 | Bacteria | 2025 |
| 880 | Ga0207644_10166355 | 3300025931 | Bacteria | 1718 |
| 881 | Ga0207644_10462805 | 3300025931 | Bacteria | 1043 |
| 882 | Ga0207690_10005886 | 3300025932 | Bacteria | 7261 |
| 883 | Ga0207690_10014322 | 3300025932 | Bacteria | 4790 |
| 884 | Ga0207706_10000835 | 3300025933 | Bacteria | 31957 |
| 885 | Ga0207706_10022504 | 3300025933 | Bacteria | 5656 |
| 886 | Ga0207706_10029024 | 3300025933 | Bacteria | 4939 |
| 887 | Ga0207706_10053786 | 3300025933 | Bacteria | 3553 |
| 888 | Ga0207706_10058900 | 3300025933 | Bacteria | 3383 |
| 889 | Ga0207706_10520645 | 3300025933 | Unclassified | 1025 |
| 890 | Ga0207686_10039911 | 3300025934 | Bacteria | 2851 |
| 891 | Ga0207686_10202743 | 3300025934 | Bacteria | 1422 |
| 892 | Ga0207686_10315580 | 3300025934 | Unclassified | 1166 |
| 893 | Ga0207686_10466054 | 3300025934 | Unclassified | 974 |
| 894 | Ga0207686_10546273 | 3300025934 | Bacteria | 905 |
| 895 | Ga0207686_10641764 | 3300025934 | Unclassified | 839 |
| 896 | Ga0207686_11202376 | 3300025934 | Bacteria | 620 |
| 897 | Ga0207686_11511546 | 3300025934 | Unclassified | 554 |
| 898 | Ga0207709_10153255 | 3300025935 | Unclassified | 1599 |
| 899 | Ga0207709_10420036 | 3300025935 | Bacteria | 1027 |
| 900 | Ga0207709_10490659 | 3300025935 | Bacteria | 957 |
| 901 | Ga0207709_11149403 | 3300025935 | Bacteria | 639 |
| 902 | Ga0207670_10012608 | 3300025936 | Bacteria | 4952 |
| 903 | Ga0207670_10034843 | 3300025936 | Bacteria | 3258 |
| 904 | Ga0207670_10055383 | 3300025936 | Bacteria | 2680 |
| 905 | Ga0207670_10221545 | 3300025936 | Bacteria | 1448 |
| 906 | Ga0207669_10002444 | 3300025937 | Bacteria | 7924 |
| 907 | Ga0207704_10074481 | 3300025938 | Bacteria | 2166 |
| 908 | Ga0207704_10218092 | 3300025938 | Bacteria | 1409 |
| 909 | Ga0207704_10990751 | 3300025938 | Bacteria | 710 |
| 910 | Ga0207665_10037075 | 3300025939 | Bacteria | 3244 |
| 911 | Ga0207665_10101170 | 3300025939 | Unclassified | 2012 |
| 912 | Ga0207691_10015890 | 3300025940 | Bacteria | 7152 |
| 913 | Ga0207691_10259128 | 3300025940 | Bacteria | 1499 |
| 914 | Ga0207691_10306957 | 3300025940 | Bacteria | 1362 |
| 915 | Ga0207691_10465035 | 3300025940 | Unclassified | 1076 |
| 916 | Ga0207711_10000992 | 3300025941 | Bacteria | 27228 |
| 917 | Ga0207711_10011105 | 3300025941 | Bacteria | 7485 |
| 918 | Ga0207711_10015238 | 3300025941 | Bacteria | 6382 |
| 919 | Ga0207711_10016385 | 3300025941 | Bacteria | 6161 |
| 920 | Ga0207711_10097307 | 3300025941 | Bacteria | 2598 |
| 921 | Ga0207711_10850507 | 3300025941 | Bacteria | 849 |
| 922 | Ga0207711_10933335 | 3300025941 | Unclassified | 806 |
| 923 | Ga0207689_10000936 | 3300025942 | Bacteria | 28039 |
| 924 | Ga0207689_10005617 | 3300025942 | Bacteria | 11172 |
| 925 | Ga0207689_10007815 | 3300025942 | Bacteria | 9356 |
| 926 | Ga0207689_10079940 | 3300025942 | Bacteria | 2687 |
| 927 | Ga0207689_10207224 | 3300025942 | Bacteria | 1619 |
| 928 | Ga0207689_10220434 | 3300025942 | Bacteria | 1567 |
| 929 | Ga0207689_10249036 | 3300025942 | Bacteria | 1469 |
| 930 | Ga0207689_11171806 | 3300025942 | Bacteria | 647 |
| 931 | Ga0207661_10002184 | 3300025944 | Bacteria | 13500 |
| 932 | Ga0207661_10003133 | 3300025944 | Bacteria | 11463 |
| 933 | Ga0207661_10005275 | 3300025944 | Bacteria | 9099 |
| 934 | Ga0207661_10006124 | 3300025944 | Bacteria | 8500 |
| 935 | Ga0207661_10036591 | 3300025944 | Bacteria | 3833 |
| 936 | Ga0207661_10085703 | 3300025944 | Unclassified | 2612 |
| 937 | Ga0207661_10168298 | 3300025944 | Bacteria | 1906 |
| 938 | Ga0207661_10561959 | 3300025944 | Bacteria | 1046 |
| 939 | Ga0207661_10632361 | 3300025944 | Bacteria | 983 |
| 940 | Ga0207661_10732003 | 3300025944 | Bacteria | 910 |
| 941 | Ga0207679_10086413 | 3300025945 | Bacteria | 2412 |
| 942 | Ga0207679_10096016 | 3300025945 | Bacteria | 2305 |
| 943 | Ga0207679_10110884 | 3300025945 | Bacteria | 2165 |
| 944 | Ga0207679_10221701 | 3300025945 | Bacteria | 1591 |
| 945 | Ga0207679_10295079 | 3300025945 | Bacteria | 1395 |
| 946 | Ga0207679_10498582 | 3300025945 | Bacteria | 1086 |
| 947 | Ga0207679_12106558 | 3300025945 | Unclassified | 512 |
| 948 | Ga0207667_10024639 | 3300025949 | Bacteria | 6602 |
| 949 | Ga0207667_10037735 | 3300025949 | Bacteria | 5164 |
| 950 | Ga0207667_10062221 | 3300025949 | Bacteria | 3903 |
| 951 | Ga0207667_10065082 | 3300025949 | Bacteria | 3804 |
| 952 | Ga0207667_10223914 | 3300025949 | Bacteria | 1927 |
| 953 | Ga0207667_11152628 | 3300025949 | Unclassified | 756 |
| 954 | Ga0207667_11237901 | 3300025949 | Unclassified | 725 |
| 955 | Ga0207667_11879650 | 3300025949 | Bacteria | 561 |
| 956 | Ga0207651_10071094 | 3300025960 | Bacteria | 2465 |
| 957 | Ga0207651_10116699 | 3300025960 | Bacteria | 2015 |
| 958 | Ga0207651_10288970 | 3300025960 | Bacteria | 1358 |
| 959 | Ga0207651_10509413 | 3300025960 | Bacteria | 1041 |
| 960 | Ga0207651_10924059 | 3300025960 | Unclassified | 778 |
| 961 | Ga0207651_11436738 | 3300025960 | Bacteria | 621 |
| 962 | Ga0207712_10011388 | 3300025961 | Bacteria | 5667 |
| 963 | Ga0207712_10044880 | 3300025961 | Bacteria | 3058 |
| 964 | Ga0207712_10082829 | 3300025961 | Bacteria | 2340 |
| 965 | Ga0207712_10086875 | 3300025961 | Bacteria | 2292 |
| 966 | Ga0207712_10584482 | 3300025961 | Bacteria | 964 |
| 967 | Ga0207712_11367359 | 3300025961 | Bacteria | 633 |
| 968 | Ga0207712_11574167 | 3300025961 | Bacteria | 589 |
| 969 | Ga0207668_10012145 | 3300025972 | Bacteria | 5263 |
| 970 | Ga0207668_10036595 | 3300025972 | Unclassified | 3277 |
| 971 | Ga0207668_10036798 | 3300025972 | Bacteria | 3270 |
| 972 | Ga0207668_10570720 | 3300025972 | Bacteria | 982 |
| 973 | Ga0207640_10041395 | 3300025981 | Unclassified | 2930 |
| 974 | Ga0207640_10292782 | 3300025981 | Bacteria | 1284 |
| 975 | Ga0207640_10406645 | 3300025981 | Bacteria | 1110 |
| 976 | Ga0207640_10533773 | 3300025981 | Unclassified | 983 |
| 977 | Ga0207658_10000721 | 3300025986 | Bacteria | 28564 |
| 978 | Ga0207658_10011703 | 3300025986 | Bacteria | 5973 |
| 979 | Ga0207658_10027685 | 3300025986 | Bacteria | 3985 |
| 980 | Ga0207658_10273536 | 3300025986 | Unclassified | 1445 |
| 981 | Ga0207658_10637673 | 3300025986 | Bacteria | 959 |
| 982 | Ga0207658_11200364 | 3300025986 | Bacteria | 693 |
| 983 | Ga0207658_11220208 | 3300025986 | Unclassified | 688 |
| 984 | Ga0207677_10000697 | 3300026023 | Bacteria | 19930 |
| 985 | Ga0207677_10169968 | 3300026023 | Bacteria | 1703 |
| 986 | Ga0207677_10184760 | 3300026023 | Unclassified | 1643 |
| 987 | Ga0207677_10288948 | 3300026023 | Bacteria | 1349 |
| 988 | Ga0207677_10336818 | 3300026023 | Bacteria | 1259 |
| 989 | Ga0207677_11056612 | 3300026023 | Bacteria | 738 |
| 990 | Ga0207677_12042237 | 3300026023 | Bacteria | 533 |
| 991 | Ga0207703_10002669 | 3300026035 | Bacteria | 15330 |
| 992 | Ga0207703_10018927 | 3300026035 | Bacteria | 5380 |
| 993 | Ga0207703_10087496 | 3300026035 | Bacteria | 2612 |
| 994 | Ga0207703_10103649 | 3300026035 | Bacteria | 2415 |
| 995 | Ga0207703_10609390 | 3300026035 | Bacteria | 1033 |
| 996 | Ga0207639_10000072 | 3300026041 | Bacteria | 94533 |
| 997 | Ga0207639_10002644 | 3300026041 | Bacteria | 12027 |
| 998 | Ga0207639_10014151 | 3300026041 | Bacteria | 5602 |
| 999 | Ga0207639_10091496 | 3300026041 | Bacteria | 2436 |
| 1000 | Ga0207639_10140214 | 3300026041 | Bacteria | 2013 |
| 1001 | Ga0207639_10163447 | 3300026041 | Bacteria | 1878 |
| 1002 | Ga0207639_10721623 | 3300026041 | Bacteria | 925 |
| 1003 | Ga0207639_11390124 | 3300026041 | Unclassified | 659 |
| 1004 | Ga0207639_11411348 | 3300026041 | Unclassified | 653 |
| 1005 | Ga0207678_10069636 | 3300026067 | Bacteria | 3017 |
| 1006 | Ga0207678_10144168 | 3300026067 | Bacteria | 2033 |
| 1007 | Ga0207678_10990235 | 3300026067 | Bacteria | 744 |
| 1008 | Ga0207678_11023174 | 3300026067 | Bacteria | 731 |
| 1009 | Ga0207708_10052624 | 3300026075 | Bacteria | 3101 |
| 1010 | Ga0207702_10006483 | 3300026078 | Bacteria | 10087 |
| 1011 | Ga0207702_10016091 | 3300026078 | Bacteria | 6192 |
| 1012 | Ga0207702_10273811 | 3300026078 | Unclassified | 1593 |
| 1013 | Ga0207702_10335056 | 3300026078 | Bacteria | 1444 |
| 1014 | Ga0207702_10343101 | 3300026078 | Unclassified | 1427 |
| 1015 | Ga0207702_10644916 | 3300026078 | Bacteria | 1041 |
| 1016 | Ga0207702_11255265 | 3300026078 | Unclassified | 735 |
| 1017 | Ga0207702_11806514 | 3300026078 | Bacteria | 603 |
| 1018 | Ga0207702_11942626 | 3300026078 | Bacteria | 579 |
| 1019 | Ga0207641_10003347 | 3300026088 | Bacteria | 14248 |
| 1020 | Ga0207641_10020959 | 3300026088 | Bacteria | 5373 |
| 1021 | Ga0207641_10061136 | 3300026088 | Bacteria | 3212 |
| 1022 | Ga0207641_10105292 | 3300026088 | Unclassified | 2491 |
| 1023 | Ga0207641_10166113 | 3300026088 | Bacteria | 2010 |
| 1024 | Ga0207641_10237758 | 3300026088 | Bacteria | 1696 |
| 1025 | Ga0207641_10333580 | 3300026088 | Bacteria | 1441 |
| 1026 | Ga0207641_10610842 | 3300026088 | Unclassified | 1068 |
| 1027 | Ga0207648_10022243 | 3300026089 | Bacteria | 5696 |
| 1028 | Ga0207648_10073512 | 3300026089 | Bacteria | 2979 |
| 1029 | Ga0207648_10458456 | 3300026089 | Bacteria | 1162 |
| 1030 | Ga0207648_10550496 | 3300026089 | Bacteria | 1060 |
| 1031 | Ga0207648_10862644 | 3300026089 | Bacteria | 845 |
| 1032 | Ga0207648_11775287 | 3300026089 | Unclassified | 578 |
| 1033 | Ga0207676_10005629 | 3300026095 | Bacteria | 8867 |
| 1034 | Ga0207676_10039951 | 3300026095 | Bacteria | 3593 |
| 1035 | Ga0207676_10212667 | 3300026095 | Bacteria | 1716 |
| 1036 | Ga0207676_10437656 | 3300026095 | Bacteria | 1230 |
| 1037 | Ga0207676_10628058 | 3300026095 | Bacteria | 1034 |
| 1038 | Ga0207676_11658607 | 3300026095 | Bacteria | 637 |
| 1039 | Ga0207676_11718266 | 3300026095 | Archaea | 626 |
| 1040 | Ga0207676_11985695 | 3300026095 | Bacteria | 580 |
| 1041 | Ga0207676_12239877 | 3300026095 | Unclassified | 544 |
| 1042 | Ga0207674_10006105 | 3300026116 | Bacteria | 14242 |
| 1043 | Ga0207674_10026877 | 3300026116 | Bacteria | 6103 |
| 1044 | Ga0207674_10112388 | 3300026116 | Bacteria | 2697 |
| 1045 | Ga0207674_10571134 | 3300026116 | Unclassified | 1092 |
| 1046 | Ga0207674_10933541 | 3300026116 | Bacteria | 836 |
| 1047 | Ga0207674_11152808 | 3300026116 | Bacteria | 745 |
| 1048 | Ga0207675_100006619 | 3300026118 | Bacteria | 10960 |
| 1049 | Ga0207675_100092204 | 3300026118 | Bacteria | 2849 |
| 1050 | Ga0207675_100172832 | 3300026118 | Unclassified | 2066 |
| 1051 | Ga0207675_100236790 | 3300026118 | Bacteria | 1763 |
| 1052 | Ga0207675_100252565 | 3300026118 | Bacteria | 1707 |
| 1053 | Ga0207675_100675252 | 3300026118 | Bacteria | 1040 |
| 1054 | Ga0207675_100723374 | 3300026118 | Unclassified | 1005 |
| 1055 | Ga0207675_102532205 | 3300026118 | Unclassified | 524 |
| 1056 | Ga0207683_10000392 | 3300026121 | Bacteria | 40319 |
| 1057 | Ga0207683_10058359 | 3300026121 | Bacteria | 3389 |
| 1058 | Ga0207698_10002536 | 3300026142 | Bacteria | 10844 |
| 1059 | Ga0207698_10006606 | 3300026142 | Bacteria | 7253 |
| 1060 | Ga0207698_10037024 | 3300026142 | Bacteria | 3589 |
| 1061 | Ga0207698_10094864 | 3300026142 | Bacteria | 2454 |
| 1062 | Ga0207698_10278488 | 3300026142 | Bacteria | 1546 |
| 1063 | Ga0207698_10575811 | 3300026142 | Bacteria | 1107 |
| 1064 | Ga0207698_11042794 | 3300026142 | Unclassified | 829 |
| 1065 | Ga0207698_11071263 | 3300026142 | Unclassified | 818 |
| 1066 | Ga0207698_11134968 | 3300026142 | Unclassified | 795 |
| 1067 | Ga0209999_1064506 | 3300027543 | Bacteria | 699 |
| 1068 | Ga0209998_10175110 | 3300027717 | Bacteria | 557 |
| 1069 | Ga0207428_10000608 | 3300027907 | Bacteria | 42445 |
| 1070 | Ga0207428_10015891 | 3300027907 | Bacteria | 6494 |
| 1071 | Ga0207428_10287312 | 3300027907 | Bacteria | 1220 |
| 1072 | Ga0207428_10567855 | 3300027907 | Unclassified | 819 |
| 1073 | Ga0207428_10675362 | 3300027907 | Bacteria | 740 |
| 1074 | Ga0207428_11032171 | 3300027907 | Bacteria | 577 |
| 1075 | Ga0265354_1000098 | 3300028016 | Bacteria | 14977 |
| 1076 | Ga0265354_1000950 | 3300028016 | Bacteria | 4569 |
| 1077 | Ga0265355_1012880 | 3300028036 | Unclassified | 695 |
| 1078 | Ga0268266_10028937 | 3300028379 | Bacteria | 4708 |
| 1079 | Ga0268266_10051630 | 3300028379 | Bacteria | 3530 |
| 1080 | Ga0268266_10752208 | 3300028379 | Unclassified | 941 |
| 1081 | Ga0268266_10872161 | 3300028379 | Bacteria | 870 |
| 1082 | Ga0268266_11267437 | 3300028379 | Bacteria | 712 |
| 1083 | Ga0268266_12009194 | 3300028379 | Bacteria | 551 |
| 1084 | Ga0268265_10036595 | 3300028380 | Bacteria | 3596 |
| 1085 | Ga0268265_10074665 | 3300028380 | Bacteria | 2653 |
| 1086 | Ga0268265_10100723 | 3300028380 | Unclassified | 2332 |
| 1087 | Ga0268265_10139054 | 3300028380 | Bacteria | 2030 |
| 1088 | Ga0268265_10835675 | 3300028380 | Bacteria | 900 |
| 1089 | Ga0268265_11033087 | 3300028380 | Unclassified | 813 |
| 1090 | Ga0268265_11459766 | 3300028380 | Bacteria | 687 |
| 1091 | Ga0268264_10001264 | 3300028381 | Bacteria | 24011 |
| 1092 | Ga0268264_10014533 | 3300028381 | Bacteria | 6469 |
| 1093 | Ga0268264_10016196 | 3300028381 | Bacteria | 6105 |
| 1094 | Ga0268264_10024740 | 3300028381 | Bacteria | 4904 |
| 1095 | Ga0268264_10240123 | 3300028381 | Bacteria | 1678 |
| 1096 | Ga0268264_10247856 | 3300028381 | Bacteria | 1653 |
| 1097 | Ga0268264_10370565 | 3300028381 | Bacteria | 1369 |
| 1098 | Ga0268264_10453754 | 3300028381 | Unclassified | 1242 |
| 1099 | Ga0268264_10633907 | 3300028381 | Unclassified | 1056 |
| 1100 | Ga0265326_10035795 | 3300028558 | Bacteria | 1412 |
| 1101 | Ga0265319_1093397 | 3300028563 | Bacteria | 948 |
| 1102 | Ga0265323_10001642 | 3300028653 | Bacteria | 10755 |
| 1103 | Ga0265323_10029672 | 3300028653 | Unclassified | 2044 |
| 1104 | Ga0265323_10035115 | 3300028653 | Bacteria | 1850 |
| 1105 | Ga0265323_10037767 | 3300028653 | Bacteria | 1768 |
| 1106 | Ga0265338_10007747 | 3300028800 | Bacteria | 13217 |
| 1107 | Ga0265338_10036426 | 3300028800 | Bacteria | 4708 |
| 1108 | Ga0265338_10051346 | 3300028800 | Bacteria | 3713 |
| 1109 | Ga0265338_10716149 | 3300028800 | Unclassified | 690 |
| 1110 | Ga0316177_1136457 | 3300030731 | Bacteria | 951 |
| 1111 | Ga0316176_1005077 | 3300030732 | Bacteria | 694 |
| 1112 | Ga0316182_1208682 | 3300030745 | Bacteria | 888 |
| 1113 | Ga0265770_1002035 | 3300030878 | Bacteria | 2755 |
| 1114 | Ga0265765_1001343 | 3300030879 | Bacteria | 2246 |
| 1115 | Ga0265765_1036246 | 3300030879 | Unclassified | 644 |
| 1116 | Ga0265760_10001198 | 3300031090 | Bacteria | 7597 |
| 1117 | Ga0265760_10014078 | 3300031090 | Bacteria | 2290 |
| 1118 | Ga0265330_10004895 | 3300031235 | Bacteria | 6744 |
| 1119 | Ga0265330_10008926 | 3300031235 | Bacteria | 4788 |
| 1120 | Ga0265332_10000009 | 3300031238 | Bacteria | 295760 |
| 1121 | Ga0265332_10000042 | 3300031238 | Bacteria | 117639 |
| 1122 | Ga0265332_10133215 | 3300031238 | Bacteria | 1042 |
| 1123 | Ga0265328_10014817 | 3300031239 | Bacteria | 3063 |
| 1124 | Ga0265320_10050477 | 3300031240 | Bacteria | 2021 |
| 1125 | Ga0265320_10094376 | 3300031240 | Bacteria | 1383 |
| 1126 | Ga0265329_10015222 | 3300031242 | Bacteria | 2692 |
| 1127 | Ga0265340_10005578 | 3300031247 | Bacteria | 6979 |
| 1128 | Ga0265339_10005067 | 3300031249 | Bacteria | 8848 |
| 1129 | Ga0265331_10000022 | 3300031250 | Bacteria | 240970 |
| 1130 | Ga0265327_10082134 | 3300031251 | Bacteria | 1589 |
| 1131 | Ga0265316_10004370 | 3300031344 | Bacteria | 14096 |
| 1132 | Ga0265316_10024993 | 3300031344 | Bacteria | 4991 |
| 1133 | Ga0265316_10052764 | 3300031344 | Bacteria | 3188 |
| 1134 | Ga0265316_10093223 | 3300031344 | Bacteria | 2295 |
| 1135 | Ga0265316_10693067 | 3300031344 | Bacteria | 718 |
| 1136 | Ga0307509_10000076 | 3300031507 | Bacteria | 138855 |
| 1137 | Ga0265314_10000681 | 3300031711 | Bacteria | 41349 |
| 1138 | Ga0265314_10100234 | 3300031711 | Bacteria | 1863 |
| 1139 | Ga0265314_10139877 | 3300031711 | Bacteria | 1498 |
| 1140 | Ga0265342_10004261 | 3300031712 | Bacteria | 11327 |
| 1141 | Ga0265342_10008059 | 3300031712 | Bacteria | 7619 |
| 1142 | Ga0265342_10327422 | 3300031712 | Unclassified | 802 |
| 1143 | Ga0307407_10815383 | 3300031903 | Unclassified | 711 |
| 1144 | Ga0316053_102437 | 3300032120 | Unclassified | 1055 |
| 1145 | Ga0316212_1002969 | 3300033547 | Bacteria | 2439 |
| 1146 | Ga0316212_1020776 | 3300033547 | Bacteria | 921 |
| 1147 | Ga0373929_0091436 | 3300035085 | Bacteria | 756 |
| 1148 | Ga0373934_0001839 | 3300035086 | Bacteria | 7803 |
| 1149 | Ga0373934_0128101 | 3300035086 | Bacteria | 1034 |
| 1150 | Ga0373940_0154000 | 3300035088 | Bacteria | 734 |
| 1151 | Ga0373940_0294809 | 3300035088 | Unclassified | 557 |
| 1152 | Ga0373951_0019781 | 3300035091 | Bacteria | 1537 |
| 1153 | Ga0373923_0094482 | 3300035111 | Bacteria | 1312 |
| 1154 | Ga0373923_0158048 | 3300035111 | Bacteria | 1033 |
| 1155 | Ga0373936_0183399 | 3300035113 | Archaea | 919 |
| 1156 | Ga0373936_0434186 | 3300035113 | Bacteria | 606 |
| 1157 | Ga0373953_0056831 | 3300035117 | Bacteria | 1592 |
| 1158 | Ga0373953_0131853 | 3300035117 | Bacteria | 1066 |
| 1159 | Ga0373953_0178180 | 3300035117 | Bacteria | 916 |
| 1160 | Ga0373953_0248623 | 3300035117 | Unclassified | 773 |
| 1161 | Ga0373954_0045359 | 3300035118 | Bacteria | 2053 |
| 1162 | Ga0373954_0071639 | 3300035118 | Bacteria | 1647 |
| 1163 | Ga0373956_0011297 | 3300035119 | Bacteria | 3678 |
| 1164 | Ga0373956_0025194 | 3300035119 | Bacteria | 2569 |
| 1165 | Ga0373956_0080257 | 3300035119 | Bacteria | 1497 |
| 1166 | Ga0373957_0323409 | 3300035120 | Unclassified | 656 |
| 1167 | Ga0373957_0332543 | 3300035120 | Unclassified | 647 |
| 1168 | Ga0373957_0339927 | 3300035120 | Unclassified | 640 |
| 1169 | Ga0373957_0522703 | 3300035120 | Bacteria | 518 |
| 1170 | Ga0373955_0012644 | 3300035172 | Bacteria | 4060 |
| 1171 | Ga0373955_0346412 | 3300035172 | Unclassified | 900 |
| 1172 | Ga0373955_0625318 | 3300035172 | Unclassified | 660 |
| 1173 | Ga0373961_0267220 | 3300035241 | Bacteria | 623 |
| 1174 | Ga0316574_0143853 | 3300035398 | Bacteria | 1537 |
| 1175 | Ga0373924_0315826 | 3300035410 | Unclassified | 694 |
| 1176 | Ga0373931_0033965 | 3300035691 | Unclassified | 2645 |
| 1177 | Ga0373931_0332260 | 3300035691 | Bacteria | 947 |
| 1178 | Ga0373931_0604631 | 3300035691 | Bacteria | 717 |
| 1179 | Ga0373935_0433005 | 3300035692 | Bacteria | 948 |
| 1180 | Ga0373933_0036573 | 3300035724 | Bacteria | 2875 |
| 1181 | Ga0373933_0040062 | 3300035724 | Bacteria | 2758 |
| 1182 | Ga0373933_0170240 | 3300035724 | Bacteria | 1386 |
| 1183 | Ga0373933_0400081 | 3300035724 | Bacteria | 896 |
| 1184 | Ga0373933_0689509 | 3300035724 | Unclassified | 672 |
| 1185 | Ga0373937_0004374 | 3300036401 | Bacteria | 11997 |
| 1186 | Ga0373937_0060946 | 3300036401 | Bacteria | 3468 |
| 1187 | Ga0373937_0084956 | 3300036401 | Bacteria | 2929 |
| 1188 | Ga0373937_0156351 | 3300036401 | Bacteria | 2137 |
| 1189 | Ga0373937_0270489 | 3300036401 | Unclassified | 1604 |
| 1190 | Ga0373937_0376361 | 3300036401 | Bacteria | 1346 |
| 1191 | Ga0373937_0380585 | 3300036401 | Unclassified | 1338 |
| 1192 | Ga0373937_0511519 | 3300036401 | Unclassified | 1141 |
| 1193 | Ga0373937_0948879 | 3300036401 | Unclassified | 809 |
| 1194 | Ga0373937_0975167 | 3300036401 | Unclassified | 796 |
| 1195 | Ga0373925_1175321 | 3300037068 | Unclassified | 631 |
| 1196 | Ga0373925_1347120 | 3300037068 | Unclassified | 585 |
| 1197 | Ga0395899_0976327 | 3300037312 | Unclassified | 512 |
| 1198 | Ga0395900_0786191 | 3300037418 | Bacteria | 880 |
| 1199 | Ga0395900_0834549 | 3300037418 | Unclassified | 848 |
| 1200 | Ga0395898_1834323 | 3300037466 | Bacteria | 527 |
| 1201 | Ga0395901_0587782 | 3300038443 | Unclassified | 1124 |
| 1202 | Ga0395901_2087217 | 3300038443 | Bacteria | 512 |
| 1203 | Ga0451802_1861437 | 3300041460 | Bacteria | 632 |
| 1204 | Ga0451807_0907752 | 3300041486 | Unclassified | 1126 |
| 1205 | Ga0451839_1288097 | 3300041496 | Bacteria | 743 |
| 1206 | Ga0451843_0211863 | 3300041509 | Bacteria | 530 |
| 1207 | Ga0451843_1005222 | 3300041509 | Unclassified | 607 |
| 1208 | Ga0451853_2542678 | 3300041512 | Bacteria | 816 |
| 1209 | Ga0450923_106454 | 3300042125 | Bacteria | 651 |
| 1210 | Ga0439460_0224587 | 3300042461 | Bacteria | 645 |
| 1211 | Ga0451577_0063966 | 3300042876 | Bacteria | 3281 |
| 1212 | Ga0451577_0078362 | 3300042876 | Bacteria | 2946 |
| 1213 | Ga0451577_0106049 | 3300042876 | Unclassified | 2512 |
| 1214 | Ga0451577_0138218 | 3300042876 | Bacteria | 2188 |
| 1215 | Ga0451577_0822950 | 3300042876 | Bacteria | 838 |
| 1216 | Ga0451577_1515252 | 3300042876 | Unclassified | 593 |
| 1217 | Ga0451577_1554443 | 3300042876 | Unclassified | 584 |
| 1218 | Ga0451577_2017912 | 3300042876 | Unclassified | 504 |
| 1219 | Ga0439440_0146535 | 3300042993 | Bacteria | 674 |
| 1220 | Ga0453683_0019235 | 3300044673 | Bacteria | 4375 |
| 1221 | Ga0453683_0354812 | 3300044673 | Unclassified | 942 |
| 1222 | Ga0453683_0426242 | 3300044673 | Unclassified | 856 |
| 1223 | Ga0453683_0467740 | 3300044673 | Bacteria | 816 |
| 1224 | Ga0466963_0333165 | 3300044694 | Unclassified | 1068 |
| 1225 | Ga0453684_0084340 | 3300044712 | Bacteria | 3951 |
| 1226 | Ga0453684_0091154 | 3300044712 | Bacteria | 3763 |
| 1227 | Ga0453684_0152887 | 3300044712 | Bacteria | 2740 |
| 1228 | Ga0453684_0223641 | 3300044712 | Bacteria | 2178 |
| 1229 | Ga0453684_0518234 | 3300044712 | Bacteria | 1318 |
| 1230 | Ga0453684_1222631 | 3300044712 | Unclassified | 787 |
| 1231 | Ga0453684_1620555 | 3300044712 | Unclassified | 664 |
| 1232 | Ga0453684_2548615 | 3300044712 | Bacteria | 504 |
| 1233 | Ga0466957_0880160 | 3300044842 | Unclassified | 639 |
| 1234 | Ga0451576_0001883 | 3300045051 | Bacteria | 33774 |
| 1235 | Ga0451576_0059242 | 3300045051 | Bacteria | 3998 |
| 1236 | Ga0451576_0059260 | 3300045051 | Unclassified | 3998 |
| 1237 | Ga0451576_0090653 | 3300045051 | Bacteria | 3180 |
| 1238 | Ga0451576_0124751 | 3300045051 | Bacteria | 2683 |
| 1239 | Ga0451576_0133396 | 3300045051 | Bacteria | 2589 |
| 1240 | Ga0451576_0240284 | 3300045051 | Bacteria | 1892 |
| 1241 | Ga0451576_0375565 | 3300045051 | Bacteria | 1490 |
| 1242 | Ga0451576_0401641 | 3300045051 | Bacteria | 1437 |
| 1243 | Ga0451576_0464825 | 3300045051 | Bacteria | 1329 |
| 1244 | Ga0451576_0502080 | 3300045051 | Bacteria | 1274 |
| 1245 | Ga0451576_0786898 | 3300045051 | Bacteria | 999 |
| 1246 | Ga0451576_0855342 | 3300045051 | Unclassified | 955 |
| 1247 | Ga0466967_0002917 | 3300045976 | Bacteria | 10906 |
| 1248 | Ga0495592_0191652 | 3300046454 | Bacteria | 1385 |
| 1249 | Ga0495603_0314973 | 3300046455 | Unclassified | 898 |
| 1250 | Ga0495629_0759927 | 3300046459 | Unclassified | 641 |
| 1251 | Ga0495629_0899982 | 3300046459 | Unclassified | 580 |
| 1252 | Ga0495651_1024348 | 3300046462 | Unclassified | 500 |
| 1253 | Ga0495653_0824971 | 3300046463 | Bacteria | 556 |
| 1254 | Ga0495580_0125999 | 3300046472 | Bacteria | 1777 |
| 1255 | Ga0495580_0139332 | 3300046472 | Bacteria | 1682 |
| 1256 | Ga0495580_0246831 | 3300046472 | Unclassified | 1223 |
| 1257 | Ga0495580_1007317 | 3300046472 | Bacteria | 531 |
| 1258 | Ga0495582_0638181 | 3300046473 | Bacteria | 616 |
| 1259 | Ga0495639_0072580 | 3300046475 | Bacteria | 1592 |
| 1260 | Ga0495585_0525181 | 3300046492 | Bacteria | 561 |
| 1261 | Ga0495608_0227305 | 3300046511 | Unclassified | 1169 |
| 1262 | Ga0495618_0203742 | 3300046514 | Bacteria | 1252 |
| 1263 | Ga0495628_0375465 | 3300046516 | Bacteria | 1042 |
| 1264 | Ga0495630_0070982 | 3300046517 | Bacteria | 2621 |
| 1265 | Ga0495652_0762873 | 3300046529 | Bacteria | 646 |
| 1266 | Ga0495586_0735573 | 3300046535 | Unclassified | 569 |
| 1267 | Ga0495586_0846714 | 3300046535 | Bacteria | 527 |
| 1268 | Ga0495587_0397258 | 3300046536 | Bacteria | 766 |
| 1269 | Ga0495587_0425626 | 3300046536 | Unclassified | 737 |
| 1270 | Ga0495622_0344915 | 3300046557 | Bacteria | 645 |
| 1271 | Ga0495622_0388364 | 3300046557 | Unclassified | 602 |
| 1272 | Ga0495667_0435067 | 3300046559 | Unclassified | 825 |
| 1273 | Ga0495634_0028961 | 3300046642 | Bacteria | 3839 |
| 1274 | Ga0495634_0285044 | 3300046642 | Bacteria | 1002 |
| 1275 | Ga0495635_0809855 | 3300046663 | Unclassified | 603 |
| 1276 | Ga0495657_0305061 | 3300046675 | Unclassified | 949 |
| 1277 | Ga0495599_0515429 | 3300046678 | Bacteria | 703 |
| 1278 | Ga0495646_0676971 | 3300046680 | Unclassified | 520 |
| 1279 | Ga0495647_0253352 | 3300046681 | Unclassified | 784 |
| 1280 | Ga0495658_0506217 | 3300046683 | Bacteria | 773 |
| 1281 | Ga0495669_0066462 | 3300046684 | Bacteria | 1638 |
| 1282 | Ga0495669_0432199 | 3300046684 | Bacteria | 639 |
| 1283 | Ga0495613_0095160 | 3300046689 | Bacteria | 2155 |
| 1284 | Ga0495613_0179709 | 3300046689 | Unclassified | 1499 |
| 1285 | Ga0495670_0830072 | 3300046691 | Bacteria | 505 |
| 1286 | Ga0495600_0417746 | 3300046809 | Bacteria | 833 |
| 1287 | Ga0495680_0243301 | 3300047322 | Bacteria | 1277 |
| 1288 | Ga0495680_0853826 | 3300047322 | Bacteria | 591 |
| 1289 | Ga0495680_0878458 | 3300047322 | Bacteria | 581 |
| 1290 | Ga0495680_1016783 | 3300047322 | Bacteria | 529 |
| 1291 | Ga0495684_0178850 | 3300047471 | Unclassified | 1573 |
| 1292 | Ga0495684_0301944 | 3300047471 | Bacteria | 1150 |
| 1293 | Ga0495593_0540647 | 3300047673 | Unclassified | 584 |
| 1294 | Ga0495602_0474726 | 3300048088 | Bacteria | 879 |
| 1295 | Ga0496100_0177343 | 3300048903 | Bacteria | 1539 |
| 1296 | Ga0496100_0961853 | 3300048903 | Bacteria | 671 |
| 1297 | Ga0496101_0748775 | 3300048904 | Unclassified | 771 |
| 1298 | Ga0496102_0003426 | 3300048905 | Bacteria | 13444 |
| 1299 | Ga0496102_1363466 | 3300048905 | Bacteria | 628 |
| 1300 | Ga0496103_0223104 | 3300048906 | Bacteria | 1212 |
| 1301 | Ga0496104_0578944 | 3300048907 | Bacteria | 1033 |
| 1302 | Ga0496104_0874090 | 3300048907 | Unclassified | 804 |
| 1303 | Ga0496105_0560014 | 3300048908 | Unclassified | 891 |
| 1304 | Ga0496106_0112490 | 3300048909 | Bacteria | 2121 |
| 1305 | Ga0496106_0639086 | 3300048909 | Bacteria | 851 |
| 1306 | Ga0496106_0903385 | 3300048909 | Bacteria | 697 |
| 1307 | Ga0496108_0008090 | 3300048911 | Bacteria | 8531 |
| 1308 | Ga0496108_0069079 | 3300048911 | Bacteria | 2981 |
| 1309 | Ga0496108_0186752 | 3300048911 | Bacteria | 1796 |
| 1310 | Ga0496108_0285755 | 3300048911 | Bacteria | 1436 |
| 1311 | Ga0496108_0930722 | 3300048911 | Bacteria | 745 |
| 1312 | Ga0496108_1120762 | 3300048911 | Bacteria | 668 |
| 1313 | Ga0496109_0001877 | 3300048912 | Bacteria | 17407 |
| 1314 | Ga0496110_0044892 | 3300048913 | Bacteria | 3860 |
| 1315 | Ga0496110_0592788 | 3300048913 | Unclassified | 1006 |
| 1316 | Ga0496110_1231160 | 3300048913 | Bacteria | 657 |
| 1317 | Ga0496110_1344930 | 3300048913 | Bacteria | 624 |
| 1318 | Ga0496111_0376435 | 3300048914 | Unclassified | 1050 |
| 1319 | Ga0496111_0676832 | 3300048914 | Bacteria | 752 |
| 1320 | Ga0496112_0147241 | 3300048915 | Bacteria | 2323 |
| 1321 | Ga0496112_0353809 | 3300048915 | Unclassified | 1411 |
| 1322 | Ga0496112_0989787 | 3300048915 | Archaea | 761 |
| 1323 | Ga0496113_0224189 | 3300048916 | Bacteria | 1498 |
| 1324 | Ga0496114_0197160 | 3300048917 | Bacteria | 1763 |
| 1325 | Ga0496115_0003187 | 3300048918 | Bacteria | 11780 |
| 1326 | Ga0496115_0051899 | 3300048918 | Unclassified | 3289 |
| 1327 | Ga0496115_0166618 | 3300048918 | Bacteria | 1822 |
| 1328 | Ga0496115_0855460 | 3300048918 | Bacteria | 704 |
| 1329 | Ga0496126_0683616 | 3300048929 | Bacteria | 799 |
| 1330 | Ga0501310_012639 | 3300049130 | Bacteria | 971 |
| 1331 | Ga0501315_052556 | 3300049531 | Bacteria | 643 |
| 1332 | Ga0501031_0246246 | 3300049568 | Bacteria | 1162 |
| 1333 | Ga0501032_0038061 | 3300049569 | Bacteria | 3277 |
| 1334 | Ga0501032_0540280 | 3300049569 | Unclassified | 743 |
| 1335 | Ga0501033_0052408 | 3300049570 | Bacteria | 3024 |
| 1336 | Ga0501033_0868990 | 3300049570 | Unclassified | 607 |
| 1337 | Ga0501034_0026609 | 3300049571 | Bacteria | 5889 |
| 1338 | Ga0501034_0548433 | 3300049571 | Bacteria | 1065 |
| 1339 | Ga0501034_0598232 | 3300049571 | Bacteria | 1008 |
| 1340 | Ga0501036_0116535 | 3300049572 | Bacteria | 2256 |
| 1341 | Ga0501036_0376694 | 3300049572 | Bacteria | 1184 |
| 1342 | Ga0501037_0058985 | 3300049573 | Bacteria | 2800 |
| 1343 | Ga0501037_0062601 | 3300049573 | Bacteria | 2712 |
| 1344 | Ga0501038_0098967 | 3300049574 | Bacteria | 2431 |
| 1345 | Ga0501038_0264997 | 3300049574 | Bacteria | 1356 |
| 1346 | Ga0501038_0321381 | 3300049574 | Bacteria | 1211 |
| 1347 | Ga0501039_0126887 | 3300049575 | Bacteria | 2001 |
| 1348 | Ga0501039_0132178 | 3300049575 | Bacteria | 1959 |
| 1349 | Ga0501039_1420855 | 3300049575 | Bacteria | 534 |
| 1350 | Ga0501040_0243013 | 3300049576 | Bacteria | 1284 |
| 1351 | Ga0501040_1366719 | 3300049576 | Bacteria | 514 |
| 1352 | Ga0501041_0103736 | 3300049577 | Bacteria | 1761 |
| 1353 | Ga0501041_0388174 | 3300049577 | Bacteria | 884 |
| 1354 | Ga0501042_0006571 | 3300049578 | Bacteria | 7562 |
| 1355 | Ga0501042_1141937 | 3300049578 | Unclassified | 568 |
| 1356 | Ga0501043_0049118 | 3300049579 | Bacteria | 3317 |
| 1357 | Ga0501043_0091498 | 3300049579 | Bacteria | 2391 |
| 1358 | Ga0501043_0606017 | 3300049579 | Bacteria | 808 |
| 1359 | Ga0501046_0045612 | 3300049580 | Bacteria | 3482 |
| 1360 | Ga0501046_0064852 | 3300049580 | Bacteria | 2850 |
| 1361 | Ga0501046_0123185 | 3300049580 | Bacteria | 1971 |
| 1362 | Ga0501047_0327571 | 3300049581 | Bacteria | 1370 |
| 1363 | Ga0501047_0863938 | 3300049581 | Bacteria | 718 |
| 1364 | Ga0501047_1372407 | 3300049581 | Bacteria | 521 |
| 1365 | Ga0501048_0034507 | 3300049582 | Bacteria | 3649 |
| 1366 | Ga0501048_0079035 | 3300049582 | Bacteria | 2321 |
| 1367 | Ga0501067_0008902 | 3300049583 | Bacteria | 5561 |
| 1368 | Ga0501067_0169930 | 3300049583 | Bacteria | 1214 |
| 1369 | Ga0501067_0188648 | 3300049583 | Unclassified | 1148 |
| 1370 | Ga0501068_0032050 | 3300049584 | Bacteria | 3124 |
| 1371 | Ga0501068_0052413 | 3300049584 | Bacteria | 2469 |
| 1372 | Ga0501068_0520520 | 3300049584 | Bacteria | 772 |
| 1373 | Ga0501069_0004494 | 3300049585 | Bacteria | 7206 |
| 1374 | Ga0501070_0224127 | 3300049586 | Bacteria | 1541 |
| 1375 | Ga0501070_0382453 | 3300049586 | Bacteria | 1140 |
| 1376 | Ga0501071_0080954 | 3300049587 | Bacteria | 2376 |
| 1377 | Ga0501071_0862763 | 3300049587 | Bacteria | 698 |
| 1378 | Ga0501071_1015621 | 3300049587 | Bacteria | 641 |
| 1379 | Ga0501071_1205039 | 3300049587 | Unclassified | 585 |
| 1380 | Ga0501072_0039700 | 3300049588 | Bacteria | 3695 |
| 1381 | Ga0501072_0097589 | 3300049588 | Bacteria | 2336 |
| 1382 | Ga0501072_0146616 | 3300049588 | Bacteria | 1882 |
| 1383 | Ga0501072_0867793 | 3300049588 | Bacteria | 705 |
| 1384 | Ga0501073_0059231 | 3300049589 | Bacteria | 2675 |
| 1385 | Ga0501073_0156069 | 3300049589 | Bacteria | 1581 |
| 1386 | Ga0501074_0092132 | 3300049590 | Bacteria | 2170 |
| 1387 | Ga0501075_0341867 | 3300049591 | Unclassified | 1140 |
| 1388 | Ga0501076_0569224 | 3300049592 | Bacteria | 934 |
| 1389 | Ga0501076_0718961 | 3300049592 | Bacteria | 824 |
| 1390 | Ga0501076_0989290 | 3300049592 | Unclassified | 693 |
| 1391 | Ga0501077_0506966 | 3300049593 | Bacteria | 774 |
| 1392 | Ga0501079_0037276 | 3300049741 | Bacteria | 3747 |
| 1393 | Ga0501079_1014142 | 3300049741 | Bacteria | 654 |
| 1394 | Ga0501079_1406353 | 3300049741 | Unclassified | 549 |
| 1395 | Ga0501080_0301014 | 3300049742 | Bacteria | 1454 |
| 1396 | Ga0501080_0402355 | 3300049742 | Bacteria | 1231 |
| 1397 | Ga0501080_0405268 | 3300049742 | Unclassified | 1226 |
| 1398 | Ga0501080_1114728 | 3300049742 | Bacteria | 681 |
| 1399 | Ga0501080_1691947 | 3300049742 | Bacteria | 534 |
| 1400 | Ga0501081_0247611 | 3300049743 | Bacteria | 1300 |
| 1401 | Ga0501081_0486427 | 3300049743 | Bacteria | 919 |
| 1402 | Ga0501081_0546611 | 3300049743 | Bacteria | 865 |
| 1403 | Ga0501081_0946984 | 3300049743 | Unclassified | 650 |
| 1404 | Ga0501083_0002089 | 3300049744 | Bacteria | 13737 |
| 1405 | Ga0501083_0150204 | 3300049744 | Bacteria | 1525 |
| 1406 | Ga0501083_0961920 | 3300049744 | Unclassified | 556 |
| 1407 | Ga0501035_0105773 | 3300049822 | Bacteria | 2467 |
| 1408 | Ga0501044_0120546 | 3300049823 | Bacteria | 2624 |
| 1409 | Ga0501044_0189789 | 3300049823 | Bacteria | 2018 |
| 1410 | Ga0501044_0292645 | 3300049823 | Bacteria | 1559 |
| 1411 | Ga0501045_0080520 | 3300049824 | Bacteria | 2401 |
| 1412 | Ga0501045_0358615 | 3300049824 | Bacteria | 1085 |
| 1413 | nmdc:mga0k408_151229_c1 | 3300050493 | Bacteria | 1382 |
| 1414 | nmdc:mga05p37_12092_c1 | 3300050507 | Bacteria | 10303 |
| 1415 | nmdc:mga05p37_1386757_c1 | 3300050507 | Unclassified | 709 |
| 1416 | nmdc:mga05p37_204944_c1 | 3300050507 | Bacteria | 2386 |
| 1417 | nmdc:mga05p37_370855_c1 | 3300050507 | Bacteria | 1680 |
| 1418 | nmdc:mga05p37_381218_c1 | 3300050507 | Bacteria | 1652 |
| 1419 | nmdc:mga05p37_523024_c1 | 3300050507 | Bacteria | 1356 |
| 1420 | nmdc:mga05p37_538804_c1 | 3300050507 | Unclassified | 1331 |
| 1421 | nmdc:mga05p37_57379_c1 | 3300050507 | Bacteria | 4796 |
| 1422 | nmdc:mga09592_234689_c1 | 3300050508 | Bacteria | 1589 |
| 1423 | nmdc:mga09592_275530_c1 | 3300050508 | Bacteria | 1459 |
| 1424 | nmdc:mga09592_335945_c1 | 3300050508 | Bacteria | 1308 |
| 1425 | nmdc:mga09592_460981_c1 | 3300050508 | Unclassified | 1096 |
| 1426 | nmdc:mga09592_987605_c1 | 3300050508 | Bacteria | 704 |
| 1427 | nmdc:mga0qj67_298460_c1 | 3300050509 | Bacteria | 1305 |
| 1428 | nmdc:mga06r32_1154380_c1 | 3300050510 | Unclassified | 722 |
| 1429 | nmdc:mga06r32_196779_c1 | 3300050510 | Bacteria | 2003 |
| 1430 | nmdc:mga06r32_643319_c1 | 3300050510 | Unclassified | 1029 |
| 1431 | nmdc:mga08y16_1131174_c1 | 3300050511 | Unclassified | 757 |
| 1432 | nmdc:mga08y16_23201_c1 | 3300050511 | Bacteria | 6550 |
| 1433 | nmdc:mga08y16_294223_c1 | 3300050511 | Bacteria | 1674 |
| 1434 | nmdc:mga08y16_342_c1 | 3300050511 | Bacteria | 42098 |
| 1435 | nmdc:mga08y16_602455_c1 | 3300050511 | Bacteria | 1107 |
| 1436 | nmdc:mga08y16_90657_c1 | 3300050511 | Bacteria | 3187 |
| 1437 | nmdc:mga0n895_1135537_c1 | 3300050512 | Unclassified | 757 |
| 1438 | nmdc:mga0n895_1910895_c1 | 3300050512 | Unclassified | 552 |
| 1439 | nmdc:mga0n895_2014993_c1 | 3300050512 | Unclassified | 535 |
| 1440 | nmdc:mga0n895_397902_c1 | 3300050512 | Bacteria | 1393 |
| 1441 | nmdc:mga0rr50_1239469_c1 | 3300050513 | Unclassified | 633 |
| 1442 | nmdc:mga0rr50_1551797_c1 | 3300050513 | Unclassified | 559 |
| 1443 | nmdc:mga0rr50_1641393_c1 | 3300050513 | Unclassified | 542 |
| 1444 | nmdc:mga08x19_172659_c1 | 3300050514 | Bacteria | 1473 |
| 1445 | nmdc:mga0a205_1454072_c1 | 3300050515 | Bacteria | 533 |
| 1446 | nmdc:mga0a205_322471_c1 | 3300050515 | Bacteria | 1416 |
| 1447 | nmdc:mga0a205_811202_c1 | 3300050515 | Bacteria | 783 |
| 1448 | nmdc:mga0a205_968792_c1 | 3300050515 | Unclassified | 697 |
| 1449 | Ga0495595_0288838 | 3300053084 | Bacteria | 824 |
| 1450 | Ga0500566_0442418 | 3300053094 | Bacteria | 571 |
| 1451 | Ga0500655_043141 | 3300053133 | Unclassified | 888 |
| 1452 | Ga0500633_0195074 | 3300053160 | Bacteria | 758 |
| 1453 | Ga0501084_0499091 | 3300054114 | Bacteria | 1028 |
| 1454 | Ga0501084_0618811 | 3300054114 | Bacteria | 915 |
| 1455 | Ga0501084_0732282 | 3300054114 | Unclassified | 833 |
| 1456 | Ga0587084_077701 | 3300059477 | Unclassified | 638 |
| 1457 | Ga0587093_012631 | 3300059478 | Unclassified | 1028 |
| 1458 | Ga0587066_011939 | 3300059490 | Unclassified | 1285 |
| 1459 | Ga0587066_064411 | 3300059490 | Unclassified | 756 |
| 1460 | Ga0587070_018263 | 3300059491 | Unclassified | 1147 |
| 1461 | Ga0587070_235916 | 3300059491 | Unclassified | 502 |
| 1462 | Ga0587073_0022772 | 3300059492 | Bacteria | 1220 |
| 1463 | Ga0587073_0028789 | 3300059492 | Unclassified | 1131 |
| 1464 | Ga0587077_009896 | 3300059493 | Unclassified | 1460 |
| 1465 | Ga0587077_105433 | 3300059493 | Unclassified | 683 |
| 1466 | Ga0587080_056529 | 3300059503 | Unclassified | 754 |
| 1467 | Ga0587080_180120 | 3300059503 | Unclassified | 506 |
| 1468 | Ga0587082_028075 | 3300059504 | Unclassified | 963 |
| 1469 | Ga0587082_057398 | 3300059504 | Unclassified | 759 |
| 1470 | Ga0587083_0008633 | 3300059505 | Unclassified | 1601 |
| 1471 | Ga0587083_0079236 | 3300059505 | Unclassified | 779 |
| 1472 | Ga0587085_003167 | 3300059506 | Bacteria | 1761 |
| 1473 | Ga0587086_006977 | 3300059507 | Bacteria | 1281 |
| 1474 | Ga0587086_038159 | 3300059507 | Unclassified | 733 |
| 1475 | Ga0587088_019415 | 3300059508 | Bacteria | 1117 |
| 1476 | Ga0587088_036209 | 3300059508 | Unclassified | 908 |
| 1477 | Ga0587089_015927 | 3300059509 | Bacteria | 997 |
| 1478 | Ga0587089_021932 | 3300059509 | Unclassified | 890 |
| 1479 | Ga0587089_058658 | 3300059509 | Unclassified | 632 |
| 1480 | Ga0587090_022559 | 3300059510 | Bacteria | 995 |
| 1481 | Ga0587090_036723 | 3300059510 | Unclassified | 845 |
| 1482 | Ga0587091_014316 | 3300059511 | Bacteria | 1290 |
| 1483 | Ga0587091_139962 | 3300059511 | Unclassified | 605 |
| 1484 | Ga0587091_208683 | 3300059511 | Unclassified | 528 |
| 1485 | Ga0587092_024928 | 3300059512 | Unclassified | 952 |
| 1486 | Ga0587092_047651 | 3300059512 | Bacteria | 766 |
| 1487 | Ga0587094_009876 | 3300059513 | Bacteria | 1227 |
| 1488 | Ga0587094_030814 | 3300059513 | Unclassified | 830 |
| 1489 | Ga0587094_066924 | 3300059513 | Unclassified | 639 |
| 1490 | Ga0587098_019251 | 3300059604 | Unclassified | 853 |
| 1491 | Ga0587106_013849 | 3300059605 | Unclassified | 1102 |
| 1492 | Ga0587106_141192 | 3300059605 | Unclassified | 528 |
| 1493 | Ga0587099_063986 | 3300059622 | Unclassified | 512 |
| 1494 | Ga0587101_011992 | 3300059623 | Bacteria | 1119 |
| 1495 | Ga0587101_035396 | 3300059623 | Unclassified | 800 |
| 1496 | Ga0587109_214206 | 3300059624 | Unclassified | 507 |
| 1497 | Ga0587113_006489 | 3300059625 | Bacteria | 995 |
| 1498 | Ga0587128_008914 | 3300059630 | Bacteria | 1309 |
| 1499 | Ga0587128_098881 | 3300059630 | Unclassified | 609 |
| 1500 | Ga0587130_017039 | 3300059631 | Unclassified | 761 |
| 1501 | Ga0587062_129511 | 3300059639 | Unclassified | 518 |
| 1502 | Ga0587067_020773 | 3300059640 | Unclassified | 1126 |
| 1503 | Ga0587067_030361 | 3300059640 | Bacteria | 993 |
| 1504 | Ga0587068_087177 | 3300059641 | Unclassified | 639 |
| 1505 | Ga0587069_009019 | 3300059642 | Unclassified | 1277 |
| 1506 | Ga0587072_031409 | 3300059643 | Bacteria | 994 |
| 1507 | Ga0587075_010783 | 3300059644 | Bacteria | 1215 |
| 1508 | Ga0587075_030657 | 3300059644 | Unclassified | 854 |
| 1509 | Ga0587076_021837 | 3300059645 | Unclassified | 1064 |
| 1510 | Ga0587078_026380 | 3300059646 | Unclassified | 763 |
| 1511 | Ga0587079_064066 | 3300059647 | Unclassified | 804 |
| 1512 | Ga0587079_196547 | 3300059647 | Unclassified | 548 |
| 1513 | Ga0587102_045429 | 3300059649 | Unclassified | 578 |
| 1514 | Ga0587105_007098 | 3300059651 | Unclassified | 784 |
| 1515 | Ga0587105_032989 | 3300059651 | Unclassified | 501 |
| 1516 | Ga0587107_145130 | 3300059652 | Unclassified | 511 |
| 1517 | Ga0587114_016168 | 3300059655 | Unclassified | 996 |
| 1518 | Ga0587114_042778 | 3300059655 | Unclassified | 740 |
| 1519 | Ga0587119_031462 | 3300059658 | Unclassified | 727 |
| 1520 | Ga0587071_026707 | 3300060344 | Unclassified | 1090 |
| 1521 | Ga0501082_0000001 | 3300060353 | Bacteria | 209420 |
| 1522 | Ga0501082_0095630 | 3300060353 | Bacteria | 2567 |
| 1523 | Ga0501082_0205791 | 3300060353 | Bacteria | 1712 |
| 1524 | Ga0501082_0574090 | 3300060353 | Bacteria | 987 |
| 1525 | Ga0530510_0247811 | 3300061734 | Bacteria | 1327 |
| 1526 | Ga0530510_0370195 | 3300061734 | Unclassified | 1078 |
| 1527 | Ga0530510_0551709 | 3300061734 | Unclassified | 875 |
| 1528 | Ga0530510_1205250 | 3300061734 | Bacteria | 580 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005345 | Ga0070692_10644261 | Ga0070692_106442611 | 39 |
| 2 | 3300005719 | Ga0068861_102564558 | Ga0068861_1025645582 | 39 |
| 3 | 3300035691 | Ga0373931_0033965 | Ga0373931_0033965_527_673 | 47 |
| 4 | 3300042125 | Ga0450923_106454 | Ga0450923_106454_337_483 | 47 |
| 5 | 3300002774 | JGI25150J39212_1003133 | JGI25150J39212_10031335 | 48 |
| 6 | 3300003323 | rootH1_10117195 | rootH1_101171952 | 48 |
| 7 | 3300005338 | Ga0068868_101119674 | Ga0068868_1011196741 | 48 |
| 8 | 3300005365 | Ga0070688_100207675 | Ga0070688_1002076751 | 48 |
| 9 | 3300005367 | Ga0070667_100377286 | Ga0070667_1003772862 | 48 |
| 10 | 3300005445 | Ga0070708_100738985 | Ga0070708_1007389852 | 48 |
| 11 | 3300005467 | Ga0070706_100428084 | Ga0070706_1004280843 | 48 |
| 12 | 3300005471 | Ga0070698_100180208 | Ga0070698_1001802082 | 48 |
| 13 | 3300005518 | Ga0070699_100181860 | Ga0070699_1001818601 | 48 |
| 14 | 3300005539 | Ga0068853_100011324 | Ga0068853_1000113244 | 48 |
| 15 | 3300005544 | Ga0070686_100006667 | Ga0070686_1000066673 | 48 |
| 16 | 3300005563 | Ga0068855_100116447 | Ga0068855_1001164473 | 48 |
| 17 | 3300005577 | Ga0068857_102300266 | Ga0068857_1023002662 | 48 |
| 18 | 3300005616 | Ga0068852_100295585 | Ga0068852_1002955852 | 48 |
| 19 | 3300005617 | Ga0068859_100023227 | Ga0068859_1000232272 | 48 |
| 20 | 3300005617 | Ga0068859_101826801 | Ga0068859_1018268012 | 48 |
| 21 | 3300005719 | Ga0068861_100048419 | Ga0068861_1000484193 | 48 |
| 22 | 3300005841 | Ga0068863_100853902 | Ga0068863_1008539022 | 48 |
| 23 | 3300005842 | Ga0068858_100012503 | Ga0068858_10001250314 | 48 |
| 24 | 3300005843 | Ga0068860_100405120 | Ga0068860_1004051202 | 48 |
| 25 | 3300005843 | Ga0068860_101448991 | Ga0068860_1014489912 | 48 |
| 26 | 3300006173 | Ga0070716_100068870 | Ga0070716_1000688704 | 48 |
| 27 | 3300006195 | Ga0075366_10126873 | Ga0075366_101268733 | 48 |
| 28 | 3300006237 | Ga0097621_100544276 | Ga0097621_1005442761 | 48 |
| 29 | 3300006914 | Ga0075436_100721614 | Ga0075436_1007216141 | 48 |
| 30 | 3300006931 | Ga0097620_100023227 | Ga0097620_1000232272 | 48 |
| 31 | 3300006931 | Ga0097620_101826261 | Ga0097620_1018262611 | 48 |
| 32 | 3300009094 | Ga0111539_10675155 | Ga0111539_106751551 | 48 |
| 33 | 3300009098 | Ga0105245_10931796 | Ga0105245_109317962 | 48 |
| 34 | 3300009098 | Ga0105245_11195087 | Ga0105245_111950871 | 48 |
| 35 | 3300009147 | Ga0114129_10517222 | Ga0114129_105172222 | 48 |
| 36 | 3300009174 | Ga0105241_10875101 | Ga0105241_108751012 | 48 |
| 37 | 3300009177 | Ga0105248_10143487 | Ga0105248_101434872 | 48 |
| 38 | 3300009545 | Ga0105237_12786388 | Ga0105237_127863881 | 48 |
| 39 | 3300009551 | Ga0105238_10001184 | Ga0105238_100011848 | 48 |
| 40 | 3300013306 | Ga0163162_10177007 | Ga0163162_101770073 | 48 |
| 41 | 3300014968 | Ga0157379_10015911 | Ga0157379_100159118 | 48 |
| 42 | 3300014969 | Ga0157376_10136351 | Ga0157376_101363514 | 48 |
| 43 | 3300025910 | Ga0207684_10119835 | Ga0207684_101198351 | 48 |
| 44 | 3300025911 | Ga0207654_11385674 | Ga0207654_113856742 | 48 |
| 45 | 3300025922 | Ga0207646_10056597 | Ga0207646_100565973 | 48 |
| 46 | 3300025924 | Ga0207694_10005101 | Ga0207694_100051013 | 48 |
| 47 | 3300025939 | Ga0207665_10037075 | Ga0207665_100370751 | 48 |
| 48 | 3300025942 | Ga0207689_11171806 | Ga0207689_111718061 | 48 |
| 49 | 3300025949 | Ga0207667_10065082 | Ga0207667_100650824 | 48 |
| 50 | 3300025961 | Ga0207712_10584482 | Ga0207712_105844822 | 48 |
| 51 | 3300025986 | Ga0207658_10273536 | Ga0207658_102735362 | 48 |
| 52 | 3300026041 | Ga0207639_10002644 | Ga0207639_100026445 | 48 |
| 53 | 3300026078 | Ga0207702_10343101 | Ga0207702_103431013 | 48 |
| 54 | 3300026078 | Ga0207702_10644916 | Ga0207702_106449162 | 48 |
| 55 | 3300026095 | Ga0207676_12239877 | Ga0207676_122398772 | 48 |
| 56 | 3300026118 | Ga0207675_100236790 | Ga0207675_1002367902 | 48 |
| 57 | 3300026142 | Ga0207698_10278488 | Ga0207698_102784882 | 48 |
| 58 | 3300028381 | Ga0268264_10370565 | Ga0268264_103705652 | 48 |
| 59 | 3300028381 | Ga0268264_10633907 | Ga0268264_106339072 | 48 |
| 60 | 3300028653 | Ga0265323_10037767 | Ga0265323_100377673 | 48 |
| 61 | 3300028800 | Ga0265338_10007747 | Ga0265338_100077479 | 48 |
| 62 | 3300030731 | Ga0316177_1136457 | Ga0316177_11364572 | 48 |
| 63 | 3300030732 | Ga0316176_1005077 | Ga0316176_10050771 | 48 |
| 64 | 3300030745 | Ga0316182_1208682 | Ga0316182_12086822 | 48 |
| 65 | 3300031251 | Ga0265327_10082134 | Ga0265327_100821341 | 48 |
| 66 | 3300042876 | Ga0451577_0138218 | Ga0451577_0138218_759_911 | 48 |
| 67 | 3300044673 | Ga0453683_0467740 | Ga0453683_0467740_179_325 | 48 |
| 68 | 3300044712 | Ga0453684_0084340 | Ga0453684_0084340_3617_3769 | 48 |
| 69 | 3300044712 | Ga0453684_0152887 | Ga0453684_0152887_397_543 | 48 |
| 70 | 3300045051 | Ga0451576_0001883 | Ga0451576_0001883_219_368 | 48 |
| 71 | 3300046463 | Ga0495653_0824971 | Ga0495653_0824971_319_465 | 48 |
| 72 | 3300046536 | Ga0495587_0397258 | Ga0495587_0397258_182_328 | 48 |
| 73 | 3300046557 | Ga0495622_0344915 | Ga0495622_0344915_323_469 | 48 |
| 74 | 3300046683 | Ga0495658_0506217 | Ga0495658_0506217_25_171 | 48 |
| 75 | 3300048908 | Ga0496105_0560014 | Ga0496105_0560014_621_767 | 48 |
| 76 | 3300048911 | Ga0496108_0069079 | Ga0496108_0069079_409_555 | 48 |
| 77 | 3300048913 | Ga0496110_1344930 | Ga0496110_1344930_272_418 | 48 |
| 78 | 3300048914 | Ga0496111_0376435 | Ga0496111_0376435_294_440 | 48 |
| 79 | 3300048918 | Ga0496115_0003187 | Ga0496115_0003187_3067_3213 | 48 |
| 80 | 3300048918 | Ga0496115_0855460 | Ga0496115_0855460_12_158 | 48 |
| 81 | 3300049130 | Ga0501310_012639 | Ga0501310_012639_36_182 | 48 |
| 82 | 3300049531 | Ga0501315_052556 | Ga0501315_052556_58_204 | 48 |
| 83 | 3300050493 | nmdc:mga0k408_151229_c1 | nmdc:mga0k408_151229_c1_905_1051 | 48 |
| 84 | 2162886012 | MBSR1b_contig_14242384 | MBSR1b_0926.00003820 | 49 |
| 85 | 2162886012 | MBSR1b_contig_8201409 | MBSR1b_0652.00004620 | 49 |
| 86 | 3300001977 | JGI24746J21847_1029963 | JGI24746J21847_10299632 | 49 |
| 87 | 3300001977 | JGI24746J21847_1043975 | JGI24746J21847_10439752 | 49 |
| 88 | 3300001990 | JGI24737J22298_10024215 | JGI24737J22298_100242153 | 49 |
| 89 | 3300001991 | JGI24743J22301_10006758 | JGI24743J22301_100067581 | 49 |
| 90 | 3300002070 | JGI24750J21931_1028019 | JGI24750J21931_10280192 | 49 |
| 91 | 3300002073 | JGI24745J21846_1020836 | JGI24745J21846_10208361 | 49 |
| 92 | 3300002076 | JGI24749J21850_1070969 | JGI24749J21850_10709691 | 49 |
| 93 | 3300002126 | JGI24035J26624_1004495 | JGI24035J26624_10044952 | 49 |
| 94 | 3300002126 | JGI24035J26624_1005983 | JGI24035J26624_10059832 | 49 |
| 95 | 3300002155 | JGI24033J26618_1012705 | JGI24033J26618_10127052 | 49 |
| 96 | 3300003323 | rootH1_10386370 | rootH1_103863702 | 49 |
| 97 | 3300003577 | Ga0007416J51690_1082995 | Ga0007416J51690_10829951 | 49 |
| 98 | 3300003577 | Ga0007416J51690_1087572 | Ga0007416J51690_10875721 | 49 |
| 99 | 3300003579 | Ga0007429J51699_1116211 | Ga0007429J51699_11162112 | 49 |
| 100 | 3300003693 | Ga0032354_1066680 | Ga0032354_10666803 | 49 |
| 101 | 3300003735 | Ga0006780_1035515 | Ga0006780_10355151 | 49 |
| 102 | 3300003911 | JGI25405J52794_10002815 | JGI25405J52794_100028152 | 49 |
| 103 | 3300003911 | JGI25405J52794_10091519 | JGI25405J52794_100915192 | 49 |
| 104 | 3300004798 | Ga0058859_10573809 | Ga0058859_105738091 | 49 |
| 105 | 3300004799 | Ga0058863_11637505 | Ga0058863_116375051 | 49 |
| 106 | 3300004800 | Ga0058861_12064034 | Ga0058861_120640341 | 49 |
| 107 | 3300004801 | Ga0058860_10830546 | Ga0058860_108305461 | 49 |
| 108 | 3300004801 | Ga0058860_11908751 | Ga0058860_119087511 | 49 |
| 109 | 3300004803 | Ga0058862_10065783 | Ga0058862_100657831 | 49 |
| 110 | 3300005289 | Ga0065704_10458354 | Ga0065704_104583542 | 49 |
| 111 | 3300005289 | Ga0065704_10507344 | Ga0065704_105073442 | 49 |
| 112 | 3300005290 | Ga0065712_10048891 | Ga0065712_100488911 | 49 |
| 113 | 3300005290 | Ga0065712_10069346 | Ga0065712_100693466 | 49 |
| 114 | 3300005290 | Ga0065712_10240498 | Ga0065712_102404982 | 49 |
| 115 | 3300005290 | Ga0065712_10259197 | Ga0065712_102591973 | 49 |
| 116 | 3300005293 | Ga0065715_10001014 | Ga0065715_100010145 | 49 |
| 117 | 3300005293 | Ga0065715_10102904 | Ga0065715_101029045 | 49 |
| 118 | 3300005293 | Ga0065715_10182618 | Ga0065715_101826183 | 49 |
| 119 | 3300005293 | Ga0065715_10290619 | Ga0065715_102906192 | 49 |
| 120 | 3300005293 | Ga0065715_10372329 | Ga0065715_103723293 | 49 |
| 121 | 3300005293 | Ga0065715_10674335 | Ga0065715_106743351 | 49 |
| 122 | 3300005295 | Ga0065707_10046903 | Ga0065707_100469033 | 49 |
| 123 | 3300005295 | Ga0065707_10087756 | Ga0065707_100877566 | 49 |
| 124 | 3300005295 | Ga0065707_10374149 | Ga0065707_103741492 | 49 |
| 125 | 3300005295 | Ga0065707_10674810 | Ga0065707_106748102 | 49 |
| 126 | 3300005327 | Ga0070658_10076572 | Ga0070658_100765724 | 49 |
| 127 | 3300005327 | Ga0070658_10095655 | Ga0070658_100956553 | 49 |
| 128 | 3300005327 | Ga0070658_11807841 | Ga0070658_118078411 | 49 |
| 129 | 3300005328 | Ga0070676_10000418 | Ga0070676_100004184 | 49 |
| 130 | 3300005328 | Ga0070676_10522339 | Ga0070676_105223391 | 49 |
| 131 | 3300005328 | Ga0070676_10623758 | Ga0070676_106237582 | 49 |
| 132 | 3300005328 | Ga0070676_10801171 | Ga0070676_108011712 | 49 |
| 133 | 3300005328 | Ga0070676_10853742 | Ga0070676_108537421 | 49 |
| 134 | 3300005329 | Ga0070683_100010649 | Ga0070683_1000106492 | 49 |
| 135 | 3300005329 | Ga0070683_100017263 | Ga0070683_1000172633 | 49 |
| 136 | 3300005329 | Ga0070683_100027215 | Ga0070683_1000272155 | 49 |
| 137 | 3300005329 | Ga0070683_100079856 | Ga0070683_1000798563 | 49 |
| 138 | 3300005329 | Ga0070683_100134395 | Ga0070683_1001343953 | 49 |
| 139 | 3300005329 | Ga0070683_100343424 | Ga0070683_1003434242 | 49 |
| 140 | 3300005329 | Ga0070683_100883903 | Ga0070683_1008839031 | 49 |
| 141 | 3300005330 | Ga0070690_100043378 | Ga0070690_1000433784 | 49 |
| 142 | 3300005330 | Ga0070690_100558308 | Ga0070690_1005583081 | 49 |
| 143 | 3300005331 | Ga0070670_100011058 | Ga0070670_1000110583 | 49 |
| 144 | 3300005331 | Ga0070670_100074116 | Ga0070670_1000741164 | 49 |
| 145 | 3300005333 | Ga0070677_10007365 | Ga0070677_100073652 | 49 |
| 146 | 3300005334 | Ga0068869_100054842 | Ga0068869_1000548424 | 49 |
| 147 | 3300005334 | Ga0068869_100203957 | Ga0068869_1002039572 | 49 |
| 148 | 3300005334 | Ga0068869_100254504 | Ga0068869_1002545043 | 49 |
| 149 | 3300005334 | Ga0068869_100945966 | Ga0068869_1009459661 | 49 |
| 150 | 3300005334 | Ga0068869_101202165 | Ga0068869_1012021652 | 49 |
| 151 | 3300005334 | Ga0068869_101935665 | Ga0068869_1019356651 | 49 |
| 152 | 3300005335 | Ga0070666_10005575 | Ga0070666_100055754 | 49 |
| 153 | 3300005335 | Ga0070666_10016515 | Ga0070666_100165154 | 49 |
| 154 | 3300005335 | Ga0070666_10127985 | Ga0070666_101279853 | 49 |
| 155 | 3300005335 | Ga0070666_11180931 | Ga0070666_111809311 | 49 |
| 156 | 3300005336 | Ga0070680_100300048 | Ga0070680_1003000482 | 49 |
| 157 | 3300005336 | Ga0070680_100859935 | Ga0070680_1008599352 | 49 |
| 158 | 3300005337 | Ga0070682_100055437 | Ga0070682_1000554373 | 49 |
| 159 | 3300005338 | Ga0068868_100003887 | Ga0068868_1000038879 | 49 |
| 160 | 3300005338 | Ga0068868_100022957 | Ga0068868_1000229572 | 49 |
| 161 | 3300005338 | Ga0068868_100031456 | Ga0068868_1000314564 | 49 |
| 162 | 3300005338 | Ga0068868_100035075 | Ga0068868_1000350754 | 49 |
| 163 | 3300005338 | Ga0068868_100175841 | Ga0068868_1001758413 | 49 |
| 164 | 3300005338 | Ga0068868_101215670 | Ga0068868_1012156702 | 49 |
| 165 | 3300005339 | Ga0070660_100012509 | Ga0070660_1000125093 | 49 |
| 166 | 3300005339 | Ga0070660_100258012 | Ga0070660_1002580122 | 49 |
| 167 | 3300005339 | Ga0070660_100315672 | Ga0070660_1003156721 | 49 |
| 168 | 3300005340 | Ga0070689_100000951 | Ga0070689_1000009519 | 49 |
| 169 | 3300005340 | Ga0070689_100008894 | Ga0070689_1000088943 | 49 |
| 170 | 3300005340 | Ga0070689_100056957 | Ga0070689_1000569574 | 49 |
| 171 | 3300005340 | Ga0070689_100088561 | Ga0070689_1000885611 | 49 |
| 172 | 3300005341 | Ga0070691_10243083 | Ga0070691_102430832 | 49 |
| 173 | 3300005341 | Ga0070691_10456613 | Ga0070691_104566131 | 49 |
| 174 | 3300005343 | Ga0070687_100000361 | Ga0070687_1000003612 | 49 |
| 175 | 3300005343 | Ga0070687_100021338 | Ga0070687_1000213385 | 49 |
| 176 | 3300005343 | Ga0070687_100040095 | Ga0070687_1000400953 | 49 |
| 177 | 3300005344 | Ga0070661_100006977 | Ga0070661_1000069776 | 49 |
| 178 | 3300005344 | Ga0070661_100030810 | Ga0070661_1000308105 | 49 |
| 179 | 3300005344 | Ga0070661_100033886 | Ga0070661_1000338863 | 49 |
| 180 | 3300005344 | Ga0070661_100694709 | Ga0070661_1006947092 | 49 |
| 181 | 3300005345 | Ga0070692_10715442 | Ga0070692_107154421 | 49 |
| 182 | 3300005347 | Ga0070668_100001339 | Ga0070668_10000133911 | 49 |
| 183 | 3300005347 | Ga0070668_100011324 | Ga0070668_1000113246 | 49 |
| 184 | 3300005347 | Ga0070668_100087415 | Ga0070668_1000874152 | 49 |
| 185 | 3300005353 | Ga0070669_100003769 | Ga0070669_1000037697 | 49 |
| 186 | 3300005353 | Ga0070669_100010101 | Ga0070669_1000101017 | 49 |
| 187 | 3300005353 | Ga0070669_100062749 | Ga0070669_1000627494 | 49 |
| 188 | 3300005353 | Ga0070669_100665988 | Ga0070669_1006659881 | 49 |
| 189 | 3300005353 | Ga0070669_101335342 | Ga0070669_1013353421 | 49 |
| 190 | 3300005354 | Ga0070675_100000360 | Ga0070675_10000036010 | 49 |
| 191 | 3300005354 | Ga0070675_100004745 | Ga0070675_1000047459 | 49 |
| 192 | 3300005354 | Ga0070675_100112789 | Ga0070675_1001127894 | 49 |
| 193 | 3300005355 | Ga0070671_100002249 | Ga0070671_1000022495 | 49 |
| 194 | 3300005355 | Ga0070671_100067121 | Ga0070671_1000671214 | 49 |
| 195 | 3300005355 | Ga0070671_100102517 | Ga0070671_1001025175 | 49 |
| 196 | 3300005355 | Ga0070671_100211683 | Ga0070671_1002116832 | 49 |
| 197 | 3300005355 | Ga0070671_101486856 | Ga0070671_1014868561 | 49 |
| 198 | 3300005355 | Ga0070671_101751211 | Ga0070671_1017512111 | 49 |
| 199 | 3300005355 | Ga0070671_101848539 | Ga0070671_1018485391 | 49 |
| 200 | 3300005355 | Ga0070671_102113366 | Ga0070671_1021133661 | 49 |
| 201 | 3300005356 | Ga0070674_100009313 | Ga0070674_1000093136 | 49 |
| 202 | 3300005356 | Ga0070674_101635160 | Ga0070674_1016351602 | 49 |
| 203 | 3300005356 | Ga0070674_101795797 | Ga0070674_1017957971 | 49 |
| 204 | 3300005364 | Ga0070673_100059046 | Ga0070673_1000590466 | 49 |
| 205 | 3300005364 | Ga0070673_100068950 | Ga0070673_1000689502 | 49 |
| 206 | 3300005364 | Ga0070673_100169580 | Ga0070673_1001695802 | 49 |
| 207 | 3300005364 | Ga0070673_100170740 | Ga0070673_1001707401 | 49 |
| 208 | 3300005364 | Ga0070673_100941656 | Ga0070673_1009416561 | 49 |
| 209 | 3300005365 | Ga0070688_100018693 | Ga0070688_1000186935 | 49 |
| 210 | 3300005365 | Ga0070688_100071906 | Ga0070688_1000719063 | 49 |
| 211 | 3300005366 | Ga0070659_100001731 | Ga0070659_1000017316 | 49 |
| 212 | 3300005366 | Ga0070659_100065735 | Ga0070659_1000657353 | 49 |
| 213 | 3300005366 | Ga0070659_100191439 | Ga0070659_1001914391 | 49 |
| 214 | 3300005366 | Ga0070659_101927678 | Ga0070659_1019276781 | 49 |
| 215 | 3300005367 | Ga0070667_100001138 | Ga0070667_1000011389 | 49 |
| 216 | 3300005367 | Ga0070667_100003924 | Ga0070667_1000039247 | 49 |
| 217 | 3300005367 | Ga0070667_100120314 | Ga0070667_1001203143 | 49 |
| 218 | 3300005367 | Ga0070667_101261312 | Ga0070667_1012613122 | 49 |
| 219 | 3300005406 | Ga0070703_10129289 | Ga0070703_101292892 | 49 |
| 220 | 3300005434 | Ga0070709_10097351 | Ga0070709_100973513 | 49 |
| 221 | 3300005434 | Ga0070709_10115928 | Ga0070709_101159282 | 49 |
| 222 | 3300005434 | Ga0070709_10134276 | Ga0070709_101342763 | 49 |
| 223 | 3300005434 | Ga0070709_10426617 | Ga0070709_104266173 | 49 |
| 224 | 3300005434 | Ga0070709_10426931 | Ga0070709_104269311 | 49 |
| 225 | 3300005435 | Ga0070714_100028342 | Ga0070714_1000283422 | 49 |
| 226 | 3300005435 | Ga0070714_100475561 | Ga0070714_1004755612 | 49 |
| 227 | 3300005435 | Ga0070714_100648771 | Ga0070714_1006487711 | 49 |
| 228 | 3300005435 | Ga0070714_101336297 | Ga0070714_1013362972 | 49 |
| 229 | 3300005436 | Ga0070713_100047807 | Ga0070713_1000478072 | 49 |
| 230 | 3300005436 | Ga0070713_100678121 | Ga0070713_1006781213 | 49 |
| 231 | 3300005437 | Ga0070710_10051355 | Ga0070710_100513552 | 49 |
| 232 | 3300005437 | Ga0070710_10994818 | Ga0070710_109948182 | 49 |
| 233 | 3300005437 | Ga0070710_11494080 | Ga0070710_114940802 | 49 |
| 234 | 3300005438 | Ga0070701_10027101 | Ga0070701_100271014 | 49 |
| 235 | 3300005438 | Ga0070701_10410704 | Ga0070701_104107042 | 49 |
| 236 | 3300005439 | Ga0070711_101121249 | Ga0070711_1011212492 | 49 |
| 237 | 3300005439 | Ga0070711_102060469 | Ga0070711_1020604691 | 49 |
| 238 | 3300005440 | Ga0070705_100047803 | Ga0070705_1000478032 | 49 |
| 239 | 3300005440 | Ga0070705_100066937 | Ga0070705_1000669371 | 49 |
| 240 | 3300005440 | Ga0070705_100074876 | Ga0070705_1000748763 | 49 |
| 241 | 3300005440 | Ga0070705_100138765 | Ga0070705_1001387653 | 49 |
| 242 | 3300005440 | Ga0070705_100563672 | Ga0070705_1005636722 | 49 |
| 243 | 3300005440 | Ga0070705_100589801 | Ga0070705_1005898012 | 49 |
| 244 | 3300005440 | Ga0070705_100864064 | Ga0070705_1008640641 | 49 |
| 245 | 3300005440 | Ga0070705_101957723 | Ga0070705_1019577232 | 49 |
| 246 | 3300005441 | Ga0070700_100009155 | Ga0070700_1000091554 | 49 |
| 247 | 3300005441 | Ga0070700_100102198 | Ga0070700_1001021982 | 49 |
| 248 | 3300005441 | Ga0070700_101559147 | Ga0070700_1015591472 | 49 |
| 249 | 3300005444 | Ga0070694_100050845 | Ga0070694_1000508453 | 49 |
| 250 | 3300005444 | Ga0070694_100074804 | Ga0070694_1000748042 | 49 |
| 251 | 3300005444 | Ga0070694_100666426 | Ga0070694_1006664262 | 49 |
| 252 | 3300005444 | Ga0070694_100828183 | Ga0070694_1008281832 | 49 |
| 253 | 3300005444 | Ga0070694_100853483 | Ga0070694_1008534831 | 49 |
| 254 | 3300005445 | Ga0070708_100012156 | Ga0070708_1000121564 | 49 |
| 255 | 3300005445 | Ga0070708_100114605 | Ga0070708_1001146052 | 49 |
| 256 | 3300005445 | Ga0070708_100205571 | Ga0070708_1002055712 | 49 |
| 257 | 3300005445 | Ga0070708_100895387 | Ga0070708_1008953871 | 49 |
| 258 | 3300005445 | Ga0070708_101623374 | Ga0070708_1016233742 | 49 |
| 259 | 3300005455 | Ga0070663_100159601 | Ga0070663_1001596013 | 49 |
| 260 | 3300005456 | Ga0070678_101290683 | Ga0070678_1012906832 | 49 |
| 261 | 3300005456 | Ga0070678_102057956 | Ga0070678_1020579561 | 49 |
| 262 | 3300005457 | Ga0070662_100000570 | Ga0070662_10000057012 | 49 |
| 263 | 3300005457 | Ga0070662_100006539 | Ga0070662_10000653911 | 49 |
| 264 | 3300005457 | Ga0070662_100016016 | Ga0070662_1000160166 | 49 |
| 265 | 3300005457 | Ga0070662_100105636 | Ga0070662_1001056362 | 49 |
| 266 | 3300005458 | Ga0070681_10014963 | Ga0070681_100149638 | 49 |
| 267 | 3300005458 | Ga0070681_10075591 | Ga0070681_100755913 | 49 |
| 268 | 3300005459 | Ga0068867_100025103 | Ga0068867_1000251036 | 49 |
| 269 | 3300005459 | Ga0068867_100169271 | Ga0068867_1001692711 | 49 |
| 270 | 3300005459 | Ga0068867_100701556 | Ga0068867_1007015561 | 49 |
| 271 | 3300005459 | Ga0068867_100945807 | Ga0068867_1009458071 | 49 |
| 272 | 3300005459 | Ga0068867_101424476 | Ga0068867_1014244761 | 49 |
| 273 | 3300005466 | Ga0070685_10034317 | Ga0070685_100343175 | 49 |
| 274 | 3300005467 | Ga0070706_100021634 | Ga0070706_1000216341 | 49 |
| 275 | 3300005467 | Ga0070706_100201862 | Ga0070706_1002018621 | 49 |
| 276 | 3300005467 | Ga0070706_100573863 | Ga0070706_1005738632 | 49 |
| 277 | 3300005467 | Ga0070706_100829556 | Ga0070706_1008295562 | 49 |
| 278 | 3300005467 | Ga0070706_101135363 | Ga0070706_1011353632 | 49 |
| 279 | 3300005468 | Ga0070707_100007972 | Ga0070707_1000079725 | 49 |
| 280 | 3300005468 | Ga0070707_100098485 | Ga0070707_1000984855 | 49 |
| 281 | 3300005468 | Ga0070707_100146787 | Ga0070707_1001467873 | 49 |
| 282 | 3300005468 | Ga0070707_100354881 | Ga0070707_1003548812 | 49 |
| 283 | 3300005468 | Ga0070707_101004367 | Ga0070707_1010043672 | 49 |
| 284 | 3300005468 | Ga0070707_101289453 | Ga0070707_1012894532 | 49 |
| 285 | 3300005468 | Ga0070707_101433484 | Ga0070707_1014334842 | 49 |
| 286 | 3300005471 | Ga0070698_100045677 | Ga0070698_1000456772 | 49 |
| 287 | 3300005471 | Ga0070698_101228981 | Ga0070698_1012289813 | 49 |
| 288 | 3300005471 | Ga0070698_101537069 | Ga0070698_1015370692 | 49 |
| 289 | 3300005471 | Ga0070698_101985517 | Ga0070698_1019855171 | 49 |
| 290 | 3300005471 | Ga0070698_102180058 | Ga0070698_1021800581 | 49 |
| 291 | 3300005518 | Ga0070699_100012669 | Ga0070699_1000126695 | 49 |
| 292 | 3300005518 | Ga0070699_100713643 | Ga0070699_1007136431 | 49 |
| 293 | 3300005518 | Ga0070699_101330689 | Ga0070699_1013306891 | 49 |
| 294 | 3300005518 | Ga0070699_101361395 | Ga0070699_1013613952 | 49 |
| 295 | 3300005518 | Ga0070699_102158714 | Ga0070699_1021587141 | 49 |
| 296 | 3300005530 | Ga0070679_100002344 | Ga0070679_10000234412 | 49 |
| 297 | 3300005530 | Ga0070679_100004021 | Ga0070679_10000402114 | 49 |
| 298 | 3300005530 | Ga0070679_100623111 | Ga0070679_1006231112 | 49 |
| 299 | 3300005530 | Ga0070679_101453141 | Ga0070679_1014531412 | 49 |
| 300 | 3300005535 | Ga0070684_100000110 | Ga0070684_10000011033 | 49 |
| 301 | 3300005535 | Ga0070684_100000523 | Ga0070684_10000052314 | 49 |
| 302 | 3300005535 | Ga0070684_100015073 | Ga0070684_1000150736 | 49 |
| 303 | 3300005535 | Ga0070684_100070037 | Ga0070684_1000700371 | 49 |
| 304 | 3300005535 | Ga0070684_100071702 | Ga0070684_1000717023 | 49 |
| 305 | 3300005535 | Ga0070684_100105770 | Ga0070684_1001057702 | 49 |
| 306 | 3300005535 | Ga0070684_100265868 | Ga0070684_1002658683 | 49 |
| 307 | 3300005535 | Ga0070684_101072016 | Ga0070684_1010720162 | 49 |
| 308 | 3300005536 | Ga0070697_100003151 | Ga0070697_1000031515 | 49 |
| 309 | 3300005536 | Ga0070697_100075581 | Ga0070697_1000755811 | 49 |
| 310 | 3300005536 | Ga0070697_100081548 | Ga0070697_1000815484 | 49 |
| 311 | 3300005536 | Ga0070697_101062637 | Ga0070697_1010626372 | 49 |
| 312 | 3300005536 | Ga0070697_101217611 | Ga0070697_1012176111 | 49 |
| 313 | 3300005536 | Ga0070697_101302716 | Ga0070697_1013027162 | 49 |
| 314 | 3300005539 | Ga0068853_100002222 | Ga0068853_1000022229 | 49 |
| 315 | 3300005539 | Ga0068853_100024353 | Ga0068853_1000243536 | 49 |
| 316 | 3300005539 | Ga0068853_100109926 | Ga0068853_1001099263 | 49 |
| 317 | 3300005543 | Ga0070672_100005622 | Ga0070672_1000056226 | 49 |
| 318 | 3300005543 | Ga0070672_100221563 | Ga0070672_1002215632 | 49 |
| 319 | 3300005543 | Ga0070672_100269157 | Ga0070672_1002691573 | 49 |
| 320 | 3300005544 | Ga0070686_100052436 | Ga0070686_1000524361 | 49 |
| 321 | 3300005544 | Ga0070686_100140984 | Ga0070686_1001409841 | 49 |
| 322 | 3300005544 | Ga0070686_100354272 | Ga0070686_1003542722 | 49 |
| 323 | 3300005544 | Ga0070686_100594547 | Ga0070686_1005945472 | 49 |
| 324 | 3300005544 | Ga0070686_101267599 | Ga0070686_1012675992 | 49 |
| 325 | 3300005545 | Ga0070695_100001859 | Ga0070695_1000018598 | 49 |
| 326 | 3300005545 | Ga0070695_100506255 | Ga0070695_1005062552 | 49 |
| 327 | 3300005545 | Ga0070695_100752721 | Ga0070695_1007527211 | 49 |
| 328 | 3300005545 | Ga0070695_101899311 | Ga0070695_1018993111 | 49 |
| 329 | 3300005546 | Ga0070696_100061380 | Ga0070696_1000613804 | 49 |
| 330 | 3300005546 | Ga0070696_100594979 | Ga0070696_1005949793 | 49 |
| 331 | 3300005546 | Ga0070696_100781220 | Ga0070696_1007812202 | 49 |
| 332 | 3300005546 | Ga0070696_101515178 | Ga0070696_1015151782 | 49 |
| 333 | 3300005546 | Ga0070696_101739384 | Ga0070696_1017393842 | 49 |
| 334 | 3300005547 | Ga0070693_100414386 | Ga0070693_1004143862 | 49 |
| 335 | 3300005548 | Ga0070665_100031101 | Ga0070665_1000311014 | 49 |
| 336 | 3300005548 | Ga0070665_100045170 | Ga0070665_1000451704 | 49 |
| 337 | 3300005548 | Ga0070665_100422681 | Ga0070665_1004226813 | 49 |
| 338 | 3300005548 | Ga0070665_101128229 | Ga0070665_1011282291 | 49 |
| 339 | 3300005549 | Ga0070704_100044846 | Ga0070704_1000448464 | 49 |
| 340 | 3300005549 | Ga0070704_100102942 | Ga0070704_1001029422 | 49 |
| 341 | 3300005549 | Ga0070704_100200404 | Ga0070704_1002004043 | 49 |
| 342 | 3300005549 | Ga0070704_100511688 | Ga0070704_1005116881 | 49 |
| 343 | 3300005549 | Ga0070704_100580010 | Ga0070704_1005800103 | 49 |
| 344 | 3300005549 | Ga0070704_101724708 | Ga0070704_1017247081 | 49 |
| 345 | 3300005563 | Ga0068855_100009737 | Ga0068855_1000097372 | 49 |
| 346 | 3300005563 | Ga0068855_100033699 | Ga0068855_1000336992 | 49 |
| 347 | 3300005564 | Ga0070664_100061800 | Ga0070664_1000618006 | 49 |
| 348 | 3300005564 | Ga0070664_100175364 | Ga0070664_1001753644 | 49 |
| 349 | 3300005564 | Ga0070664_100198634 | Ga0070664_1001986342 | 49 |
| 350 | 3300005564 | Ga0070664_100337093 | Ga0070664_1003370932 | 49 |
| 351 | 3300005564 | Ga0070664_100522606 | Ga0070664_1005226062 | 49 |
| 352 | 3300005577 | Ga0068857_100035905 | Ga0068857_1000359054 | 49 |
| 353 | 3300005577 | Ga0068857_100154280 | Ga0068857_1001542801 | 49 |
| 354 | 3300005577 | Ga0068857_100220699 | Ga0068857_1002206993 | 49 |
| 355 | 3300005577 | Ga0068857_100323360 | Ga0068857_1003233603 | 49 |
| 356 | 3300005577 | Ga0068857_100994560 | Ga0068857_1009945603 | 49 |
| 357 | 3300005577 | Ga0068857_101416477 | Ga0068857_1014164773 | 49 |
| 358 | 3300005577 | Ga0068857_102259923 | Ga0068857_1022599231 | 49 |
| 359 | 3300005578 | Ga0068854_100049779 | Ga0068854_1000497793 | 49 |
| 360 | 3300005578 | Ga0068854_100055299 | Ga0068854_1000552993 | 49 |
| 361 | 3300005578 | Ga0068854_100151666 | Ga0068854_1001516663 | 49 |
| 362 | 3300005578 | Ga0068854_100609558 | Ga0068854_1006095582 | 49 |
| 363 | 3300005614 | Ga0068856_100003860 | Ga0068856_1000038604 | 49 |
| 364 | 3300005614 | Ga0068856_100031074 | Ga0068856_1000310745 | 49 |
| 365 | 3300005614 | Ga0068856_100130357 | Ga0068856_1001303573 | 49 |
| 366 | 3300005614 | Ga0068856_100199016 | Ga0068856_1001990162 | 49 |
| 367 | 3300005614 | Ga0068856_100305611 | Ga0068856_1003056113 | 49 |
| 368 | 3300005615 | Ga0070702_100025832 | Ga0070702_1000258321 | 49 |
| 369 | 3300005615 | Ga0070702_100605280 | Ga0070702_1006052802 | 49 |
| 370 | 3300005615 | Ga0070702_100992685 | Ga0070702_1009926851 | 49 |
| 371 | 3300005615 | Ga0070702_101722606 | Ga0070702_1017226061 | 49 |
| 372 | 3300005616 | Ga0068852_100009188 | Ga0068852_1000091883 | 49 |
| 373 | 3300005616 | Ga0068852_100035207 | Ga0068852_1000352073 | 49 |
| 374 | 3300005616 | Ga0068852_100067942 | Ga0068852_1000679421 | 49 |
| 375 | 3300005616 | Ga0068852_100195988 | Ga0068852_1001959883 | 49 |
| 376 | 3300005616 | Ga0068852_100425841 | Ga0068852_1004258412 | 49 |
| 377 | 3300005616 | Ga0068852_100613478 | Ga0068852_1006134782 | 49 |
| 378 | 3300005617 | Ga0068859_100045876 | Ga0068859_1000458766 | 49 |
| 379 | 3300005617 | Ga0068859_100063366 | Ga0068859_1000633663 | 49 |
| 380 | 3300005617 | Ga0068859_100070965 | Ga0068859_1000709654 | 49 |
| 381 | 3300005617 | Ga0068859_100114165 | Ga0068859_1001141652 | 49 |
| 382 | 3300005617 | Ga0068859_100202971 | Ga0068859_1002029713 | 49 |
| 383 | 3300005617 | Ga0068859_100420258 | Ga0068859_1004202582 | 49 |
| 384 | 3300005617 | Ga0068859_100453774 | Ga0068859_1004537742 | 49 |
| 385 | 3300005618 | Ga0068864_100003454 | Ga0068864_1000034549 | 49 |
| 386 | 3300005618 | Ga0068864_100095270 | Ga0068864_1000952704 | 49 |
| 387 | 3300005618 | Ga0068864_100276103 | Ga0068864_1002761035 | 49 |
| 388 | 3300005618 | Ga0068864_100276154 | Ga0068864_1002761542 | 49 |
| 389 | 3300005618 | Ga0068864_101146903 | Ga0068864_1011469032 | 49 |
| 390 | 3300005618 | Ga0068864_101169306 | Ga0068864_1011693062 | 49 |
| 391 | 3300005618 | Ga0068864_102530584 | Ga0068864_1025305841 | 49 |
| 392 | 3300005718 | Ga0068866_10009452 | Ga0068866_100094525 | 49 |
| 393 | 3300005718 | Ga0068866_10361479 | Ga0068866_103614792 | 49 |
| 394 | 3300005718 | Ga0068866_10428845 | Ga0068866_104288452 | 49 |
| 395 | 3300005719 | Ga0068861_100054073 | Ga0068861_1000540734 | 49 |
| 396 | 3300005719 | Ga0068861_100069321 | Ga0068861_1000693212 | 49 |
| 397 | 3300005719 | Ga0068861_100077089 | Ga0068861_1000770892 | 49 |
| 398 | 3300005719 | Ga0068861_100124289 | Ga0068861_1001242892 | 49 |
| 399 | 3300005719 | Ga0068861_100478422 | Ga0068861_1004784221 | 49 |
| 400 | 3300005719 | Ga0068861_102125696 | Ga0068861_1021256962 | 49 |
| 401 | 3300005834 | Ga0068851_10007988 | Ga0068851_100079883 | 49 |
| 402 | 3300005834 | Ga0068851_10029576 | Ga0068851_100295763 | 49 |
| 403 | 3300005834 | Ga0068851_10042166 | Ga0068851_100421663 | 49 |
| 404 | 3300005834 | Ga0068851_10191976 | Ga0068851_101919762 | 49 |
| 405 | 3300005834 | Ga0068851_10256774 | Ga0068851_102567741 | 49 |
| 406 | 3300005840 | Ga0068870_10034678 | Ga0068870_100346784 | 49 |
| 407 | 3300005840 | Ga0068870_10576209 | Ga0068870_105762092 | 49 |
| 408 | 3300005841 | Ga0068863_100000974 | Ga0068863_10000097414 | 49 |
| 409 | 3300005841 | Ga0068863_100007127 | Ga0068863_1000071274 | 49 |
| 410 | 3300005841 | Ga0068863_100106002 | Ga0068863_1001060024 | 49 |
| 411 | 3300005841 | Ga0068863_100157606 | Ga0068863_1001576061 | 49 |
| 412 | 3300005841 | Ga0068863_100235298 | Ga0068863_1002352983 | 49 |
| 413 | 3300005841 | Ga0068863_100272384 | Ga0068863_1002723842 | 49 |
| 414 | 3300005841 | Ga0068863_101001834 | Ga0068863_1010018342 | 49 |
| 415 | 3300005842 | Ga0068858_100002623 | Ga0068858_1000026238 | 49 |
| 416 | 3300005842 | Ga0068858_100062288 | Ga0068858_1000622882 | 49 |
| 417 | 3300005842 | Ga0068858_100077532 | Ga0068858_1000775322 | 49 |
| 418 | 3300005842 | Ga0068858_100178109 | Ga0068858_1001781095 | 49 |
| 419 | 3300005842 | Ga0068858_100327128 | Ga0068858_1003271282 | 49 |
| 420 | 3300005842 | Ga0068858_101950348 | Ga0068858_1019503482 | 49 |
| 421 | 3300005843 | Ga0068860_100001412 | Ga0068860_10000141216 | 49 |
| 422 | 3300005843 | Ga0068860_100004098 | Ga0068860_10000409819 | 49 |
| 423 | 3300005843 | Ga0068860_100005238 | Ga0068860_1000052389 | 49 |
| 424 | 3300005843 | Ga0068860_100025320 | Ga0068860_1000253206 | 49 |
| 425 | 3300005843 | Ga0068860_100027817 | Ga0068860_1000278178 | 49 |
| 426 | 3300005843 | Ga0068860_100197113 | Ga0068860_1001971131 | 49 |
| 427 | 3300005844 | Ga0068862_100013065 | Ga0068862_1000130652 | 49 |
| 428 | 3300005844 | Ga0068862_100023721 | Ga0068862_1000237216 | 49 |
| 429 | 3300005844 | Ga0068862_100095688 | Ga0068862_1000956885 | 49 |
| 430 | 3300005844 | Ga0068862_100957557 | Ga0068862_1009575574 | 49 |
| 431 | 3300005844 | Ga0068862_101757105 | Ga0068862_1017571051 | 49 |
| 432 | 3300005844 | Ga0068862_102311646 | Ga0068862_1023116461 | 49 |
| 433 | 3300005937 | Ga0081455_10000385 | Ga0081455_1000038549 | 49 |
| 434 | 3300005937 | Ga0081455_10001418 | Ga0081455_100014189 | 49 |
| 435 | 3300005937 | Ga0081455_10057581 | Ga0081455_100575812 | 49 |
| 436 | 3300005937 | Ga0081455_10059526 | Ga0081455_100595263 | 49 |
| 437 | 3300005937 | Ga0081455_10165062 | Ga0081455_101650623 | 49 |
| 438 | 3300005937 | Ga0081455_10639067 | Ga0081455_106390672 | 49 |
| 439 | 3300005937 | Ga0081455_10706022 | Ga0081455_107060222 | 49 |
| 440 | 3300005937 | Ga0081455_10885070 | Ga0081455_108850702 | 49 |
| 441 | 3300005937 | Ga0081455_10993195 | Ga0081455_109931951 | 49 |
| 442 | 3300005985 | Ga0081539_10057340 | Ga0081539_100573404 | 49 |
| 443 | 3300005985 | Ga0081539_10131913 | Ga0081539_101319131 | 49 |
| 444 | 3300006028 | Ga0070717_10029027 | Ga0070717_100290273 | 49 |
| 445 | 3300006028 | Ga0070717_10739641 | Ga0070717_107396412 | 49 |
| 446 | 3300006028 | Ga0070717_10768654 | Ga0070717_107686542 | 49 |
| 447 | 3300006048 | Ga0075363_100216542 | Ga0075363_1002165421 | 49 |
| 448 | 3300006163 | Ga0070715_10019964 | Ga0070715_100199643 | 49 |
| 449 | 3300006163 | Ga0070715_10024870 | Ga0070715_100248703 | 49 |
| 450 | 3300006163 | Ga0070715_10311046 | Ga0070715_103110462 | 49 |
| 451 | 3300006163 | Ga0070715_10441016 | Ga0070715_104410162 | 49 |
| 452 | 3300006163 | Ga0070715_11088471 | Ga0070715_110884712 | 49 |
| 453 | 3300006173 | Ga0070716_100261331 | Ga0070716_1002613312 | 49 |
| 454 | 3300006173 | Ga0070716_100836321 | Ga0070716_1008363212 | 49 |
| 455 | 3300006173 | Ga0070716_101406932 | Ga0070716_1014069321 | 49 |
| 456 | 3300006175 | Ga0070712_100000422 | Ga0070712_10000042216 | 49 |
| 457 | 3300006175 | Ga0070712_100065633 | Ga0070712_1000656334 | 49 |
| 458 | 3300006175 | Ga0070712_100099079 | Ga0070712_1000990792 | 49 |
| 459 | 3300006175 | Ga0070712_101054375 | Ga0070712_1010543752 | 49 |
| 460 | 3300006175 | Ga0070712_101724361 | Ga0070712_1017243612 | 49 |
| 461 | 3300006178 | Ga0075367_10048417 | Ga0075367_100484173 | 49 |
| 462 | 3300006195 | Ga0075366_10844090 | Ga0075366_108440902 | 49 |
| 463 | 3300006237 | Ga0097621_100001221 | Ga0097621_10000122114 | 49 |
| 464 | 3300006237 | Ga0097621_100032768 | Ga0097621_1000327684 | 49 |
| 465 | 3300006237 | Ga0097621_100039388 | Ga0097621_1000393883 | 49 |
| 466 | 3300006237 | Ga0097621_100082439 | Ga0097621_1000824392 | 49 |
| 467 | 3300006237 | Ga0097621_100115447 | Ga0097621_1001154475 | 49 |
| 468 | 3300006237 | Ga0097621_101517081 | Ga0097621_1015170811 | 49 |
| 469 | 3300006353 | Ga0075370_10295510 | Ga0075370_102955102 | 49 |
| 470 | 3300006358 | Ga0068871_100000577 | Ga0068871_1000005778 | 49 |
| 471 | 3300006358 | Ga0068871_100010141 | Ga0068871_1000101414 | 49 |
| 472 | 3300006358 | Ga0068871_100024331 | Ga0068871_1000243312 | 49 |
| 473 | 3300006358 | Ga0068871_100059020 | Ga0068871_1000590202 | 49 |
| 474 | 3300006358 | Ga0068871_100097617 | Ga0068871_1000976172 | 49 |
| 475 | 3300006358 | Ga0068871_101077505 | Ga0068871_1010775052 | 49 |
| 476 | 3300006844 | Ga0075428_100036788 | Ga0075428_1000367889 | 49 |
| 477 | 3300006844 | Ga0075428_100113690 | Ga0075428_1001136903 | 49 |
| 478 | 3300006844 | Ga0075428_100341508 | Ga0075428_1003415082 | 49 |
| 479 | 3300006844 | Ga0075428_100396864 | Ga0075428_1003968642 | 49 |
| 480 | 3300006844 | Ga0075428_101699616 | Ga0075428_1016996162 | 49 |
| 481 | 3300006844 | Ga0075428_101810421 | Ga0075428_1018104212 | 49 |
| 482 | 3300006846 | Ga0075430_100014611 | Ga0075430_1000146112 | 49 |
| 483 | 3300006846 | Ga0075430_100326437 | Ga0075430_1003264372 | 49 |
| 484 | 3300006846 | Ga0075430_100842435 | Ga0075430_1008424352 | 49 |
| 485 | 3300006847 | Ga0075431_100063943 | Ga0075431_1000639436 | 49 |
| 486 | 3300006847 | Ga0075431_100105891 | Ga0075431_1001058915 | 49 |
| 487 | 3300006847 | Ga0075431_101211909 | Ga0075431_1012119092 | 49 |
| 488 | 3300006847 | Ga0075431_101235827 | Ga0075431_1012358271 | 49 |
| 489 | 3300006847 | Ga0075431_102190820 | Ga0075431_1021908201 | 49 |
| 490 | 3300006852 | Ga0075433_10014786 | Ga0075433_100147862 | 49 |
| 491 | 3300006852 | Ga0075433_10148874 | Ga0075433_101488742 | 49 |
| 492 | 3300006852 | Ga0075433_10154580 | Ga0075433_101545804 | 49 |
| 493 | 3300006852 | Ga0075433_10234774 | Ga0075433_102347742 | 49 |
| 494 | 3300006852 | Ga0075433_10865416 | Ga0075433_108654162 | 49 |
| 495 | 3300006871 | Ga0075434_100017000 | Ga0075434_1000170003 | 49 |
| 496 | 3300006871 | Ga0075434_100025317 | Ga0075434_1000253173 | 49 |
| 497 | 3300006871 | Ga0075434_100978976 | Ga0075434_1009789762 | 49 |
| 498 | 3300006871 | Ga0075434_101727921 | Ga0075434_1017279212 | 49 |
| 499 | 3300006871 | Ga0075434_102179227 | Ga0075434_1021792271 | 49 |
| 500 | 3300006871 | Ga0075434_102309116 | Ga0075434_1023091161 | 49 |
| 501 | 3300006880 | Ga0075429_100060513 | Ga0075429_1000605132 | 49 |
| 502 | 3300006880 | Ga0075429_100129943 | Ga0075429_1001299434 | 49 |
| 503 | 3300006880 | Ga0075429_100153736 | Ga0075429_1001537362 | 49 |
| 504 | 3300006880 | Ga0075429_100433546 | Ga0075429_1004335462 | 49 |
| 505 | 3300006880 | Ga0075429_101072315 | Ga0075429_1010723151 | 49 |
| 506 | 3300006881 | Ga0068865_100028781 | Ga0068865_1000287815 | 49 |
| 507 | 3300006881 | Ga0068865_100407035 | Ga0068865_1004070352 | 49 |
| 508 | 3300006881 | Ga0068865_101081183 | Ga0068865_1010811832 | 49 |
| 509 | 3300006914 | Ga0075436_100166357 | Ga0075436_1001663571 | 49 |
| 510 | 3300006931 | Ga0097620_100045876 | Ga0097620_1000458766 | 49 |
| 511 | 3300006931 | Ga0097620_100063366 | Ga0097620_1000633662 | 49 |
| 512 | 3300006931 | Ga0097620_100070969 | Ga0097620_1000709694 | 49 |
| 513 | 3300006931 | Ga0097620_100114166 | Ga0097620_1001141662 | 49 |
| 514 | 3300006931 | Ga0097620_100202947 | Ga0097620_1002029474 | 49 |
| 515 | 3300006931 | Ga0097620_100420319 | Ga0097620_1004203192 | 49 |
| 516 | 3300006931 | Ga0097620_100453800 | Ga0097620_1004538002 | 49 |
| 517 | 3300007076 | Ga0075435_100033669 | Ga0075435_1000336692 | 49 |
| 518 | 3300007076 | Ga0075435_101580545 | Ga0075435_1015805451 | 49 |
| 519 | 3300007076 | Ga0075435_101709217 | Ga0075435_1017092171 | 49 |
| 520 | 3300007076 | Ga0075435_101767320 | Ga0075435_1017673201 | 49 |
| 521 | 3300007265 | Ga0099794_10584615 | Ga0099794_105846151 | 49 |
| 522 | 3300007788 | Ga0099795_10560745 | Ga0099795_105607452 | 49 |
| 523 | 3300009011 | Ga0105251_10115959 | Ga0105251_101159592 | 49 |
| 524 | 3300009011 | Ga0105251_10146368 | Ga0105251_101463682 | 49 |
| 525 | 3300009011 | Ga0105251_10264346 | Ga0105251_102643462 | 49 |
| 526 | 3300009092 | Ga0105250_10153247 | Ga0105250_101532472 | 49 |
| 527 | 3300009093 | Ga0105240_10000873 | Ga0105240_1000087313 | 49 |
| 528 | 3300009093 | Ga0105240_10001323 | Ga0105240_1000132325 | 49 |
| 529 | 3300009093 | Ga0105240_10021506 | Ga0105240_100215064 | 49 |
| 530 | 3300009093 | Ga0105240_10365894 | Ga0105240_103658942 | 49 |
| 531 | 3300009093 | Ga0105240_11446721 | Ga0105240_114467212 | 49 |
| 532 | 3300009094 | Ga0111539_10000371 | Ga0111539_1000037128 | 49 |
| 533 | 3300009094 | Ga0111539_10027156 | Ga0111539_100271566 | 49 |
| 534 | 3300009094 | Ga0111539_10081568 | Ga0111539_100815685 | 49 |
| 535 | 3300009094 | Ga0111539_10126374 | Ga0111539_101263742 | 49 |
| 536 | 3300009094 | Ga0111539_10264066 | Ga0111539_102640662 | 49 |
| 537 | 3300009094 | Ga0111539_10396414 | Ga0111539_103964142 | 49 |
| 538 | 3300009094 | Ga0111539_10738954 | Ga0111539_107389542 | 49 |
| 539 | 3300009094 | Ga0111539_13284353 | Ga0111539_132843532 | 49 |
| 540 | 3300009098 | Ga0105245_10001718 | Ga0105245_100017185 | 49 |
| 541 | 3300009098 | Ga0105245_10003144 | Ga0105245_1000314411 | 49 |
| 542 | 3300009098 | Ga0105245_10057252 | Ga0105245_100572523 | 49 |
| 543 | 3300009098 | Ga0105245_10070000 | Ga0105245_100700002 | 49 |
| 544 | 3300009098 | Ga0105245_10080585 | Ga0105245_100805852 | 49 |
| 545 | 3300009098 | Ga0105245_10466852 | Ga0105245_104668522 | 49 |
| 546 | 3300009098 | Ga0105245_10474382 | Ga0105245_104743822 | 49 |
| 547 | 3300009101 | Ga0105247_10001246 | Ga0105247_1000124614 | 49 |
| 548 | 3300009101 | Ga0105247_10031295 | Ga0105247_100312952 | 49 |
| 549 | 3300009101 | Ga0105247_10091105 | Ga0105247_100911052 | 49 |
| 550 | 3300009101 | Ga0105247_10092475 | Ga0105247_100924752 | 49 |
| 551 | 3300009101 | Ga0105247_10131636 | Ga0105247_101316362 | 49 |
| 552 | 3300009101 | Ga0105247_11504603 | Ga0105247_115046031 | 49 |
| 553 | 3300009147 | Ga0114129_10093669 | Ga0114129_100936694 | 49 |
| 554 | 3300009147 | Ga0114129_10124261 | Ga0114129_101242612 | 49 |
| 555 | 3300009147 | Ga0114129_10169692 | Ga0114129_101696923 | 49 |
| 556 | 3300009147 | Ga0114129_10365195 | Ga0114129_103651953 | 49 |
| 557 | 3300009147 | Ga0114129_10371602 | Ga0114129_103716022 | 49 |
| 558 | 3300009147 | Ga0114129_11735592 | Ga0114129_117355922 | 49 |
| 559 | 3300009147 | Ga0114129_12264923 | Ga0114129_122649231 | 49 |
| 560 | 3300009148 | Ga0105243_10018079 | Ga0105243_100180794 | 49 |
| 561 | 3300009148 | Ga0105243_10053838 | Ga0105243_100538382 | 49 |
| 562 | 3300009148 | Ga0105243_10058538 | Ga0105243_100585387 | 49 |
| 563 | 3300009148 | Ga0105243_11070589 | Ga0105243_110705892 | 49 |
| 564 | 3300009148 | Ga0105243_12059440 | Ga0105243_120594401 | 49 |
| 565 | 3300009174 | Ga0105241_10000983 | Ga0105241_1000098319 | 49 |
| 566 | 3300009174 | Ga0105241_10001736 | Ga0105241_1000173612 | 49 |
| 567 | 3300009174 | Ga0105241_10003627 | Ga0105241_100036274 | 49 |
| 568 | 3300009174 | Ga0105241_10036225 | Ga0105241_100362252 | 49 |
| 569 | 3300009174 | Ga0105241_10112990 | Ga0105241_101129903 | 49 |
| 570 | 3300009174 | Ga0105241_10145484 | Ga0105241_101454843 | 49 |
| 571 | 3300009176 | Ga0105242_10018099 | Ga0105242_100180992 | 49 |
| 572 | 3300009176 | Ga0105242_10072872 | Ga0105242_100728722 | 49 |
| 573 | 3300009176 | Ga0105242_10213464 | Ga0105242_102134641 | 49 |
| 574 | 3300009176 | Ga0105242_10264618 | Ga0105242_102646182 | 49 |
| 575 | 3300009176 | Ga0105242_10634426 | Ga0105242_106344261 | 49 |
| 576 | 3300009176 | Ga0105242_11221675 | Ga0105242_112216752 | 49 |
| 577 | 3300009176 | Ga0105242_12839912 | Ga0105242_128399122 | 49 |
| 578 | 3300009177 | Ga0105248_10001935 | Ga0105248_1000193511 | 49 |
| 579 | 3300009177 | Ga0105248_10014763 | Ga0105248_100147636 | 49 |
| 580 | 3300009177 | Ga0105248_10020929 | Ga0105248_100209294 | 49 |
| 581 | 3300009177 | Ga0105248_10282450 | Ga0105248_102824502 | 49 |
| 582 | 3300009177 | Ga0105248_10363488 | Ga0105248_103634882 | 49 |
| 583 | 3300009177 | Ga0105248_10432666 | Ga0105248_104326662 | 49 |
| 584 | 3300009177 | Ga0105248_10459845 | Ga0105248_104598452 | 49 |
| 585 | 3300009177 | Ga0105248_11149280 | Ga0105248_111492803 | 49 |
| 586 | 3300009177 | Ga0105248_11300185 | Ga0105248_113001852 | 49 |
| 587 | 3300009177 | Ga0105248_11448541 | Ga0105248_114485411 | 49 |
| 588 | 3300009177 | Ga0105248_12284891 | Ga0105248_122848911 | 49 |
| 589 | 3300009545 | Ga0105237_10000686 | Ga0105237_1000068643 | 49 |
| 590 | 3300009545 | Ga0105237_10015100 | Ga0105237_100151004 | 49 |
| 591 | 3300009545 | Ga0105237_10398531 | Ga0105237_103985311 | 49 |
| 592 | 3300009545 | Ga0105237_10459718 | Ga0105237_104597181 | 49 |
| 593 | 3300009545 | Ga0105237_10486843 | Ga0105237_104868432 | 49 |
| 594 | 3300009545 | Ga0105237_10669503 | Ga0105237_106695031 | 49 |
| 595 | 3300009551 | Ga0105238_10000083 | Ga0105238_100000835 | 49 |
| 596 | 3300009551 | Ga0105238_10001626 | Ga0105238_1000162619 | 49 |
| 597 | 3300009551 | Ga0105238_10019760 | Ga0105238_100197602 | 49 |
| 598 | 3300009551 | Ga0105238_10041026 | Ga0105238_100410264 | 49 |
| 599 | 3300009551 | Ga0105238_10436546 | Ga0105238_104365462 | 49 |
| 600 | 3300009551 | Ga0105238_10602847 | Ga0105238_106028472 | 49 |
| 601 | 3300009553 | Ga0105249_10000609 | Ga0105249_1000060922 | 49 |
| 602 | 3300009553 | Ga0105249_10013478 | Ga0105249_100134788 | 49 |
| 603 | 3300009553 | Ga0105249_10078094 | Ga0105249_100780945 | 49 |
| 604 | 3300009553 | Ga0105249_10083043 | Ga0105249_100830432 | 49 |
| 605 | 3300009553 | Ga0105249_10787145 | Ga0105249_107871452 | 49 |
| 606 | 3300009553 | Ga0105249_11496378 | Ga0105249_114963781 | 49 |
| 607 | 3300009553 | Ga0105249_12591396 | Ga0105249_125913962 | 49 |
| 608 | 3300009553 | Ga0105249_12754685 | Ga0105249_127546851 | 49 |
| 609 | 3300010375 | Ga0105239_10002607 | Ga0105239_1000260710 | 49 |
| 610 | 3300010375 | Ga0105239_10004332 | Ga0105239_1000433213 | 49 |
| 611 | 3300010375 | Ga0105239_10016054 | Ga0105239_100160545 | 49 |
| 612 | 3300010375 | Ga0105239_10026115 | Ga0105239_100261152 | 49 |
| 613 | 3300010375 | Ga0105239_10042846 | Ga0105239_100428462 | 49 |
| 614 | 3300010375 | Ga0105239_10301373 | Ga0105239_103013733 | 49 |
| 615 | 3300010375 | Ga0105239_13054485 | Ga0105239_130544851 | 49 |
| 616 | 3300010375 | Ga0105239_13079762 | Ga0105239_130797621 | 49 |
| 617 | 3300011119 | Ga0105246_10000993 | Ga0105246_100009935 | 49 |
| 618 | 3300012483 | Ga0157337_1032241 | Ga0157337_10322412 | 49 |
| 619 | 3300013100 | Ga0157373_10083360 | Ga0157373_100833603 | 49 |
| 620 | 3300013100 | Ga0157373_10339331 | Ga0157373_103393313 | 49 |
| 621 | 3300013102 | Ga0157371_10121362 | Ga0157371_101213623 | 49 |
| 622 | 3300013102 | Ga0157371_10656553 | Ga0157371_106565531 | 49 |
| 623 | 3300013104 | Ga0157370_10208379 | Ga0157370_102083793 | 49 |
| 624 | 3300013105 | Ga0157369_10004527 | Ga0157369_100045273 | 49 |
| 625 | 3300013105 | Ga0157369_10119802 | Ga0157369_101198024 | 49 |
| 626 | 3300013105 | Ga0157369_10121335 | Ga0157369_101213352 | 49 |
| 627 | 3300013105 | Ga0157369_11311204 | Ga0157369_113112042 | 49 |
| 628 | 3300013296 | Ga0157374_10006274 | Ga0157374_100062746 | 49 |
| 629 | 3300013296 | Ga0157374_10011199 | Ga0157374_100111995 | 49 |
| 630 | 3300013296 | Ga0157374_10011244 | Ga0157374_100112447 | 49 |
| 631 | 3300013296 | Ga0157374_10030653 | Ga0157374_100306535 | 49 |
| 632 | 3300013296 | Ga0157374_10033159 | Ga0157374_100331593 | 49 |
| 633 | 3300013296 | Ga0157374_10146488 | Ga0157374_101464884 | 49 |
| 634 | 3300013296 | Ga0157374_10516282 | Ga0157374_105162822 | 49 |
| 635 | 3300013296 | Ga0157374_11578708 | Ga0157374_115787082 | 49 |
| 636 | 3300013297 | Ga0157378_10004372 | Ga0157378_100043728 | 49 |
| 637 | 3300013297 | Ga0157378_10013267 | Ga0157378_100132678 | 49 |
| 638 | 3300013297 | Ga0157378_10059049 | Ga0157378_100590492 | 49 |
| 639 | 3300013297 | Ga0157378_10065400 | Ga0157378_100654005 | 49 |
| 640 | 3300013297 | Ga0157378_10127879 | Ga0157378_101278793 | 49 |
| 641 | 3300013297 | Ga0157378_10300240 | Ga0157378_103002403 | 49 |
| 642 | 3300013297 | Ga0157378_10435786 | Ga0157378_104357863 | 49 |
| 643 | 3300013297 | Ga0157378_10724458 | Ga0157378_107244582 | 49 |
| 644 | 3300013297 | Ga0157378_11203652 | Ga0157378_112036521 | 49 |
| 645 | 3300013297 | Ga0157378_11394101 | Ga0157378_113941012 | 49 |
| 646 | 3300013297 | Ga0157378_13294199 | Ga0157378_132941991 | 49 |
| 647 | 3300013297 | Ga0157378_13302765 | Ga0157378_133027651 | 49 |
| 648 | 3300013306 | Ga0163162_10002560 | Ga0163162_100025607 | 49 |
| 649 | 3300013306 | Ga0163162_10003473 | Ga0163162_100034733 | 49 |
| 650 | 3300013306 | Ga0163162_10006012 | Ga0163162_100060128 | 49 |
| 651 | 3300013306 | Ga0163162_10073177 | Ga0163162_100731776 | 49 |
| 652 | 3300013306 | Ga0163162_10080847 | Ga0163162_100808476 | 49 |
| 653 | 3300013306 | Ga0163162_10217998 | Ga0163162_102179983 | 49 |
| 654 | 3300013306 | Ga0163162_10263694 | Ga0163162_102636942 | 49 |
| 655 | 3300013306 | Ga0163162_11031310 | Ga0163162_110313102 | 49 |
| 656 | 3300013307 | Ga0157372_10012613 | Ga0157372_100126135 | 49 |
| 657 | 3300013307 | Ga0157372_10012966 | Ga0157372_100129665 | 49 |
| 658 | 3300013307 | Ga0157372_10025051 | Ga0157372_100250514 | 49 |
| 659 | 3300013307 | Ga0157372_10027734 | Ga0157372_100277345 | 49 |
| 660 | 3300013307 | Ga0157372_10045286 | Ga0157372_100452863 | 49 |
| 661 | 3300013307 | Ga0157372_11258751 | Ga0157372_112587511 | 49 |
| 662 | 3300013308 | Ga0157375_10000912 | Ga0157375_1000091214 | 49 |
| 663 | 3300013308 | Ga0157375_10028226 | Ga0157375_100282262 | 49 |
| 664 | 3300013308 | Ga0157375_10088269 | Ga0157375_100882693 | 49 |
| 665 | 3300013308 | Ga0157375_10842351 | Ga0157375_108423512 | 49 |
| 666 | 3300013308 | Ga0157375_11665472 | Ga0157375_116654722 | 49 |
| 667 | 3300013308 | Ga0157375_11777540 | Ga0157375_117775402 | 49 |
| 668 | 3300014325 | Ga0163163_10000990 | Ga0163163_100009907 | 49 |
| 669 | 3300014325 | Ga0163163_10029024 | Ga0163163_100290245 | 49 |
| 670 | 3300014325 | Ga0163163_10062006 | Ga0163163_100620063 | 49 |
| 671 | 3300014325 | Ga0163163_10848919 | Ga0163163_108489192 | 49 |
| 672 | 3300014325 | Ga0163163_11732179 | Ga0163163_117321793 | 49 |
| 673 | 3300014326 | Ga0157380_10009132 | Ga0157380_100091329 | 49 |
| 674 | 3300014326 | Ga0157380_10088504 | Ga0157380_100885043 | 49 |
| 675 | 3300014326 | Ga0157380_10098522 | Ga0157380_100985223 | 49 |
| 676 | 3300014326 | Ga0157380_10150515 | Ga0157380_101505153 | 49 |
| 677 | 3300014326 | Ga0157380_10359334 | Ga0157380_103593342 | 49 |
| 678 | 3300014326 | Ga0157380_10797490 | Ga0157380_107974902 | 49 |
| 679 | 3300014326 | Ga0157380_11234724 | Ga0157380_112347242 | 49 |
| 680 | 3300014745 | Ga0157377_10059755 | Ga0157377_100597553 | 49 |
| 681 | 3300014745 | Ga0157377_10249782 | Ga0157377_102497823 | 49 |
| 682 | 3300014745 | Ga0157377_10964884 | Ga0157377_109648842 | 49 |
| 683 | 3300014968 | Ga0157379_10002598 | Ga0157379_1000259810 | 49 |
| 684 | 3300014968 | Ga0157379_10014161 | Ga0157379_100141613 | 49 |
| 685 | 3300014968 | Ga0157379_10020313 | Ga0157379_100203134 | 49 |
| 686 | 3300014968 | Ga0157379_10127549 | Ga0157379_101275491 | 49 |
| 687 | 3300014968 | Ga0157379_10637578 | Ga0157379_106375782 | 49 |
| 688 | 3300014968 | Ga0157379_11695101 | Ga0157379_116951012 | 49 |
| 689 | 3300014968 | Ga0157379_12032556 | Ga0157379_120325561 | 49 |
| 690 | 3300014969 | Ga0157376_10002690 | Ga0157376_100026903 | 49 |
| 691 | 3300014969 | Ga0157376_10032695 | Ga0157376_100326953 | 49 |
| 692 | 3300014969 | Ga0157376_10499856 | Ga0157376_104998562 | 49 |
| 693 | 3300014969 | Ga0157376_10967481 | Ga0157376_109674812 | 49 |
| 694 | 3300014969 | Ga0157376_11026982 | Ga0157376_110269822 | 49 |
| 695 | 3300017792 | Ga0163161_10029282 | Ga0163161_100292823 | 49 |
| 696 | 3300017792 | Ga0163161_10168841 | Ga0163161_101688414 | 49 |
| 697 | 3300017792 | Ga0163161_10272827 | Ga0163161_102728273 | 49 |
| 698 | 3300019162 | Ga0184597_129778 | Ga0184597_1297781 | 49 |
| 699 | 3300019190 | Ga0184600_121265 | Ga0184600_1212651 | 49 |
| 700 | 3300020069 | Ga0197907_10324399 | Ga0197907_103243992 | 49 |
| 701 | 3300020069 | Ga0197907_11250092 | Ga0197907_112500921 | 49 |
| 702 | 3300020069 | Ga0197907_11279047 | Ga0197907_112790471 | 49 |
| 703 | 3300020069 | Ga0197907_11386164 | Ga0197907_113861641 | 49 |
| 704 | 3300020070 | Ga0206356_10516644 | Ga0206356_105166442 | 49 |
| 705 | 3300020070 | Ga0206356_10715572 | Ga0206356_107155722 | 49 |
| 706 | 3300020070 | Ga0206356_10844135 | Ga0206356_108441352 | 49 |
| 707 | 3300020070 | Ga0206356_11132424 | Ga0206356_111324241 | 49 |
| 708 | 3300020070 | Ga0206356_11161235 | Ga0206356_111612352 | 49 |
| 709 | 3300020070 | Ga0206356_11205819 | Ga0206356_112058192 | 49 |
| 710 | 3300020070 | Ga0206356_11215637 | Ga0206356_112156371 | 49 |
| 711 | 3300020075 | Ga0206349_1297786 | Ga0206349_12977861 | 49 |
| 712 | 3300020075 | Ga0206349_1835108 | Ga0206349_18351082 | 49 |
| 713 | 3300020075 | Ga0206349_1874035 | Ga0206349_18740352 | 49 |
| 714 | 3300020075 | Ga0206349_1917504 | Ga0206349_19175041 | 49 |
| 715 | 3300020075 | Ga0206349_1919281 | Ga0206349_19192811 | 49 |
| 716 | 3300020076 | Ga0206355_1256411 | Ga0206355_12564111 | 49 |
| 717 | 3300020076 | Ga0206355_1258114 | Ga0206355_12581142 | 49 |
| 718 | 3300020076 | Ga0206355_1262814 | Ga0206355_12628142 | 49 |
| 719 | 3300020076 | Ga0206355_1268818 | Ga0206355_12688182 | 49 |
| 720 | 3300020076 | Ga0206355_1451817 | Ga0206355_14518173 | 49 |
| 721 | 3300020076 | Ga0206355_1687652 | Ga0206355_16876522 | 49 |
| 722 | 3300020077 | Ga0206351_10188504 | Ga0206351_101885042 | 49 |
| 723 | 3300020077 | Ga0206351_10405074 | Ga0206351_104050742 | 49 |
| 724 | 3300020077 | Ga0206351_10700374 | Ga0206351_107003741 | 49 |
| 725 | 3300020077 | Ga0206351_10906423 | Ga0206351_109064231 | 49 |
| 726 | 3300020077 | Ga0206351_10908887 | Ga0206351_109088871 | 49 |
| 727 | 3300020077 | Ga0206351_10957061 | Ga0206351_109570612 | 49 |
| 728 | 3300020078 | Ga0206352_10782869 | Ga0206352_107828692 | 49 |
| 729 | 3300020078 | Ga0206352_10893130 | Ga0206352_108931301 | 49 |
| 730 | 3300020078 | Ga0206352_11038743 | Ga0206352_110387432 | 49 |
| 731 | 3300020078 | Ga0206352_11169670 | Ga0206352_111696702 | 49 |
| 732 | 3300020078 | Ga0206352_11252282 | Ga0206352_112522822 | 49 |
| 733 | 3300020078 | Ga0206352_11295039 | Ga0206352_112950392 | 49 |
| 734 | 3300020078 | Ga0206352_11342208 | Ga0206352_113422082 | 49 |
| 735 | 3300020080 | Ga0206350_10525024 | Ga0206350_105250241 | 49 |
| 736 | 3300020080 | Ga0206350_10561742 | Ga0206350_105617422 | 49 |
| 737 | 3300020080 | Ga0206350_10744426 | Ga0206350_107444261 | 49 |
| 738 | 3300020080 | Ga0206350_11634810 | Ga0206350_116348101 | 49 |
| 739 | 3300020081 | Ga0206354_10491623 | Ga0206354_104916231 | 49 |
| 740 | 3300020081 | Ga0206354_11121875 | Ga0206354_111218752 | 49 |
| 741 | 3300020081 | Ga0206354_11697218 | Ga0206354_116972181 | 49 |
| 742 | 3300020082 | Ga0206353_10553268 | Ga0206353_105532682 | 49 |
| 743 | 3300020082 | Ga0206353_11160635 | Ga0206353_111606351 | 49 |
| 744 | 3300020082 | Ga0206353_11160646 | Ga0206353_111606462 | 49 |
| 745 | 3300020082 | Ga0206353_11283297 | Ga0206353_112832971 | 49 |
| 746 | 3300020082 | Ga0206353_11811571 | Ga0206353_118115712 | 49 |
| 747 | 3300020610 | Ga0154015_1019451 | Ga0154015_10194512 | 49 |
| 748 | 3300020610 | Ga0154015_1270677 | Ga0154015_12706772 | 49 |
| 749 | 3300020610 | Ga0154015_1314901 | Ga0154015_13149011 | 49 |
| 750 | 3300021384 | Ga0213876_10215943 | Ga0213876_102159432 | 49 |
| 751 | 3300022467 | Ga0224712_10180851 | Ga0224712_101808511 | 49 |
| 752 | 3300022467 | Ga0224712_10253323 | Ga0224712_102533232 | 49 |
| 753 | 3300022467 | Ga0224712_10271147 | Ga0224712_102711472 | 49 |
| 754 | 3300022467 | Ga0224712_10282527 | Ga0224712_102825271 | 49 |
| 755 | 3300022467 | Ga0224712_10522227 | Ga0224712_105222272 | 49 |
| 756 | 3300022467 | Ga0224712_10579271 | Ga0224712_105792712 | 49 |
| 757 | 3300023672 | Ga0247553_100118 | Ga0247553_1001185 | 49 |
| 758 | 3300025271 | Ga0207666_1010013 | Ga0207666_10100132 | 49 |
| 759 | 3300025271 | Ga0207666_1020265 | Ga0207666_10202652 | 49 |
| 760 | 3300025315 | Ga0207697_10000006 | Ga0207697_1000000664 | 49 |
| 761 | 3300025315 | Ga0207697_10000780 | Ga0207697_1000078016 | 49 |
| 762 | 3300025315 | Ga0207697_10002440 | Ga0207697_100024404 | 49 |
| 763 | 3300025315 | Ga0207697_10376224 | Ga0207697_103762241 | 49 |
| 764 | 3300025321 | Ga0207656_10019971 | Ga0207656_100199712 | 49 |
| 765 | 3300025321 | Ga0207656_10067747 | Ga0207656_100677472 | 49 |
| 766 | 3300025321 | Ga0207656_10106207 | Ga0207656_101062072 | 49 |
| 767 | 3300025321 | Ga0207656_10230723 | Ga0207656_102307231 | 49 |
| 768 | 3300025321 | Ga0207656_10306886 | Ga0207656_103068861 | 49 |
| 769 | 3300025711 | Ga0207696_1115898 | Ga0207696_11158982 | 49 |
| 770 | 3300025885 | Ga0207653_10004397 | Ga0207653_100043975 | 49 |
| 771 | 3300025885 | Ga0207653_10227564 | Ga0207653_102275643 | 49 |
| 772 | 3300025893 | Ga0207682_10003312 | Ga0207682_100033127 | 49 |
| 773 | 3300025898 | Ga0207692_10024648 | Ga0207692_100246482 | 49 |
| 774 | 3300025898 | Ga0207692_10032655 | Ga0207692_100326554 | 49 |
| 775 | 3300025898 | Ga0207692_10265768 | Ga0207692_102657683 | 49 |
| 776 | 3300025898 | Ga0207692_10806008 | Ga0207692_108060082 | 49 |
| 777 | 3300025899 | Ga0207642_10004743 | Ga0207642_100047436 | 49 |
| 778 | 3300025899 | Ga0207642_10503365 | Ga0207642_105033652 | 49 |
| 779 | 3300025900 | Ga0207710_10000831 | Ga0207710_100008314 | 49 |
| 780 | 3300025900 | Ga0207710_10048282 | Ga0207710_100482822 | 49 |
| 781 | 3300025900 | Ga0207710_10180517 | Ga0207710_101805172 | 49 |
| 782 | 3300025900 | Ga0207710_10191476 | Ga0207710_101914761 | 49 |
| 783 | 3300025901 | Ga0207688_10005241 | Ga0207688_100052414 | 49 |
| 784 | 3300025901 | Ga0207688_10355584 | Ga0207688_103555842 | 49 |
| 785 | 3300025901 | Ga0207688_11000942 | Ga0207688_110009422 | 49 |
| 786 | 3300025903 | Ga0207680_10010390 | Ga0207680_100103906 | 49 |
| 787 | 3300025903 | Ga0207680_10108407 | Ga0207680_101084072 | 49 |
| 788 | 3300025903 | Ga0207680_10488712 | Ga0207680_104887122 | 49 |
| 789 | 3300025903 | Ga0207680_10966284 | Ga0207680_109662841 | 49 |
| 790 | 3300025904 | Ga0207647_10026420 | Ga0207647_100264202 | 49 |
| 791 | 3300025904 | Ga0207647_10045450 | Ga0207647_100454504 | 49 |
| 792 | 3300025904 | Ga0207647_10150472 | Ga0207647_101504723 | 49 |
| 793 | 3300025905 | Ga0207685_10018562 | Ga0207685_100185622 | 49 |
| 794 | 3300025905 | Ga0207685_10342396 | Ga0207685_103423962 | 49 |
| 795 | 3300025905 | Ga0207685_10658975 | Ga0207685_106589751 | 49 |
| 796 | 3300025906 | Ga0207699_10033122 | Ga0207699_100331222 | 49 |
| 797 | 3300025906 | Ga0207699_10271497 | Ga0207699_102714972 | 49 |
| 798 | 3300025906 | Ga0207699_10396846 | Ga0207699_103968461 | 49 |
| 799 | 3300025906 | Ga0207699_10467861 | Ga0207699_104678612 | 49 |
| 800 | 3300025906 | Ga0207699_10619847 | Ga0207699_106198472 | 49 |
| 801 | 3300025906 | Ga0207699_11282786 | Ga0207699_112827861 | 49 |
| 802 | 3300025906 | Ga0207699_11325765 | Ga0207699_113257651 | 49 |
| 803 | 3300025907 | Ga0207645_10000071 | Ga0207645_1000007121 | 49 |
| 804 | 3300025907 | Ga0207645_10002340 | Ga0207645_100023405 | 49 |
| 805 | 3300025907 | Ga0207645_10024039 | Ga0207645_100240393 | 49 |
| 806 | 3300025907 | Ga0207645_10232344 | Ga0207645_102323442 | 49 |
| 807 | 3300025907 | Ga0207645_10886918 | Ga0207645_108869182 | 49 |
| 808 | 3300025908 | Ga0207643_10001825 | Ga0207643_100018256 | 49 |
| 809 | 3300025909 | Ga0207705_10044589 | Ga0207705_100445893 | 49 |
| 810 | 3300025909 | Ga0207705_10086494 | Ga0207705_100864943 | 49 |
| 811 | 3300025909 | Ga0207705_10160274 | Ga0207705_101602744 | 49 |
| 812 | 3300025909 | Ga0207705_10275115 | Ga0207705_102751152 | 49 |
| 813 | 3300025910 | Ga0207684_10000032 | Ga0207684_10000032201 | 49 |
| 814 | 3300025910 | Ga0207684_10003246 | Ga0207684_1000324615 | 49 |
| 815 | 3300025910 | Ga0207684_10011152 | Ga0207684_100111528 | 49 |
| 816 | 3300025910 | Ga0207684_10075694 | Ga0207684_100756941 | 49 |
| 817 | 3300025910 | Ga0207684_11006226 | Ga0207684_110062261 | 49 |
| 818 | 3300025910 | Ga0207684_11297323 | Ga0207684_112973232 | 49 |
| 819 | 3300025911 | Ga0207654_10000023 | Ga0207654_1000002327 | 49 |
| 820 | 3300025911 | Ga0207654_10000668 | Ga0207654_100006684 | 49 |
| 821 | 3300025911 | Ga0207654_10000858 | Ga0207654_100008585 | 49 |
| 822 | 3300025911 | Ga0207654_10024153 | Ga0207654_100241532 | 49 |
| 823 | 3300025911 | Ga0207654_10230781 | Ga0207654_102307812 | 49 |
| 824 | 3300025911 | Ga0207654_10342235 | Ga0207654_103422351 | 49 |
| 825 | 3300025911 | Ga0207654_10453387 | Ga0207654_104533873 | 49 |
| 826 | 3300025911 | Ga0207654_11450163 | Ga0207654_114501631 | 49 |
| 827 | 3300025912 | Ga0207707_10018524 | Ga0207707_100185243 | 49 |
| 828 | 3300025912 | Ga0207707_10027394 | Ga0207707_100273946 | 49 |
| 829 | 3300025912 | Ga0207707_10188095 | Ga0207707_101880952 | 49 |
| 830 | 3300025912 | Ga0207707_10519191 | Ga0207707_105191911 | 49 |
| 831 | 3300025913 | Ga0207695_10000113 | Ga0207695_1000011326 | 49 |
| 832 | 3300025913 | Ga0207695_10000188 | Ga0207695_1000018813 | 49 |
| 833 | 3300025913 | Ga0207695_10000338 | Ga0207695_100003385 | 49 |
| 834 | 3300025913 | Ga0207695_10030295 | Ga0207695_100302951 | 49 |
| 835 | 3300025913 | Ga0207695_10110382 | Ga0207695_101103822 | 49 |
| 836 | 3300025913 | Ga0207695_10125368 | Ga0207695_101253682 | 49 |
| 837 | 3300025913 | Ga0207695_11266651 | Ga0207695_112666512 | 49 |
| 838 | 3300025914 | Ga0207671_10000145 | Ga0207671_100001456 | 49 |
| 839 | 3300025914 | Ga0207671_10000506 | Ga0207671_1000050634 | 49 |
| 840 | 3300025914 | Ga0207671_10209158 | Ga0207671_102091583 | 49 |
| 841 | 3300025914 | Ga0207671_10271655 | Ga0207671_102716552 | 49 |
| 842 | 3300025914 | Ga0207671_10336731 | Ga0207671_103367313 | 49 |
| 843 | 3300025914 | Ga0207671_11011833 | Ga0207671_110118332 | 49 |
| 844 | 3300025914 | Ga0207671_11045780 | Ga0207671_110457802 | 49 |
| 845 | 3300025915 | Ga0207693_10000509 | Ga0207693_1000050917 | 49 |
| 846 | 3300025915 | Ga0207693_10005034 | Ga0207693_100050346 | 49 |
| 847 | 3300025915 | Ga0207693_10035797 | Ga0207693_100357972 | 49 |
| 848 | 3300025915 | Ga0207693_10177522 | Ga0207693_101775223 | 49 |
| 849 | 3300025915 | Ga0207693_10312386 | Ga0207693_103123861 | 49 |
| 850 | 3300025915 | Ga0207693_11049377 | Ga0207693_110493771 | 49 |
| 851 | 3300025916 | Ga0207663_10006497 | Ga0207663_100064976 | 49 |
| 852 | 3300025916 | Ga0207663_10293696 | Ga0207663_102936963 | 49 |
| 853 | 3300025916 | Ga0207663_10460865 | Ga0207663_104608652 | 49 |
| 854 | 3300025916 | Ga0207663_10772164 | Ga0207663_107721642 | 49 |
| 855 | 3300025917 | Ga0207660_10009241 | Ga0207660_100092413 | 49 |
| 856 | 3300025917 | Ga0207660_10872097 | Ga0207660_108720972 | 49 |
| 857 | 3300025917 | Ga0207660_10981310 | Ga0207660_109813102 | 49 |
| 858 | 3300025917 | Ga0207660_11566210 | Ga0207660_115662102 | 49 |
| 859 | 3300025918 | Ga0207662_10000982 | Ga0207662_1000098210 | 49 |
| 860 | 3300025918 | Ga0207662_10031481 | Ga0207662_100314814 | 49 |
| 861 | 3300025918 | Ga0207662_10073670 | Ga0207662_100736703 | 49 |
| 862 | 3300025918 | Ga0207662_10305736 | Ga0207662_103057362 | 49 |
| 863 | 3300025919 | Ga0207657_10224725 | Ga0207657_102247252 | 49 |
| 864 | 3300025919 | Ga0207657_10525388 | Ga0207657_105253882 | 49 |
| 865 | 3300025919 | Ga0207657_10683319 | Ga0207657_106833193 | 49 |
| 866 | 3300025919 | Ga0207657_10755408 | Ga0207657_107554082 | 49 |
| 867 | 3300025919 | Ga0207657_11366482 | Ga0207657_113664821 | 49 |
| 868 | 3300025920 | Ga0207649_10019388 | Ga0207649_100193882 | 49 |
| 869 | 3300025920 | Ga0207649_10021494 | Ga0207649_100214942 | 49 |
| 870 | 3300025920 | Ga0207649_10053841 | Ga0207649_100538414 | 49 |
| 871 | 3300025920 | Ga0207649_10131767 | Ga0207649_101317673 | 49 |
| 872 | 3300025920 | Ga0207649_10946755 | Ga0207649_109467551 | 49 |
| 873 | 3300025921 | Ga0207652_10001839 | Ga0207652_1000183912 | 49 |
| 874 | 3300025921 | Ga0207652_10014955 | Ga0207652_100149557 | 49 |
| 875 | 3300025921 | Ga0207652_10913376 | Ga0207652_109133761 | 49 |
| 876 | 3300025922 | Ga0207646_10061224 | Ga0207646_100612244 | 49 |
| 877 | 3300025922 | Ga0207646_10064592 | Ga0207646_100645926 | 49 |
| 878 | 3300025922 | Ga0207646_10371726 | Ga0207646_103717262 | 49 |
| 879 | 3300025922 | Ga0207646_10747916 | Ga0207646_107479162 | 49 |
| 880 | 3300025922 | Ga0207646_10897852 | Ga0207646_108978522 | 49 |
| 881 | 3300025923 | Ga0207681_10011809 | Ga0207681_100118093 | 49 |
| 882 | 3300025923 | Ga0207681_10018647 | Ga0207681_100186474 | 49 |
| 883 | 3300025923 | Ga0207681_10020853 | Ga0207681_100208539 | 49 |
| 884 | 3300025923 | Ga0207681_11409261 | Ga0207681_114092611 | 49 |
| 885 | 3300025923 | Ga0207681_11489715 | Ga0207681_114897152 | 49 |
| 886 | 3300025924 | Ga0207694_10000076 | Ga0207694_1000007662 | 49 |
| 887 | 3300025924 | Ga0207694_10000085 | Ga0207694_1000008594 | 49 |
| 888 | 3300025924 | Ga0207694_10001059 | Ga0207694_1000105916 | 49 |
| 889 | 3300025924 | Ga0207694_10012774 | Ga0207694_100127746 | 49 |
| 890 | 3300025924 | Ga0207694_10244570 | Ga0207694_102445702 | 49 |
| 891 | 3300025924 | Ga0207694_10322145 | Ga0207694_103221453 | 49 |
| 892 | 3300025924 | Ga0207694_10534474 | Ga0207694_105344742 | 49 |
| 893 | 3300025924 | Ga0207694_11122480 | Ga0207694_111224802 | 49 |
| 894 | 3300025924 | Ga0207694_11367276 | Ga0207694_113672762 | 49 |
| 895 | 3300025925 | Ga0207650_10008426 | Ga0207650_100084266 | 49 |
| 896 | 3300025925 | Ga0207650_10028473 | Ga0207650_100284734 | 49 |
| 897 | 3300025925 | Ga0207650_10638442 | Ga0207650_106384421 | 49 |
| 898 | 3300025926 | Ga0207659_10011630 | Ga0207659_100116308 | 49 |
| 899 | 3300025926 | Ga0207659_10018061 | Ga0207659_100180614 | 49 |
| 900 | 3300025926 | Ga0207659_10230470 | Ga0207659_102304703 | 49 |
| 901 | 3300025927 | Ga0207687_10007183 | Ga0207687_100071835 | 49 |
| 902 | 3300025927 | Ga0207687_10069733 | Ga0207687_100697334 | 49 |
| 903 | 3300025927 | Ga0207687_10075565 | Ga0207687_100755651 | 49 |
| 904 | 3300025927 | Ga0207687_10085461 | Ga0207687_100854611 | 49 |
| 905 | 3300025927 | Ga0207687_10104912 | Ga0207687_101049124 | 49 |
| 906 | 3300025927 | Ga0207687_10398889 | Ga0207687_103988892 | 49 |
| 907 | 3300025927 | Ga0207687_10536014 | Ga0207687_105360142 | 49 |
| 908 | 3300025928 | Ga0207700_10050602 | Ga0207700_100506022 | 49 |
| 909 | 3300025928 | Ga0207700_10688130 | Ga0207700_106881302 | 49 |
| 910 | 3300025929 | Ga0207664_10140945 | Ga0207664_101409451 | 49 |
| 911 | 3300025929 | Ga0207664_10298205 | Ga0207664_102982052 | 49 |
| 912 | 3300025929 | Ga0207664_10447526 | Ga0207664_104475262 | 49 |
| 913 | 3300025929 | Ga0207664_11013951 | Ga0207664_110139512 | 49 |
| 914 | 3300025931 | Ga0207644_10001426 | Ga0207644_100014268 | 49 |
| 915 | 3300025931 | Ga0207644_10041382 | Ga0207644_100413823 | 49 |
| 916 | 3300025931 | Ga0207644_10056522 | Ga0207644_100565223 | 49 |
| 917 | 3300025931 | Ga0207644_10074074 | Ga0207644_100740743 | 49 |
| 918 | 3300025931 | Ga0207644_10116851 | Ga0207644_101168515 | 49 |
| 919 | 3300025931 | Ga0207644_10166355 | Ga0207644_101663552 | 49 |
| 920 | 3300025931 | Ga0207644_10462805 | Ga0207644_104628052 | 49 |
| 921 | 3300025932 | Ga0207690_10005886 | Ga0207690_100058863 | 49 |
| 922 | 3300025932 | Ga0207690_10014322 | Ga0207690_100143226 | 49 |
| 923 | 3300025933 | Ga0207706_10000835 | Ga0207706_1000083522 | 49 |
| 924 | 3300025933 | Ga0207706_10022504 | Ga0207706_100225042 | 49 |
| 925 | 3300025933 | Ga0207706_10029024 | Ga0207706_100290244 | 49 |
| 926 | 3300025933 | Ga0207706_10053786 | Ga0207706_100537863 | 49 |
| 927 | 3300025933 | Ga0207706_10058900 | Ga0207706_100589003 | 49 |
| 928 | 3300025933 | Ga0207706_10520645 | Ga0207706_105206451 | 49 |
| 929 | 3300025934 | Ga0207686_10039911 | Ga0207686_100399115 | 49 |
| 930 | 3300025934 | Ga0207686_10202743 | Ga0207686_102027434 | 49 |
| 931 | 3300025934 | Ga0207686_10315580 | Ga0207686_103155802 | 49 |
| 932 | 3300025934 | Ga0207686_10466054 | Ga0207686_104660541 | 49 |
| 933 | 3300025934 | Ga0207686_10546273 | Ga0207686_105462731 | 49 |
| 934 | 3300025934 | Ga0207686_10641764 | Ga0207686_106417642 | 49 |
| 935 | 3300025934 | Ga0207686_11202376 | Ga0207686_112023761 | 49 |
| 936 | 3300025934 | Ga0207686_11511546 | Ga0207686_115115461 | 49 |
| 937 | 3300025935 | Ga0207709_10153255 | Ga0207709_101532552 | 49 |
| 938 | 3300025935 | Ga0207709_10420036 | Ga0207709_104200362 | 49 |
| 939 | 3300025935 | Ga0207709_10490659 | Ga0207709_104906593 | 49 |
| 940 | 3300025935 | Ga0207709_11149403 | Ga0207709_111494031 | 49 |
| 941 | 3300025936 | Ga0207670_10012608 | Ga0207670_100126083 | 49 |
| 942 | 3300025936 | Ga0207670_10034843 | Ga0207670_100348432 | 49 |
| 943 | 3300025936 | Ga0207670_10055383 | Ga0207670_100553832 | 49 |
| 944 | 3300025936 | Ga0207670_10221545 | Ga0207670_102215452 | 49 |
| 945 | 3300025937 | Ga0207669_10002444 | Ga0207669_100024446 | 49 |
| 946 | 3300025938 | Ga0207704_10074481 | Ga0207704_100744813 | 49 |
| 947 | 3300025938 | Ga0207704_10218092 | Ga0207704_102180922 | 49 |
| 948 | 3300025938 | Ga0207704_10990751 | Ga0207704_109907511 | 49 |
| 949 | 3300025939 | Ga0207665_10101170 | Ga0207665_101011702 | 49 |
| 950 | 3300025940 | Ga0207691_10015890 | Ga0207691_100158906 | 49 |
| 951 | 3300025940 | Ga0207691_10259128 | Ga0207691_102591283 | 49 |
| 952 | 3300025940 | Ga0207691_10306957 | Ga0207691_103069573 | 49 |
| 953 | 3300025940 | Ga0207691_10465035 | Ga0207691_104650352 | 49 |
| 954 | 3300025941 | Ga0207711_10000992 | Ga0207711_1000099214 | 49 |
| 955 | 3300025941 | Ga0207711_10011105 | Ga0207711_100111053 | 49 |
| 956 | 3300025941 | Ga0207711_10015238 | Ga0207711_100152386 | 49 |
| 957 | 3300025941 | Ga0207711_10016385 | Ga0207711_100163853 | 49 |
| 958 | 3300025941 | Ga0207711_10097307 | Ga0207711_100973072 | 49 |
| 959 | 3300025941 | Ga0207711_10850507 | Ga0207711_108505071 | 49 |
| 960 | 3300025941 | Ga0207711_10933335 | Ga0207711_109333352 | 49 |
| 961 | 3300025942 | Ga0207689_10000936 | Ga0207689_1000093616 | 49 |
| 962 | 3300025942 | Ga0207689_10005617 | Ga0207689_100056174 | 49 |
| 963 | 3300025942 | Ga0207689_10007815 | Ga0207689_100078157 | 49 |
| 964 | 3300025942 | Ga0207689_10079940 | Ga0207689_100799402 | 49 |
| 965 | 3300025942 | Ga0207689_10207224 | Ga0207689_102072241 | 49 |
| 966 | 3300025942 | Ga0207689_10220434 | Ga0207689_102204342 | 49 |
| 967 | 3300025942 | Ga0207689_10249036 | Ga0207689_102490362 | 49 |
| 968 | 3300025944 | Ga0207661_10002184 | Ga0207661_100021845 | 49 |
| 969 | 3300025944 | Ga0207661_10003133 | Ga0207661_100031338 | 49 |
| 970 | 3300025944 | Ga0207661_10005275 | Ga0207661_1000527510 | 49 |
| 971 | 3300025944 | Ga0207661_10006124 | Ga0207661_100061243 | 49 |
| 972 | 3300025944 | Ga0207661_10036591 | Ga0207661_100365913 | 49 |
| 973 | 3300025944 | Ga0207661_10085703 | Ga0207661_100857032 | 49 |
| 974 | 3300025944 | Ga0207661_10168298 | Ga0207661_101682984 | 49 |
| 975 | 3300025944 | Ga0207661_10561959 | Ga0207661_105619592 | 49 |
| 976 | 3300025944 | Ga0207661_10632361 | Ga0207661_106323611 | 49 |
| 977 | 3300025944 | Ga0207661_10732003 | Ga0207661_107320032 | 49 |
| 978 | 3300025945 | Ga0207679_10086413 | Ga0207679_100864135 | 49 |
| 979 | 3300025945 | Ga0207679_10096016 | Ga0207679_100960163 | 49 |
| 980 | 3300025945 | Ga0207679_10110884 | Ga0207679_101108842 | 49 |
| 981 | 3300025945 | Ga0207679_10221701 | Ga0207679_102217012 | 49 |
| 982 | 3300025945 | Ga0207679_10295079 | Ga0207679_102950792 | 49 |
| 983 | 3300025945 | Ga0207679_10498582 | Ga0207679_104985821 | 49 |
| 984 | 3300025945 | Ga0207679_12106558 | Ga0207679_121065581 | 49 |
| 985 | 3300025949 | Ga0207667_10024639 | Ga0207667_100246395 | 49 |
| 986 | 3300025949 | Ga0207667_10037735 | Ga0207667_100377354 | 49 |
| 987 | 3300025949 | Ga0207667_10062221 | Ga0207667_100622213 | 49 |
| 988 | 3300025949 | Ga0207667_10223914 | Ga0207667_102239142 | 49 |
| 989 | 3300025949 | Ga0207667_11152628 | Ga0207667_111526282 | 49 |
| 990 | 3300025949 | Ga0207667_11237901 | Ga0207667_112379011 | 49 |
| 991 | 3300025949 | Ga0207667_11879650 | Ga0207667_118796502 | 49 |
| 992 | 3300025960 | Ga0207651_10071094 | Ga0207651_100710943 | 49 |
| 993 | 3300025960 | Ga0207651_10116699 | Ga0207651_101166992 | 49 |
| 994 | 3300025960 | Ga0207651_10288970 | Ga0207651_102889702 | 49 |
| 995 | 3300025960 | Ga0207651_10509413 | Ga0207651_105094132 | 49 |
| 996 | 3300025960 | Ga0207651_10924059 | Ga0207651_109240591 | 49 |
| 997 | 3300025960 | Ga0207651_11436738 | Ga0207651_114367381 | 49 |
| 998 | 3300025961 | Ga0207712_10011388 | Ga0207712_100113882 | 49 |
| 999 | 3300025961 | Ga0207712_10044880 | Ga0207712_100448803 | 49 |
| 1000 | 3300025961 | Ga0207712_10082829 | Ga0207712_100828293 | 49 |
| 1001 | 3300025961 | Ga0207712_10086875 | Ga0207712_100868754 | 49 |
| 1002 | 3300025961 | Ga0207712_11367359 | Ga0207712_113673592 | 49 |
| 1003 | 3300025961 | Ga0207712_11574167 | Ga0207712_115741671 | 49 |
| 1004 | 3300025972 | Ga0207668_10012145 | Ga0207668_100121457 | 49 |
| 1005 | 3300025972 | Ga0207668_10036595 | Ga0207668_100365955 | 49 |
| 1006 | 3300025972 | Ga0207668_10036798 | Ga0207668_100367982 | 49 |
| 1007 | 3300025972 | Ga0207668_10570720 | Ga0207668_105707201 | 49 |
| 1008 | 3300025981 | Ga0207640_10041395 | Ga0207640_100413954 | 49 |
| 1009 | 3300025981 | Ga0207640_10292782 | Ga0207640_102927821 | 49 |
| 1010 | 3300025981 | Ga0207640_10406645 | Ga0207640_104066451 | 49 |
| 1011 | 3300025981 | Ga0207640_10533773 | Ga0207640_105337732 | 49 |
| 1012 | 3300025986 | Ga0207658_10000721 | Ga0207658_1000072125 | 49 |
| 1013 | 3300025986 | Ga0207658_10011703 | Ga0207658_100117039 | 49 |
| 1014 | 3300025986 | Ga0207658_10027685 | Ga0207658_100276852 | 49 |
| 1015 | 3300025986 | Ga0207658_10637673 | Ga0207658_106376732 | 49 |
| 1016 | 3300025986 | Ga0207658_11200364 | Ga0207658_112003642 | 49 |
| 1017 | 3300025986 | Ga0207658_11220208 | Ga0207658_112202081 | 49 |
| 1018 | 3300026023 | Ga0207677_10000697 | Ga0207677_1000069713 | 49 |
| 1019 | 3300026023 | Ga0207677_10169968 | Ga0207677_101699682 | 49 |
| 1020 | 3300026023 | Ga0207677_10184760 | Ga0207677_101847603 | 49 |
| 1021 | 3300026023 | Ga0207677_10288948 | Ga0207677_102889482 | 49 |
| 1022 | 3300026023 | Ga0207677_10336818 | Ga0207677_103368183 | 49 |
| 1023 | 3300026023 | Ga0207677_11056612 | Ga0207677_110566121 | 49 |
| 1024 | 3300026023 | Ga0207677_12042237 | Ga0207677_120422371 | 49 |
| 1025 | 3300026035 | Ga0207703_10002669 | Ga0207703_1000266914 | 49 |
| 1026 | 3300026035 | Ga0207703_10018927 | Ga0207703_100189273 | 49 |
| 1027 | 3300026035 | Ga0207703_10087496 | Ga0207703_100874962 | 49 |
| 1028 | 3300026035 | Ga0207703_10103649 | Ga0207703_101036493 | 49 |
| 1029 | 3300026035 | Ga0207703_10609390 | Ga0207703_106093901 | 49 |
| 1030 | 3300026041 | Ga0207639_10000072 | Ga0207639_100000725 | 49 |
| 1031 | 3300026041 | Ga0207639_10014151 | Ga0207639_100141514 | 49 |
| 1032 | 3300026041 | Ga0207639_10091496 | Ga0207639_100914962 | 49 |
| 1033 | 3300026041 | Ga0207639_10140214 | Ga0207639_101402143 | 49 |
| 1034 | 3300026041 | Ga0207639_10163447 | Ga0207639_101634472 | 49 |
| 1035 | 3300026041 | Ga0207639_10721623 | Ga0207639_107216232 | 49 |
| 1036 | 3300026041 | Ga0207639_11390124 | Ga0207639_113901242 | 49 |
| 1037 | 3300026041 | Ga0207639_11411348 | Ga0207639_114113482 | 49 |
| 1038 | 3300026067 | Ga0207678_10069636 | Ga0207678_100696361 | 49 |
| 1039 | 3300026067 | Ga0207678_10144168 | Ga0207678_101441683 | 49 |
| 1040 | 3300026067 | Ga0207678_10990235 | Ga0207678_109902353 | 49 |
| 1041 | 3300026067 | Ga0207678_11023174 | Ga0207678_110231741 | 49 |
| 1042 | 3300026075 | Ga0207708_10052624 | Ga0207708_100526246 | 49 |
| 1043 | 3300026078 | Ga0207702_10006483 | Ga0207702_100064835 | 49 |
| 1044 | 3300026078 | Ga0207702_10016091 | Ga0207702_100160912 | 49 |
| 1045 | 3300026078 | Ga0207702_10273811 | Ga0207702_102738111 | 49 |
| 1046 | 3300026078 | Ga0207702_10335056 | Ga0207702_103350562 | 49 |
| 1047 | 3300026078 | Ga0207702_11255265 | Ga0207702_112552651 | 49 |
| 1048 | 3300026078 | Ga0207702_11806514 | Ga0207702_118065142 | 49 |
| 1049 | 3300026078 | Ga0207702_11942626 | Ga0207702_119426262 | 49 |
| 1050 | 3300026088 | Ga0207641_10003347 | Ga0207641_100033473 | 49 |
| 1051 | 3300026088 | Ga0207641_10020959 | Ga0207641_100209596 | 49 |
| 1052 | 3300026088 | Ga0207641_10061136 | Ga0207641_100611363 | 49 |
| 1053 | 3300026088 | Ga0207641_10105292 | Ga0207641_101052924 | 49 |
| 1054 | 3300026088 | Ga0207641_10166113 | Ga0207641_101661132 | 49 |
| 1055 | 3300026088 | Ga0207641_10237758 | Ga0207641_102377582 | 49 |
| 1056 | 3300026088 | Ga0207641_10333580 | Ga0207641_103335802 | 49 |
| 1057 | 3300026088 | Ga0207641_10610842 | Ga0207641_106108422 | 49 |
| 1058 | 3300026089 | Ga0207648_10022243 | Ga0207648_100222435 | 49 |
| 1059 | 3300026089 | Ga0207648_10073512 | Ga0207648_100735122 | 49 |
| 1060 | 3300026089 | Ga0207648_10458456 | Ga0207648_104584563 | 49 |
| 1061 | 3300026089 | Ga0207648_10550496 | Ga0207648_105504961 | 49 |
| 1062 | 3300026089 | Ga0207648_10862644 | Ga0207648_108626442 | 49 |
| 1063 | 3300026089 | Ga0207648_11775287 | Ga0207648_117752871 | 49 |
| 1064 | 3300026095 | Ga0207676_10005629 | Ga0207676_100056295 | 49 |
| 1065 | 3300026095 | Ga0207676_10039951 | Ga0207676_100399513 | 49 |
| 1066 | 3300026095 | Ga0207676_10212667 | Ga0207676_102126673 | 49 |
| 1067 | 3300026095 | Ga0207676_10437656 | Ga0207676_104376562 | 49 |
| 1068 | 3300026095 | Ga0207676_10628058 | Ga0207676_106280581 | 49 |
| 1069 | 3300026095 | Ga0207676_11658607 | Ga0207676_116586072 | 49 |
| 1070 | 3300026095 | Ga0207676_11718266 | Ga0207676_117182662 | 49 |
| 1071 | 3300026095 | Ga0207676_11985695 | Ga0207676_119856952 | 49 |
| 1072 | 3300026116 | Ga0207674_10006105 | Ga0207674_100061053 | 49 |
| 1073 | 3300026116 | Ga0207674_10026877 | Ga0207674_100268772 | 49 |
| 1074 | 3300026116 | Ga0207674_10112388 | Ga0207674_101123883 | 49 |
| 1075 | 3300026116 | Ga0207674_10571134 | Ga0207674_105711341 | 49 |
| 1076 | 3300026116 | Ga0207674_10933541 | Ga0207674_109335413 | 49 |
| 1077 | 3300026116 | Ga0207674_11152808 | Ga0207674_111528082 | 49 |
| 1078 | 3300026118 | Ga0207675_100006619 | Ga0207675_1000066199 | 49 |
| 1079 | 3300026118 | Ga0207675_100092204 | Ga0207675_1000922043 | 49 |
| 1080 | 3300026118 | Ga0207675_100172832 | Ga0207675_1001728322 | 49 |
| 1081 | 3300026118 | Ga0207675_100252565 | Ga0207675_1002525653 | 49 |
| 1082 | 3300026118 | Ga0207675_100675252 | Ga0207675_1006752522 | 49 |
| 1083 | 3300026118 | Ga0207675_100723374 | Ga0207675_1007233742 | 49 |
| 1084 | 3300026118 | Ga0207675_102532205 | Ga0207675_1025322051 | 49 |
| 1085 | 3300026121 | Ga0207683_10000392 | Ga0207683_1000039215 | 49 |
| 1086 | 3300026121 | Ga0207683_10058359 | Ga0207683_100583596 | 49 |
| 1087 | 3300026142 | Ga0207698_10002536 | Ga0207698_100025365 | 49 |
| 1088 | 3300026142 | Ga0207698_10006606 | Ga0207698_100066066 | 49 |
| 1089 | 3300026142 | Ga0207698_10037024 | Ga0207698_100370243 | 49 |
| 1090 | 3300026142 | Ga0207698_10094864 | Ga0207698_100948641 | 49 |
| 1091 | 3300026142 | Ga0207698_10575811 | Ga0207698_105758112 | 49 |
| 1092 | 3300026142 | Ga0207698_11042794 | Ga0207698_110427942 | 49 |
| 1093 | 3300026142 | Ga0207698_11071263 | Ga0207698_110712632 | 49 |
| 1094 | 3300026142 | Ga0207698_11134968 | Ga0207698_111349683 | 49 |
| 1095 | 3300027543 | Ga0209999_1064506 | Ga0209999_10645062 | 49 |
| 1096 | 3300027717 | Ga0209998_10175110 | Ga0209998_101751102 | 49 |
| 1097 | 3300027907 | Ga0207428_10000608 | Ga0207428_100006083 | 49 |
| 1098 | 3300027907 | Ga0207428_10015891 | Ga0207428_100158914 | 49 |
| 1099 | 3300027907 | Ga0207428_10287312 | Ga0207428_102873122 | 49 |
| 1100 | 3300027907 | Ga0207428_10567855 | Ga0207428_105678552 | 49 |
| 1101 | 3300027907 | Ga0207428_10675362 | Ga0207428_106753622 | 49 |
| 1102 | 3300027907 | Ga0207428_11032171 | Ga0207428_110321711 | 49 |
| 1103 | 3300028016 | Ga0265354_1000098 | Ga0265354_100009811 | 49 |
| 1104 | 3300028016 | Ga0265354_1000950 | Ga0265354_10009504 | 49 |
| 1105 | 3300028036 | Ga0265355_1012880 | Ga0265355_10128802 | 49 |
| 1106 | 3300028379 | Ga0268266_10028937 | Ga0268266_100289376 | 49 |
| 1107 | 3300028379 | Ga0268266_10051630 | Ga0268266_100516304 | 49 |
| 1108 | 3300028379 | Ga0268266_10752208 | Ga0268266_107522082 | 49 |
| 1109 | 3300028379 | Ga0268266_10872161 | Ga0268266_108721613 | 49 |
| 1110 | 3300028379 | Ga0268266_11267437 | Ga0268266_112674373 | 49 |
| 1111 | 3300028379 | Ga0268266_12009194 | Ga0268266_120091942 | 49 |
| 1112 | 3300028380 | Ga0268265_10036595 | Ga0268265_100365954 | 49 |
| 1113 | 3300028380 | Ga0268265_10074665 | Ga0268265_100746653 | 49 |
| 1114 | 3300028380 | Ga0268265_10100723 | Ga0268265_101007232 | 49 |
| 1115 | 3300028380 | Ga0268265_10139054 | Ga0268265_101390543 | 49 |
| 1116 | 3300028380 | Ga0268265_10835675 | Ga0268265_108356753 | 49 |
| 1117 | 3300028380 | Ga0268265_11033087 | Ga0268265_110330872 | 49 |
| 1118 | 3300028380 | Ga0268265_11459766 | Ga0268265_114597661 | 49 |
| 1119 | 3300028381 | Ga0268264_10001264 | Ga0268264_100012646 | 49 |
| 1120 | 3300028381 | Ga0268264_10014533 | Ga0268264_100145332 | 49 |
| 1121 | 3300028381 | Ga0268264_10016196 | Ga0268264_100161963 | 49 |
| 1122 | 3300028381 | Ga0268264_10024740 | Ga0268264_100247406 | 49 |
| 1123 | 3300028381 | Ga0268264_10240123 | Ga0268264_102401233 | 49 |
| 1124 | 3300028381 | Ga0268264_10247856 | Ga0268264_102478562 | 49 |
| 1125 | 3300028381 | Ga0268264_10453754 | Ga0268264_104537543 | 49 |
| 1126 | 3300028558 | Ga0265326_10035795 | Ga0265326_100357953 | 49 |
| 1127 | 3300028563 | Ga0265319_1093397 | Ga0265319_10933972 | 49 |
| 1128 | 3300028653 | Ga0265323_10001642 | Ga0265323_100016421 | 49 |
| 1129 | 3300028653 | Ga0265323_10029672 | Ga0265323_100296724 | 49 |
| 1130 | 3300028653 | Ga0265323_10035115 | Ga0265323_100351155 | 49 |
| 1131 | 3300028800 | Ga0265338_10036426 | Ga0265338_100364265 | 49 |
| 1132 | 3300028800 | Ga0265338_10051346 | Ga0265338_100513466 | 49 |
| 1133 | 3300028800 | Ga0265338_10716149 | Ga0265338_107161492 | 49 |
| 1134 | 3300030878 | Ga0265770_1002035 | Ga0265770_10020353 | 49 |
| 1135 | 3300030879 | Ga0265765_1001343 | Ga0265765_10013432 | 49 |
| 1136 | 3300030879 | Ga0265765_1036246 | Ga0265765_10362462 | 49 |
| 1137 | 3300031090 | Ga0265760_10001198 | Ga0265760_100011985 | 49 |
| 1138 | 3300031090 | Ga0265760_10014078 | Ga0265760_100140782 | 49 |
| 1139 | 3300031235 | Ga0265330_10004895 | Ga0265330_100048954 | 49 |
| 1140 | 3300031235 | Ga0265330_10008926 | Ga0265330_1000892610 | 49 |
| 1141 | 3300031238 | Ga0265332_10000009 | Ga0265332_10000009144 | 49 |
| 1142 | 3300031238 | Ga0265332_10000042 | Ga0265332_1000004249 | 49 |
| 1143 | 3300031238 | Ga0265332_10133215 | Ga0265332_101332152 | 49 |
| 1144 | 3300031239 | Ga0265328_10014817 | Ga0265328_100148172 | 49 |
| 1145 | 3300031240 | Ga0265320_10050477 | Ga0265320_100504772 | 49 |
| 1146 | 3300031240 | Ga0265320_10094376 | Ga0265320_100943763 | 49 |
| 1147 | 3300031242 | Ga0265329_10015222 | Ga0265329_100152223 | 49 |
| 1148 | 3300031247 | Ga0265340_10005578 | Ga0265340_100055782 | 49 |
| 1149 | 3300031249 | Ga0265339_10005067 | Ga0265339_100050679 | 49 |
| 1150 | 3300031250 | Ga0265331_10000022 | Ga0265331_1000002252 | 49 |
| 1151 | 3300031344 | Ga0265316_10004370 | Ga0265316_100043709 | 49 |
| 1152 | 3300031344 | Ga0265316_10024993 | Ga0265316_100249934 | 49 |
| 1153 | 3300031344 | Ga0265316_10052764 | Ga0265316_100527642 | 49 |
| 1154 | 3300031344 | Ga0265316_10093223 | Ga0265316_100932233 | 49 |
| 1155 | 3300031344 | Ga0265316_10693067 | Ga0265316_106930672 | 49 |
| 1156 | 3300031507 | Ga0307509_10000076 | Ga0307509_1000007614 | 49 |
| 1157 | 3300031711 | Ga0265314_10000681 | Ga0265314_1000068123 | 49 |
| 1158 | 3300031711 | Ga0265314_10100234 | Ga0265314_101002342 | 49 |
| 1159 | 3300031711 | Ga0265314_10139877 | Ga0265314_101398772 | 49 |
| 1160 | 3300031712 | Ga0265342_10004261 | Ga0265342_100042614 | 49 |
| 1161 | 3300031712 | Ga0265342_10008059 | Ga0265342_100080598 | 49 |
| 1162 | 3300031712 | Ga0265342_10327422 | Ga0265342_103274221 | 49 |
| 1163 | 3300031903 | Ga0307407_10815383 | Ga0307407_108153833 | 49 |
| 1164 | 3300032120 | Ga0316053_102437 | Ga0316053_1024373 | 49 |
| 1165 | 3300033547 | Ga0316212_1002969 | Ga0316212_10029693 | 49 |
| 1166 | 3300033547 | Ga0316212_1020776 | Ga0316212_10207762 | 49 |
| 1167 | 3300035085 | Ga0373929_0091436 | Ga0373929_0091436_98_247 | 49 |
| 1168 | 3300035086 | Ga0373934_0001839 | Ga0373934_0001839_1741_1890 | 49 |
| 1169 | 3300035086 | Ga0373934_0128101 | Ga0373934_0128101_30_179 | 49 |
| 1170 | 3300035088 | Ga0373940_0154000 | Ga0373940_0154000_29_178 | 49 |
| 1171 | 3300035088 | Ga0373940_0294809 | Ga0373940_0294809_26_175 | 49 |
| 1172 | 3300035091 | Ga0373951_0019781 | Ga0373951_0019781_939_1088 | 49 |
| 1173 | 3300035111 | Ga0373923_0094482 | Ga0373923_0094482_283_432 | 49 |
| 1174 | 3300035111 | Ga0373923_0158048 | Ga0373923_0158048_315_464 | 49 |
| 1175 | 3300035113 | Ga0373936_0183399 | Ga0373936_0183399_692_844 | 49 |
| 1176 | 3300035113 | Ga0373936_0434186 | Ga0373936_0434186_21_170 | 49 |
| 1177 | 3300035117 | Ga0373953_0056831 | Ga0373953_0056831_470_619 | 49 |
| 1178 | 3300035117 | Ga0373953_0131853 | Ga0373953_0131853_828_980 | 49 |
| 1179 | 3300035117 | Ga0373953_0178180 | Ga0373953_0178180_716_868 | 49 |
| 1180 | 3300035117 | Ga0373953_0248623 | Ga0373953_0248623_553_702 | 49 |
| 1181 | 3300035118 | Ga0373954_0045359 | Ga0373954_0045359_766_918 | 49 |
| 1182 | 3300035118 | Ga0373954_0071639 | Ga0373954_0071639_83_232 | 49 |
| 1183 | 3300035119 | Ga0373956_0011297 | Ga0373956_0011297_2191_2340 | 49 |
| 1184 | 3300035119 | Ga0373956_0025194 | Ga0373956_0025194_1280_1432 | 49 |
| 1185 | 3300035119 | Ga0373956_0080257 | Ga0373956_0080257_306_455 | 49 |
| 1186 | 3300035120 | Ga0373957_0323409 | Ga0373957_0323409_312_461 | 49 |
| 1187 | 3300035120 | Ga0373957_0332543 | Ga0373957_0332543_483_632 | 49 |
| 1188 | 3300035120 | Ga0373957_0339927 | Ga0373957_0339927_474_623 | 49 |
| 1189 | 3300035120 | Ga0373957_0522703 | Ga0373957_0522703_51_200 | 49 |
| 1190 | 3300035172 | Ga0373955_0012644 | Ga0373955_0012644_1298_1447 | 49 |
| 1191 | 3300035172 | Ga0373955_0346412 | Ga0373955_0346412_434_583 | 49 |
| 1192 | 3300035172 | Ga0373955_0625318 | Ga0373955_0625318_440_592 | 49 |
| 1193 | 3300035241 | Ga0373961_0267220 | Ga0373961_0267220_12_161 | 49 |
| 1194 | 3300035398 | Ga0316574_0143853 | Ga0316574_0143853_161_328 | 49 |
| 1195 | 3300035410 | Ga0373924_0315826 | Ga0373924_0315826_222_374 | 49 |
| 1196 | 3300035691 | Ga0373931_0332260 | Ga0373931_0332260_138_287 | 49 |
| 1197 | 3300035691 | Ga0373931_0604631 | Ga0373931_0604631_478_630 | 49 |
| 1198 | 3300035692 | Ga0373935_0433005 | Ga0373935_0433005_697_846 | 49 |
| 1199 | 3300035724 | Ga0373933_0036573 | Ga0373933_0036573_908_1057 | 49 |
| 1200 | 3300035724 | Ga0373933_0040062 | Ga0373933_0040062_2555_2704 | 49 |
| 1201 | 3300035724 | Ga0373933_0170240 | Ga0373933_0170240_791_940 | 49 |
| 1202 | 3300035724 | Ga0373933_0400081 | Ga0373933_0400081_82_231 | 49 |
| 1203 | 3300035724 | Ga0373933_0689509 | Ga0373933_0689509_467_616 | 49 |
| 1204 | 3300036401 | Ga0373937_0004374 | Ga0373937_0004374_3182_3331 | 49 |
| 1205 | 3300036401 | Ga0373937_0060946 | Ga0373937_0060946_33_182 | 49 |
| 1206 | 3300036401 | Ga0373937_0084956 | Ga0373937_0084956_1416_1565 | 49 |
| 1207 | 3300036401 | Ga0373937_0156351 | Ga0373937_0156351_1392_1541 | 49 |
| 1208 | 3300036401 | Ga0373937_0270489 | Ga0373937_0270489_532_681 | 49 |
| 1209 | 3300036401 | Ga0373937_0376361 | Ga0373937_0376361_24_176 | 49 |
| 1210 | 3300036401 | Ga0373937_0380585 | Ga0373937_0380585_325_474 | 49 |
| 1211 | 3300036401 | Ga0373937_0511519 | Ga0373937_0511519_564_713 | 49 |
| 1212 | 3300036401 | Ga0373937_0948879 | Ga0373937_0948879_477_626 | 49 |
| 1213 | 3300036401 | Ga0373937_0975167 | Ga0373937_0975167_429_578 | 49 |
| 1214 | 3300037068 | Ga0373925_1175321 | Ga0373925_1175321_379_528 | 49 |
| 1215 | 3300037068 | Ga0373925_1347120 | Ga0373925_1347120_247_396 | 49 |
| 1216 | 3300037312 | Ga0395899_0976327 | Ga0395899_0976327_295_444 | 49 |
| 1217 | 3300037418 | Ga0395900_0786191 | Ga0395900_0786191_646_795 | 49 |
| 1218 | 3300037418 | Ga0395900_0834549 | Ga0395900_0834549_103_252 | 49 |
| 1219 | 3300037466 | Ga0395898_1834323 | Ga0395898_1834323_210_359 | 49 |
| 1220 | 3300038443 | Ga0395901_0587782 | Ga0395901_0587782_140_289 | 49 |
| 1221 | 3300038443 | Ga0395901_2087217 | Ga0395901_2087217_50_199 | 49 |
| 1222 | 3300041460 | Ga0451802_1861437 | Ga0451802_1861437_300_452 | 49 |
| 1223 | 3300041486 | Ga0451807_0907752 | Ga0451807_0907752_621_770 | 49 |
| 1224 | 3300041496 | Ga0451839_1288097 | Ga0451839_1288097_73_222 | 49 |
| 1225 | 3300041509 | Ga0451843_0211863 | Ga0451843_0211863_97_246 | 49 |
| 1226 | 3300041509 | Ga0451843_1005222 | Ga0451843_1005222_36_188 | 49 |
| 1227 | 3300041512 | Ga0451853_2542678 | Ga0451853_2542678_577_729 | 49 |
| 1228 | 3300042461 | Ga0439460_0224587 | Ga0439460_0224587_26_175 | 49 |
| 1229 | 3300042876 | Ga0451577_0063966 | Ga0451577_0063966_417_566 | 49 |
| 1230 | 3300042876 | Ga0451577_0078362 | Ga0451577_0078362_1637_1813 | 49 |
| 1231 | 3300042876 | Ga0451577_0106049 | Ga0451577_0106049_551_700 | 49 |
| 1232 | 3300042876 | Ga0451577_0822950 | Ga0451577_0822950_29_178 | 49 |
| 1233 | 3300042876 | Ga0451577_1515252 | Ga0451577_1515252_108_257 | 49 |
| 1234 | 3300042876 | Ga0451577_1554443 | Ga0451577_1554443_280_429 | 49 |
| 1235 | 3300042876 | Ga0451577_2017912 | Ga0451577_2017912_18_167 | 49 |
| 1236 | 3300042993 | Ga0439440_0146535 | Ga0439440_0146535_46_195 | 49 |
| 1237 | 3300044673 | Ga0453683_0019235 | Ga0453683_0019235_1967_2116 | 49 |
| 1238 | 3300044673 | Ga0453683_0354812 | Ga0453683_0354812_721_873 | 49 |
| 1239 | 3300044673 | Ga0453683_0426242 | Ga0453683_0426242_422_571 | 49 |
| 1240 | 3300044694 | Ga0466963_0333165 | Ga0466963_0333165_415_567 | 49 |
| 1241 | 3300044712 | Ga0453684_0091154 | Ga0453684_0091154_664_813 | 49 |
| 1242 | 3300044712 | Ga0453684_0223641 | Ga0453684_0223641_857_1006 | 49 |
| 1243 | 3300044712 | Ga0453684_0518234 | Ga0453684_0518234_903_1055 | 49 |
| 1244 | 3300044712 | Ga0453684_1222631 | Ga0453684_1222631_265_414 | 49 |
| 1245 | 3300044712 | Ga0453684_1620555 | Ga0453684_1620555_56_205 | 49 |
| 1246 | 3300044712 | Ga0453684_2548615 | Ga0453684_2548615_37_186 | 49 |
| 1247 | 3300044842 | Ga0466957_0880160 | Ga0466957_0880160_396_548 | 49 |
| 1248 | 3300045051 | Ga0451576_0059242 | Ga0451576_0059242_1523_1672 | 49 |
| 1249 | 3300045051 | Ga0451576_0059260 | Ga0451576_0059260_1074_1223 | 49 |
| 1250 | 3300045051 | Ga0451576_0090653 | Ga0451576_0090653_2870_3019 | 49 |
| 1251 | 3300045051 | Ga0451576_0124751 | Ga0451576_0124751_329_478 | 49 |
| 1252 | 3300045051 | Ga0451576_0133396 | Ga0451576_0133396_1128_1283 | 49 |
| 1253 | 3300045051 | Ga0451576_0240284 | Ga0451576_0240284_172_321 | 49 |
| 1254 | 3300045051 | Ga0451576_0375565 | Ga0451576_0375565_156_305 | 49 |
| 1255 | 3300045051 | Ga0451576_0401641 | Ga0451576_0401641_43_192 | 49 |
| 1256 | 3300045051 | Ga0451576_0464825 | Ga0451576_0464825_631_780 | 49 |
| 1257 | 3300045051 | Ga0451576_0502080 | Ga0451576_0502080_646_798 | 49 |
| 1258 | 3300045051 | Ga0451576_0786898 | Ga0451576_0786898_463_612 | 49 |
| 1259 | 3300045051 | Ga0451576_0855342 | Ga0451576_0855342_770_919 | 49 |
| 1260 | 3300045976 | Ga0466967_0002917 | Ga0466967_0002917_8562_8714 | 49 |
| 1261 | 3300046454 | Ga0495592_0191652 | Ga0495592_0191652_1144_1293 | 49 |
| 1262 | 3300046455 | Ga0495603_0314973 | Ga0495603_0314973_400_549 | 49 |
| 1263 | 3300046459 | Ga0495629_0759927 | Ga0495629_0759927_16_165 | 49 |
| 1264 | 3300046459 | Ga0495629_0899982 | Ga0495629_0899982_125_277 | 49 |
| 1265 | 3300046462 | Ga0495651_1024348 | Ga0495651_1024348_323_475 | 49 |
| 1266 | 3300046472 | Ga0495580_0125999 | Ga0495580_0125999_1589_1738 | 49 |
| 1267 | 3300046472 | Ga0495580_0139332 | Ga0495580_0139332_1400_1549 | 49 |
| 1268 | 3300046472 | Ga0495580_0246831 | Ga0495580_0246831_718_870 | 49 |
| 1269 | 3300046472 | Ga0495580_1007317 | Ga0495580_1007317_275_424 | 49 |
| 1270 | 3300046473 | Ga0495582_0638181 | Ga0495582_0638181_36_188 | 49 |
| 1271 | 3300046475 | Ga0495639_0072580 | Ga0495639_0072580_1395_1544 | 49 |
| 1272 | 3300046492 | Ga0495585_0525181 | Ga0495585_0525181_305_454 | 49 |
| 1273 | 3300046511 | Ga0495608_0227305 | Ga0495608_0227305_706_855 | 49 |
| 1274 | 3300046514 | Ga0495618_0203742 | Ga0495618_0203742_283_432 | 49 |
| 1275 | 3300046516 | Ga0495628_0375465 | Ga0495628_0375465_491_643 | 49 |
| 1276 | 3300046517 | Ga0495630_0070982 | Ga0495630_0070982_100_249 | 49 |
| 1277 | 3300046529 | Ga0495652_0762873 | Ga0495652_0762873_430_579 | 49 |
| 1278 | 3300046535 | Ga0495586_0735573 | Ga0495586_0735573_18_167 | 49 |
| 1279 | 3300046535 | Ga0495586_0846714 | Ga0495586_0846714_23_172 | 49 |
| 1280 | 3300046536 | Ga0495587_0425626 | Ga0495587_0425626_109_261 | 49 |
| 1281 | 3300046557 | Ga0495622_0388364 | Ga0495622_0388364_231_380 | 49 |
| 1282 | 3300046559 | Ga0495667_0435067 | Ga0495667_0435067_284_436 | 49 |
| 1283 | 3300046642 | Ga0495634_0028961 | Ga0495634_0028961_3597_3746 | 49 |
| 1284 | 3300046642 | Ga0495634_0285044 | Ga0495634_0285044_819_968 | 49 |
| 1285 | 3300046663 | Ga0495635_0809855 | Ga0495635_0809855_55_204 | 49 |
| 1286 | 3300046675 | Ga0495657_0305061 | Ga0495657_0305061_563_712 | 49 |
| 1287 | 3300046678 | Ga0495599_0515429 | Ga0495599_0515429_238_390 | 49 |
| 1288 | 3300046680 | Ga0495646_0676971 | Ga0495646_0676971_354_503 | 49 |
| 1289 | 3300046681 | Ga0495647_0253352 | Ga0495647_0253352_449_598 | 49 |
| 1290 | 3300046684 | Ga0495669_0066462 | Ga0495669_0066462_779_928 | 49 |
| 1291 | 3300046684 | Ga0495669_0432199 | Ga0495669_0432199_120_272 | 49 |
| 1292 | 3300046689 | Ga0495613_0095160 | Ga0495613_0095160_629_778 | 49 |
| 1293 | 3300046689 | Ga0495613_0179709 | Ga0495613_0179709_256_405 | 49 |
| 1294 | 3300046691 | Ga0495670_0830072 | Ga0495670_0830072_42_194 | 49 |
| 1295 | 3300046809 | Ga0495600_0417746 | Ga0495600_0417746_434_583 | 49 |
| 1296 | 3300047322 | Ga0495680_0243301 | Ga0495680_0243301_734_883 | 49 |
| 1297 | 3300047322 | Ga0495680_0853826 | Ga0495680_0853826_215_367 | 49 |
| 1298 | 3300047322 | Ga0495680_0878458 | Ga0495680_0878458_11_163 | 49 |
| 1299 | 3300047322 | Ga0495680_1016783 | Ga0495680_1016783_202_351 | 49 |
| 1300 | 3300047471 | Ga0495684_0178850 | Ga0495684_0178850_1169_1318 | 49 |
| 1301 | 3300047471 | Ga0495684_0301944 | Ga0495684_0301944_369_521 | 49 |
| 1302 | 3300047673 | Ga0495593_0540647 | Ga0495593_0540647_365_514 | 49 |
| 1303 | 3300048088 | Ga0495602_0474726 | Ga0495602_0474726_399_551 | 49 |
| 1304 | 3300048903 | Ga0496100_0177343 | Ga0496100_0177343_1282_1431 | 49 |
| 1305 | 3300048903 | Ga0496100_0961853 | Ga0496100_0961853_234_386 | 49 |
| 1306 | 3300048904 | Ga0496101_0748775 | Ga0496101_0748775_265_417 | 49 |
| 1307 | 3300048905 | Ga0496102_0003426 | Ga0496102_0003426_2169_2318 | 49 |
| 1308 | 3300048905 | Ga0496102_1363466 | Ga0496102_1363466_197_349 | 49 |
| 1309 | 3300048906 | Ga0496103_0223104 | Ga0496103_0223104_700_849 | 49 |
| 1310 | 3300048907 | Ga0496104_0578944 | Ga0496104_0578944_465_617 | 49 |
| 1311 | 3300048907 | Ga0496104_0874090 | Ga0496104_0874090_265_417 | 49 |
| 1312 | 3300048909 | Ga0496106_0112490 | Ga0496106_0112490_188_337 | 49 |
| 1313 | 3300048909 | Ga0496106_0639086 | Ga0496106_0639086_327_476 | 49 |
| 1314 | 3300048909 | Ga0496106_0903385 | Ga0496106_0903385_526_675 | 49 |
| 1315 | 3300048911 | Ga0496108_0008090 | Ga0496108_0008090_1168_1317 | 49 |
| 1316 | 3300048911 | Ga0496108_0186752 | Ga0496108_0186752_407_559 | 49 |
| 1317 | 3300048911 | Ga0496108_0285755 | Ga0496108_0285755_1033_1185 | 49 |
| 1318 | 3300048911 | Ga0496108_0930722 | Ga0496108_0930722_530_679 | 49 |
| 1319 | 3300048911 | Ga0496108_1120762 | Ga0496108_1120762_211_360 | 49 |
| 1320 | 3300048912 | Ga0496109_0001877 | Ga0496109_0001877_561_710 | 49 |
| 1321 | 3300048913 | Ga0496110_0044892 | Ga0496110_0044892_1533_1682 | 49 |
| 1322 | 3300048913 | Ga0496110_0592788 | Ga0496110_0592788_700_849 | 49 |
| 1323 | 3300048913 | Ga0496110_1231160 | Ga0496110_1231160_241_390 | 49 |
| 1324 | 3300048914 | Ga0496111_0676832 | Ga0496111_0676832_409_561 | 49 |
| 1325 | 3300048915 | Ga0496112_0147241 | Ga0496112_0147241_415_564 | 49 |
| 1326 | 3300048915 | Ga0496112_0353809 | Ga0496112_0353809_1042_1191 | 49 |
| 1327 | 3300048915 | Ga0496112_0989787 | Ga0496112_0989787_407_556 | 49 |
| 1328 | 3300048916 | Ga0496113_0224189 | Ga0496113_0224189_522_671 | 49 |
| 1329 | 3300048917 | Ga0496114_0197160 | Ga0496114_0197160_891_1040 | 49 |
| 1330 | 3300048918 | Ga0496115_0051899 | Ga0496115_0051899_1196_1351 | 49 |
| 1331 | 3300048918 | Ga0496115_0166618 | Ga0496115_0166618_1327_1479 | 49 |
| 1332 | 3300048929 | Ga0496126_0683616 | Ga0496126_0683616_492_641 | 49 |
| 1333 | 3300049568 | Ga0501031_0246246 | Ga0501031_0246246_856_1005 | 49 |
| 1334 | 3300049569 | Ga0501032_0038061 | Ga0501032_0038061_1774_1923 | 49 |
| 1335 | 3300049569 | Ga0501032_0540280 | Ga0501032_0540280_251_400 | 49 |
| 1336 | 3300049570 | Ga0501033_0052408 | Ga0501033_0052408_2479_2628 | 49 |
| 1337 | 3300049570 | Ga0501033_0868990 | Ga0501033_0868990_57_206 | 49 |
| 1338 | 3300049571 | Ga0501034_0026609 | Ga0501034_0026609_2049_2198 | 49 |
| 1339 | 3300049571 | Ga0501034_0548433 | Ga0501034_0548433_71_220 | 49 |
| 1340 | 3300049571 | Ga0501034_0598232 | Ga0501034_0598232_775_924 | 49 |
| 1341 | 3300049572 | Ga0501036_0116535 | Ga0501036_0116535_1041_1190 | 49 |
| 1342 | 3300049572 | Ga0501036_0376694 | Ga0501036_0376694_831_980 | 49 |
| 1343 | 3300049573 | Ga0501037_0058985 | Ga0501037_0058985_1684_1833 | 49 |
| 1344 | 3300049573 | Ga0501037_0062601 | Ga0501037_0062601_1507_1656 | 49 |
| 1345 | 3300049574 | Ga0501038_0098967 | Ga0501038_0098967_1539_1688 | 49 |
| 1346 | 3300049574 | Ga0501038_0264997 | Ga0501038_0264997_67_216 | 49 |
| 1347 | 3300049574 | Ga0501038_0321381 | Ga0501038_0321381_945_1094 | 49 |
| 1348 | 3300049575 | Ga0501039_0126887 | Ga0501039_0126887_1675_1824 | 49 |
| 1349 | 3300049575 | Ga0501039_0132178 | Ga0501039_0132178_629_778 | 49 |
| 1350 | 3300049575 | Ga0501039_1420855 | Ga0501039_1420855_261_410 | 49 |
| 1351 | 3300049576 | Ga0501040_0243013 | Ga0501040_0243013_154_303 | 49 |
| 1352 | 3300049576 | Ga0501040_1366719 | Ga0501040_1366719_199_348 | 49 |
| 1353 | 3300049577 | Ga0501041_0103736 | Ga0501041_0103736_461_610 | 49 |
| 1354 | 3300049577 | Ga0501041_0388174 | Ga0501041_0388174_445_594 | 49 |
| 1355 | 3300049578 | Ga0501042_0006571 | Ga0501042_0006571_2886_3035 | 49 |
| 1356 | 3300049578 | Ga0501042_1141937 | Ga0501042_1141937_259_408 | 49 |
| 1357 | 3300049579 | Ga0501043_0049118 | Ga0501043_0049118_3143_3292 | 49 |
| 1358 | 3300049579 | Ga0501043_0091498 | Ga0501043_0091498_1380_1529 | 49 |
| 1359 | 3300049579 | Ga0501043_0606017 | Ga0501043_0606017_612_761 | 49 |
| 1360 | 3300049580 | Ga0501046_0045612 | Ga0501046_0045612_43_192 | 49 |
| 1361 | 3300049580 | Ga0501046_0064852 | Ga0501046_0064852_444_593 | 49 |
| 1362 | 3300049580 | Ga0501046_0123185 | Ga0501046_0123185_430_579 | 49 |
| 1363 | 3300049581 | Ga0501047_0327571 | Ga0501047_0327571_762_911 | 49 |
| 1364 | 3300049581 | Ga0501047_0863938 | Ga0501047_0863938_86_235 | 49 |
| 1365 | 3300049581 | Ga0501047_1372407 | Ga0501047_1372407_302_451 | 49 |
| 1366 | 3300049582 | Ga0501048_0034507 | Ga0501048_0034507_1602_1751 | 49 |
| 1367 | 3300049582 | Ga0501048_0079035 | Ga0501048_0079035_1930_2079 | 49 |
| 1368 | 3300049583 | Ga0501067_0008902 | Ga0501067_0008902_4026_4175 | 49 |
| 1369 | 3300049583 | Ga0501067_0169930 | Ga0501067_0169930_1040_1189 | 49 |
| 1370 | 3300049583 | Ga0501067_0188648 | Ga0501067_0188648_182_331 | 49 |
| 1371 | 3300049584 | Ga0501068_0032050 | Ga0501068_0032050_101_250 | 49 |
| 1372 | 3300049584 | Ga0501068_0052413 | Ga0501068_0052413_1052_1204 | 49 |
| 1373 | 3300049584 | Ga0501068_0520520 | Ga0501068_0520520_484_633 | 49 |
| 1374 | 3300049585 | Ga0501069_0004494 | Ga0501069_0004494_595_744 | 49 |
| 1375 | 3300049586 | Ga0501070_0224127 | Ga0501070_0224127_846_995 | 49 |
| 1376 | 3300049586 | Ga0501070_0382453 | Ga0501070_0382453_280_429 | 49 |
| 1377 | 3300049587 | Ga0501071_0080954 | Ga0501071_0080954_1853_2002 | 49 |
| 1378 | 3300049587 | Ga0501071_0862763 | Ga0501071_0862763_228_380 | 49 |
| 1379 | 3300049587 | Ga0501071_1015621 | Ga0501071_1015621_327_476 | 49 |
| 1380 | 3300049587 | Ga0501071_1205039 | Ga0501071_1205039_361_510 | 49 |
| 1381 | 3300049588 | Ga0501072_0039700 | Ga0501072_0039700_2752_2901 | 49 |
| 1382 | 3300049588 | Ga0501072_0097589 | Ga0501072_0097589_117_266 | 49 |
| 1383 | 3300049588 | Ga0501072_0146616 | Ga0501072_0146616_286_435 | 49 |
| 1384 | 3300049588 | Ga0501072_0867793 | Ga0501072_0867793_518_667 | 49 |
| 1385 | 3300049589 | Ga0501073_0059231 | Ga0501073_0059231_1460_1609 | 49 |
| 1386 | 3300049589 | Ga0501073_0156069 | Ga0501073_0156069_180_329 | 49 |
| 1387 | 3300049590 | Ga0501074_0092132 | Ga0501074_0092132_1622_1771 | 49 |
| 1388 | 3300049591 | Ga0501075_0341867 | Ga0501075_0341867_938_1087 | 49 |
| 1389 | 3300049592 | Ga0501076_0569224 | Ga0501076_0569224_47_196 | 49 |
| 1390 | 3300049592 | Ga0501076_0718961 | Ga0501076_0718961_155_304 | 49 |
| 1391 | 3300049592 | Ga0501076_0989290 | Ga0501076_0989290_435_584 | 49 |
| 1392 | 3300049593 | Ga0501077_0506966 | Ga0501077_0506966_601_750 | 49 |
| 1393 | 3300049741 | Ga0501079_0037276 | Ga0501079_0037276_1847_1996 | 49 |
| 1394 | 3300049741 | Ga0501079_1014142 | Ga0501079_1014142_300_449 | 49 |
| 1395 | 3300049741 | Ga0501079_1406353 | Ga0501079_1406353_230_379 | 49 |
| 1396 | 3300049742 | Ga0501080_0301014 | Ga0501080_0301014_219_368 | 49 |
| 1397 | 3300049742 | Ga0501080_0402355 | Ga0501080_0402355_491_640 | 49 |
| 1398 | 3300049742 | Ga0501080_0405268 | Ga0501080_0405268_898_1047 | 49 |
| 1399 | 3300049742 | Ga0501080_1114728 | Ga0501080_1114728_285_434 | 49 |
| 1400 | 3300049742 | Ga0501080_1691947 | Ga0501080_1691947_180_329 | 49 |
| 1401 | 3300049743 | Ga0501081_0247611 | Ga0501081_0247611_299_448 | 49 |
| 1402 | 3300049743 | Ga0501081_0486427 | Ga0501081_0486427_710_859 | 49 |
| 1403 | 3300049743 | Ga0501081_0546611 | Ga0501081_0546611_93_242 | 49 |
| 1404 | 3300049743 | Ga0501081_0946984 | Ga0501081_0946984_127_276 | 49 |
| 1405 | 3300049744 | Ga0501083_0002089 | Ga0501083_0002089_10340_10489 | 49 |
| 1406 | 3300049744 | Ga0501083_0150204 | Ga0501083_0150204_588_737 | 49 |
| 1407 | 3300049744 | Ga0501083_0961920 | Ga0501083_0961920_273_422 | 49 |
| 1408 | 3300049822 | Ga0501035_0105773 | Ga0501035_0105773_657_806 | 49 |
| 1409 | 3300049823 | Ga0501044_0120546 | Ga0501044_0120546_2133_2282 | 49 |
| 1410 | 3300049823 | Ga0501044_0189789 | Ga0501044_0189789_868_1017 | 49 |
| 1411 | 3300049823 | Ga0501044_0292645 | Ga0501044_0292645_1109_1258 | 49 |
| 1412 | 3300049824 | Ga0501045_0080520 | Ga0501045_0080520_2122_2271 | 49 |
| 1413 | 3300049824 | Ga0501045_0358615 | Ga0501045_0358615_298_447 | 49 |
| 1414 | 3300050507 | nmdc:mga05p37_12092_c1 | nmdc:mga05p37_12092_c1_3269_3421 | 49 |
| 1415 | 3300050507 | nmdc:mga05p37_1386757_c1 | nmdc:mga05p37_1386757_c1_351_506 | 49 |
| 1416 | 3300050507 | nmdc:mga05p37_204944_c1 | nmdc:mga05p37_204944_c1_1931_2080 | 49 |
| 1417 | 3300050507 | nmdc:mga05p37_370855_c1 | nmdc:mga05p37_370855_c1_286_441 | 49 |
| 1418 | 3300050507 | nmdc:mga05p37_381218_c1 | nmdc:mga05p37_381218_c1_406_555 | 49 |
| 1419 | 3300050507 | nmdc:mga05p37_523024_c1 | nmdc:mga05p37_523024_c1_1011_1160 | 49 |
| 1420 | 3300050507 | nmdc:mga05p37_538804_c1 | nmdc:mga05p37_538804_c1_226_375 | 49 |
| 1421 | 3300050507 | nmdc:mga05p37_57379_c1 | nmdc:mga05p37_57379_c1_751_903 | 49 |
| 1422 | 3300050508 | nmdc:mga09592_234689_c1 | nmdc:mga09592_234689_c1_592_741 | 49 |
| 1423 | 3300050508 | nmdc:mga09592_275530_c1 | nmdc:mga09592_275530_c1_613_762 | 49 |
| 1424 | 3300050508 | nmdc:mga09592_335945_c1 | nmdc:mga09592_335945_c1_476_628 | 49 |
| 1425 | 3300050508 | nmdc:mga09592_460981_c1 | nmdc:mga09592_460981_c1_739_894 | 49 |
| 1426 | 3300050508 | nmdc:mga09592_987605_c1 | nmdc:mga09592_987605_c1_499_648 | 49 |
| 1427 | 3300050509 | nmdc:mga0qj67_298460_c1 | nmdc:mga0qj67_298460_c1_209_361 | 49 |
| 1428 | 3300050510 | nmdc:mga06r32_1154380_c1 | nmdc:mga06r32_1154380_c1_221_370 | 49 |
| 1429 | 3300050510 | nmdc:mga06r32_196779_c1 | nmdc:mga06r32_196779_c1_1145_1297 | 49 |
| 1430 | 3300050510 | nmdc:mga06r32_643319_c1 | nmdc:mga06r32_643319_c1_532_687 | 49 |
| 1431 | 3300050511 | nmdc:mga08y16_1131174_c1 | nmdc:mga08y16_1131174_c1_175_324 | 49 |
| 1432 | 3300050511 | nmdc:mga08y16_23201_c1 | nmdc:mga08y16_23201_c1_5424_5573 | 49 |
| 1433 | 3300050511 | nmdc:mga08y16_294223_c1 | nmdc:mga08y16_294223_c1_1345_1497 | 49 |
| 1434 | 3300050511 | nmdc:mga08y16_342_c1 | nmdc:mga08y16_342_c1_13587_13736 | 49 |
| 1435 | 3300050511 | nmdc:mga08y16_602455_c1 | nmdc:mga08y16_602455_c1_372_521 | 49 |
| 1436 | 3300050511 | nmdc:mga08y16_90657_c1 | nmdc:mga08y16_90657_c1_571_720 | 49 |
| 1437 | 3300050512 | nmdc:mga0n895_1135537_c1 | nmdc:mga0n895_1135537_c1_468_623 | 49 |
| 1438 | 3300050512 | nmdc:mga0n895_1910895_c1 | nmdc:mga0n895_1910895_c1_390_539 | 49 |
| 1439 | 3300050512 | nmdc:mga0n895_2014993_c1 | nmdc:mga0n895_2014993_c1_60_212 | 49 |
| 1440 | 3300050512 | nmdc:mga0n895_397902_c1 | nmdc:mga0n895_397902_c1_949_1101 | 49 |
| 1441 | 3300050513 | nmdc:mga0rr50_1239469_c1 | nmdc:mga0rr50_1239469_c1_277_426 | 49 |
| 1442 | 3300050513 | nmdc:mga0rr50_1551797_c1 | nmdc:mga0rr50_1551797_c1_343_498 | 49 |
| 1443 | 3300050513 | nmdc:mga0rr50_1641393_c1 | nmdc:mga0rr50_1641393_c1_195_353 | 49 |
| 1444 | 3300050514 | nmdc:mga08x19_172659_c1 | nmdc:mga08x19_172659_c1_1231_1383 | 49 |
| 1445 | 3300050515 | nmdc:mga0a205_1454072_c1 | nmdc:mga0a205_1454072_c1_152_301 | 49 |
| 1446 | 3300050515 | nmdc:mga0a205_322471_c1 | nmdc:mga0a205_322471_c1_101_250 | 49 |
| 1447 | 3300050515 | nmdc:mga0a205_811202_c1 | nmdc:mga0a205_811202_c1_316_471 | 49 |
| 1448 | 3300050515 | nmdc:mga0a205_968792_c1 | nmdc:mga0a205_968792_c1_130_285 | 49 |
| 1449 | 3300053084 | Ga0495595_0288838 | Ga0495595_0288838_530_682 | 49 |
| 1450 | 3300053094 | Ga0500566_0442418 | Ga0500566_0442418_254_403 | 49 |
| 1451 | 3300053133 | Ga0500655_043141 | Ga0500655_043141_547_696 | 49 |
| 1452 | 3300053160 | Ga0500633_0195074 | Ga0500633_0195074_250_399 | 49 |
| 1453 | 3300054114 | Ga0501084_0499091 | Ga0501084_0499091_68_217 | 49 |
| 1454 | 3300054114 | Ga0501084_0618811 | Ga0501084_0618811_98_247 | 49 |
| 1455 | 3300054114 | Ga0501084_0732282 | Ga0501084_0732282_208_357 | 49 |
| 1456 | 3300059477 | Ga0587084_077701 | Ga0587084_077701_467_619 | 49 |
| 1457 | 3300059478 | Ga0587093_012631 | Ga0587093_012631_335_490 | 49 |
| 1458 | 3300059490 | Ga0587066_011939 | Ga0587066_011939_758_913 | 49 |
| 1459 | 3300059490 | Ga0587066_064411 | Ga0587066_064411_28_180 | 49 |
| 1460 | 3300059491 | Ga0587070_018263 | Ga0587070_018263_929_1084 | 49 |
| 1461 | 3300059491 | Ga0587070_235916 | Ga0587070_235916_331_483 | 49 |
| 1462 | 3300059492 | Ga0587073_0022772 | Ga0587073_0022772_1039_1191 | 49 |
| 1463 | 3300059492 | Ga0587073_0028789 | Ga0587073_0028789_600_755 | 49 |
| 1464 | 3300059493 | Ga0587077_009896 | Ga0587077_009896_953_1108 | 49 |
| 1465 | 3300059493 | Ga0587077_105433 | Ga0587077_105433_514_666 | 49 |
| 1466 | 3300059503 | Ga0587080_056529 | Ga0587080_056529_291_446 | 49 |
| 1467 | 3300059503 | Ga0587080_180120 | Ga0587080_180120_328_480 | 49 |
| 1468 | 3300059504 | Ga0587082_028075 | Ga0587082_028075_765_920 | 49 |
| 1469 | 3300059504 | Ga0587082_057398 | Ga0587082_057398_585_737 | 49 |
| 1470 | 3300059505 | Ga0587083_0008633 | Ga0587083_0008633_339_494 | 49 |
| 1471 | 3300059505 | Ga0587083_0079236 | Ga0587083_0079236_25_177 | 49 |
| 1472 | 3300059506 | Ga0587085_003167 | Ga0587085_003167_1585_1737 | 49 |
| 1473 | 3300059507 | Ga0587086_006977 | Ga0587086_006977_1105_1257 | 49 |
| 1474 | 3300059507 | Ga0587086_038159 | Ga0587086_038159_22_174 | 49 |
| 1475 | 3300059508 | Ga0587088_019415 | Ga0587088_019415_940_1092 | 49 |
| 1476 | 3300059508 | Ga0587088_036209 | Ga0587088_036209_373_528 | 49 |
| 1477 | 3300059509 | Ga0587089_015927 | Ga0587089_015927_820_972 | 49 |
| 1478 | 3300059509 | Ga0587089_021932 | Ga0587089_021932_291_446 | 49 |
| 1479 | 3300059509 | Ga0587089_058658 | Ga0587089_058658_22_174 | 49 |
| 1480 | 3300059510 | Ga0587090_022559 | Ga0587090_022559_25_177 | 49 |
| 1481 | 3300059510 | Ga0587090_036723 | Ga0587090_036723_375_530 | 49 |
| 1482 | 3300059511 | Ga0587091_014316 | Ga0587091_014316_749_904 | 49 |
| 1483 | 3300059511 | Ga0587091_139962 | Ga0587091_139962_25_177 | 49 |
| 1484 | 3300059511 | Ga0587091_208683 | Ga0587091_208683_28_180 | 49 |
| 1485 | 3300059512 | Ga0587092_024928 | Ga0587092_024928_44_199 | 49 |
| 1486 | 3300059512 | Ga0587092_047651 | Ga0587092_047651_590_742 | 49 |
| 1487 | 3300059513 | Ga0587094_009876 | Ga0587094_009876_25_177 | 49 |
| 1488 | 3300059513 | Ga0587094_030814 | Ga0587094_030814_310_465 | 49 |
| 1489 | 3300059513 | Ga0587094_066924 | Ga0587094_066924_462_614 | 49 |
| 1490 | 3300059604 | Ga0587098_019251 | Ga0587098_019251_291_446 | 49 |
| 1491 | 3300059605 | Ga0587106_013849 | Ga0587106_013849_339_494 | 49 |
| 1492 | 3300059605 | Ga0587106_141192 | Ga0587106_141192_351_503 | 49 |
| 1493 | 3300059622 | Ga0587099_063986 | Ga0587099_063986_44_199 | 49 |
| 1494 | 3300059623 | Ga0587101_011992 | Ga0587101_011992_62_214 | 49 |
| 1495 | 3300059623 | Ga0587101_035396 | Ga0587101_035396_305_460 | 49 |
| 1496 | 3300059624 | Ga0587109_214206 | Ga0587109_214206_307_462 | 49 |
| 1497 | 3300059625 | Ga0587113_006489 | Ga0587113_006489_25_177 | 49 |
| 1498 | 3300059630 | Ga0587128_008914 | Ga0587128_008914_724_876 | 49 |
| 1499 | 3300059630 | Ga0587128_098881 | Ga0587128_098881_27_179 | 49 |
| 1500 | 3300059631 | Ga0587130_017039 | Ga0587130_017039_590_742 | 49 |
| 1501 | 3300059639 | Ga0587062_129511 | Ga0587062_129511_43_198 | 49 |
| 1502 | 3300059640 | Ga0587067_020773 | Ga0587067_020773_363_518 | 49 |
| 1503 | 3300059640 | Ga0587067_030361 | Ga0587067_030361_25_177 | 49 |
| 1504 | 3300059641 | Ga0587068_087177 | Ga0587068_087177_22_174 | 49 |
| 1505 | 3300059642 | Ga0587069_009019 | Ga0587069_009019_371_526 | 49 |
| 1506 | 3300059643 | Ga0587072_031409 | Ga0587072_031409_24_176 | 49 |
| 1507 | 3300059644 | Ga0587075_010783 | Ga0587075_010783_1039_1191 | 49 |
| 1508 | 3300059644 | Ga0587075_030657 | Ga0587075_030657_311_466 | 49 |
| 1509 | 3300059645 | Ga0587076_021837 | Ga0587076_021837_335_490 | 49 |
| 1510 | 3300059646 | Ga0587078_026380 | Ga0587078_026380_585_737 | 49 |
| 1511 | 3300059647 | Ga0587079_064066 | Ga0587079_064066_295_450 | 49 |
| 1512 | 3300059647 | Ga0587079_196547 | Ga0587079_196547_22_174 | 49 |
| 1513 | 3300059649 | Ga0587102_045429 | Ga0587102_045429_327_482 | 49 |
| 1514 | 3300059651 | Ga0587105_007098 | Ga0587105_007098_275_430 | 49 |
| 1515 | 3300059651 | Ga0587105_032989 | Ga0587105_032989_330_482 | 49 |
| 1516 | 3300059652 | Ga0587107_145130 | Ga0587107_145130_282_437 | 49 |
| 1517 | 3300059655 | Ga0587114_016168 | Ga0587114_016168_820_972 | 49 |
| 1518 | 3300059655 | Ga0587114_042778 | Ga0587114_042778_213_368 | 49 |
| 1519 | 3300059658 | Ga0587119_031462 | Ga0587119_031462_551_703 | 49 |
| 1520 | 3300060344 | Ga0587071_026707 | Ga0587071_026707_364_519 | 49 |
| 1521 | 3300060353 | Ga0501082_0000001 | Ga0501082_0000001_15881_16033 | 49 |
| 1522 | 3300060353 | Ga0501082_0095630 | Ga0501082_0095630_1417_1566 | 49 |
| 1523 | 3300060353 | Ga0501082_0205791 | Ga0501082_0205791_96_245 | 49 |
| 1524 | 3300060353 | Ga0501082_0574090 | Ga0501082_0574090_783_932 | 49 |
| 1525 | 3300061734 | Ga0530510_0247811 | Ga0530510_0247811_782_931 | 49 |
| 1526 | 3300061734 | Ga0530510_0370195 | Ga0530510_0370195_506_655 | 49 |
| 1527 | 3300061734 | Ga0530510_0551709 | Ga0530510_0551709_167_316 | 49 |
| 1528 | 3300061734 | Ga0530510_1205250 | Ga0530510_1205250_343_492 | 49 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar