F494584

General Info

Members Datasets Scaffolds Average Seq Length
1528 454 1528 49

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0078362|Ga0451577_0078362_1637_1813
Length 58
Sequence LGANLKEVAMLNTIAVVLIILWLLGLVTSYTLGGFIHILLVIAXXXXLLRVIRGKPPL

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
6 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
7 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
8 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
9 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
10 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
18 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
19 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
21 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
24 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
40 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
53 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
54 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
55 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
56 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
57 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
58 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
59 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
60 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
61 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
62 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
63 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
64 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
65 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
66 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
67 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
68 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
69 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
70 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
71 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
72 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
73 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
74 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
75 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
76 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
77 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
78 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
79 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
80 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
81 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
82 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
83 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
84 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
85 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
86 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
87 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
88 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
89 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
90 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
91 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
92 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
93 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
94 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
95 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
96 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
97 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
98 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
99 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
100 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
101 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
102 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
103 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
104 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
105 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
106 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
107 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
108 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
109 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
110 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
112 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
113 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
114 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
115 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
116 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
117 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
118 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
119 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
120 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
121 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
122 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
123 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
124 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
125 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
126 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
127 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
128 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
129 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
130 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
131 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
132 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
133 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
134 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
135 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
136 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
137 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
138 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
139 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
140 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
141 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
142 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
143 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
144 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
145 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
146 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
147 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
148 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
149 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
150 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
151 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
152 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
153 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
154 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
155 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
156 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
157 3300019162 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300019190 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
160 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
161 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
162 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
163 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
164 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
165 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
166 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
167 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
168 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
170 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
171 3300023672 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
245 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
246 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
247 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
251 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
252 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
253 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
254 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
255 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
256 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
257 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
261 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
262 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
263 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
264 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
265 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
266 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
267 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
268 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
269 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
270 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
271 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
272 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
273 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
274 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
275 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
276 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
277 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
278 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
279 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
280 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
281 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
282 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
283 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
284 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
285 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
286 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
287 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
288 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
289 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
290 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
291 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
292 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
293 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
294 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
295 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
296 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
297 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
298 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
299 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
300 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
301 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
302 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
303 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
304 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
305 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
306 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
307 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
308 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
309 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
310 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
311 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
312 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
313 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
314 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
315 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
316 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
317 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
318 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
319 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
320 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
321 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
322 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
323 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
324 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
325 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
326 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
327 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
328 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
329 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
330 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
331 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
332 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
333 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
334 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
335 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
336 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
337 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
338 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
339 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
340 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
341 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
342 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
343 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
344 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
345 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
346 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
347 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
348 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
349 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
350 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
351 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
352 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
353 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
354 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
355 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
356 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
357 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
358 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
359 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
360 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
361 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
362 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
363 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
376 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
380 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
381 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
382 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
383 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
384 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
385 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
386 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
387 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
388 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
389 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
390 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
391 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
392 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
393 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
394 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
395 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
396 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
397 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
398 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
399 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
400 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
401 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
402 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
403 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
404 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
405 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
406 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
407 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
408 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
409 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
410 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
411 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
412 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
413 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
415 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
419 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
420 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
422 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
423 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
424 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
425 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
427 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
428 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
430 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
431 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
435 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
436 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
437 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
438 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
439 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
440 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
441 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
442 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
443 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
444 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
445 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
446 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
447 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
448 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
449 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
450 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
451 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
452 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
453 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
454 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.64
Metatranscriptomes 9.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.65
Nodule 0
Rhizoplane 2.36
Rhizosphere 96.07
Stem 0
Stem Tuber 0
Unclassified 0.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_14242384 2162886012 Unclassified 826
2 MBSR1b_contig_8201409 2162886012 Unclassified 1149
3 JGI24746J21847_1029963 3300001977 Bacteria 750
4 JGI24746J21847_1043975 3300001977 Bacteria 623
5 JGI24737J22298_10024215 3300001990 Bacteria 1922
6 JGI24743J22301_10006758 3300001991 Bacteria 1967
7 JGI24750J21931_1028019 3300002070 Bacteria 817
8 JGI24745J21846_1020836 3300002073 Bacteria 770
9 JGI24749J21850_1070969 3300002076 Bacteria 538
10 JGI24035J26624_1004495 3300002126 Unclassified 1325
11 JGI24035J26624_1005983 3300002126 Bacteria 1170
12 JGI24033J26618_1012705 3300002155 Bacteria 1016
13 JGI25150J39212_1003133 3300002774 Bacteria 3940
14 rootH1_10117195 3300003323 Bacteria 2045
15 rootH1_10386370 3300003323 Bacteria 1316
16 Ga0007416J51690_1082995 3300003577 Unclassified 568
17 Ga0007416J51690_1087572 3300003577 Unclassified 515
18 Ga0007429J51699_1116211 3300003579 Unclassified 542
19 Ga0032354_1066680 3300003693 Unclassified 1500
20 Ga0006780_1035515 3300003735 Unclassified 665
21 JGI25405J52794_10002815 3300003911 Unclassified 3018
22 JGI25405J52794_10091519 3300003911 Bacteria 674
23 Ga0058859_10573809 3300004798 Unclassified 578
24 Ga0058863_11637505 3300004799 Unclassified 528
25 Ga0058861_12064034 3300004800 Unclassified 513
26 Ga0058860_10830546 3300004801 Unclassified 573
27 Ga0058860_11908751 3300004801 Unclassified 788
28 Ga0058862_10065783 3300004803 Unclassified 595
29 Ga0065704_10458354 3300005289 Unclassified 699
30 Ga0065704_10507344 3300005289 Bacteria 663
31 Ga0065712_10048891 3300005290 Unclassified 727
32 Ga0065712_10069346 3300005290 Bacteria 7486
33 Ga0065712_10240498 3300005290 Unclassified 985
34 Ga0065712_10259197 3300005290 Unclassified 941
35 Ga0065715_10001014 3300005293 Bacteria 7370
36 Ga0065715_10102904 3300005293 Bacteria 3073
37 Ga0065715_10182618 3300005293 Bacteria 1466
38 Ga0065715_10290619 3300005293 Unclassified 1046
39 Ga0065715_10372329 3300005293 Unclassified 919
40 Ga0065715_10674335 3300005293 Unclassified 665
41 Ga0065707_10046903 3300005295 Bacteria 936
42 Ga0065707_10087756 3300005295 Bacteria 4900
43 Ga0065707_10374149 3300005295 Unclassified 886
44 Ga0065707_10674810 3300005295 Bacteria 651
45 Ga0070658_10076572 3300005327 Bacteria 2743
46 Ga0070658_10095655 3300005327 Bacteria 2452
47 Ga0070658_11807841 3300005327 Bacteria 528
48 Ga0070676_10000418 3300005328 Bacteria 20037
49 Ga0070676_10522339 3300005328 Bacteria 846
50 Ga0070676_10623758 3300005328 Unclassified 780
51 Ga0070676_10801171 3300005328 Viruses 695
52 Ga0070676_10853742 3300005328 Bacteria 675
53 Ga0070683_100010649 3300005329 Bacteria 7905
54 Ga0070683_100017263 3300005329 Bacteria 6377
55 Ga0070683_100027215 3300005329 Bacteria 5156
56 Ga0070683_100079856 3300005329 Bacteria 3062
57 Ga0070683_100134395 3300005329 Bacteria 2342
58 Ga0070683_100343424 3300005329 Bacteria 1421
59 Ga0070683_100883903 3300005329 Bacteria 857
60 Ga0070690_100043378 3300005330 Unclassified 2852
61 Ga0070690_100558308 3300005330 Unclassified 864
62 Ga0070670_100011058 3300005331 Bacteria 7711
63 Ga0070670_100074116 3300005331 Bacteria 2923
64 Ga0070677_10007365 3300005333 Bacteria 3670
65 Ga0068869_100054842 3300005334 Bacteria 2903
66 Ga0068869_100203957 3300005334 Bacteria 1560
67 Ga0068869_100254504 3300005334 Bacteria 1404
68 Ga0068869_100945966 3300005334 Unclassified 748
69 Ga0068869_101202165 3300005334 Unclassified 666
70 Ga0068869_101935665 3300005334 Unclassified 529
71 Ga0070666_10005575 3300005335 Bacteria 7721
72 Ga0070666_10016515 3300005335 Bacteria 4722
73 Ga0070666_10127985 3300005335 Bacteria 1763
74 Ga0070666_11180931 3300005335 Bacteria 570
75 Ga0070680_100300048 3300005336 Bacteria 1362
76 Ga0070680_100859935 3300005336 Unclassified 782
77 Ga0070682_100055437 3300005337 Bacteria 2489
78 Ga0068868_100003887 3300005338 Bacteria 10437
79 Ga0068868_100022957 3300005338 Bacteria 4717
80 Ga0068868_100031456 3300005338 Bacteria 4076
81 Ga0068868_100035075 3300005338 Bacteria 3876
82 Ga0068868_100175841 3300005338 Bacteria 1774
83 Ga0068868_101119674 3300005338 Bacteria 725
84 Ga0068868_101215670 3300005338 Unclassified 697
85 Ga0070660_100012509 3300005339 Bacteria 6062
86 Ga0070660_100258012 3300005339 Unclassified 1423
87 Ga0070660_100315672 3300005339 Bacteria 1283
88 Ga0070689_100000951 3300005340 Bacteria 18036
89 Ga0070689_100008894 3300005340 Bacteria 7100
90 Ga0070689_100056957 3300005340 Bacteria 3032
91 Ga0070689_100088561 3300005340 Bacteria 2437
92 Ga0070691_10243083 3300005341 Bacteria 962
93 Ga0070691_10456613 3300005341 Bacteria 730
94 Ga0070687_100000361 3300005343 Bacteria 15538
95 Ga0070687_100021338 3300005343 Bacteria 3042
96 Ga0070687_100040095 3300005343 Unclassified 2358
97 Ga0070661_100006977 3300005344 Bacteria 7797
98 Ga0070661_100030810 3300005344 Bacteria 3876
99 Ga0070661_100033886 3300005344 Bacteria 3702
100 Ga0070661_100694709 3300005344 Bacteria 829
101 Ga0070692_10644261 3300005345 Bacteria 706
102 Ga0070692_10715442 3300005345 Bacteria 675
103 Ga0070668_100001339 3300005347 Bacteria 17602
104 Ga0070668_100011324 3300005347 Bacteria 6644
105 Ga0070668_100087415 3300005347 Bacteria 2453
106 Ga0070669_100003769 3300005353 Bacteria 10950
107 Ga0070669_100010101 3300005353 Bacteria 6714
108 Ga0070669_100062749 3300005353 Bacteria 2733
109 Ga0070669_100665988 3300005353 Unclassified 877
110 Ga0070669_101335342 3300005353 Bacteria 621
111 Ga0070675_100000360 3300005354 Bacteria 30832
112 Ga0070675_100004745 3300005354 Bacteria 10373
113 Ga0070675_100112789 3300005354 Unclassified 2302
114 Ga0070671_100002249 3300005355 Bacteria 14908
115 Ga0070671_100067121 3300005355 Bacteria 2990
116 Ga0070671_100102517 3300005355 Bacteria 2401
117 Ga0070671_100211683 3300005355 Bacteria 1644
118 Ga0070671_101486856 3300005355 Unclassified 599
119 Ga0070671_101751211 3300005355 Unclassified 552
120 Ga0070671_101848539 3300005355 Unclassified 537
121 Ga0070671_102113366 3300005355 Bacteria 502
122 Ga0070674_100009313 3300005356 Bacteria 5879
123 Ga0070674_101635160 3300005356 Unclassified 581
124 Ga0070674_101795797 3300005356 Unclassified 556
125 Ga0070673_100059046 3300005364 Bacteria 3035
126 Ga0070673_100068950 3300005364 Unclassified 2833
127 Ga0070673_100169580 3300005364 Unclassified 1862
128 Ga0070673_100170740 3300005364 Bacteria 1856
129 Ga0070673_100941656 3300005364 Unclassified 802
130 Ga0070688_100018693 3300005365 Bacteria 4004
131 Ga0070688_100071906 3300005365 Bacteria 2215
132 Ga0070688_100207675 3300005365 Bacteria 1373
133 Ga0070659_100001731 3300005366 Bacteria 15673
134 Ga0070659_100065735 3300005366 Bacteria 2872
135 Ga0070659_100191439 3300005366 Bacteria 1681
136 Ga0070659_101927678 3300005366 Unclassified 530
137 Ga0070667_100001138 3300005367 Bacteria 24198
138 Ga0070667_100003924 3300005367 Bacteria 12635
139 Ga0070667_100120314 3300005367 Unclassified 2283
140 Ga0070667_100377286 3300005367 Unclassified 1287
141 Ga0070667_101261312 3300005367 Bacteria 692
142 Ga0070703_10129289 3300005406 Bacteria 926
143 Ga0070709_10097351 3300005434 Unclassified 1953
144 Ga0070709_10115928 3300005434 Bacteria 1808
145 Ga0070709_10134276 3300005434 Unclassified 1693
146 Ga0070709_10426617 3300005434 Bacteria 995
147 Ga0070709_10426931 3300005434 Unclassified 994
148 Ga0070714_100028342 3300005435 Unclassified 4645
149 Ga0070714_100475561 3300005435 Unclassified 1189
150 Ga0070714_100648771 3300005435 Bacteria 1016
151 Ga0070714_101336297 3300005435 Unclassified 700
152 Ga0070713_100047807 3300005436 Bacteria 3519
153 Ga0070713_100678121 3300005436 Unclassified 983
154 Ga0070710_10051355 3300005437 Unclassified 2314
155 Ga0070710_10994818 3300005437 Unclassified 611
156 Ga0070710_11494080 3300005437 Unclassified 507
157 Ga0070701_10027101 3300005438 Unclassified 2803
158 Ga0070701_10410704 3300005438 Bacteria 860
159 Ga0070711_101121249 3300005439 Unclassified 678
160 Ga0070711_102060469 3300005439 Unclassified 502
161 Ga0070705_100047803 3300005440 Bacteria 2475
162 Ga0070705_100066937 3300005440 Bacteria 2156
163 Ga0070705_100074876 3300005440 Bacteria 2060
164 Ga0070705_100138765 3300005440 Bacteria 1597
165 Ga0070705_100563672 3300005440 Bacteria 875
166 Ga0070705_100589801 3300005440 Bacteria 858
167 Ga0070705_100864064 3300005440 Bacteria 725
168 Ga0070705_101957723 3300005440 Unclassified 500
169 Ga0070700_100009155 3300005441 Bacteria 5427
170 Ga0070700_100102198 3300005441 Bacteria 1890
171 Ga0070700_101559147 3300005441 Bacteria 563
172 Ga0070694_100050845 3300005444 Bacteria 2795
173 Ga0070694_100074804 3300005444 Bacteria 2342
174 Ga0070694_100666426 3300005444 Bacteria 843
175 Ga0070694_100828183 3300005444 Bacteria 760
176 Ga0070694_100853483 3300005444 Bacteria 749
177 Ga0070708_100012156 3300005445 Bacteria 7018
178 Ga0070708_100114605 3300005445 Bacteria 2480
179 Ga0070708_100205571 3300005445 Bacteria 1844
180 Ga0070708_100738985 3300005445 Bacteria 925
181 Ga0070708_100895387 3300005445 Bacteria 833
182 Ga0070708_101623374 3300005445 Unclassified 602
183 Ga0070663_100159601 3300005455 Bacteria 1735
184 Ga0070678_101290683 3300005456 Unclassified 679
185 Ga0070678_102057956 3300005456 Unclassified 540
186 Ga0070662_100000570 3300005457 Bacteria 22495
187 Ga0070662_100006539 3300005457 Bacteria 7520
188 Ga0070662_100016016 3300005457 Bacteria 5030
189 Ga0070662_100105636 3300005457 Bacteria 2138
190 Ga0070681_10014963 3300005458 Bacteria 7715
191 Ga0070681_10075591 3300005458 Bacteria 3328
192 Ga0068867_100025103 3300005459 Bacteria 4275
193 Ga0068867_100169271 3300005459 Bacteria 1729
194 Ga0068867_100701556 3300005459 Bacteria 893
195 Ga0068867_100945807 3300005459 Bacteria 778
196 Ga0068867_101424476 3300005459 Unclassified 643
197 Ga0070685_10034317 3300005466 Bacteria 2857
198 Ga0070706_100021634 3300005467 Bacteria 5923
199 Ga0070706_100201862 3300005467 Bacteria 1857
200 Ga0070706_100428084 3300005467 Bacteria 1232
201 Ga0070706_100573863 3300005467 Unclassified 1049
202 Ga0070706_100829556 3300005467 Bacteria 855
203 Ga0070706_101135363 3300005467 Bacteria 719
204 Ga0070707_100007972 3300005468 Bacteria 9837
205 Ga0070707_100098485 3300005468 Unclassified 2832
206 Ga0070707_100146787 3300005468 Bacteria 2296
207 Ga0070707_100354881 3300005468 Bacteria 1424
208 Ga0070707_101004367 3300005468 Bacteria 800
209 Ga0070707_101289453 3300005468 Unclassified 697
210 Ga0070707_101433484 3300005468 Bacteria 657
211 Ga0070698_100045677 3300005471 Bacteria 4482
212 Ga0070698_100180208 3300005471 Bacteria 2051
213 Ga0070698_101228981 3300005471 Unclassified 699
214 Ga0070698_101537069 3300005471 Bacteria 617
215 Ga0070698_101985517 3300005471 Bacteria 535
216 Ga0070698_102180058 3300005471 Bacteria 508
217 Ga0070699_100012669 3300005518 Bacteria 7273
218 Ga0070699_100181860 3300005518 Bacteria 1866
219 Ga0070699_100713643 3300005518 Unclassified 916
220 Ga0070699_101330689 3300005518 Bacteria 659
221 Ga0070699_101361395 3300005518 Unclassified 651
222 Ga0070699_102158714 3300005518 Bacteria 508
223 Ga0070679_100002344 3300005530 Bacteria 17138
224 Ga0070679_100004021 3300005530 Bacteria 13549
225 Ga0070679_100623111 3300005530 Bacteria 1022
226 Ga0070679_101453141 3300005530 Bacteria 632
227 Ga0070684_100000110 3300005535 Bacteria 53697
228 Ga0070684_100000523 3300005535 Bacteria 26285
229 Ga0070684_100015073 3300005535 Bacteria 6282
230 Ga0070684_100070037 3300005535 Bacteria 3085
231 Ga0070684_100071702 3300005535 Bacteria 3048
232 Ga0070684_100105770 3300005535 Bacteria 2518
233 Ga0070684_100265868 3300005535 Bacteria 1569
234 Ga0070684_101072016 3300005535 Bacteria 757
235 Ga0070697_100003151 3300005536 Bacteria 12680
236 Ga0070697_100075581 3300005536 Bacteria 2769
237 Ga0070697_100081548 3300005536 Bacteria 2666
238 Ga0070697_101062637 3300005536 Unclassified 720
239 Ga0070697_101217611 3300005536 Bacteria 671
240 Ga0070697_101302716 3300005536 Unclassified 648
241 Ga0068853_100002222 3300005539 Bacteria 14509
242 Ga0068853_100011324 3300005539 Bacteria 7242
243 Ga0068853_100024353 3300005539 Bacteria 5073
244 Ga0068853_100109926 3300005539 Bacteria 2448
245 Ga0070672_100005622 3300005543 Bacteria 8339
246 Ga0070672_100221563 3300005543 Bacteria 1587
247 Ga0070672_100269157 3300005543 Unclassified 1438
248 Ga0070686_100006667 3300005544 Bacteria 6429
249 Ga0070686_100052436 3300005544 Bacteria 2601
250 Ga0070686_100140984 3300005544 Bacteria 1678
251 Ga0070686_100354272 3300005544 Bacteria 1104
252 Ga0070686_100594547 3300005544 Unclassified 871
253 Ga0070686_101267599 3300005544 Unclassified 614
254 Ga0070695_100001859 3300005545 Bacteria 11921
255 Ga0070695_100506255 3300005545 Bacteria 935
256 Ga0070695_100752721 3300005545 Bacteria 777
257 Ga0070695_101899311 3300005545 Unclassified 500
258 Ga0070696_100061380 3300005546 Bacteria 2630
259 Ga0070696_100594979 3300005546 Unclassified 891
260 Ga0070696_100781220 3300005546 Bacteria 785
261 Ga0070696_101515178 3300005546 Unclassified 574
262 Ga0070696_101739384 3300005546 Bacteria 538
263 Ga0070693_100414386 3300005547 Bacteria 937
264 Ga0070665_100031101 3300005548 Bacteria 5373
265 Ga0070665_100045170 3300005548 Bacteria 4424
266 Ga0070665_100422681 3300005548 Bacteria 1341
267 Ga0070665_101128229 3300005548 Bacteria 795
268 Ga0070704_100044846 3300005549 Bacteria 3075
269 Ga0070704_100102942 3300005549 Bacteria 2156
270 Ga0070704_100200404 3300005549 Bacteria 1611
271 Ga0070704_100511688 3300005549 Bacteria 1043
272 Ga0070704_100580010 3300005549 Unclassified 983
273 Ga0070704_101724708 3300005549 Bacteria 579
274 Ga0068855_100009737 3300005563 Bacteria 11593
275 Ga0068855_100033699 3300005563 Bacteria 6110
276 Ga0068855_100116447 3300005563 Bacteria 3063
277 Ga0070664_100061800 3300005564 Bacteria 3193
278 Ga0070664_100175364 3300005564 Bacteria 1903
279 Ga0070664_100198634 3300005564 Bacteria 1789
280 Ga0070664_100337093 3300005564 Bacteria 1369
281 Ga0070664_100522606 3300005564 Unclassified 1096
282 Ga0068857_100035905 3300005577 Bacteria 4391
283 Ga0068857_100154280 3300005577 Unclassified 2082
284 Ga0068857_100220699 3300005577 Bacteria 1731
285 Ga0068857_100323360 3300005577 Bacteria 1425
286 Ga0068857_100994560 3300005577 Bacteria 807
287 Ga0068857_101416477 3300005577 Bacteria 676
288 Ga0068857_102259923 3300005577 Bacteria 534
289 Ga0068857_102300266 3300005577 Unclassified 529
290 Ga0068854_100049779 3300005578 Bacteria 2995
291 Ga0068854_100055299 3300005578 Bacteria 2856
292 Ga0068854_100151666 3300005578 Bacteria 1788
293 Ga0068854_100609558 3300005578 Unclassified 933
294 Ga0068856_100003860 3300005614 Bacteria 15040
295 Ga0068856_100031074 3300005614 Bacteria 5223
296 Ga0068856_100130357 3300005614 Bacteria 2519
297 Ga0068856_100199016 3300005614 Bacteria 2018
298 Ga0068856_100305611 3300005614 Unclassified 1608
299 Ga0070702_100025832 3300005615 Unclassified 3151
300 Ga0070702_100605280 3300005615 Bacteria 822
301 Ga0070702_100992685 3300005615 Bacteria 664
302 Ga0070702_101722606 3300005615 Bacteria 521
303 Ga0068852_100009188 3300005616 Bacteria 7325
304 Ga0068852_100035207 3300005616 Bacteria 4174
305 Ga0068852_100067942 3300005616 Unclassified 3117
306 Ga0068852_100195988 3300005616 Bacteria 1909
307 Ga0068852_100295585 3300005616 Bacteria 1566
308 Ga0068852_100425841 3300005616 Unclassified 1310
309 Ga0068852_100613478 3300005616 Bacteria 1093
310 Ga0068859_100023227 3300005617 Bacteria 6223
311 Ga0068859_100045876 3300005617 Bacteria 4390
312 Ga0068859_100063366 3300005617 Bacteria 3728
313 Ga0068859_100070965 3300005617 Bacteria 3518
314 Ga0068859_100114165 3300005617 Bacteria 2765
315 Ga0068859_100202971 3300005617 Bacteria 2067
316 Ga0068859_100420258 3300005617 Unclassified 1433
317 Ga0068859_100453774 3300005617 Bacteria 1378
318 Ga0068859_101826801 3300005617 Unclassified 671
319 Ga0068864_100003454 3300005618 Bacteria 13051
320 Ga0068864_100095270 3300005618 Unclassified 2632
321 Ga0068864_100276103 3300005618 Bacteria 1567
322 Ga0068864_100276154 3300005618 Bacteria 1567
323 Ga0068864_101146903 3300005618 Bacteria 775
324 Ga0068864_101169306 3300005618 Bacteria 767
325 Ga0068864_102530584 3300005618 Unclassified 519
326 Ga0068866_10009452 3300005718 Bacteria 4140
327 Ga0068866_10361479 3300005718 Bacteria 925
328 Ga0068866_10428845 3300005718 Unclassified 859
329 Ga0068861_100048419 3300005719 Bacteria 3213
330 Ga0068861_100054073 3300005719 Unclassified 3057
331 Ga0068861_100069321 3300005719 Bacteria 2728
332 Ga0068861_100077089 3300005719 Bacteria 2599
333 Ga0068861_100124289 3300005719 Bacteria 2085
334 Ga0068861_100478422 3300005719 Bacteria 1121
335 Ga0068861_102125696 3300005719 Unclassified 562
336 Ga0068861_102564558 3300005719 Bacteria 513
337 Ga0068851_10007988 3300005834 Bacteria 4878
338 Ga0068851_10029576 3300005834 Bacteria 2713
339 Ga0068851_10042166 3300005834 Bacteria 2297
340 Ga0068851_10191976 3300005834 Bacteria 1136
341 Ga0068851_10256774 3300005834 Bacteria 993
342 Ga0068870_10034678 3300005840 Unclassified 2583
343 Ga0068870_10576209 3300005840 Bacteria 761
344 Ga0068863_100000974 3300005841 Bacteria 28785
345 Ga0068863_100007127 3300005841 Bacteria 10964
346 Ga0068863_100106002 3300005841 Unclassified 2674
347 Ga0068863_100157606 3300005841 Bacteria 2174
348 Ga0068863_100235298 3300005841 Bacteria 1767
349 Ga0068863_100272384 3300005841 Bacteria 1639
350 Ga0068863_100853902 3300005841 Bacteria 909
351 Ga0068863_101001834 3300005841 Bacteria 838
352 Ga0068858_100002623 3300005842 Bacteria 18113
353 Ga0068858_100012503 3300005842 Bacteria 8007
354 Ga0068858_100062288 3300005842 Bacteria 3449
355 Ga0068858_100077532 3300005842 Unclassified 3087
356 Ga0068858_100178109 3300005842 Bacteria 2006
357 Ga0068858_100327128 3300005842 Bacteria 1466
358 Ga0068858_101950348 3300005842 Unclassified 580
359 Ga0068860_100001412 3300005843 Bacteria 26033
360 Ga0068860_100004098 3300005843 Bacteria 14935
361 Ga0068860_100005238 3300005843 Bacteria 13169
362 Ga0068860_100025320 3300005843 Bacteria 5726
363 Ga0068860_100027817 3300005843 Bacteria 5445
364 Ga0068860_100197113 3300005843 Bacteria 1951
365 Ga0068860_100405120 3300005843 Bacteria 1350
366 Ga0068860_101448991 3300005843 Unclassified 708
367 Ga0068862_100013065 3300005844 Bacteria 6868
368 Ga0068862_100023721 3300005844 Bacteria 5142
369 Ga0068862_100095688 3300005844 Bacteria 2591
370 Ga0068862_100957557 3300005844 Bacteria 844
371 Ga0068862_101757105 3300005844 Bacteria 629
372 Ga0068862_102311646 3300005844 Unclassified 549
373 Ga0081455_10000385 3300005937 Bacteria 58366
374 Ga0081455_10001418 3300005937 Bacteria 29680
375 Ga0081455_10057581 3300005937 Bacteria 3293
376 Ga0081455_10059526 3300005937 Bacteria 3225
377 Ga0081455_10165062 3300005937 Unclassified 1693
378 Ga0081455_10639067 3300005937 Bacteria 687
379 Ga0081455_10706022 3300005937 Bacteria 642
380 Ga0081455_10885070 3300005937 Unclassified 556
381 Ga0081455_10993195 3300005937 Unclassified 520
382 Ga0081539_10057340 3300005985 Bacteria 2156
383 Ga0081539_10131913 3300005985 Bacteria 1226
384 Ga0070717_10029027 3300006028 Unclassified 4434
385 Ga0070717_10739641 3300006028 Unclassified 894
386 Ga0070717_10768654 3300006028 Bacteria 876
387 Ga0075363_100216542 3300006048 Bacteria 1097
388 Ga0070715_10019964 3300006163 Unclassified 2577
389 Ga0070715_10024870 3300006163 Bacteria 2366
390 Ga0070715_10311046 3300006163 Unclassified 846
391 Ga0070715_10441016 3300006163 Unclassified 733
392 Ga0070715_11088471 3300006163 Unclassified 503
393 Ga0070716_100068870 3300006173 Bacteria 2072
394 Ga0070716_100261331 3300006173 Unclassified 1185
395 Ga0070716_100836321 3300006173 Unclassified 716
396 Ga0070716_101406932 3300006173 Unclassified 567
397 Ga0070712_100000422 3300006175 Bacteria 24266
398 Ga0070712_100065633 3300006175 Unclassified 2577
399 Ga0070712_100099079 3300006175 Bacteria 2151
400 Ga0070712_101054375 3300006175 Bacteria 705
401 Ga0070712_101724361 3300006175 Bacteria 548
402 Ga0075367_10048417 3300006178 Bacteria 2504
403 Ga0075366_10126873 3300006195 Bacteria 1539
404 Ga0075366_10844090 3300006195 Unclassified 570
405 Ga0097621_100001221 3300006237 Bacteria 17801
406 Ga0097621_100032768 3300006237 Bacteria 4132
407 Ga0097621_100039388 3300006237 Bacteria 3796
408 Ga0097621_100082439 3300006237 Bacteria 2678
409 Ga0097621_100115447 3300006237 Bacteria 2272
410 Ga0097621_100544276 3300006237 Unclassified 1056
411 Ga0097621_101517081 3300006237 Unclassified 636
412 Ga0075370_10295510 3300006353 Unclassified 963
413 Ga0068871_100000577 3300006358 Bacteria 25108
414 Ga0068871_100010141 3300006358 Bacteria 6858
415 Ga0068871_100024331 3300006358 Bacteria 4695
416 Ga0068871_100059020 3300006358 Bacteria 3125
417 Ga0068871_100097617 3300006358 Bacteria 2456
418 Ga0068871_101077505 3300006358 Unclassified 751
419 Ga0075428_100036788 3300006844 Bacteria 5390
420 Ga0075428_100113690 3300006844 Bacteria 2949
421 Ga0075428_100341508 3300006844 Bacteria 1608
422 Ga0075428_100396864 3300006844 Bacteria 1478
423 Ga0075428_101699616 3300006844 Unclassified 658
424 Ga0075428_101810421 3300006844 Unclassified 635
425 Ga0075430_100014611 3300006846 Bacteria 6687
426 Ga0075430_100326437 3300006846 Bacteria 1268
427 Ga0075430_100842435 3300006846 Unclassified 756
428 Ga0075431_100063943 3300006847 Bacteria 3798
429 Ga0075431_100105891 3300006847 Unclassified 2901
430 Ga0075431_101211909 3300006847 Unclassified 717
431 Ga0075431_101235827 3300006847 Unclassified 709
432 Ga0075431_102190820 3300006847 Unclassified 507
433 Ga0075433_10014786 3300006852 Bacteria 6388
434 Ga0075433_10148874 3300006852 Bacteria 2082
435 Ga0075433_10154580 3300006852 Bacteria 2041
436 Ga0075433_10234774 3300006852 Bacteria 1628
437 Ga0075433_10865416 3300006852 Unclassified 789
438 Ga0075434_100017000 3300006871 Bacteria 6999
439 Ga0075434_100025317 3300006871 Bacteria 5806
440 Ga0075434_100978976 3300006871 Bacteria 860
441 Ga0075434_101727921 3300006871 Unclassified 633
442 Ga0075434_102179227 3300006871 Unclassified 558
443 Ga0075434_102309116 3300006871 Unclassified 541
444 Ga0075429_100060513 3300006880 Bacteria 3298
445 Ga0075429_100129943 3300006880 Unclassified 2203
446 Ga0075429_100153736 3300006880 Bacteria 2015
447 Ga0075429_100433546 3300006880 Bacteria 1151
448 Ga0075429_101072315 3300006880 Bacteria 704
449 Ga0068865_100028781 3300006881 Unclassified 3680
450 Ga0068865_100407035 3300006881 Bacteria 1115
451 Ga0068865_101081183 3300006881 Unclassified 706
452 Ga0075436_100166357 3300006914 Bacteria 1556
453 Ga0075436_100721614 3300006914 Unclassified 739
454 Ga0097620_100023227 3300006931 Bacteria 6223
455 Ga0097620_100045876 3300006931 Bacteria 4390
456 Ga0097620_100063366 3300006931 Bacteria 3728
457 Ga0097620_100070969 3300006931 Bacteria 3518
458 Ga0097620_100114166 3300006931 Bacteria 2765
459 Ga0097620_100202947 3300006931 Bacteria 2067
460 Ga0097620_100420319 3300006931 Unclassified 1433
461 Ga0097620_100453800 3300006931 Bacteria 1378
462 Ga0097620_101826261 3300006931 Unclassified 671
463 Ga0075435_100033669 3300007076 Unclassified 4053
464 Ga0075435_101580545 3300007076 Unclassified 575
465 Ga0075435_101709217 3300007076 Unclassified 552
466 Ga0075435_101767320 3300007076 Unclassified 543
467 Ga0099794_10584615 3300007265 Bacteria 591
468 Ga0099795_10560745 3300007788 Bacteria 539
469 Ga0105251_10115959 3300009011 Bacteria 1218
470 Ga0105251_10146368 3300009011 Bacteria 1068
471 Ga0105251_10264346 3300009011 Bacteria 777
472 Ga0105250_10153247 3300009092 Unclassified 960
473 Ga0105240_10000873 3300009093 Bacteria 54313
474 Ga0105240_10001323 3300009093 Bacteria 42757
475 Ga0105240_10021506 3300009093 Bacteria 8578
476 Ga0105240_10365894 3300009093 Bacteria 1632
477 Ga0105240_11446721 3300009093 Bacteria 721
478 Ga0111539_10000371 3300009094 Bacteria 55543
479 Ga0111539_10027156 3300009094 Bacteria 6991
480 Ga0111539_10081568 3300009094 Bacteria 3804
481 Ga0111539_10126374 3300009094 Bacteria 2996
482 Ga0111539_10264066 3300009094 Bacteria 2004
483 Ga0111539_10396414 3300009094 Bacteria 1607
484 Ga0111539_10675155 3300009094 Unclassified 1203
485 Ga0111539_10738954 3300009094 Unclassified 1145
486 Ga0111539_13284353 3300009094 Unclassified 521
487 Ga0105245_10001718 3300009098 Bacteria 19959
488 Ga0105245_10003144 3300009098 Bacteria 14772
489 Ga0105245_10057252 3300009098 Bacteria 3505
490 Ga0105245_10070000 3300009098 Bacteria 3182
491 Ga0105245_10080585 3300009098 Bacteria 2974
492 Ga0105245_10466852 3300009098 Bacteria 1273
493 Ga0105245_10474382 3300009098 Bacteria 1263
494 Ga0105245_10931796 3300009098 Unclassified 911
495 Ga0105245_11195087 3300009098 Unclassified 808
496 Ga0105247_10001246 3300009101 Bacteria 18878
497 Ga0105247_10031295 3300009101 Bacteria 3229
498 Ga0105247_10091105 3300009101 Unclassified 1936
499 Ga0105247_10092475 3300009101 Bacteria 1921
500 Ga0105247_10131636 3300009101 Bacteria 1631
501 Ga0105247_11504603 3300009101 Unclassified 549
502 Ga0114129_10093669 3300009147 Bacteria 4161
503 Ga0114129_10124261 3300009147 Bacteria 3549
504 Ga0114129_10169692 3300009147 Bacteria 2975
505 Ga0114129_10365195 3300009147 Bacteria 1909
506 Ga0114129_10371602 3300009147 Bacteria 1890
507 Ga0114129_10517222 3300009147 Bacteria 1557
508 Ga0114129_11735592 3300009147 Unclassified 761
509 Ga0114129_12264923 3300009147 Unclassified 653
510 Ga0105243_10018079 3300009148 Bacteria 5334
511 Ga0105243_10053838 3300009148 Bacteria 3193
512 Ga0105243_10058538 3300009148 Bacteria 3071
513 Ga0105243_11070589 3300009148 Unclassified 813
514 Ga0105243_12059440 3300009148 Bacteria 606
515 Ga0105241_10000983 3300009174 Bacteria 21600
516 Ga0105241_10001736 3300009174 Bacteria 16550
517 Ga0105241_10003627 3300009174 Bacteria 11470
518 Ga0105241_10036225 3300009174 Bacteria 3712
519 Ga0105241_10112990 3300009174 Bacteria 2177
520 Ga0105241_10145484 3300009174 Bacteria 1934
521 Ga0105241_10875101 3300009174 Bacteria 832
522 Ga0105242_10018099 3300009176 Bacteria 5504
523 Ga0105242_10072872 3300009176 Bacteria 2854
524 Ga0105242_10213464 3300009176 Bacteria 1721
525 Ga0105242_10264618 3300009176 Bacteria 1555
526 Ga0105242_10634426 3300009176 Bacteria 1037
527 Ga0105242_11221675 3300009176 Bacteria 772
528 Ga0105242_12839912 3300009176 Unclassified 535
529 Ga0105248_10001935 3300009177 Bacteria 23010
530 Ga0105248_10014763 3300009177 Bacteria 8601
531 Ga0105248_10020929 3300009177 Bacteria 7250
532 Ga0105248_10143487 3300009177 Bacteria 2694
533 Ga0105248_10282450 3300009177 Unclassified 1869
534 Ga0105248_10363488 3300009177 Bacteria 1629
535 Ga0105248_10432666 3300009177 Bacteria 1482
536 Ga0105248_10459845 3300009177 Bacteria 1435
537 Ga0105248_11149280 3300009177 Bacteria 878
538 Ga0105248_11300185 3300009177 Bacteria 823
539 Ga0105248_11448541 3300009177 Bacteria 777
540 Ga0105248_12284891 3300009177 Unclassified 616
541 Ga0105237_10000686 3300009545 Bacteria 46922
542 Ga0105237_10015100 3300009545 Bacteria 8049
543 Ga0105237_10398531 3300009545 Bacteria 1381
544 Ga0105237_10459718 3300009545 Unclassified 1279
545 Ga0105237_10486843 3300009545 Bacteria 1240
546 Ga0105237_10669503 3300009545 Unclassified 1044
547 Ga0105237_12786388 3300009545 Unclassified 500
548 Ga0105238_10000083 3300009551 Bacteria 107423
549 Ga0105238_10001184 3300009551 Bacteria 26230
550 Ga0105238_10001626 3300009551 Bacteria 22494
551 Ga0105238_10019760 3300009551 Bacteria 6859
552 Ga0105238_10041026 3300009551 Bacteria 4689
553 Ga0105238_10436546 3300009551 Bacteria 1305
554 Ga0105238_10602847 3300009551 Bacteria 1106
555 Ga0105249_10000609 3300009553 Bacteria 32611
556 Ga0105249_10013478 3300009553 Bacteria 7218
557 Ga0105249_10078094 3300009553 Bacteria 3071
558 Ga0105249_10083043 3300009553 Bacteria 2981
559 Ga0105249_10787145 3300009553 Bacteria 1015
560 Ga0105249_11496378 3300009553 Unclassified 747
561 Ga0105249_12591396 3300009553 Bacteria 579
562 Ga0105249_12754685 3300009553 Unclassified 563
563 Ga0105239_10002607 3300010375 Bacteria 22823
564 Ga0105239_10004332 3300010375 Bacteria 17003
565 Ga0105239_10016054 3300010375 Bacteria 8287
566 Ga0105239_10026115 3300010375 Bacteria 6429
567 Ga0105239_10042846 3300010375 Bacteria 4960
568 Ga0105239_10301373 3300010375 Bacteria 1805
569 Ga0105239_13054485 3300010375 Bacteria 545
570 Ga0105239_13079762 3300010375 Unclassified 543
571 Ga0105246_10000993 3300011119 Bacteria 16283
572 Ga0157337_1032241 3300012483 Unclassified 542
573 Ga0157373_10083360 3300013100 Unclassified 2253
574 Ga0157373_10339331 3300013100 Bacteria 1071
575 Ga0157371_10121362 3300013102 Unclassified 1858
576 Ga0157371_10656553 3300013102 Unclassified 783
577 Ga0157370_10208379 3300013104 Bacteria 1812
578 Ga0157369_10004527 3300013105 Bacteria 16357
579 Ga0157369_10119802 3300013105 Bacteria 2793
580 Ga0157369_10121335 3300013105 Bacteria 2773
581 Ga0157369_11311204 3300013105 Bacteria 738
582 Ga0157374_10006274 3300013296 Bacteria 10080
583 Ga0157374_10011199 3300013296 Bacteria 7754
584 Ga0157374_10011244 3300013296 Bacteria 7741
585 Ga0157374_10030653 3300013296 Bacteria 4886
586 Ga0157374_10033159 3300013296 Bacteria 4710
587 Ga0157374_10146488 3300013296 Unclassified 2294
588 Ga0157374_10516282 3300013296 Bacteria 1200
589 Ga0157374_11578708 3300013296 Unclassified 680
590 Ga0157378_10004372 3300013297 Bacteria 12437
591 Ga0157378_10013267 3300013297 Bacteria 7203
592 Ga0157378_10059049 3300013297 Bacteria 3421
593 Ga0157378_10065400 3300013297 Unclassified 3255
594 Ga0157378_10127879 3300013297 Bacteria 2349
595 Ga0157378_10300240 3300013297 Bacteria 1554
596 Ga0157378_10435786 3300013297 Bacteria 1298
597 Ga0157378_10724458 3300013297 Bacteria 1016
598 Ga0157378_11203652 3300013297 Unclassified 797
599 Ga0157378_11394101 3300013297 Bacteria 744
600 Ga0157378_13294199 3300013297 Bacteria 502
601 Ga0157378_13302765 3300013297 Unclassified 501
602 Ga0163162_10002560 3300013306 Bacteria 17209
603 Ga0163162_10003473 3300013306 Bacteria 15059
604 Ga0163162_10006012 3300013306 Bacteria 11746
605 Ga0163162_10073177 3300013306 Bacteria 3483
606 Ga0163162_10080847 3300013306 Bacteria 3319
607 Ga0163162_10177007 3300013306 Bacteria 2259
608 Ga0163162_10217998 3300013306 Bacteria 2038
609 Ga0163162_10263694 3300013306 Bacteria 1854
610 Ga0163162_11031310 3300013306 Bacteria 931
611 Ga0157372_10012613 3300013307 Bacteria 8999
612 Ga0157372_10012966 3300013307 Bacteria 8889
613 Ga0157372_10025051 3300013307 Bacteria 6483
614 Ga0157372_10027734 3300013307 Bacteria 6172
615 Ga0157372_10045286 3300013307 Bacteria 4879
616 Ga0157372_11258751 3300013307 Unclassified 854
617 Ga0157375_10000912 3300013308 Bacteria 25698
618 Ga0157375_10028226 3300013308 Bacteria 5257
619 Ga0157375_10088269 3300013308 Bacteria 3155
620 Ga0157375_10842351 3300013308 Bacteria 1064
621 Ga0157375_11665472 3300013308 Bacteria 755
622 Ga0157375_11777540 3300013308 Bacteria 731
623 Ga0163163_10000990 3300014325 Bacteria 24033
624 Ga0163163_10029024 3300014325 Bacteria 5318
625 Ga0163163_10062006 3300014325 Bacteria 3705
626 Ga0163163_10848919 3300014325 Bacteria 977
627 Ga0163163_11732179 3300014325 Unclassified 685
628 Ga0157380_10009132 3300014326 Bacteria 7090
629 Ga0157380_10088504 3300014326 Bacteria 2548
630 Ga0157380_10098522 3300014326 Unclassified 2429
631 Ga0157380_10150515 3300014326 Unclassified 2011
632 Ga0157380_10359334 3300014326 Bacteria 1366
633 Ga0157380_10797490 3300014326 Bacteria 961
634 Ga0157380_11234724 3300014326 Bacteria 792
635 Ga0157377_10059755 3300014745 Bacteria 2174
636 Ga0157377_10249782 3300014745 Bacteria 1149
637 Ga0157377_10964884 3300014745 Bacteria 643
638 Ga0157379_10002598 3300014968 Bacteria 15178
639 Ga0157379_10014161 3300014968 Bacteria 6994
640 Ga0157379_10015911 3300014968 Bacteria 6612
641 Ga0157379_10020313 3300014968 Bacteria 5872
642 Ga0157379_10127549 3300014968 Unclassified 2289
643 Ga0157379_10637578 3300014968 Bacteria 997
644 Ga0157379_11695101 3300014968 Unclassified 619
645 Ga0157379_12032556 3300014968 Unclassified 568
646 Ga0157376_10002690 3300014969 Bacteria 12092
647 Ga0157376_10032695 3300014969 Bacteria 4179
648 Ga0157376_10136351 3300014969 Bacteria 2196
649 Ga0157376_10499856 3300014969 Bacteria 1195
650 Ga0157376_10967481 3300014969 Bacteria 872
651 Ga0157376_11026982 3300014969 Bacteria 848
652 Ga0163161_10029282 3300017792 Bacteria 3914
653 Ga0163161_10168841 3300017792 Unclassified 1672
654 Ga0163161_10272827 3300017792 Bacteria 1324
655 Ga0184597_129778 3300019162 Unclassified 586
656 Ga0184600_121265 3300019190 Unclassified 658
657 Ga0197907_10324399 3300020069 Unclassified 723
658 Ga0197907_11250092 3300020069 Bacteria 837
659 Ga0197907_11279047 3300020069 Unclassified 565
660 Ga0197907_11386164 3300020069 Unclassified 595
661 Ga0206356_10516644 3300020070 Bacteria 640
662 Ga0206356_10715572 3300020070 Unclassified 785
663 Ga0206356_10844135 3300020070 Bacteria 1061
664 Ga0206356_11132424 3300020070 Unclassified 533
665 Ga0206356_11161235 3300020070 Unclassified 562
666 Ga0206356_11205819 3300020070 Unclassified 900
667 Ga0206356_11215637 3300020070 Unclassified 570
668 Ga0206349_1297786 3300020075 Unclassified 570
669 Ga0206349_1835108 3300020075 Unclassified 723
670 Ga0206349_1874035 3300020075 Unclassified 557
671 Ga0206349_1917504 3300020075 Bacteria 765
672 Ga0206349_1919281 3300020075 Unclassified 568
673 Ga0206355_1256411 3300020076 Unclassified 557
674 Ga0206355_1258114 3300020076 Bacteria 636
675 Ga0206355_1262814 3300020076 Unclassified 572
676 Ga0206355_1268818 3300020076 Bacteria 776
677 Ga0206355_1451817 3300020076 Unclassified 778
678 Ga0206355_1687652 3300020076 Bacteria 1238
679 Ga0206351_10188504 3300020077 Unclassified 578
680 Ga0206351_10405074 3300020077 Unclassified 574
681 Ga0206351_10700374 3300020077 Bacteria 528
682 Ga0206351_10906423 3300020077 Bacteria 713
683 Ga0206351_10908887 3300020077 Bacteria 576
684 Ga0206351_10957061 3300020077 Unclassified 614
685 Ga0206352_10782869 3300020078 Unclassified 572
686 Ga0206352_10893130 3300020078 Bacteria 1344
687 Ga0206352_11038743 3300020078 Unclassified 869
688 Ga0206352_11169670 3300020078 Unclassified 616
689 Ga0206352_11252282 3300020078 Unclassified 588
690 Ga0206352_11295039 3300020078 Unclassified 972
691 Ga0206352_11342208 3300020078 Unclassified 577
692 Ga0206350_10525024 3300020080 Bacteria 658
693 Ga0206350_10561742 3300020080 Bacteria 663
694 Ga0206350_10744426 3300020080 Unclassified 662
695 Ga0206350_11634810 3300020080 Unclassified 559
696 Ga0206354_10491623 3300020081 Bacteria 652
697 Ga0206354_11121875 3300020081 Bacteria 590
698 Ga0206354_11697218 3300020081 Unclassified 554
699 Ga0206353_10553268 3300020082 Unclassified 654
700 Ga0206353_11160635 3300020082 Unclassified 785
701 Ga0206353_11160646 3300020082 Bacteria 613
702 Ga0206353_11283297 3300020082 Unclassified 559
703 Ga0206353_11811571 3300020082 Unclassified 578
704 Ga0154015_1019451 3300020610 Unclassified 866
705 Ga0154015_1270677 3300020610 Unclassified 531
706 Ga0154015_1314901 3300020610 Bacteria 528
707 Ga0213876_10215943 3300021384 Bacteria 1020
708 Ga0224712_10180851 3300022467 Bacteria 950
709 Ga0224712_10253323 3300022467 Bacteria 814
710 Ga0224712_10271147 3300022467 Bacteria 788
711 Ga0224712_10282527 3300022467 Bacteria 773
712 Ga0224712_10522227 3300022467 Unclassified 575
713 Ga0224712_10579271 3300022467 Unclassified 547
714 Ga0247553_100118 3300023672 Bacteria 2272
715 Ga0207666_1010013 3300025271 Bacteria 1291
716 Ga0207666_1020265 3300025271 Unclassified 975
717 Ga0207697_10000006 3300025315 Bacteria 82632
718 Ga0207697_10000780 3300025315 Bacteria 18048
719 Ga0207697_10002440 3300025315 Bacteria 9638
720 Ga0207697_10376224 3300025315 Bacteria 631
721 Ga0207656_10019971 3300025321 Bacteria 2656
722 Ga0207656_10067747 3300025321 Bacteria 1580
723 Ga0207656_10106207 3300025321 Unclassified 1292
724 Ga0207656_10230723 3300025321 Bacteria 902
725 Ga0207656_10306886 3300025321 Unclassified 786
726 Ga0207696_1115898 3300025711 Unclassified 724
727 Ga0207653_10004397 3300025885 Bacteria 4422
728 Ga0207653_10227564 3300025885 Bacteria 710
729 Ga0207682_10003312 3300025893 Bacteria 7034
730 Ga0207692_10024648 3300025898 Unclassified 2800
731 Ga0207692_10032655 3300025898 Bacteria 2503
732 Ga0207692_10265768 3300025898 Bacteria 1033
733 Ga0207692_10806008 3300025898 Bacteria 614
734 Ga0207642_10004743 3300025899 Bacteria 4390
735 Ga0207642_10503365 3300025899 Bacteria 742
736 Ga0207710_10000831 3300025900 Bacteria 16688
737 Ga0207710_10048282 3300025900 Unclassified 1905
738 Ga0207710_10180517 3300025900 Bacteria 1035
739 Ga0207710_10191476 3300025900 Bacteria 1007
740 Ga0207688_10005241 3300025901 Bacteria 7046
741 Ga0207688_10355584 3300025901 Unclassified 903
742 Ga0207688_11000942 3300025901 Unclassified 528
743 Ga0207680_10010390 3300025903 Bacteria 4655
744 Ga0207680_10108407 3300025903 Bacteria 1797
745 Ga0207680_10488712 3300025903 Bacteria 876
746 Ga0207680_10966284 3300025903 Bacteria 610
747 Ga0207647_10026420 3300025904 Unclassified 3799
748 Ga0207647_10045450 3300025904 Bacteria 2740
749 Ga0207647_10150472 3300025904 Unclassified 1361
750 Ga0207685_10018562 3300025905 Bacteria 2273
751 Ga0207685_10342396 3300025905 Bacteria 752
752 Ga0207685_10658975 3300025905 Unclassified 567
753 Ga0207699_10033122 3300025906 Bacteria 2918
754 Ga0207699_10271497 3300025906 Unclassified 1175
755 Ga0207699_10396846 3300025906 Unclassified 982
756 Ga0207699_10467861 3300025906 Unclassified 906
757 Ga0207699_10619847 3300025906 Bacteria 789
758 Ga0207699_11282786 3300025906 Unclassified 542
759 Ga0207699_11325765 3300025906 Unclassified 533
760 Ga0207645_10000071 3300025907 Bacteria 72725
761 Ga0207645_10002340 3300025907 Bacteria 14953
762 Ga0207645_10024039 3300025907 Bacteria 3954
763 Ga0207645_10232344 3300025907 Bacteria 1217
764 Ga0207645_10886918 3300025907 Bacteria 606
765 Ga0207643_10001825 3300025908 Bacteria 11822
766 Ga0207705_10044589 3300025909 Bacteria 3187
767 Ga0207705_10086494 3300025909 Bacteria 2291
768 Ga0207705_10160274 3300025909 Bacteria 1690
769 Ga0207705_10275115 3300025909 Bacteria 1288
770 Ga0207684_10000032 3300025910 Bacteria 293234
771 Ga0207684_10003246 3300025910 Bacteria 15950
772 Ga0207684_10011152 3300025910 Bacteria 7868
773 Ga0207684_10075694 3300025910 Bacteria 2861
774 Ga0207684_10119835 3300025910 Bacteria 2256
775 Ga0207684_11006226 3300025910 Unclassified 697
776 Ga0207684_11297323 3300025910 Unclassified 600
777 Ga0207654_10000023 3300025911 Bacteria 161401
778 Ga0207654_10000668 3300025911 Bacteria 19386
779 Ga0207654_10000858 3300025911 Bacteria 16815
780 Ga0207654_10024153 3300025911 Bacteria 3265
781 Ga0207654_10230781 3300025911 Bacteria 1232
782 Ga0207654_10342235 3300025911 Bacteria 1028
783 Ga0207654_10453387 3300025911 Bacteria 900
784 Ga0207654_11385674 3300025911 Unclassified 513
785 Ga0207654_11450163 3300025911 Bacteria 501
786 Ga0207707_10018524 3300025912 Bacteria 6069
787 Ga0207707_10027394 3300025912 Bacteria 4984
788 Ga0207707_10188095 3300025912 Bacteria 1802
789 Ga0207707_10519191 3300025912 Bacteria 1014
790 Ga0207695_10000113 3300025913 Bacteria 247240
791 Ga0207695_10000188 3300025913 Bacteria 178721
792 Ga0207695_10000338 3300025913 Bacteria 110289
793 Ga0207695_10030295 3300025913 Bacteria 5959
794 Ga0207695_10110382 3300025913 Bacteria 2731
795 Ga0207695_10125368 3300025913 Bacteria 2531
796 Ga0207695_11266651 3300025913 Bacteria 618
797 Ga0207671_10000145 3300025914 Bacteria 109306
798 Ga0207671_10000506 3300025914 Bacteria 52834
799 Ga0207671_10209158 3300025914 Bacteria 1525
800 Ga0207671_10271655 3300025914 Unclassified 1336
801 Ga0207671_10336731 3300025914 Bacteria 1195
802 Ga0207671_11011833 3300025914 Bacteria 655
803 Ga0207671_11045780 3300025914 Unclassified 642
804 Ga0207693_10000509 3300025915 Bacteria 35091
805 Ga0207693_10005034 3300025915 Bacteria 11094
806 Ga0207693_10035797 3300025915 Bacteria 3914
807 Ga0207693_10177522 3300025915 Bacteria 1676
808 Ga0207693_10312386 3300025915 Unclassified 1231
809 Ga0207693_11049377 3300025915 Unclassified 621
810 Ga0207663_10006497 3300025916 Bacteria 5987
811 Ga0207663_10293696 3300025916 Bacteria 1211
812 Ga0207663_10460865 3300025916 Unclassified 982
813 Ga0207663_10772164 3300025916 Bacteria 764
814 Ga0207660_10009241 3300025917 Bacteria 6378
815 Ga0207660_10872097 3300025917 Bacteria 734
816 Ga0207660_10981310 3300025917 Bacteria 689
817 Ga0207660_11566210 3300025917 Unclassified 532
818 Ga0207662_10000982 3300025918 Bacteria 13288
819 Ga0207662_10031481 3300025918 Bacteria 3083
820 Ga0207662_10073670 3300025918 Unclassified 2072
821 Ga0207662_10305736 3300025918 Bacteria 1058
822 Ga0207657_10224725 3300025919 Bacteria 1503
823 Ga0207657_10525388 3300025919 Bacteria 926
824 Ga0207657_10683319 3300025919 Unclassified 798
825 Ga0207657_10755408 3300025919 Unclassified 753
826 Ga0207657_11366482 3300025919 Unclassified 533
827 Ga0207649_10019388 3300025920 Bacteria 3887
828 Ga0207649_10021494 3300025920 Bacteria 3716
829 Ga0207649_10053841 3300025920 Bacteria 2502
830 Ga0207649_10131767 3300025920 Bacteria 1699
831 Ga0207649_10946755 3300025920 Bacteria 676
832 Ga0207652_10001839 3300025921 Bacteria 18406
833 Ga0207652_10014955 3300025921 Bacteria 6294
834 Ga0207652_10913376 3300025921 Bacteria 775
835 Ga0207646_10056597 3300025922 Bacteria 3504
836 Ga0207646_10061224 3300025922 Bacteria 3360
837 Ga0207646_10064592 3300025922 Bacteria 3267
838 Ga0207646_10371726 3300025922 Unclassified 1292
839 Ga0207646_10747916 3300025922 Bacteria 872
840 Ga0207646_10897852 3300025922 Bacteria 786
841 Ga0207681_10011809 3300025923 Bacteria 5373
842 Ga0207681_10018647 3300025923 Bacteria 4374
843 Ga0207681_10020853 3300025923 Bacteria 4159
844 Ga0207681_11409261 3300025923 Bacteria 585
845 Ga0207681_11489715 3300025923 Unclassified 567
846 Ga0207694_10000076 3300025924 Bacteria 113436
847 Ga0207694_10000085 3300025924 Bacteria 108662
848 Ga0207694_10001059 3300025924 Bacteria 23946
849 Ga0207694_10005101 3300025924 Bacteria 10146
850 Ga0207694_10012774 3300025924 Bacteria 6327
851 Ga0207694_10244570 3300025924 Bacteria 1467
852 Ga0207694_10322145 3300025924 Bacteria 1276
853 Ga0207694_10534474 3300025924 Unclassified 983
854 Ga0207694_11122480 3300025924 Unclassified 665
855 Ga0207694_11367276 3300025924 Bacteria 599
856 Ga0207650_10008426 3300025925 Bacteria 7037
857 Ga0207650_10028473 3300025925 Bacteria 4007
858 Ga0207650_10638442 3300025925 Bacteria 897
859 Ga0207659_10011630 3300025926 Bacteria 5567
860 Ga0207659_10018061 3300025926 Bacteria 4617
861 Ga0207659_10230470 3300025926 Bacteria 1494
862 Ga0207687_10007183 3300025927 Bacteria 7343
863 Ga0207687_10069733 3300025927 Bacteria 2508
864 Ga0207687_10075565 3300025927 Unclassified 2418
865 Ga0207687_10085461 3300025927 Bacteria 2289
866 Ga0207687_10104912 3300025927 Bacteria 2087
867 Ga0207687_10398889 3300025927 Bacteria 1131
868 Ga0207687_10536014 3300025927 Unclassified 981
869 Ga0207700_10050602 3300025928 Bacteria 3097
870 Ga0207700_10688130 3300025928 Unclassified 912
871 Ga0207664_10140945 3300025929 Bacteria 2039
872 Ga0207664_10298205 3300025929 Unclassified 1417
873 Ga0207664_10447526 3300025929 Unclassified 1153
874 Ga0207664_11013951 3300025929 Bacteria 744
875 Ga0207644_10001426 3300025931 Bacteria 15395
876 Ga0207644_10041382 3300025931 Unclassified 3259
877 Ga0207644_10056522 3300025931 Bacteria 2832
878 Ga0207644_10074074 3300025931 Bacteria 2498
879 Ga0207644_10116851 3300025931 Bacteria 2025
880 Ga0207644_10166355 3300025931 Bacteria 1718
881 Ga0207644_10462805 3300025931 Bacteria 1043
882 Ga0207690_10005886 3300025932 Bacteria 7261
883 Ga0207690_10014322 3300025932 Bacteria 4790
884 Ga0207706_10000835 3300025933 Bacteria 31957
885 Ga0207706_10022504 3300025933 Bacteria 5656
886 Ga0207706_10029024 3300025933 Bacteria 4939
887 Ga0207706_10053786 3300025933 Bacteria 3553
888 Ga0207706_10058900 3300025933 Bacteria 3383
889 Ga0207706_10520645 3300025933 Unclassified 1025
890 Ga0207686_10039911 3300025934 Bacteria 2851
891 Ga0207686_10202743 3300025934 Bacteria 1422
892 Ga0207686_10315580 3300025934 Unclassified 1166
893 Ga0207686_10466054 3300025934 Unclassified 974
894 Ga0207686_10546273 3300025934 Bacteria 905
895 Ga0207686_10641764 3300025934 Unclassified 839
896 Ga0207686_11202376 3300025934 Bacteria 620
897 Ga0207686_11511546 3300025934 Unclassified 554
898 Ga0207709_10153255 3300025935 Unclassified 1599
899 Ga0207709_10420036 3300025935 Bacteria 1027
900 Ga0207709_10490659 3300025935 Bacteria 957
901 Ga0207709_11149403 3300025935 Bacteria 639
902 Ga0207670_10012608 3300025936 Bacteria 4952
903 Ga0207670_10034843 3300025936 Bacteria 3258
904 Ga0207670_10055383 3300025936 Bacteria 2680
905 Ga0207670_10221545 3300025936 Bacteria 1448
906 Ga0207669_10002444 3300025937 Bacteria 7924
907 Ga0207704_10074481 3300025938 Bacteria 2166
908 Ga0207704_10218092 3300025938 Bacteria 1409
909 Ga0207704_10990751 3300025938 Bacteria 710
910 Ga0207665_10037075 3300025939 Bacteria 3244
911 Ga0207665_10101170 3300025939 Unclassified 2012
912 Ga0207691_10015890 3300025940 Bacteria 7152
913 Ga0207691_10259128 3300025940 Bacteria 1499
914 Ga0207691_10306957 3300025940 Bacteria 1362
915 Ga0207691_10465035 3300025940 Unclassified 1076
916 Ga0207711_10000992 3300025941 Bacteria 27228
917 Ga0207711_10011105 3300025941 Bacteria 7485
918 Ga0207711_10015238 3300025941 Bacteria 6382
919 Ga0207711_10016385 3300025941 Bacteria 6161
920 Ga0207711_10097307 3300025941 Bacteria 2598
921 Ga0207711_10850507 3300025941 Bacteria 849
922 Ga0207711_10933335 3300025941 Unclassified 806
923 Ga0207689_10000936 3300025942 Bacteria 28039
924 Ga0207689_10005617 3300025942 Bacteria 11172
925 Ga0207689_10007815 3300025942 Bacteria 9356
926 Ga0207689_10079940 3300025942 Bacteria 2687
927 Ga0207689_10207224 3300025942 Bacteria 1619
928 Ga0207689_10220434 3300025942 Bacteria 1567
929 Ga0207689_10249036 3300025942 Bacteria 1469
930 Ga0207689_11171806 3300025942 Bacteria 647
931 Ga0207661_10002184 3300025944 Bacteria 13500
932 Ga0207661_10003133 3300025944 Bacteria 11463
933 Ga0207661_10005275 3300025944 Bacteria 9099
934 Ga0207661_10006124 3300025944 Bacteria 8500
935 Ga0207661_10036591 3300025944 Bacteria 3833
936 Ga0207661_10085703 3300025944 Unclassified 2612
937 Ga0207661_10168298 3300025944 Bacteria 1906
938 Ga0207661_10561959 3300025944 Bacteria 1046
939 Ga0207661_10632361 3300025944 Bacteria 983
940 Ga0207661_10732003 3300025944 Bacteria 910
941 Ga0207679_10086413 3300025945 Bacteria 2412
942 Ga0207679_10096016 3300025945 Bacteria 2305
943 Ga0207679_10110884 3300025945 Bacteria 2165
944 Ga0207679_10221701 3300025945 Bacteria 1591
945 Ga0207679_10295079 3300025945 Bacteria 1395
946 Ga0207679_10498582 3300025945 Bacteria 1086
947 Ga0207679_12106558 3300025945 Unclassified 512
948 Ga0207667_10024639 3300025949 Bacteria 6602
949 Ga0207667_10037735 3300025949 Bacteria 5164
950 Ga0207667_10062221 3300025949 Bacteria 3903
951 Ga0207667_10065082 3300025949 Bacteria 3804
952 Ga0207667_10223914 3300025949 Bacteria 1927
953 Ga0207667_11152628 3300025949 Unclassified 756
954 Ga0207667_11237901 3300025949 Unclassified 725
955 Ga0207667_11879650 3300025949 Bacteria 561
956 Ga0207651_10071094 3300025960 Bacteria 2465
957 Ga0207651_10116699 3300025960 Bacteria 2015
958 Ga0207651_10288970 3300025960 Bacteria 1358
959 Ga0207651_10509413 3300025960 Bacteria 1041
960 Ga0207651_10924059 3300025960 Unclassified 778
961 Ga0207651_11436738 3300025960 Bacteria 621
962 Ga0207712_10011388 3300025961 Bacteria 5667
963 Ga0207712_10044880 3300025961 Bacteria 3058
964 Ga0207712_10082829 3300025961 Bacteria 2340
965 Ga0207712_10086875 3300025961 Bacteria 2292
966 Ga0207712_10584482 3300025961 Bacteria 964
967 Ga0207712_11367359 3300025961 Bacteria 633
968 Ga0207712_11574167 3300025961 Bacteria 589
969 Ga0207668_10012145 3300025972 Bacteria 5263
970 Ga0207668_10036595 3300025972 Unclassified 3277
971 Ga0207668_10036798 3300025972 Bacteria 3270
972 Ga0207668_10570720 3300025972 Bacteria 982
973 Ga0207640_10041395 3300025981 Unclassified 2930
974 Ga0207640_10292782 3300025981 Bacteria 1284
975 Ga0207640_10406645 3300025981 Bacteria 1110
976 Ga0207640_10533773 3300025981 Unclassified 983
977 Ga0207658_10000721 3300025986 Bacteria 28564
978 Ga0207658_10011703 3300025986 Bacteria 5973
979 Ga0207658_10027685 3300025986 Bacteria 3985
980 Ga0207658_10273536 3300025986 Unclassified 1445
981 Ga0207658_10637673 3300025986 Bacteria 959
982 Ga0207658_11200364 3300025986 Bacteria 693
983 Ga0207658_11220208 3300025986 Unclassified 688
984 Ga0207677_10000697 3300026023 Bacteria 19930
985 Ga0207677_10169968 3300026023 Bacteria 1703
986 Ga0207677_10184760 3300026023 Unclassified 1643
987 Ga0207677_10288948 3300026023 Bacteria 1349
988 Ga0207677_10336818 3300026023 Bacteria 1259
989 Ga0207677_11056612 3300026023 Bacteria 738
990 Ga0207677_12042237 3300026023 Bacteria 533
991 Ga0207703_10002669 3300026035 Bacteria 15330
992 Ga0207703_10018927 3300026035 Bacteria 5380
993 Ga0207703_10087496 3300026035 Bacteria 2612
994 Ga0207703_10103649 3300026035 Bacteria 2415
995 Ga0207703_10609390 3300026035 Bacteria 1033
996 Ga0207639_10000072 3300026041 Bacteria 94533
997 Ga0207639_10002644 3300026041 Bacteria 12027
998 Ga0207639_10014151 3300026041 Bacteria 5602
999 Ga0207639_10091496 3300026041 Bacteria 2436
1000 Ga0207639_10140214 3300026041 Bacteria 2013
1001 Ga0207639_10163447 3300026041 Bacteria 1878
1002 Ga0207639_10721623 3300026041 Bacteria 925
1003 Ga0207639_11390124 3300026041 Unclassified 659
1004 Ga0207639_11411348 3300026041 Unclassified 653
1005 Ga0207678_10069636 3300026067 Bacteria 3017
1006 Ga0207678_10144168 3300026067 Bacteria 2033
1007 Ga0207678_10990235 3300026067 Bacteria 744
1008 Ga0207678_11023174 3300026067 Bacteria 731
1009 Ga0207708_10052624 3300026075 Bacteria 3101
1010 Ga0207702_10006483 3300026078 Bacteria 10087
1011 Ga0207702_10016091 3300026078 Bacteria 6192
1012 Ga0207702_10273811 3300026078 Unclassified 1593
1013 Ga0207702_10335056 3300026078 Bacteria 1444
1014 Ga0207702_10343101 3300026078 Unclassified 1427
1015 Ga0207702_10644916 3300026078 Bacteria 1041
1016 Ga0207702_11255265 3300026078 Unclassified 735
1017 Ga0207702_11806514 3300026078 Bacteria 603
1018 Ga0207702_11942626 3300026078 Bacteria 579
1019 Ga0207641_10003347 3300026088 Bacteria 14248
1020 Ga0207641_10020959 3300026088 Bacteria 5373
1021 Ga0207641_10061136 3300026088 Bacteria 3212
1022 Ga0207641_10105292 3300026088 Unclassified 2491
1023 Ga0207641_10166113 3300026088 Bacteria 2010
1024 Ga0207641_10237758 3300026088 Bacteria 1696
1025 Ga0207641_10333580 3300026088 Bacteria 1441
1026 Ga0207641_10610842 3300026088 Unclassified 1068
1027 Ga0207648_10022243 3300026089 Bacteria 5696
1028 Ga0207648_10073512 3300026089 Bacteria 2979
1029 Ga0207648_10458456 3300026089 Bacteria 1162
1030 Ga0207648_10550496 3300026089 Bacteria 1060
1031 Ga0207648_10862644 3300026089 Bacteria 845
1032 Ga0207648_11775287 3300026089 Unclassified 578
1033 Ga0207676_10005629 3300026095 Bacteria 8867
1034 Ga0207676_10039951 3300026095 Bacteria 3593
1035 Ga0207676_10212667 3300026095 Bacteria 1716
1036 Ga0207676_10437656 3300026095 Bacteria 1230
1037 Ga0207676_10628058 3300026095 Bacteria 1034
1038 Ga0207676_11658607 3300026095 Bacteria 637
1039 Ga0207676_11718266 3300026095 Archaea 626
1040 Ga0207676_11985695 3300026095 Bacteria 580
1041 Ga0207676_12239877 3300026095 Unclassified 544
1042 Ga0207674_10006105 3300026116 Bacteria 14242
1043 Ga0207674_10026877 3300026116 Bacteria 6103
1044 Ga0207674_10112388 3300026116 Bacteria 2697
1045 Ga0207674_10571134 3300026116 Unclassified 1092
1046 Ga0207674_10933541 3300026116 Bacteria 836
1047 Ga0207674_11152808 3300026116 Bacteria 745
1048 Ga0207675_100006619 3300026118 Bacteria 10960
1049 Ga0207675_100092204 3300026118 Bacteria 2849
1050 Ga0207675_100172832 3300026118 Unclassified 2066
1051 Ga0207675_100236790 3300026118 Bacteria 1763
1052 Ga0207675_100252565 3300026118 Bacteria 1707
1053 Ga0207675_100675252 3300026118 Bacteria 1040
1054 Ga0207675_100723374 3300026118 Unclassified 1005
1055 Ga0207675_102532205 3300026118 Unclassified 524
1056 Ga0207683_10000392 3300026121 Bacteria 40319
1057 Ga0207683_10058359 3300026121 Bacteria 3389
1058 Ga0207698_10002536 3300026142 Bacteria 10844
1059 Ga0207698_10006606 3300026142 Bacteria 7253
1060 Ga0207698_10037024 3300026142 Bacteria 3589
1061 Ga0207698_10094864 3300026142 Bacteria 2454
1062 Ga0207698_10278488 3300026142 Bacteria 1546
1063 Ga0207698_10575811 3300026142 Bacteria 1107
1064 Ga0207698_11042794 3300026142 Unclassified 829
1065 Ga0207698_11071263 3300026142 Unclassified 818
1066 Ga0207698_11134968 3300026142 Unclassified 795
1067 Ga0209999_1064506 3300027543 Bacteria 699
1068 Ga0209998_10175110 3300027717 Bacteria 557
1069 Ga0207428_10000608 3300027907 Bacteria 42445
1070 Ga0207428_10015891 3300027907 Bacteria 6494
1071 Ga0207428_10287312 3300027907 Bacteria 1220
1072 Ga0207428_10567855 3300027907 Unclassified 819
1073 Ga0207428_10675362 3300027907 Bacteria 740
1074 Ga0207428_11032171 3300027907 Bacteria 577
1075 Ga0265354_1000098 3300028016 Bacteria 14977
1076 Ga0265354_1000950 3300028016 Bacteria 4569
1077 Ga0265355_1012880 3300028036 Unclassified 695
1078 Ga0268266_10028937 3300028379 Bacteria 4708
1079 Ga0268266_10051630 3300028379 Bacteria 3530
1080 Ga0268266_10752208 3300028379 Unclassified 941
1081 Ga0268266_10872161 3300028379 Bacteria 870
1082 Ga0268266_11267437 3300028379 Bacteria 712
1083 Ga0268266_12009194 3300028379 Bacteria 551
1084 Ga0268265_10036595 3300028380 Bacteria 3596
1085 Ga0268265_10074665 3300028380 Bacteria 2653
1086 Ga0268265_10100723 3300028380 Unclassified 2332
1087 Ga0268265_10139054 3300028380 Bacteria 2030
1088 Ga0268265_10835675 3300028380 Bacteria 900
1089 Ga0268265_11033087 3300028380 Unclassified 813
1090 Ga0268265_11459766 3300028380 Bacteria 687
1091 Ga0268264_10001264 3300028381 Bacteria 24011
1092 Ga0268264_10014533 3300028381 Bacteria 6469
1093 Ga0268264_10016196 3300028381 Bacteria 6105
1094 Ga0268264_10024740 3300028381 Bacteria 4904
1095 Ga0268264_10240123 3300028381 Bacteria 1678
1096 Ga0268264_10247856 3300028381 Bacteria 1653
1097 Ga0268264_10370565 3300028381 Bacteria 1369
1098 Ga0268264_10453754 3300028381 Unclassified 1242
1099 Ga0268264_10633907 3300028381 Unclassified 1056
1100 Ga0265326_10035795 3300028558 Bacteria 1412
1101 Ga0265319_1093397 3300028563 Bacteria 948
1102 Ga0265323_10001642 3300028653 Bacteria 10755
1103 Ga0265323_10029672 3300028653 Unclassified 2044
1104 Ga0265323_10035115 3300028653 Bacteria 1850
1105 Ga0265323_10037767 3300028653 Bacteria 1768
1106 Ga0265338_10007747 3300028800 Bacteria 13217
1107 Ga0265338_10036426 3300028800 Bacteria 4708
1108 Ga0265338_10051346 3300028800 Bacteria 3713
1109 Ga0265338_10716149 3300028800 Unclassified 690
1110 Ga0316177_1136457 3300030731 Bacteria 951
1111 Ga0316176_1005077 3300030732 Bacteria 694
1112 Ga0316182_1208682 3300030745 Bacteria 888
1113 Ga0265770_1002035 3300030878 Bacteria 2755
1114 Ga0265765_1001343 3300030879 Bacteria 2246
1115 Ga0265765_1036246 3300030879 Unclassified 644
1116 Ga0265760_10001198 3300031090 Bacteria 7597
1117 Ga0265760_10014078 3300031090 Bacteria 2290
1118 Ga0265330_10004895 3300031235 Bacteria 6744
1119 Ga0265330_10008926 3300031235 Bacteria 4788
1120 Ga0265332_10000009 3300031238 Bacteria 295760
1121 Ga0265332_10000042 3300031238 Bacteria 117639
1122 Ga0265332_10133215 3300031238 Bacteria 1042
1123 Ga0265328_10014817 3300031239 Bacteria 3063
1124 Ga0265320_10050477 3300031240 Bacteria 2021
1125 Ga0265320_10094376 3300031240 Bacteria 1383
1126 Ga0265329_10015222 3300031242 Bacteria 2692
1127 Ga0265340_10005578 3300031247 Bacteria 6979
1128 Ga0265339_10005067 3300031249 Bacteria 8848
1129 Ga0265331_10000022 3300031250 Bacteria 240970
1130 Ga0265327_10082134 3300031251 Bacteria 1589
1131 Ga0265316_10004370 3300031344 Bacteria 14096
1132 Ga0265316_10024993 3300031344 Bacteria 4991
1133 Ga0265316_10052764 3300031344 Bacteria 3188
1134 Ga0265316_10093223 3300031344 Bacteria 2295
1135 Ga0265316_10693067 3300031344 Bacteria 718
1136 Ga0307509_10000076 3300031507 Bacteria 138855
1137 Ga0265314_10000681 3300031711 Bacteria 41349
1138 Ga0265314_10100234 3300031711 Bacteria 1863
1139 Ga0265314_10139877 3300031711 Bacteria 1498
1140 Ga0265342_10004261 3300031712 Bacteria 11327
1141 Ga0265342_10008059 3300031712 Bacteria 7619
1142 Ga0265342_10327422 3300031712 Unclassified 802
1143 Ga0307407_10815383 3300031903 Unclassified 711
1144 Ga0316053_102437 3300032120 Unclassified 1055
1145 Ga0316212_1002969 3300033547 Bacteria 2439
1146 Ga0316212_1020776 3300033547 Bacteria 921
1147 Ga0373929_0091436 3300035085 Bacteria 756
1148 Ga0373934_0001839 3300035086 Bacteria 7803
1149 Ga0373934_0128101 3300035086 Bacteria 1034
1150 Ga0373940_0154000 3300035088 Bacteria 734
1151 Ga0373940_0294809 3300035088 Unclassified 557
1152 Ga0373951_0019781 3300035091 Bacteria 1537
1153 Ga0373923_0094482 3300035111 Bacteria 1312
1154 Ga0373923_0158048 3300035111 Bacteria 1033
1155 Ga0373936_0183399 3300035113 Archaea 919
1156 Ga0373936_0434186 3300035113 Bacteria 606
1157 Ga0373953_0056831 3300035117 Bacteria 1592
1158 Ga0373953_0131853 3300035117 Bacteria 1066
1159 Ga0373953_0178180 3300035117 Bacteria 916
1160 Ga0373953_0248623 3300035117 Unclassified 773
1161 Ga0373954_0045359 3300035118 Bacteria 2053
1162 Ga0373954_0071639 3300035118 Bacteria 1647
1163 Ga0373956_0011297 3300035119 Bacteria 3678
1164 Ga0373956_0025194 3300035119 Bacteria 2569
1165 Ga0373956_0080257 3300035119 Bacteria 1497
1166 Ga0373957_0323409 3300035120 Unclassified 656
1167 Ga0373957_0332543 3300035120 Unclassified 647
1168 Ga0373957_0339927 3300035120 Unclassified 640
1169 Ga0373957_0522703 3300035120 Bacteria 518
1170 Ga0373955_0012644 3300035172 Bacteria 4060
1171 Ga0373955_0346412 3300035172 Unclassified 900
1172 Ga0373955_0625318 3300035172 Unclassified 660
1173 Ga0373961_0267220 3300035241 Bacteria 623
1174 Ga0316574_0143853 3300035398 Bacteria 1537
1175 Ga0373924_0315826 3300035410 Unclassified 694
1176 Ga0373931_0033965 3300035691 Unclassified 2645
1177 Ga0373931_0332260 3300035691 Bacteria 947
1178 Ga0373931_0604631 3300035691 Bacteria 717
1179 Ga0373935_0433005 3300035692 Bacteria 948
1180 Ga0373933_0036573 3300035724 Bacteria 2875
1181 Ga0373933_0040062 3300035724 Bacteria 2758
1182 Ga0373933_0170240 3300035724 Bacteria 1386
1183 Ga0373933_0400081 3300035724 Bacteria 896
1184 Ga0373933_0689509 3300035724 Unclassified 672
1185 Ga0373937_0004374 3300036401 Bacteria 11997
1186 Ga0373937_0060946 3300036401 Bacteria 3468
1187 Ga0373937_0084956 3300036401 Bacteria 2929
1188 Ga0373937_0156351 3300036401 Bacteria 2137
1189 Ga0373937_0270489 3300036401 Unclassified 1604
1190 Ga0373937_0376361 3300036401 Bacteria 1346
1191 Ga0373937_0380585 3300036401 Unclassified 1338
1192 Ga0373937_0511519 3300036401 Unclassified 1141
1193 Ga0373937_0948879 3300036401 Unclassified 809
1194 Ga0373937_0975167 3300036401 Unclassified 796
1195 Ga0373925_1175321 3300037068 Unclassified 631
1196 Ga0373925_1347120 3300037068 Unclassified 585
1197 Ga0395899_0976327 3300037312 Unclassified 512
1198 Ga0395900_0786191 3300037418 Bacteria 880
1199 Ga0395900_0834549 3300037418 Unclassified 848
1200 Ga0395898_1834323 3300037466 Bacteria 527
1201 Ga0395901_0587782 3300038443 Unclassified 1124
1202 Ga0395901_2087217 3300038443 Bacteria 512
1203 Ga0451802_1861437 3300041460 Bacteria 632
1204 Ga0451807_0907752 3300041486 Unclassified 1126
1205 Ga0451839_1288097 3300041496 Bacteria 743
1206 Ga0451843_0211863 3300041509 Bacteria 530
1207 Ga0451843_1005222 3300041509 Unclassified 607
1208 Ga0451853_2542678 3300041512 Bacteria 816
1209 Ga0450923_106454 3300042125 Bacteria 651
1210 Ga0439460_0224587 3300042461 Bacteria 645
1211 Ga0451577_0063966 3300042876 Bacteria 3281
1212 Ga0451577_0078362 3300042876 Bacteria 2946
1213 Ga0451577_0106049 3300042876 Unclassified 2512
1214 Ga0451577_0138218 3300042876 Bacteria 2188
1215 Ga0451577_0822950 3300042876 Bacteria 838
1216 Ga0451577_1515252 3300042876 Unclassified 593
1217 Ga0451577_1554443 3300042876 Unclassified 584
1218 Ga0451577_2017912 3300042876 Unclassified 504
1219 Ga0439440_0146535 3300042993 Bacteria 674
1220 Ga0453683_0019235 3300044673 Bacteria 4375
1221 Ga0453683_0354812 3300044673 Unclassified 942
1222 Ga0453683_0426242 3300044673 Unclassified 856
1223 Ga0453683_0467740 3300044673 Bacteria 816
1224 Ga0466963_0333165 3300044694 Unclassified 1068
1225 Ga0453684_0084340 3300044712 Bacteria 3951
1226 Ga0453684_0091154 3300044712 Bacteria 3763
1227 Ga0453684_0152887 3300044712 Bacteria 2740
1228 Ga0453684_0223641 3300044712 Bacteria 2178
1229 Ga0453684_0518234 3300044712 Bacteria 1318
1230 Ga0453684_1222631 3300044712 Unclassified 787
1231 Ga0453684_1620555 3300044712 Unclassified 664
1232 Ga0453684_2548615 3300044712 Bacteria 504
1233 Ga0466957_0880160 3300044842 Unclassified 639
1234 Ga0451576_0001883 3300045051 Bacteria 33774
1235 Ga0451576_0059242 3300045051 Bacteria 3998
1236 Ga0451576_0059260 3300045051 Unclassified 3998
1237 Ga0451576_0090653 3300045051 Bacteria 3180
1238 Ga0451576_0124751 3300045051 Bacteria 2683
1239 Ga0451576_0133396 3300045051 Bacteria 2589
1240 Ga0451576_0240284 3300045051 Bacteria 1892
1241 Ga0451576_0375565 3300045051 Bacteria 1490
1242 Ga0451576_0401641 3300045051 Bacteria 1437
1243 Ga0451576_0464825 3300045051 Bacteria 1329
1244 Ga0451576_0502080 3300045051 Bacteria 1274
1245 Ga0451576_0786898 3300045051 Bacteria 999
1246 Ga0451576_0855342 3300045051 Unclassified 955
1247 Ga0466967_0002917 3300045976 Bacteria 10906
1248 Ga0495592_0191652 3300046454 Bacteria 1385
1249 Ga0495603_0314973 3300046455 Unclassified 898
1250 Ga0495629_0759927 3300046459 Unclassified 641
1251 Ga0495629_0899982 3300046459 Unclassified 580
1252 Ga0495651_1024348 3300046462 Unclassified 500
1253 Ga0495653_0824971 3300046463 Bacteria 556
1254 Ga0495580_0125999 3300046472 Bacteria 1777
1255 Ga0495580_0139332 3300046472 Bacteria 1682
1256 Ga0495580_0246831 3300046472 Unclassified 1223
1257 Ga0495580_1007317 3300046472 Bacteria 531
1258 Ga0495582_0638181 3300046473 Bacteria 616
1259 Ga0495639_0072580 3300046475 Bacteria 1592
1260 Ga0495585_0525181 3300046492 Bacteria 561
1261 Ga0495608_0227305 3300046511 Unclassified 1169
1262 Ga0495618_0203742 3300046514 Bacteria 1252
1263 Ga0495628_0375465 3300046516 Bacteria 1042
1264 Ga0495630_0070982 3300046517 Bacteria 2621
1265 Ga0495652_0762873 3300046529 Bacteria 646
1266 Ga0495586_0735573 3300046535 Unclassified 569
1267 Ga0495586_0846714 3300046535 Bacteria 527
1268 Ga0495587_0397258 3300046536 Bacteria 766
1269 Ga0495587_0425626 3300046536 Unclassified 737
1270 Ga0495622_0344915 3300046557 Bacteria 645
1271 Ga0495622_0388364 3300046557 Unclassified 602
1272 Ga0495667_0435067 3300046559 Unclassified 825
1273 Ga0495634_0028961 3300046642 Bacteria 3839
1274 Ga0495634_0285044 3300046642 Bacteria 1002
1275 Ga0495635_0809855 3300046663 Unclassified 603
1276 Ga0495657_0305061 3300046675 Unclassified 949
1277 Ga0495599_0515429 3300046678 Bacteria 703
1278 Ga0495646_0676971 3300046680 Unclassified 520
1279 Ga0495647_0253352 3300046681 Unclassified 784
1280 Ga0495658_0506217 3300046683 Bacteria 773
1281 Ga0495669_0066462 3300046684 Bacteria 1638
1282 Ga0495669_0432199 3300046684 Bacteria 639
1283 Ga0495613_0095160 3300046689 Bacteria 2155
1284 Ga0495613_0179709 3300046689 Unclassified 1499
1285 Ga0495670_0830072 3300046691 Bacteria 505
1286 Ga0495600_0417746 3300046809 Bacteria 833
1287 Ga0495680_0243301 3300047322 Bacteria 1277
1288 Ga0495680_0853826 3300047322 Bacteria 591
1289 Ga0495680_0878458 3300047322 Bacteria 581
1290 Ga0495680_1016783 3300047322 Bacteria 529
1291 Ga0495684_0178850 3300047471 Unclassified 1573
1292 Ga0495684_0301944 3300047471 Bacteria 1150
1293 Ga0495593_0540647 3300047673 Unclassified 584
1294 Ga0495602_0474726 3300048088 Bacteria 879
1295 Ga0496100_0177343 3300048903 Bacteria 1539
1296 Ga0496100_0961853 3300048903 Bacteria 671
1297 Ga0496101_0748775 3300048904 Unclassified 771
1298 Ga0496102_0003426 3300048905 Bacteria 13444
1299 Ga0496102_1363466 3300048905 Bacteria 628
1300 Ga0496103_0223104 3300048906 Bacteria 1212
1301 Ga0496104_0578944 3300048907 Bacteria 1033
1302 Ga0496104_0874090 3300048907 Unclassified 804
1303 Ga0496105_0560014 3300048908 Unclassified 891
1304 Ga0496106_0112490 3300048909 Bacteria 2121
1305 Ga0496106_0639086 3300048909 Bacteria 851
1306 Ga0496106_0903385 3300048909 Bacteria 697
1307 Ga0496108_0008090 3300048911 Bacteria 8531
1308 Ga0496108_0069079 3300048911 Bacteria 2981
1309 Ga0496108_0186752 3300048911 Bacteria 1796
1310 Ga0496108_0285755 3300048911 Bacteria 1436
1311 Ga0496108_0930722 3300048911 Bacteria 745
1312 Ga0496108_1120762 3300048911 Bacteria 668
1313 Ga0496109_0001877 3300048912 Bacteria 17407
1314 Ga0496110_0044892 3300048913 Bacteria 3860
1315 Ga0496110_0592788 3300048913 Unclassified 1006
1316 Ga0496110_1231160 3300048913 Bacteria 657
1317 Ga0496110_1344930 3300048913 Bacteria 624
1318 Ga0496111_0376435 3300048914 Unclassified 1050
1319 Ga0496111_0676832 3300048914 Bacteria 752
1320 Ga0496112_0147241 3300048915 Bacteria 2323
1321 Ga0496112_0353809 3300048915 Unclassified 1411
1322 Ga0496112_0989787 3300048915 Archaea 761
1323 Ga0496113_0224189 3300048916 Bacteria 1498
1324 Ga0496114_0197160 3300048917 Bacteria 1763
1325 Ga0496115_0003187 3300048918 Bacteria 11780
1326 Ga0496115_0051899 3300048918 Unclassified 3289
1327 Ga0496115_0166618 3300048918 Bacteria 1822
1328 Ga0496115_0855460 3300048918 Bacteria 704
1329 Ga0496126_0683616 3300048929 Bacteria 799
1330 Ga0501310_012639 3300049130 Bacteria 971
1331 Ga0501315_052556 3300049531 Bacteria 643
1332 Ga0501031_0246246 3300049568 Bacteria 1162
1333 Ga0501032_0038061 3300049569 Bacteria 3277
1334 Ga0501032_0540280 3300049569 Unclassified 743
1335 Ga0501033_0052408 3300049570 Bacteria 3024
1336 Ga0501033_0868990 3300049570 Unclassified 607
1337 Ga0501034_0026609 3300049571 Bacteria 5889
1338 Ga0501034_0548433 3300049571 Bacteria 1065
1339 Ga0501034_0598232 3300049571 Bacteria 1008
1340 Ga0501036_0116535 3300049572 Bacteria 2256
1341 Ga0501036_0376694 3300049572 Bacteria 1184
1342 Ga0501037_0058985 3300049573 Bacteria 2800
1343 Ga0501037_0062601 3300049573 Bacteria 2712
1344 Ga0501038_0098967 3300049574 Bacteria 2431
1345 Ga0501038_0264997 3300049574 Bacteria 1356
1346 Ga0501038_0321381 3300049574 Bacteria 1211
1347 Ga0501039_0126887 3300049575 Bacteria 2001
1348 Ga0501039_0132178 3300049575 Bacteria 1959
1349 Ga0501039_1420855 3300049575 Bacteria 534
1350 Ga0501040_0243013 3300049576 Bacteria 1284
1351 Ga0501040_1366719 3300049576 Bacteria 514
1352 Ga0501041_0103736 3300049577 Bacteria 1761
1353 Ga0501041_0388174 3300049577 Bacteria 884
1354 Ga0501042_0006571 3300049578 Bacteria 7562
1355 Ga0501042_1141937 3300049578 Unclassified 568
1356 Ga0501043_0049118 3300049579 Bacteria 3317
1357 Ga0501043_0091498 3300049579 Bacteria 2391
1358 Ga0501043_0606017 3300049579 Bacteria 808
1359 Ga0501046_0045612 3300049580 Bacteria 3482
1360 Ga0501046_0064852 3300049580 Bacteria 2850
1361 Ga0501046_0123185 3300049580 Bacteria 1971
1362 Ga0501047_0327571 3300049581 Bacteria 1370
1363 Ga0501047_0863938 3300049581 Bacteria 718
1364 Ga0501047_1372407 3300049581 Bacteria 521
1365 Ga0501048_0034507 3300049582 Bacteria 3649
1366 Ga0501048_0079035 3300049582 Bacteria 2321
1367 Ga0501067_0008902 3300049583 Bacteria 5561
1368 Ga0501067_0169930 3300049583 Bacteria 1214
1369 Ga0501067_0188648 3300049583 Unclassified 1148
1370 Ga0501068_0032050 3300049584 Bacteria 3124
1371 Ga0501068_0052413 3300049584 Bacteria 2469
1372 Ga0501068_0520520 3300049584 Bacteria 772
1373 Ga0501069_0004494 3300049585 Bacteria 7206
1374 Ga0501070_0224127 3300049586 Bacteria 1541
1375 Ga0501070_0382453 3300049586 Bacteria 1140
1376 Ga0501071_0080954 3300049587 Bacteria 2376
1377 Ga0501071_0862763 3300049587 Bacteria 698
1378 Ga0501071_1015621 3300049587 Bacteria 641
1379 Ga0501071_1205039 3300049587 Unclassified 585
1380 Ga0501072_0039700 3300049588 Bacteria 3695
1381 Ga0501072_0097589 3300049588 Bacteria 2336
1382 Ga0501072_0146616 3300049588 Bacteria 1882
1383 Ga0501072_0867793 3300049588 Bacteria 705
1384 Ga0501073_0059231 3300049589 Bacteria 2675
1385 Ga0501073_0156069 3300049589 Bacteria 1581
1386 Ga0501074_0092132 3300049590 Bacteria 2170
1387 Ga0501075_0341867 3300049591 Unclassified 1140
1388 Ga0501076_0569224 3300049592 Bacteria 934
1389 Ga0501076_0718961 3300049592 Bacteria 824
1390 Ga0501076_0989290 3300049592 Unclassified 693
1391 Ga0501077_0506966 3300049593 Bacteria 774
1392 Ga0501079_0037276 3300049741 Bacteria 3747
1393 Ga0501079_1014142 3300049741 Bacteria 654
1394 Ga0501079_1406353 3300049741 Unclassified 549
1395 Ga0501080_0301014 3300049742 Bacteria 1454
1396 Ga0501080_0402355 3300049742 Bacteria 1231
1397 Ga0501080_0405268 3300049742 Unclassified 1226
1398 Ga0501080_1114728 3300049742 Bacteria 681
1399 Ga0501080_1691947 3300049742 Bacteria 534
1400 Ga0501081_0247611 3300049743 Bacteria 1300
1401 Ga0501081_0486427 3300049743 Bacteria 919
1402 Ga0501081_0546611 3300049743 Bacteria 865
1403 Ga0501081_0946984 3300049743 Unclassified 650
1404 Ga0501083_0002089 3300049744 Bacteria 13737
1405 Ga0501083_0150204 3300049744 Bacteria 1525
1406 Ga0501083_0961920 3300049744 Unclassified 556
1407 Ga0501035_0105773 3300049822 Bacteria 2467
1408 Ga0501044_0120546 3300049823 Bacteria 2624
1409 Ga0501044_0189789 3300049823 Bacteria 2018
1410 Ga0501044_0292645 3300049823 Bacteria 1559
1411 Ga0501045_0080520 3300049824 Bacteria 2401
1412 Ga0501045_0358615 3300049824 Bacteria 1085
1413 nmdc:mga0k408_151229_c1 3300050493 Bacteria 1382
1414 nmdc:mga05p37_12092_c1 3300050507 Bacteria 10303
1415 nmdc:mga05p37_1386757_c1 3300050507 Unclassified 709
1416 nmdc:mga05p37_204944_c1 3300050507 Bacteria 2386
1417 nmdc:mga05p37_370855_c1 3300050507 Bacteria 1680
1418 nmdc:mga05p37_381218_c1 3300050507 Bacteria 1652
1419 nmdc:mga05p37_523024_c1 3300050507 Bacteria 1356
1420 nmdc:mga05p37_538804_c1 3300050507 Unclassified 1331
1421 nmdc:mga05p37_57379_c1 3300050507 Bacteria 4796
1422 nmdc:mga09592_234689_c1 3300050508 Bacteria 1589
1423 nmdc:mga09592_275530_c1 3300050508 Bacteria 1459
1424 nmdc:mga09592_335945_c1 3300050508 Bacteria 1308
1425 nmdc:mga09592_460981_c1 3300050508 Unclassified 1096
1426 nmdc:mga09592_987605_c1 3300050508 Bacteria 704
1427 nmdc:mga0qj67_298460_c1 3300050509 Bacteria 1305
1428 nmdc:mga06r32_1154380_c1 3300050510 Unclassified 722
1429 nmdc:mga06r32_196779_c1 3300050510 Bacteria 2003
1430 nmdc:mga06r32_643319_c1 3300050510 Unclassified 1029
1431 nmdc:mga08y16_1131174_c1 3300050511 Unclassified 757
1432 nmdc:mga08y16_23201_c1 3300050511 Bacteria 6550
1433 nmdc:mga08y16_294223_c1 3300050511 Bacteria 1674
1434 nmdc:mga08y16_342_c1 3300050511 Bacteria 42098
1435 nmdc:mga08y16_602455_c1 3300050511 Bacteria 1107
1436 nmdc:mga08y16_90657_c1 3300050511 Bacteria 3187
1437 nmdc:mga0n895_1135537_c1 3300050512 Unclassified 757
1438 nmdc:mga0n895_1910895_c1 3300050512 Unclassified 552
1439 nmdc:mga0n895_2014993_c1 3300050512 Unclassified 535
1440 nmdc:mga0n895_397902_c1 3300050512 Bacteria 1393
1441 nmdc:mga0rr50_1239469_c1 3300050513 Unclassified 633
1442 nmdc:mga0rr50_1551797_c1 3300050513 Unclassified 559
1443 nmdc:mga0rr50_1641393_c1 3300050513 Unclassified 542
1444 nmdc:mga08x19_172659_c1 3300050514 Bacteria 1473
1445 nmdc:mga0a205_1454072_c1 3300050515 Bacteria 533
1446 nmdc:mga0a205_322471_c1 3300050515 Bacteria 1416
1447 nmdc:mga0a205_811202_c1 3300050515 Bacteria 783
1448 nmdc:mga0a205_968792_c1 3300050515 Unclassified 697
1449 Ga0495595_0288838 3300053084 Bacteria 824
1450 Ga0500566_0442418 3300053094 Bacteria 571
1451 Ga0500655_043141 3300053133 Unclassified 888
1452 Ga0500633_0195074 3300053160 Bacteria 758
1453 Ga0501084_0499091 3300054114 Bacteria 1028
1454 Ga0501084_0618811 3300054114 Bacteria 915
1455 Ga0501084_0732282 3300054114 Unclassified 833
1456 Ga0587084_077701 3300059477 Unclassified 638
1457 Ga0587093_012631 3300059478 Unclassified 1028
1458 Ga0587066_011939 3300059490 Unclassified 1285
1459 Ga0587066_064411 3300059490 Unclassified 756
1460 Ga0587070_018263 3300059491 Unclassified 1147
1461 Ga0587070_235916 3300059491 Unclassified 502
1462 Ga0587073_0022772 3300059492 Bacteria 1220
1463 Ga0587073_0028789 3300059492 Unclassified 1131
1464 Ga0587077_009896 3300059493 Unclassified 1460
1465 Ga0587077_105433 3300059493 Unclassified 683
1466 Ga0587080_056529 3300059503 Unclassified 754
1467 Ga0587080_180120 3300059503 Unclassified 506
1468 Ga0587082_028075 3300059504 Unclassified 963
1469 Ga0587082_057398 3300059504 Unclassified 759
1470 Ga0587083_0008633 3300059505 Unclassified 1601
1471 Ga0587083_0079236 3300059505 Unclassified 779
1472 Ga0587085_003167 3300059506 Bacteria 1761
1473 Ga0587086_006977 3300059507 Bacteria 1281
1474 Ga0587086_038159 3300059507 Unclassified 733
1475 Ga0587088_019415 3300059508 Bacteria 1117
1476 Ga0587088_036209 3300059508 Unclassified 908
1477 Ga0587089_015927 3300059509 Bacteria 997
1478 Ga0587089_021932 3300059509 Unclassified 890
1479 Ga0587089_058658 3300059509 Unclassified 632
1480 Ga0587090_022559 3300059510 Bacteria 995
1481 Ga0587090_036723 3300059510 Unclassified 845
1482 Ga0587091_014316 3300059511 Bacteria 1290
1483 Ga0587091_139962 3300059511 Unclassified 605
1484 Ga0587091_208683 3300059511 Unclassified 528
1485 Ga0587092_024928 3300059512 Unclassified 952
1486 Ga0587092_047651 3300059512 Bacteria 766
1487 Ga0587094_009876 3300059513 Bacteria 1227
1488 Ga0587094_030814 3300059513 Unclassified 830
1489 Ga0587094_066924 3300059513 Unclassified 639
1490 Ga0587098_019251 3300059604 Unclassified 853
1491 Ga0587106_013849 3300059605 Unclassified 1102
1492 Ga0587106_141192 3300059605 Unclassified 528
1493 Ga0587099_063986 3300059622 Unclassified 512
1494 Ga0587101_011992 3300059623 Bacteria 1119
1495 Ga0587101_035396 3300059623 Unclassified 800
1496 Ga0587109_214206 3300059624 Unclassified 507
1497 Ga0587113_006489 3300059625 Bacteria 995
1498 Ga0587128_008914 3300059630 Bacteria 1309
1499 Ga0587128_098881 3300059630 Unclassified 609
1500 Ga0587130_017039 3300059631 Unclassified 761
1501 Ga0587062_129511 3300059639 Unclassified 518
1502 Ga0587067_020773 3300059640 Unclassified 1126
1503 Ga0587067_030361 3300059640 Bacteria 993
1504 Ga0587068_087177 3300059641 Unclassified 639
1505 Ga0587069_009019 3300059642 Unclassified 1277
1506 Ga0587072_031409 3300059643 Bacteria 994
1507 Ga0587075_010783 3300059644 Bacteria 1215
1508 Ga0587075_030657 3300059644 Unclassified 854
1509 Ga0587076_021837 3300059645 Unclassified 1064
1510 Ga0587078_026380 3300059646 Unclassified 763
1511 Ga0587079_064066 3300059647 Unclassified 804
1512 Ga0587079_196547 3300059647 Unclassified 548
1513 Ga0587102_045429 3300059649 Unclassified 578
1514 Ga0587105_007098 3300059651 Unclassified 784
1515 Ga0587105_032989 3300059651 Unclassified 501
1516 Ga0587107_145130 3300059652 Unclassified 511
1517 Ga0587114_016168 3300059655 Unclassified 996
1518 Ga0587114_042778 3300059655 Unclassified 740
1519 Ga0587119_031462 3300059658 Unclassified 727
1520 Ga0587071_026707 3300060344 Unclassified 1090
1521 Ga0501082_0000001 3300060353 Bacteria 209420
1522 Ga0501082_0095630 3300060353 Bacteria 2567
1523 Ga0501082_0205791 3300060353 Bacteria 1712
1524 Ga0501082_0574090 3300060353 Bacteria 987
1525 Ga0530510_0247811 3300061734 Bacteria 1327
1526 Ga0530510_0370195 3300061734 Unclassified 1078
1527 Ga0530510_0551709 3300061734 Unclassified 875
1528 Ga0530510_1205250 3300061734 Bacteria 580

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005345 Ga0070692_10644261 Ga0070692_106442611 39
2 3300005719 Ga0068861_102564558 Ga0068861_1025645582 39
3 3300035691 Ga0373931_0033965 Ga0373931_0033965_527_673 47
4 3300042125 Ga0450923_106454 Ga0450923_106454_337_483 47
5 3300002774 JGI25150J39212_1003133 JGI25150J39212_10031335 48
6 3300003323 rootH1_10117195 rootH1_101171952 48
7 3300005338 Ga0068868_101119674 Ga0068868_1011196741 48
8 3300005365 Ga0070688_100207675 Ga0070688_1002076751 48
9 3300005367 Ga0070667_100377286 Ga0070667_1003772862 48
10 3300005445 Ga0070708_100738985 Ga0070708_1007389852 48
11 3300005467 Ga0070706_100428084 Ga0070706_1004280843 48
12 3300005471 Ga0070698_100180208 Ga0070698_1001802082 48
13 3300005518 Ga0070699_100181860 Ga0070699_1001818601 48
14 3300005539 Ga0068853_100011324 Ga0068853_1000113244 48
15 3300005544 Ga0070686_100006667 Ga0070686_1000066673 48
16 3300005563 Ga0068855_100116447 Ga0068855_1001164473 48
17 3300005577 Ga0068857_102300266 Ga0068857_1023002662 48
18 3300005616 Ga0068852_100295585 Ga0068852_1002955852 48
19 3300005617 Ga0068859_100023227 Ga0068859_1000232272 48
20 3300005617 Ga0068859_101826801 Ga0068859_1018268012 48
21 3300005719 Ga0068861_100048419 Ga0068861_1000484193 48
22 3300005841 Ga0068863_100853902 Ga0068863_1008539022 48
23 3300005842 Ga0068858_100012503 Ga0068858_10001250314 48
24 3300005843 Ga0068860_100405120 Ga0068860_1004051202 48
25 3300005843 Ga0068860_101448991 Ga0068860_1014489912 48
26 3300006173 Ga0070716_100068870 Ga0070716_1000688704 48
27 3300006195 Ga0075366_10126873 Ga0075366_101268733 48
28 3300006237 Ga0097621_100544276 Ga0097621_1005442761 48
29 3300006914 Ga0075436_100721614 Ga0075436_1007216141 48
30 3300006931 Ga0097620_100023227 Ga0097620_1000232272 48
31 3300006931 Ga0097620_101826261 Ga0097620_1018262611 48
32 3300009094 Ga0111539_10675155 Ga0111539_106751551 48
33 3300009098 Ga0105245_10931796 Ga0105245_109317962 48
34 3300009098 Ga0105245_11195087 Ga0105245_111950871 48
35 3300009147 Ga0114129_10517222 Ga0114129_105172222 48
36 3300009174 Ga0105241_10875101 Ga0105241_108751012 48
37 3300009177 Ga0105248_10143487 Ga0105248_101434872 48
38 3300009545 Ga0105237_12786388 Ga0105237_127863881 48
39 3300009551 Ga0105238_10001184 Ga0105238_100011848 48
40 3300013306 Ga0163162_10177007 Ga0163162_101770073 48
41 3300014968 Ga0157379_10015911 Ga0157379_100159118 48
42 3300014969 Ga0157376_10136351 Ga0157376_101363514 48
43 3300025910 Ga0207684_10119835 Ga0207684_101198351 48
44 3300025911 Ga0207654_11385674 Ga0207654_113856742 48
45 3300025922 Ga0207646_10056597 Ga0207646_100565973 48
46 3300025924 Ga0207694_10005101 Ga0207694_100051013 48
47 3300025939 Ga0207665_10037075 Ga0207665_100370751 48
48 3300025942 Ga0207689_11171806 Ga0207689_111718061 48
49 3300025949 Ga0207667_10065082 Ga0207667_100650824 48
50 3300025961 Ga0207712_10584482 Ga0207712_105844822 48
51 3300025986 Ga0207658_10273536 Ga0207658_102735362 48
52 3300026041 Ga0207639_10002644 Ga0207639_100026445 48
53 3300026078 Ga0207702_10343101 Ga0207702_103431013 48
54 3300026078 Ga0207702_10644916 Ga0207702_106449162 48
55 3300026095 Ga0207676_12239877 Ga0207676_122398772 48
56 3300026118 Ga0207675_100236790 Ga0207675_1002367902 48
57 3300026142 Ga0207698_10278488 Ga0207698_102784882 48
58 3300028381 Ga0268264_10370565 Ga0268264_103705652 48
59 3300028381 Ga0268264_10633907 Ga0268264_106339072 48
60 3300028653 Ga0265323_10037767 Ga0265323_100377673 48
61 3300028800 Ga0265338_10007747 Ga0265338_100077479 48
62 3300030731 Ga0316177_1136457 Ga0316177_11364572 48
63 3300030732 Ga0316176_1005077 Ga0316176_10050771 48
64 3300030745 Ga0316182_1208682 Ga0316182_12086822 48
65 3300031251 Ga0265327_10082134 Ga0265327_100821341 48
66 3300042876 Ga0451577_0138218 Ga0451577_0138218_759_911 48
67 3300044673 Ga0453683_0467740 Ga0453683_0467740_179_325 48
68 3300044712 Ga0453684_0084340 Ga0453684_0084340_3617_3769 48
69 3300044712 Ga0453684_0152887 Ga0453684_0152887_397_543 48
70 3300045051 Ga0451576_0001883 Ga0451576_0001883_219_368 48
71 3300046463 Ga0495653_0824971 Ga0495653_0824971_319_465 48
72 3300046536 Ga0495587_0397258 Ga0495587_0397258_182_328 48
73 3300046557 Ga0495622_0344915 Ga0495622_0344915_323_469 48
74 3300046683 Ga0495658_0506217 Ga0495658_0506217_25_171 48
75 3300048908 Ga0496105_0560014 Ga0496105_0560014_621_767 48
76 3300048911 Ga0496108_0069079 Ga0496108_0069079_409_555 48
77 3300048913 Ga0496110_1344930 Ga0496110_1344930_272_418 48
78 3300048914 Ga0496111_0376435 Ga0496111_0376435_294_440 48
79 3300048918 Ga0496115_0003187 Ga0496115_0003187_3067_3213 48
80 3300048918 Ga0496115_0855460 Ga0496115_0855460_12_158 48
81 3300049130 Ga0501310_012639 Ga0501310_012639_36_182 48
82 3300049531 Ga0501315_052556 Ga0501315_052556_58_204 48
83 3300050493 nmdc:mga0k408_151229_c1 nmdc:mga0k408_151229_c1_905_1051 48
84 2162886012 MBSR1b_contig_14242384 MBSR1b_0926.00003820 49
85 2162886012 MBSR1b_contig_8201409 MBSR1b_0652.00004620 49
86 3300001977 JGI24746J21847_1029963 JGI24746J21847_10299632 49
87 3300001977 JGI24746J21847_1043975 JGI24746J21847_10439752 49
88 3300001990 JGI24737J22298_10024215 JGI24737J22298_100242153 49
89 3300001991 JGI24743J22301_10006758 JGI24743J22301_100067581 49
90 3300002070 JGI24750J21931_1028019 JGI24750J21931_10280192 49
91 3300002073 JGI24745J21846_1020836 JGI24745J21846_10208361 49
92 3300002076 JGI24749J21850_1070969 JGI24749J21850_10709691 49
93 3300002126 JGI24035J26624_1004495 JGI24035J26624_10044952 49
94 3300002126 JGI24035J26624_1005983 JGI24035J26624_10059832 49
95 3300002155 JGI24033J26618_1012705 JGI24033J26618_10127052 49
96 3300003323 rootH1_10386370 rootH1_103863702 49
97 3300003577 Ga0007416J51690_1082995 Ga0007416J51690_10829951 49
98 3300003577 Ga0007416J51690_1087572 Ga0007416J51690_10875721 49
99 3300003579 Ga0007429J51699_1116211 Ga0007429J51699_11162112 49
100 3300003693 Ga0032354_1066680 Ga0032354_10666803 49
101 3300003735 Ga0006780_1035515 Ga0006780_10355151 49
102 3300003911 JGI25405J52794_10002815 JGI25405J52794_100028152 49
103 3300003911 JGI25405J52794_10091519 JGI25405J52794_100915192 49
104 3300004798 Ga0058859_10573809 Ga0058859_105738091 49
105 3300004799 Ga0058863_11637505 Ga0058863_116375051 49
106 3300004800 Ga0058861_12064034 Ga0058861_120640341 49
107 3300004801 Ga0058860_10830546 Ga0058860_108305461 49
108 3300004801 Ga0058860_11908751 Ga0058860_119087511 49
109 3300004803 Ga0058862_10065783 Ga0058862_100657831 49
110 3300005289 Ga0065704_10458354 Ga0065704_104583542 49
111 3300005289 Ga0065704_10507344 Ga0065704_105073442 49
112 3300005290 Ga0065712_10048891 Ga0065712_100488911 49
113 3300005290 Ga0065712_10069346 Ga0065712_100693466 49
114 3300005290 Ga0065712_10240498 Ga0065712_102404982 49
115 3300005290 Ga0065712_10259197 Ga0065712_102591973 49
116 3300005293 Ga0065715_10001014 Ga0065715_100010145 49
117 3300005293 Ga0065715_10102904 Ga0065715_101029045 49
118 3300005293 Ga0065715_10182618 Ga0065715_101826183 49
119 3300005293 Ga0065715_10290619 Ga0065715_102906192 49
120 3300005293 Ga0065715_10372329 Ga0065715_103723293 49
121 3300005293 Ga0065715_10674335 Ga0065715_106743351 49
122 3300005295 Ga0065707_10046903 Ga0065707_100469033 49
123 3300005295 Ga0065707_10087756 Ga0065707_100877566 49
124 3300005295 Ga0065707_10374149 Ga0065707_103741492 49
125 3300005295 Ga0065707_10674810 Ga0065707_106748102 49
126 3300005327 Ga0070658_10076572 Ga0070658_100765724 49
127 3300005327 Ga0070658_10095655 Ga0070658_100956553 49
128 3300005327 Ga0070658_11807841 Ga0070658_118078411 49
129 3300005328 Ga0070676_10000418 Ga0070676_100004184 49
130 3300005328 Ga0070676_10522339 Ga0070676_105223391 49
131 3300005328 Ga0070676_10623758 Ga0070676_106237582 49
132 3300005328 Ga0070676_10801171 Ga0070676_108011712 49
133 3300005328 Ga0070676_10853742 Ga0070676_108537421 49
134 3300005329 Ga0070683_100010649 Ga0070683_1000106492 49
135 3300005329 Ga0070683_100017263 Ga0070683_1000172633 49
136 3300005329 Ga0070683_100027215 Ga0070683_1000272155 49
137 3300005329 Ga0070683_100079856 Ga0070683_1000798563 49
138 3300005329 Ga0070683_100134395 Ga0070683_1001343953 49
139 3300005329 Ga0070683_100343424 Ga0070683_1003434242 49
140 3300005329 Ga0070683_100883903 Ga0070683_1008839031 49
141 3300005330 Ga0070690_100043378 Ga0070690_1000433784 49
142 3300005330 Ga0070690_100558308 Ga0070690_1005583081 49
143 3300005331 Ga0070670_100011058 Ga0070670_1000110583 49
144 3300005331 Ga0070670_100074116 Ga0070670_1000741164 49
145 3300005333 Ga0070677_10007365 Ga0070677_100073652 49
146 3300005334 Ga0068869_100054842 Ga0068869_1000548424 49
147 3300005334 Ga0068869_100203957 Ga0068869_1002039572 49
148 3300005334 Ga0068869_100254504 Ga0068869_1002545043 49
149 3300005334 Ga0068869_100945966 Ga0068869_1009459661 49
150 3300005334 Ga0068869_101202165 Ga0068869_1012021652 49
151 3300005334 Ga0068869_101935665 Ga0068869_1019356651 49
152 3300005335 Ga0070666_10005575 Ga0070666_100055754 49
153 3300005335 Ga0070666_10016515 Ga0070666_100165154 49
154 3300005335 Ga0070666_10127985 Ga0070666_101279853 49
155 3300005335 Ga0070666_11180931 Ga0070666_111809311 49
156 3300005336 Ga0070680_100300048 Ga0070680_1003000482 49
157 3300005336 Ga0070680_100859935 Ga0070680_1008599352 49
158 3300005337 Ga0070682_100055437 Ga0070682_1000554373 49
159 3300005338 Ga0068868_100003887 Ga0068868_1000038879 49
160 3300005338 Ga0068868_100022957 Ga0068868_1000229572 49
161 3300005338 Ga0068868_100031456 Ga0068868_1000314564 49
162 3300005338 Ga0068868_100035075 Ga0068868_1000350754 49
163 3300005338 Ga0068868_100175841 Ga0068868_1001758413 49
164 3300005338 Ga0068868_101215670 Ga0068868_1012156702 49
165 3300005339 Ga0070660_100012509 Ga0070660_1000125093 49
166 3300005339 Ga0070660_100258012 Ga0070660_1002580122 49
167 3300005339 Ga0070660_100315672 Ga0070660_1003156721 49
168 3300005340 Ga0070689_100000951 Ga0070689_1000009519 49
169 3300005340 Ga0070689_100008894 Ga0070689_1000088943 49
170 3300005340 Ga0070689_100056957 Ga0070689_1000569574 49
171 3300005340 Ga0070689_100088561 Ga0070689_1000885611 49
172 3300005341 Ga0070691_10243083 Ga0070691_102430832 49
173 3300005341 Ga0070691_10456613 Ga0070691_104566131 49
174 3300005343 Ga0070687_100000361 Ga0070687_1000003612 49
175 3300005343 Ga0070687_100021338 Ga0070687_1000213385 49
176 3300005343 Ga0070687_100040095 Ga0070687_1000400953 49
177 3300005344 Ga0070661_100006977 Ga0070661_1000069776 49
178 3300005344 Ga0070661_100030810 Ga0070661_1000308105 49
179 3300005344 Ga0070661_100033886 Ga0070661_1000338863 49
180 3300005344 Ga0070661_100694709 Ga0070661_1006947092 49
181 3300005345 Ga0070692_10715442 Ga0070692_107154421 49
182 3300005347 Ga0070668_100001339 Ga0070668_10000133911 49
183 3300005347 Ga0070668_100011324 Ga0070668_1000113246 49
184 3300005347 Ga0070668_100087415 Ga0070668_1000874152 49
185 3300005353 Ga0070669_100003769 Ga0070669_1000037697 49
186 3300005353 Ga0070669_100010101 Ga0070669_1000101017 49
187 3300005353 Ga0070669_100062749 Ga0070669_1000627494 49
188 3300005353 Ga0070669_100665988 Ga0070669_1006659881 49
189 3300005353 Ga0070669_101335342 Ga0070669_1013353421 49
190 3300005354 Ga0070675_100000360 Ga0070675_10000036010 49
191 3300005354 Ga0070675_100004745 Ga0070675_1000047459 49
192 3300005354 Ga0070675_100112789 Ga0070675_1001127894 49
193 3300005355 Ga0070671_100002249 Ga0070671_1000022495 49
194 3300005355 Ga0070671_100067121 Ga0070671_1000671214 49
195 3300005355 Ga0070671_100102517 Ga0070671_1001025175 49
196 3300005355 Ga0070671_100211683 Ga0070671_1002116832 49
197 3300005355 Ga0070671_101486856 Ga0070671_1014868561 49
198 3300005355 Ga0070671_101751211 Ga0070671_1017512111 49
199 3300005355 Ga0070671_101848539 Ga0070671_1018485391 49
200 3300005355 Ga0070671_102113366 Ga0070671_1021133661 49
201 3300005356 Ga0070674_100009313 Ga0070674_1000093136 49
202 3300005356 Ga0070674_101635160 Ga0070674_1016351602 49
203 3300005356 Ga0070674_101795797 Ga0070674_1017957971 49
204 3300005364 Ga0070673_100059046 Ga0070673_1000590466 49
205 3300005364 Ga0070673_100068950 Ga0070673_1000689502 49
206 3300005364 Ga0070673_100169580 Ga0070673_1001695802 49
207 3300005364 Ga0070673_100170740 Ga0070673_1001707401 49
208 3300005364 Ga0070673_100941656 Ga0070673_1009416561 49
209 3300005365 Ga0070688_100018693 Ga0070688_1000186935 49
210 3300005365 Ga0070688_100071906 Ga0070688_1000719063 49
211 3300005366 Ga0070659_100001731 Ga0070659_1000017316 49
212 3300005366 Ga0070659_100065735 Ga0070659_1000657353 49
213 3300005366 Ga0070659_100191439 Ga0070659_1001914391 49
214 3300005366 Ga0070659_101927678 Ga0070659_1019276781 49
215 3300005367 Ga0070667_100001138 Ga0070667_1000011389 49
216 3300005367 Ga0070667_100003924 Ga0070667_1000039247 49
217 3300005367 Ga0070667_100120314 Ga0070667_1001203143 49
218 3300005367 Ga0070667_101261312 Ga0070667_1012613122 49
219 3300005406 Ga0070703_10129289 Ga0070703_101292892 49
220 3300005434 Ga0070709_10097351 Ga0070709_100973513 49
221 3300005434 Ga0070709_10115928 Ga0070709_101159282 49
222 3300005434 Ga0070709_10134276 Ga0070709_101342763 49
223 3300005434 Ga0070709_10426617 Ga0070709_104266173 49
224 3300005434 Ga0070709_10426931 Ga0070709_104269311 49
225 3300005435 Ga0070714_100028342 Ga0070714_1000283422 49
226 3300005435 Ga0070714_100475561 Ga0070714_1004755612 49
227 3300005435 Ga0070714_100648771 Ga0070714_1006487711 49
228 3300005435 Ga0070714_101336297 Ga0070714_1013362972 49
229 3300005436 Ga0070713_100047807 Ga0070713_1000478072 49
230 3300005436 Ga0070713_100678121 Ga0070713_1006781213 49
231 3300005437 Ga0070710_10051355 Ga0070710_100513552 49
232 3300005437 Ga0070710_10994818 Ga0070710_109948182 49
233 3300005437 Ga0070710_11494080 Ga0070710_114940802 49
234 3300005438 Ga0070701_10027101 Ga0070701_100271014 49
235 3300005438 Ga0070701_10410704 Ga0070701_104107042 49
236 3300005439 Ga0070711_101121249 Ga0070711_1011212492 49
237 3300005439 Ga0070711_102060469 Ga0070711_1020604691 49
238 3300005440 Ga0070705_100047803 Ga0070705_1000478032 49
239 3300005440 Ga0070705_100066937 Ga0070705_1000669371 49
240 3300005440 Ga0070705_100074876 Ga0070705_1000748763 49
241 3300005440 Ga0070705_100138765 Ga0070705_1001387653 49
242 3300005440 Ga0070705_100563672 Ga0070705_1005636722 49
243 3300005440 Ga0070705_100589801 Ga0070705_1005898012 49
244 3300005440 Ga0070705_100864064 Ga0070705_1008640641 49
245 3300005440 Ga0070705_101957723 Ga0070705_1019577232 49
246 3300005441 Ga0070700_100009155 Ga0070700_1000091554 49
247 3300005441 Ga0070700_100102198 Ga0070700_1001021982 49
248 3300005441 Ga0070700_101559147 Ga0070700_1015591472 49
249 3300005444 Ga0070694_100050845 Ga0070694_1000508453 49
250 3300005444 Ga0070694_100074804 Ga0070694_1000748042 49
251 3300005444 Ga0070694_100666426 Ga0070694_1006664262 49
252 3300005444 Ga0070694_100828183 Ga0070694_1008281832 49
253 3300005444 Ga0070694_100853483 Ga0070694_1008534831 49
254 3300005445 Ga0070708_100012156 Ga0070708_1000121564 49
255 3300005445 Ga0070708_100114605 Ga0070708_1001146052 49
256 3300005445 Ga0070708_100205571 Ga0070708_1002055712 49
257 3300005445 Ga0070708_100895387 Ga0070708_1008953871 49
258 3300005445 Ga0070708_101623374 Ga0070708_1016233742 49
259 3300005455 Ga0070663_100159601 Ga0070663_1001596013 49
260 3300005456 Ga0070678_101290683 Ga0070678_1012906832 49
261 3300005456 Ga0070678_102057956 Ga0070678_1020579561 49
262 3300005457 Ga0070662_100000570 Ga0070662_10000057012 49
263 3300005457 Ga0070662_100006539 Ga0070662_10000653911 49
264 3300005457 Ga0070662_100016016 Ga0070662_1000160166 49
265 3300005457 Ga0070662_100105636 Ga0070662_1001056362 49
266 3300005458 Ga0070681_10014963 Ga0070681_100149638 49
267 3300005458 Ga0070681_10075591 Ga0070681_100755913 49
268 3300005459 Ga0068867_100025103 Ga0068867_1000251036 49
269 3300005459 Ga0068867_100169271 Ga0068867_1001692711 49
270 3300005459 Ga0068867_100701556 Ga0068867_1007015561 49
271 3300005459 Ga0068867_100945807 Ga0068867_1009458071 49
272 3300005459 Ga0068867_101424476 Ga0068867_1014244761 49
273 3300005466 Ga0070685_10034317 Ga0070685_100343175 49
274 3300005467 Ga0070706_100021634 Ga0070706_1000216341 49
275 3300005467 Ga0070706_100201862 Ga0070706_1002018621 49
276 3300005467 Ga0070706_100573863 Ga0070706_1005738632 49
277 3300005467 Ga0070706_100829556 Ga0070706_1008295562 49
278 3300005467 Ga0070706_101135363 Ga0070706_1011353632 49
279 3300005468 Ga0070707_100007972 Ga0070707_1000079725 49
280 3300005468 Ga0070707_100098485 Ga0070707_1000984855 49
281 3300005468 Ga0070707_100146787 Ga0070707_1001467873 49
282 3300005468 Ga0070707_100354881 Ga0070707_1003548812 49
283 3300005468 Ga0070707_101004367 Ga0070707_1010043672 49
284 3300005468 Ga0070707_101289453 Ga0070707_1012894532 49
285 3300005468 Ga0070707_101433484 Ga0070707_1014334842 49
286 3300005471 Ga0070698_100045677 Ga0070698_1000456772 49
287 3300005471 Ga0070698_101228981 Ga0070698_1012289813 49
288 3300005471 Ga0070698_101537069 Ga0070698_1015370692 49
289 3300005471 Ga0070698_101985517 Ga0070698_1019855171 49
290 3300005471 Ga0070698_102180058 Ga0070698_1021800581 49
291 3300005518 Ga0070699_100012669 Ga0070699_1000126695 49
292 3300005518 Ga0070699_100713643 Ga0070699_1007136431 49
293 3300005518 Ga0070699_101330689 Ga0070699_1013306891 49
294 3300005518 Ga0070699_101361395 Ga0070699_1013613952 49
295 3300005518 Ga0070699_102158714 Ga0070699_1021587141 49
296 3300005530 Ga0070679_100002344 Ga0070679_10000234412 49
297 3300005530 Ga0070679_100004021 Ga0070679_10000402114 49
298 3300005530 Ga0070679_100623111 Ga0070679_1006231112 49
299 3300005530 Ga0070679_101453141 Ga0070679_1014531412 49
300 3300005535 Ga0070684_100000110 Ga0070684_10000011033 49
301 3300005535 Ga0070684_100000523 Ga0070684_10000052314 49
302 3300005535 Ga0070684_100015073 Ga0070684_1000150736 49
303 3300005535 Ga0070684_100070037 Ga0070684_1000700371 49
304 3300005535 Ga0070684_100071702 Ga0070684_1000717023 49
305 3300005535 Ga0070684_100105770 Ga0070684_1001057702 49
306 3300005535 Ga0070684_100265868 Ga0070684_1002658683 49
307 3300005535 Ga0070684_101072016 Ga0070684_1010720162 49
308 3300005536 Ga0070697_100003151 Ga0070697_1000031515 49
309 3300005536 Ga0070697_100075581 Ga0070697_1000755811 49
310 3300005536 Ga0070697_100081548 Ga0070697_1000815484 49
311 3300005536 Ga0070697_101062637 Ga0070697_1010626372 49
312 3300005536 Ga0070697_101217611 Ga0070697_1012176111 49
313 3300005536 Ga0070697_101302716 Ga0070697_1013027162 49
314 3300005539 Ga0068853_100002222 Ga0068853_1000022229 49
315 3300005539 Ga0068853_100024353 Ga0068853_1000243536 49
316 3300005539 Ga0068853_100109926 Ga0068853_1001099263 49
317 3300005543 Ga0070672_100005622 Ga0070672_1000056226 49
318 3300005543 Ga0070672_100221563 Ga0070672_1002215632 49
319 3300005543 Ga0070672_100269157 Ga0070672_1002691573 49
320 3300005544 Ga0070686_100052436 Ga0070686_1000524361 49
321 3300005544 Ga0070686_100140984 Ga0070686_1001409841 49
322 3300005544 Ga0070686_100354272 Ga0070686_1003542722 49
323 3300005544 Ga0070686_100594547 Ga0070686_1005945472 49
324 3300005544 Ga0070686_101267599 Ga0070686_1012675992 49
325 3300005545 Ga0070695_100001859 Ga0070695_1000018598 49
326 3300005545 Ga0070695_100506255 Ga0070695_1005062552 49
327 3300005545 Ga0070695_100752721 Ga0070695_1007527211 49
328 3300005545 Ga0070695_101899311 Ga0070695_1018993111 49
329 3300005546 Ga0070696_100061380 Ga0070696_1000613804 49
330 3300005546 Ga0070696_100594979 Ga0070696_1005949793 49
331 3300005546 Ga0070696_100781220 Ga0070696_1007812202 49
332 3300005546 Ga0070696_101515178 Ga0070696_1015151782 49
333 3300005546 Ga0070696_101739384 Ga0070696_1017393842 49
334 3300005547 Ga0070693_100414386 Ga0070693_1004143862 49
335 3300005548 Ga0070665_100031101 Ga0070665_1000311014 49
336 3300005548 Ga0070665_100045170 Ga0070665_1000451704 49
337 3300005548 Ga0070665_100422681 Ga0070665_1004226813 49
338 3300005548 Ga0070665_101128229 Ga0070665_1011282291 49
339 3300005549 Ga0070704_100044846 Ga0070704_1000448464 49
340 3300005549 Ga0070704_100102942 Ga0070704_1001029422 49
341 3300005549 Ga0070704_100200404 Ga0070704_1002004043 49
342 3300005549 Ga0070704_100511688 Ga0070704_1005116881 49
343 3300005549 Ga0070704_100580010 Ga0070704_1005800103 49
344 3300005549 Ga0070704_101724708 Ga0070704_1017247081 49
345 3300005563 Ga0068855_100009737 Ga0068855_1000097372 49
346 3300005563 Ga0068855_100033699 Ga0068855_1000336992 49
347 3300005564 Ga0070664_100061800 Ga0070664_1000618006 49
348 3300005564 Ga0070664_100175364 Ga0070664_1001753644 49
349 3300005564 Ga0070664_100198634 Ga0070664_1001986342 49
350 3300005564 Ga0070664_100337093 Ga0070664_1003370932 49
351 3300005564 Ga0070664_100522606 Ga0070664_1005226062 49
352 3300005577 Ga0068857_100035905 Ga0068857_1000359054 49
353 3300005577 Ga0068857_100154280 Ga0068857_1001542801 49
354 3300005577 Ga0068857_100220699 Ga0068857_1002206993 49
355 3300005577 Ga0068857_100323360 Ga0068857_1003233603 49
356 3300005577 Ga0068857_100994560 Ga0068857_1009945603 49
357 3300005577 Ga0068857_101416477 Ga0068857_1014164773 49
358 3300005577 Ga0068857_102259923 Ga0068857_1022599231 49
359 3300005578 Ga0068854_100049779 Ga0068854_1000497793 49
360 3300005578 Ga0068854_100055299 Ga0068854_1000552993 49
361 3300005578 Ga0068854_100151666 Ga0068854_1001516663 49
362 3300005578 Ga0068854_100609558 Ga0068854_1006095582 49
363 3300005614 Ga0068856_100003860 Ga0068856_1000038604 49
364 3300005614 Ga0068856_100031074 Ga0068856_1000310745 49
365 3300005614 Ga0068856_100130357 Ga0068856_1001303573 49
366 3300005614 Ga0068856_100199016 Ga0068856_1001990162 49
367 3300005614 Ga0068856_100305611 Ga0068856_1003056113 49
368 3300005615 Ga0070702_100025832 Ga0070702_1000258321 49
369 3300005615 Ga0070702_100605280 Ga0070702_1006052802 49
370 3300005615 Ga0070702_100992685 Ga0070702_1009926851 49
371 3300005615 Ga0070702_101722606 Ga0070702_1017226061 49
372 3300005616 Ga0068852_100009188 Ga0068852_1000091883 49
373 3300005616 Ga0068852_100035207 Ga0068852_1000352073 49
374 3300005616 Ga0068852_100067942 Ga0068852_1000679421 49
375 3300005616 Ga0068852_100195988 Ga0068852_1001959883 49
376 3300005616 Ga0068852_100425841 Ga0068852_1004258412 49
377 3300005616 Ga0068852_100613478 Ga0068852_1006134782 49
378 3300005617 Ga0068859_100045876 Ga0068859_1000458766 49
379 3300005617 Ga0068859_100063366 Ga0068859_1000633663 49
380 3300005617 Ga0068859_100070965 Ga0068859_1000709654 49
381 3300005617 Ga0068859_100114165 Ga0068859_1001141652 49
382 3300005617 Ga0068859_100202971 Ga0068859_1002029713 49
383 3300005617 Ga0068859_100420258 Ga0068859_1004202582 49
384 3300005617 Ga0068859_100453774 Ga0068859_1004537742 49
385 3300005618 Ga0068864_100003454 Ga0068864_1000034549 49
386 3300005618 Ga0068864_100095270 Ga0068864_1000952704 49
387 3300005618 Ga0068864_100276103 Ga0068864_1002761035 49
388 3300005618 Ga0068864_100276154 Ga0068864_1002761542 49
389 3300005618 Ga0068864_101146903 Ga0068864_1011469032 49
390 3300005618 Ga0068864_101169306 Ga0068864_1011693062 49
391 3300005618 Ga0068864_102530584 Ga0068864_1025305841 49
392 3300005718 Ga0068866_10009452 Ga0068866_100094525 49
393 3300005718 Ga0068866_10361479 Ga0068866_103614792 49
394 3300005718 Ga0068866_10428845 Ga0068866_104288452 49
395 3300005719 Ga0068861_100054073 Ga0068861_1000540734 49
396 3300005719 Ga0068861_100069321 Ga0068861_1000693212 49
397 3300005719 Ga0068861_100077089 Ga0068861_1000770892 49
398 3300005719 Ga0068861_100124289 Ga0068861_1001242892 49
399 3300005719 Ga0068861_100478422 Ga0068861_1004784221 49
400 3300005719 Ga0068861_102125696 Ga0068861_1021256962 49
401 3300005834 Ga0068851_10007988 Ga0068851_100079883 49
402 3300005834 Ga0068851_10029576 Ga0068851_100295763 49
403 3300005834 Ga0068851_10042166 Ga0068851_100421663 49
404 3300005834 Ga0068851_10191976 Ga0068851_101919762 49
405 3300005834 Ga0068851_10256774 Ga0068851_102567741 49
406 3300005840 Ga0068870_10034678 Ga0068870_100346784 49
407 3300005840 Ga0068870_10576209 Ga0068870_105762092 49
408 3300005841 Ga0068863_100000974 Ga0068863_10000097414 49
409 3300005841 Ga0068863_100007127 Ga0068863_1000071274 49
410 3300005841 Ga0068863_100106002 Ga0068863_1001060024 49
411 3300005841 Ga0068863_100157606 Ga0068863_1001576061 49
412 3300005841 Ga0068863_100235298 Ga0068863_1002352983 49
413 3300005841 Ga0068863_100272384 Ga0068863_1002723842 49
414 3300005841 Ga0068863_101001834 Ga0068863_1010018342 49
415 3300005842 Ga0068858_100002623 Ga0068858_1000026238 49
416 3300005842 Ga0068858_100062288 Ga0068858_1000622882 49
417 3300005842 Ga0068858_100077532 Ga0068858_1000775322 49
418 3300005842 Ga0068858_100178109 Ga0068858_1001781095 49
419 3300005842 Ga0068858_100327128 Ga0068858_1003271282 49
420 3300005842 Ga0068858_101950348 Ga0068858_1019503482 49
421 3300005843 Ga0068860_100001412 Ga0068860_10000141216 49
422 3300005843 Ga0068860_100004098 Ga0068860_10000409819 49
423 3300005843 Ga0068860_100005238 Ga0068860_1000052389 49
424 3300005843 Ga0068860_100025320 Ga0068860_1000253206 49
425 3300005843 Ga0068860_100027817 Ga0068860_1000278178 49
426 3300005843 Ga0068860_100197113 Ga0068860_1001971131 49
427 3300005844 Ga0068862_100013065 Ga0068862_1000130652 49
428 3300005844 Ga0068862_100023721 Ga0068862_1000237216 49
429 3300005844 Ga0068862_100095688 Ga0068862_1000956885 49
430 3300005844 Ga0068862_100957557 Ga0068862_1009575574 49
431 3300005844 Ga0068862_101757105 Ga0068862_1017571051 49
432 3300005844 Ga0068862_102311646 Ga0068862_1023116461 49
433 3300005937 Ga0081455_10000385 Ga0081455_1000038549 49
434 3300005937 Ga0081455_10001418 Ga0081455_100014189 49
435 3300005937 Ga0081455_10057581 Ga0081455_100575812 49
436 3300005937 Ga0081455_10059526 Ga0081455_100595263 49
437 3300005937 Ga0081455_10165062 Ga0081455_101650623 49
438 3300005937 Ga0081455_10639067 Ga0081455_106390672 49
439 3300005937 Ga0081455_10706022 Ga0081455_107060222 49
440 3300005937 Ga0081455_10885070 Ga0081455_108850702 49
441 3300005937 Ga0081455_10993195 Ga0081455_109931951 49
442 3300005985 Ga0081539_10057340 Ga0081539_100573404 49
443 3300005985 Ga0081539_10131913 Ga0081539_101319131 49
444 3300006028 Ga0070717_10029027 Ga0070717_100290273 49
445 3300006028 Ga0070717_10739641 Ga0070717_107396412 49
446 3300006028 Ga0070717_10768654 Ga0070717_107686542 49
447 3300006048 Ga0075363_100216542 Ga0075363_1002165421 49
448 3300006163 Ga0070715_10019964 Ga0070715_100199643 49
449 3300006163 Ga0070715_10024870 Ga0070715_100248703 49
450 3300006163 Ga0070715_10311046 Ga0070715_103110462 49
451 3300006163 Ga0070715_10441016 Ga0070715_104410162 49
452 3300006163 Ga0070715_11088471 Ga0070715_110884712 49
453 3300006173 Ga0070716_100261331 Ga0070716_1002613312 49
454 3300006173 Ga0070716_100836321 Ga0070716_1008363212 49
455 3300006173 Ga0070716_101406932 Ga0070716_1014069321 49
456 3300006175 Ga0070712_100000422 Ga0070712_10000042216 49
457 3300006175 Ga0070712_100065633 Ga0070712_1000656334 49
458 3300006175 Ga0070712_100099079 Ga0070712_1000990792 49
459 3300006175 Ga0070712_101054375 Ga0070712_1010543752 49
460 3300006175 Ga0070712_101724361 Ga0070712_1017243612 49
461 3300006178 Ga0075367_10048417 Ga0075367_100484173 49
462 3300006195 Ga0075366_10844090 Ga0075366_108440902 49
463 3300006237 Ga0097621_100001221 Ga0097621_10000122114 49
464 3300006237 Ga0097621_100032768 Ga0097621_1000327684 49
465 3300006237 Ga0097621_100039388 Ga0097621_1000393883 49
466 3300006237 Ga0097621_100082439 Ga0097621_1000824392 49
467 3300006237 Ga0097621_100115447 Ga0097621_1001154475 49
468 3300006237 Ga0097621_101517081 Ga0097621_1015170811 49
469 3300006353 Ga0075370_10295510 Ga0075370_102955102 49
470 3300006358 Ga0068871_100000577 Ga0068871_1000005778 49
471 3300006358 Ga0068871_100010141 Ga0068871_1000101414 49
472 3300006358 Ga0068871_100024331 Ga0068871_1000243312 49
473 3300006358 Ga0068871_100059020 Ga0068871_1000590202 49
474 3300006358 Ga0068871_100097617 Ga0068871_1000976172 49
475 3300006358 Ga0068871_101077505 Ga0068871_1010775052 49
476 3300006844 Ga0075428_100036788 Ga0075428_1000367889 49
477 3300006844 Ga0075428_100113690 Ga0075428_1001136903 49
478 3300006844 Ga0075428_100341508 Ga0075428_1003415082 49
479 3300006844 Ga0075428_100396864 Ga0075428_1003968642 49
480 3300006844 Ga0075428_101699616 Ga0075428_1016996162 49
481 3300006844 Ga0075428_101810421 Ga0075428_1018104212 49
482 3300006846 Ga0075430_100014611 Ga0075430_1000146112 49
483 3300006846 Ga0075430_100326437 Ga0075430_1003264372 49
484 3300006846 Ga0075430_100842435 Ga0075430_1008424352 49
485 3300006847 Ga0075431_100063943 Ga0075431_1000639436 49
486 3300006847 Ga0075431_100105891 Ga0075431_1001058915 49
487 3300006847 Ga0075431_101211909 Ga0075431_1012119092 49
488 3300006847 Ga0075431_101235827 Ga0075431_1012358271 49
489 3300006847 Ga0075431_102190820 Ga0075431_1021908201 49
490 3300006852 Ga0075433_10014786 Ga0075433_100147862 49
491 3300006852 Ga0075433_10148874 Ga0075433_101488742 49
492 3300006852 Ga0075433_10154580 Ga0075433_101545804 49
493 3300006852 Ga0075433_10234774 Ga0075433_102347742 49
494 3300006852 Ga0075433_10865416 Ga0075433_108654162 49
495 3300006871 Ga0075434_100017000 Ga0075434_1000170003 49
496 3300006871 Ga0075434_100025317 Ga0075434_1000253173 49
497 3300006871 Ga0075434_100978976 Ga0075434_1009789762 49
498 3300006871 Ga0075434_101727921 Ga0075434_1017279212 49
499 3300006871 Ga0075434_102179227 Ga0075434_1021792271 49
500 3300006871 Ga0075434_102309116 Ga0075434_1023091161 49
501 3300006880 Ga0075429_100060513 Ga0075429_1000605132 49
502 3300006880 Ga0075429_100129943 Ga0075429_1001299434 49
503 3300006880 Ga0075429_100153736 Ga0075429_1001537362 49
504 3300006880 Ga0075429_100433546 Ga0075429_1004335462 49
505 3300006880 Ga0075429_101072315 Ga0075429_1010723151 49
506 3300006881 Ga0068865_100028781 Ga0068865_1000287815 49
507 3300006881 Ga0068865_100407035 Ga0068865_1004070352 49
508 3300006881 Ga0068865_101081183 Ga0068865_1010811832 49
509 3300006914 Ga0075436_100166357 Ga0075436_1001663571 49
510 3300006931 Ga0097620_100045876 Ga0097620_1000458766 49
511 3300006931 Ga0097620_100063366 Ga0097620_1000633662 49
512 3300006931 Ga0097620_100070969 Ga0097620_1000709694 49
513 3300006931 Ga0097620_100114166 Ga0097620_1001141662 49
514 3300006931 Ga0097620_100202947 Ga0097620_1002029474 49
515 3300006931 Ga0097620_100420319 Ga0097620_1004203192 49
516 3300006931 Ga0097620_100453800 Ga0097620_1004538002 49
517 3300007076 Ga0075435_100033669 Ga0075435_1000336692 49
518 3300007076 Ga0075435_101580545 Ga0075435_1015805451 49
519 3300007076 Ga0075435_101709217 Ga0075435_1017092171 49
520 3300007076 Ga0075435_101767320 Ga0075435_1017673201 49
521 3300007265 Ga0099794_10584615 Ga0099794_105846151 49
522 3300007788 Ga0099795_10560745 Ga0099795_105607452 49
523 3300009011 Ga0105251_10115959 Ga0105251_101159592 49
524 3300009011 Ga0105251_10146368 Ga0105251_101463682 49
525 3300009011 Ga0105251_10264346 Ga0105251_102643462 49
526 3300009092 Ga0105250_10153247 Ga0105250_101532472 49
527 3300009093 Ga0105240_10000873 Ga0105240_1000087313 49
528 3300009093 Ga0105240_10001323 Ga0105240_1000132325 49
529 3300009093 Ga0105240_10021506 Ga0105240_100215064 49
530 3300009093 Ga0105240_10365894 Ga0105240_103658942 49
531 3300009093 Ga0105240_11446721 Ga0105240_114467212 49
532 3300009094 Ga0111539_10000371 Ga0111539_1000037128 49
533 3300009094 Ga0111539_10027156 Ga0111539_100271566 49
534 3300009094 Ga0111539_10081568 Ga0111539_100815685 49
535 3300009094 Ga0111539_10126374 Ga0111539_101263742 49
536 3300009094 Ga0111539_10264066 Ga0111539_102640662 49
537 3300009094 Ga0111539_10396414 Ga0111539_103964142 49
538 3300009094 Ga0111539_10738954 Ga0111539_107389542 49
539 3300009094 Ga0111539_13284353 Ga0111539_132843532 49
540 3300009098 Ga0105245_10001718 Ga0105245_100017185 49
541 3300009098 Ga0105245_10003144 Ga0105245_1000314411 49
542 3300009098 Ga0105245_10057252 Ga0105245_100572523 49
543 3300009098 Ga0105245_10070000 Ga0105245_100700002 49
544 3300009098 Ga0105245_10080585 Ga0105245_100805852 49
545 3300009098 Ga0105245_10466852 Ga0105245_104668522 49
546 3300009098 Ga0105245_10474382 Ga0105245_104743822 49
547 3300009101 Ga0105247_10001246 Ga0105247_1000124614 49
548 3300009101 Ga0105247_10031295 Ga0105247_100312952 49
549 3300009101 Ga0105247_10091105 Ga0105247_100911052 49
550 3300009101 Ga0105247_10092475 Ga0105247_100924752 49
551 3300009101 Ga0105247_10131636 Ga0105247_101316362 49
552 3300009101 Ga0105247_11504603 Ga0105247_115046031 49
553 3300009147 Ga0114129_10093669 Ga0114129_100936694 49
554 3300009147 Ga0114129_10124261 Ga0114129_101242612 49
555 3300009147 Ga0114129_10169692 Ga0114129_101696923 49
556 3300009147 Ga0114129_10365195 Ga0114129_103651953 49
557 3300009147 Ga0114129_10371602 Ga0114129_103716022 49
558 3300009147 Ga0114129_11735592 Ga0114129_117355922 49
559 3300009147 Ga0114129_12264923 Ga0114129_122649231 49
560 3300009148 Ga0105243_10018079 Ga0105243_100180794 49
561 3300009148 Ga0105243_10053838 Ga0105243_100538382 49
562 3300009148 Ga0105243_10058538 Ga0105243_100585387 49
563 3300009148 Ga0105243_11070589 Ga0105243_110705892 49
564 3300009148 Ga0105243_12059440 Ga0105243_120594401 49
565 3300009174 Ga0105241_10000983 Ga0105241_1000098319 49
566 3300009174 Ga0105241_10001736 Ga0105241_1000173612 49
567 3300009174 Ga0105241_10003627 Ga0105241_100036274 49
568 3300009174 Ga0105241_10036225 Ga0105241_100362252 49
569 3300009174 Ga0105241_10112990 Ga0105241_101129903 49
570 3300009174 Ga0105241_10145484 Ga0105241_101454843 49
571 3300009176 Ga0105242_10018099 Ga0105242_100180992 49
572 3300009176 Ga0105242_10072872 Ga0105242_100728722 49
573 3300009176 Ga0105242_10213464 Ga0105242_102134641 49
574 3300009176 Ga0105242_10264618 Ga0105242_102646182 49
575 3300009176 Ga0105242_10634426 Ga0105242_106344261 49
576 3300009176 Ga0105242_11221675 Ga0105242_112216752 49
577 3300009176 Ga0105242_12839912 Ga0105242_128399122 49
578 3300009177 Ga0105248_10001935 Ga0105248_1000193511 49
579 3300009177 Ga0105248_10014763 Ga0105248_100147636 49
580 3300009177 Ga0105248_10020929 Ga0105248_100209294 49
581 3300009177 Ga0105248_10282450 Ga0105248_102824502 49
582 3300009177 Ga0105248_10363488 Ga0105248_103634882 49
583 3300009177 Ga0105248_10432666 Ga0105248_104326662 49
584 3300009177 Ga0105248_10459845 Ga0105248_104598452 49
585 3300009177 Ga0105248_11149280 Ga0105248_111492803 49
586 3300009177 Ga0105248_11300185 Ga0105248_113001852 49
587 3300009177 Ga0105248_11448541 Ga0105248_114485411 49
588 3300009177 Ga0105248_12284891 Ga0105248_122848911 49
589 3300009545 Ga0105237_10000686 Ga0105237_1000068643 49
590 3300009545 Ga0105237_10015100 Ga0105237_100151004 49
591 3300009545 Ga0105237_10398531 Ga0105237_103985311 49
592 3300009545 Ga0105237_10459718 Ga0105237_104597181 49
593 3300009545 Ga0105237_10486843 Ga0105237_104868432 49
594 3300009545 Ga0105237_10669503 Ga0105237_106695031 49
595 3300009551 Ga0105238_10000083 Ga0105238_100000835 49
596 3300009551 Ga0105238_10001626 Ga0105238_1000162619 49
597 3300009551 Ga0105238_10019760 Ga0105238_100197602 49
598 3300009551 Ga0105238_10041026 Ga0105238_100410264 49
599 3300009551 Ga0105238_10436546 Ga0105238_104365462 49
600 3300009551 Ga0105238_10602847 Ga0105238_106028472 49
601 3300009553 Ga0105249_10000609 Ga0105249_1000060922 49
602 3300009553 Ga0105249_10013478 Ga0105249_100134788 49
603 3300009553 Ga0105249_10078094 Ga0105249_100780945 49
604 3300009553 Ga0105249_10083043 Ga0105249_100830432 49
605 3300009553 Ga0105249_10787145 Ga0105249_107871452 49
606 3300009553 Ga0105249_11496378 Ga0105249_114963781 49
607 3300009553 Ga0105249_12591396 Ga0105249_125913962 49
608 3300009553 Ga0105249_12754685 Ga0105249_127546851 49
609 3300010375 Ga0105239_10002607 Ga0105239_1000260710 49
610 3300010375 Ga0105239_10004332 Ga0105239_1000433213 49
611 3300010375 Ga0105239_10016054 Ga0105239_100160545 49
612 3300010375 Ga0105239_10026115 Ga0105239_100261152 49
613 3300010375 Ga0105239_10042846 Ga0105239_100428462 49
614 3300010375 Ga0105239_10301373 Ga0105239_103013733 49
615 3300010375 Ga0105239_13054485 Ga0105239_130544851 49
616 3300010375 Ga0105239_13079762 Ga0105239_130797621 49
617 3300011119 Ga0105246_10000993 Ga0105246_100009935 49
618 3300012483 Ga0157337_1032241 Ga0157337_10322412 49
619 3300013100 Ga0157373_10083360 Ga0157373_100833603 49
620 3300013100 Ga0157373_10339331 Ga0157373_103393313 49
621 3300013102 Ga0157371_10121362 Ga0157371_101213623 49
622 3300013102 Ga0157371_10656553 Ga0157371_106565531 49
623 3300013104 Ga0157370_10208379 Ga0157370_102083793 49
624 3300013105 Ga0157369_10004527 Ga0157369_100045273 49
625 3300013105 Ga0157369_10119802 Ga0157369_101198024 49
626 3300013105 Ga0157369_10121335 Ga0157369_101213352 49
627 3300013105 Ga0157369_11311204 Ga0157369_113112042 49
628 3300013296 Ga0157374_10006274 Ga0157374_100062746 49
629 3300013296 Ga0157374_10011199 Ga0157374_100111995 49
630 3300013296 Ga0157374_10011244 Ga0157374_100112447 49
631 3300013296 Ga0157374_10030653 Ga0157374_100306535 49
632 3300013296 Ga0157374_10033159 Ga0157374_100331593 49
633 3300013296 Ga0157374_10146488 Ga0157374_101464884 49
634 3300013296 Ga0157374_10516282 Ga0157374_105162822 49
635 3300013296 Ga0157374_11578708 Ga0157374_115787082 49
636 3300013297 Ga0157378_10004372 Ga0157378_100043728 49
637 3300013297 Ga0157378_10013267 Ga0157378_100132678 49
638 3300013297 Ga0157378_10059049 Ga0157378_100590492 49
639 3300013297 Ga0157378_10065400 Ga0157378_100654005 49
640 3300013297 Ga0157378_10127879 Ga0157378_101278793 49
641 3300013297 Ga0157378_10300240 Ga0157378_103002403 49
642 3300013297 Ga0157378_10435786 Ga0157378_104357863 49
643 3300013297 Ga0157378_10724458 Ga0157378_107244582 49
644 3300013297 Ga0157378_11203652 Ga0157378_112036521 49
645 3300013297 Ga0157378_11394101 Ga0157378_113941012 49
646 3300013297 Ga0157378_13294199 Ga0157378_132941991 49
647 3300013297 Ga0157378_13302765 Ga0157378_133027651 49
648 3300013306 Ga0163162_10002560 Ga0163162_100025607 49
649 3300013306 Ga0163162_10003473 Ga0163162_100034733 49
650 3300013306 Ga0163162_10006012 Ga0163162_100060128 49
651 3300013306 Ga0163162_10073177 Ga0163162_100731776 49
652 3300013306 Ga0163162_10080847 Ga0163162_100808476 49
653 3300013306 Ga0163162_10217998 Ga0163162_102179983 49
654 3300013306 Ga0163162_10263694 Ga0163162_102636942 49
655 3300013306 Ga0163162_11031310 Ga0163162_110313102 49
656 3300013307 Ga0157372_10012613 Ga0157372_100126135 49
657 3300013307 Ga0157372_10012966 Ga0157372_100129665 49
658 3300013307 Ga0157372_10025051 Ga0157372_100250514 49
659 3300013307 Ga0157372_10027734 Ga0157372_100277345 49
660 3300013307 Ga0157372_10045286 Ga0157372_100452863 49
661 3300013307 Ga0157372_11258751 Ga0157372_112587511 49
662 3300013308 Ga0157375_10000912 Ga0157375_1000091214 49
663 3300013308 Ga0157375_10028226 Ga0157375_100282262 49
664 3300013308 Ga0157375_10088269 Ga0157375_100882693 49
665 3300013308 Ga0157375_10842351 Ga0157375_108423512 49
666 3300013308 Ga0157375_11665472 Ga0157375_116654722 49
667 3300013308 Ga0157375_11777540 Ga0157375_117775402 49
668 3300014325 Ga0163163_10000990 Ga0163163_100009907 49
669 3300014325 Ga0163163_10029024 Ga0163163_100290245 49
670 3300014325 Ga0163163_10062006 Ga0163163_100620063 49
671 3300014325 Ga0163163_10848919 Ga0163163_108489192 49
672 3300014325 Ga0163163_11732179 Ga0163163_117321793 49
673 3300014326 Ga0157380_10009132 Ga0157380_100091329 49
674 3300014326 Ga0157380_10088504 Ga0157380_100885043 49
675 3300014326 Ga0157380_10098522 Ga0157380_100985223 49
676 3300014326 Ga0157380_10150515 Ga0157380_101505153 49
677 3300014326 Ga0157380_10359334 Ga0157380_103593342 49
678 3300014326 Ga0157380_10797490 Ga0157380_107974902 49
679 3300014326 Ga0157380_11234724 Ga0157380_112347242 49
680 3300014745 Ga0157377_10059755 Ga0157377_100597553 49
681 3300014745 Ga0157377_10249782 Ga0157377_102497823 49
682 3300014745 Ga0157377_10964884 Ga0157377_109648842 49
683 3300014968 Ga0157379_10002598 Ga0157379_1000259810 49
684 3300014968 Ga0157379_10014161 Ga0157379_100141613 49
685 3300014968 Ga0157379_10020313 Ga0157379_100203134 49
686 3300014968 Ga0157379_10127549 Ga0157379_101275491 49
687 3300014968 Ga0157379_10637578 Ga0157379_106375782 49
688 3300014968 Ga0157379_11695101 Ga0157379_116951012 49
689 3300014968 Ga0157379_12032556 Ga0157379_120325561 49
690 3300014969 Ga0157376_10002690 Ga0157376_100026903 49
691 3300014969 Ga0157376_10032695 Ga0157376_100326953 49
692 3300014969 Ga0157376_10499856 Ga0157376_104998562 49
693 3300014969 Ga0157376_10967481 Ga0157376_109674812 49
694 3300014969 Ga0157376_11026982 Ga0157376_110269822 49
695 3300017792 Ga0163161_10029282 Ga0163161_100292823 49
696 3300017792 Ga0163161_10168841 Ga0163161_101688414 49
697 3300017792 Ga0163161_10272827 Ga0163161_102728273 49
698 3300019162 Ga0184597_129778 Ga0184597_1297781 49
699 3300019190 Ga0184600_121265 Ga0184600_1212651 49
700 3300020069 Ga0197907_10324399 Ga0197907_103243992 49
701 3300020069 Ga0197907_11250092 Ga0197907_112500921 49
702 3300020069 Ga0197907_11279047 Ga0197907_112790471 49
703 3300020069 Ga0197907_11386164 Ga0197907_113861641 49
704 3300020070 Ga0206356_10516644 Ga0206356_105166442 49
705 3300020070 Ga0206356_10715572 Ga0206356_107155722 49
706 3300020070 Ga0206356_10844135 Ga0206356_108441352 49
707 3300020070 Ga0206356_11132424 Ga0206356_111324241 49
708 3300020070 Ga0206356_11161235 Ga0206356_111612352 49
709 3300020070 Ga0206356_11205819 Ga0206356_112058192 49
710 3300020070 Ga0206356_11215637 Ga0206356_112156371 49
711 3300020075 Ga0206349_1297786 Ga0206349_12977861 49
712 3300020075 Ga0206349_1835108 Ga0206349_18351082 49
713 3300020075 Ga0206349_1874035 Ga0206349_18740352 49
714 3300020075 Ga0206349_1917504 Ga0206349_19175041 49
715 3300020075 Ga0206349_1919281 Ga0206349_19192811 49
716 3300020076 Ga0206355_1256411 Ga0206355_12564111 49
717 3300020076 Ga0206355_1258114 Ga0206355_12581142 49
718 3300020076 Ga0206355_1262814 Ga0206355_12628142 49
719 3300020076 Ga0206355_1268818 Ga0206355_12688182 49
720 3300020076 Ga0206355_1451817 Ga0206355_14518173 49
721 3300020076 Ga0206355_1687652 Ga0206355_16876522 49
722 3300020077 Ga0206351_10188504 Ga0206351_101885042 49
723 3300020077 Ga0206351_10405074 Ga0206351_104050742 49
724 3300020077 Ga0206351_10700374 Ga0206351_107003741 49
725 3300020077 Ga0206351_10906423 Ga0206351_109064231 49
726 3300020077 Ga0206351_10908887 Ga0206351_109088871 49
727 3300020077 Ga0206351_10957061 Ga0206351_109570612 49
728 3300020078 Ga0206352_10782869 Ga0206352_107828692 49
729 3300020078 Ga0206352_10893130 Ga0206352_108931301 49
730 3300020078 Ga0206352_11038743 Ga0206352_110387432 49
731 3300020078 Ga0206352_11169670 Ga0206352_111696702 49
732 3300020078 Ga0206352_11252282 Ga0206352_112522822 49
733 3300020078 Ga0206352_11295039 Ga0206352_112950392 49
734 3300020078 Ga0206352_11342208 Ga0206352_113422082 49
735 3300020080 Ga0206350_10525024 Ga0206350_105250241 49
736 3300020080 Ga0206350_10561742 Ga0206350_105617422 49
737 3300020080 Ga0206350_10744426 Ga0206350_107444261 49
738 3300020080 Ga0206350_11634810 Ga0206350_116348101 49
739 3300020081 Ga0206354_10491623 Ga0206354_104916231 49
740 3300020081 Ga0206354_11121875 Ga0206354_111218752 49
741 3300020081 Ga0206354_11697218 Ga0206354_116972181 49
742 3300020082 Ga0206353_10553268 Ga0206353_105532682 49
743 3300020082 Ga0206353_11160635 Ga0206353_111606351 49
744 3300020082 Ga0206353_11160646 Ga0206353_111606462 49
745 3300020082 Ga0206353_11283297 Ga0206353_112832971 49
746 3300020082 Ga0206353_11811571 Ga0206353_118115712 49
747 3300020610 Ga0154015_1019451 Ga0154015_10194512 49
748 3300020610 Ga0154015_1270677 Ga0154015_12706772 49
749 3300020610 Ga0154015_1314901 Ga0154015_13149011 49
750 3300021384 Ga0213876_10215943 Ga0213876_102159432 49
751 3300022467 Ga0224712_10180851 Ga0224712_101808511 49
752 3300022467 Ga0224712_10253323 Ga0224712_102533232 49
753 3300022467 Ga0224712_10271147 Ga0224712_102711472 49
754 3300022467 Ga0224712_10282527 Ga0224712_102825271 49
755 3300022467 Ga0224712_10522227 Ga0224712_105222272 49
756 3300022467 Ga0224712_10579271 Ga0224712_105792712 49
757 3300023672 Ga0247553_100118 Ga0247553_1001185 49
758 3300025271 Ga0207666_1010013 Ga0207666_10100132 49
759 3300025271 Ga0207666_1020265 Ga0207666_10202652 49
760 3300025315 Ga0207697_10000006 Ga0207697_1000000664 49
761 3300025315 Ga0207697_10000780 Ga0207697_1000078016 49
762 3300025315 Ga0207697_10002440 Ga0207697_100024404 49
763 3300025315 Ga0207697_10376224 Ga0207697_103762241 49
764 3300025321 Ga0207656_10019971 Ga0207656_100199712 49
765 3300025321 Ga0207656_10067747 Ga0207656_100677472 49
766 3300025321 Ga0207656_10106207 Ga0207656_101062072 49
767 3300025321 Ga0207656_10230723 Ga0207656_102307231 49
768 3300025321 Ga0207656_10306886 Ga0207656_103068861 49
769 3300025711 Ga0207696_1115898 Ga0207696_11158982 49
770 3300025885 Ga0207653_10004397 Ga0207653_100043975 49
771 3300025885 Ga0207653_10227564 Ga0207653_102275643 49
772 3300025893 Ga0207682_10003312 Ga0207682_100033127 49
773 3300025898 Ga0207692_10024648 Ga0207692_100246482 49
774 3300025898 Ga0207692_10032655 Ga0207692_100326554 49
775 3300025898 Ga0207692_10265768 Ga0207692_102657683 49
776 3300025898 Ga0207692_10806008 Ga0207692_108060082 49
777 3300025899 Ga0207642_10004743 Ga0207642_100047436 49
778 3300025899 Ga0207642_10503365 Ga0207642_105033652 49
779 3300025900 Ga0207710_10000831 Ga0207710_100008314 49
780 3300025900 Ga0207710_10048282 Ga0207710_100482822 49
781 3300025900 Ga0207710_10180517 Ga0207710_101805172 49
782 3300025900 Ga0207710_10191476 Ga0207710_101914761 49
783 3300025901 Ga0207688_10005241 Ga0207688_100052414 49
784 3300025901 Ga0207688_10355584 Ga0207688_103555842 49
785 3300025901 Ga0207688_11000942 Ga0207688_110009422 49
786 3300025903 Ga0207680_10010390 Ga0207680_100103906 49
787 3300025903 Ga0207680_10108407 Ga0207680_101084072 49
788 3300025903 Ga0207680_10488712 Ga0207680_104887122 49
789 3300025903 Ga0207680_10966284 Ga0207680_109662841 49
790 3300025904 Ga0207647_10026420 Ga0207647_100264202 49
791 3300025904 Ga0207647_10045450 Ga0207647_100454504 49
792 3300025904 Ga0207647_10150472 Ga0207647_101504723 49
793 3300025905 Ga0207685_10018562 Ga0207685_100185622 49
794 3300025905 Ga0207685_10342396 Ga0207685_103423962 49
795 3300025905 Ga0207685_10658975 Ga0207685_106589751 49
796 3300025906 Ga0207699_10033122 Ga0207699_100331222 49
797 3300025906 Ga0207699_10271497 Ga0207699_102714972 49
798 3300025906 Ga0207699_10396846 Ga0207699_103968461 49
799 3300025906 Ga0207699_10467861 Ga0207699_104678612 49
800 3300025906 Ga0207699_10619847 Ga0207699_106198472 49
801 3300025906 Ga0207699_11282786 Ga0207699_112827861 49
802 3300025906 Ga0207699_11325765 Ga0207699_113257651 49
803 3300025907 Ga0207645_10000071 Ga0207645_1000007121 49
804 3300025907 Ga0207645_10002340 Ga0207645_100023405 49
805 3300025907 Ga0207645_10024039 Ga0207645_100240393 49
806 3300025907 Ga0207645_10232344 Ga0207645_102323442 49
807 3300025907 Ga0207645_10886918 Ga0207645_108869182 49
808 3300025908 Ga0207643_10001825 Ga0207643_100018256 49
809 3300025909 Ga0207705_10044589 Ga0207705_100445893 49
810 3300025909 Ga0207705_10086494 Ga0207705_100864943 49
811 3300025909 Ga0207705_10160274 Ga0207705_101602744 49
812 3300025909 Ga0207705_10275115 Ga0207705_102751152 49
813 3300025910 Ga0207684_10000032 Ga0207684_10000032201 49
814 3300025910 Ga0207684_10003246 Ga0207684_1000324615 49
815 3300025910 Ga0207684_10011152 Ga0207684_100111528 49
816 3300025910 Ga0207684_10075694 Ga0207684_100756941 49
817 3300025910 Ga0207684_11006226 Ga0207684_110062261 49
818 3300025910 Ga0207684_11297323 Ga0207684_112973232 49
819 3300025911 Ga0207654_10000023 Ga0207654_1000002327 49
820 3300025911 Ga0207654_10000668 Ga0207654_100006684 49
821 3300025911 Ga0207654_10000858 Ga0207654_100008585 49
822 3300025911 Ga0207654_10024153 Ga0207654_100241532 49
823 3300025911 Ga0207654_10230781 Ga0207654_102307812 49
824 3300025911 Ga0207654_10342235 Ga0207654_103422351 49
825 3300025911 Ga0207654_10453387 Ga0207654_104533873 49
826 3300025911 Ga0207654_11450163 Ga0207654_114501631 49
827 3300025912 Ga0207707_10018524 Ga0207707_100185243 49
828 3300025912 Ga0207707_10027394 Ga0207707_100273946 49
829 3300025912 Ga0207707_10188095 Ga0207707_101880952 49
830 3300025912 Ga0207707_10519191 Ga0207707_105191911 49
831 3300025913 Ga0207695_10000113 Ga0207695_1000011326 49
832 3300025913 Ga0207695_10000188 Ga0207695_1000018813 49
833 3300025913 Ga0207695_10000338 Ga0207695_100003385 49
834 3300025913 Ga0207695_10030295 Ga0207695_100302951 49
835 3300025913 Ga0207695_10110382 Ga0207695_101103822 49
836 3300025913 Ga0207695_10125368 Ga0207695_101253682 49
837 3300025913 Ga0207695_11266651 Ga0207695_112666512 49
838 3300025914 Ga0207671_10000145 Ga0207671_100001456 49
839 3300025914 Ga0207671_10000506 Ga0207671_1000050634 49
840 3300025914 Ga0207671_10209158 Ga0207671_102091583 49
841 3300025914 Ga0207671_10271655 Ga0207671_102716552 49
842 3300025914 Ga0207671_10336731 Ga0207671_103367313 49
843 3300025914 Ga0207671_11011833 Ga0207671_110118332 49
844 3300025914 Ga0207671_11045780 Ga0207671_110457802 49
845 3300025915 Ga0207693_10000509 Ga0207693_1000050917 49
846 3300025915 Ga0207693_10005034 Ga0207693_100050346 49
847 3300025915 Ga0207693_10035797 Ga0207693_100357972 49
848 3300025915 Ga0207693_10177522 Ga0207693_101775223 49
849 3300025915 Ga0207693_10312386 Ga0207693_103123861 49
850 3300025915 Ga0207693_11049377 Ga0207693_110493771 49
851 3300025916 Ga0207663_10006497 Ga0207663_100064976 49
852 3300025916 Ga0207663_10293696 Ga0207663_102936963 49
853 3300025916 Ga0207663_10460865 Ga0207663_104608652 49
854 3300025916 Ga0207663_10772164 Ga0207663_107721642 49
855 3300025917 Ga0207660_10009241 Ga0207660_100092413 49
856 3300025917 Ga0207660_10872097 Ga0207660_108720972 49
857 3300025917 Ga0207660_10981310 Ga0207660_109813102 49
858 3300025917 Ga0207660_11566210 Ga0207660_115662102 49
859 3300025918 Ga0207662_10000982 Ga0207662_1000098210 49
860 3300025918 Ga0207662_10031481 Ga0207662_100314814 49
861 3300025918 Ga0207662_10073670 Ga0207662_100736703 49
862 3300025918 Ga0207662_10305736 Ga0207662_103057362 49
863 3300025919 Ga0207657_10224725 Ga0207657_102247252 49
864 3300025919 Ga0207657_10525388 Ga0207657_105253882 49
865 3300025919 Ga0207657_10683319 Ga0207657_106833193 49
866 3300025919 Ga0207657_10755408 Ga0207657_107554082 49
867 3300025919 Ga0207657_11366482 Ga0207657_113664821 49
868 3300025920 Ga0207649_10019388 Ga0207649_100193882 49
869 3300025920 Ga0207649_10021494 Ga0207649_100214942 49
870 3300025920 Ga0207649_10053841 Ga0207649_100538414 49
871 3300025920 Ga0207649_10131767 Ga0207649_101317673 49
872 3300025920 Ga0207649_10946755 Ga0207649_109467551 49
873 3300025921 Ga0207652_10001839 Ga0207652_1000183912 49
874 3300025921 Ga0207652_10014955 Ga0207652_100149557 49
875 3300025921 Ga0207652_10913376 Ga0207652_109133761 49
876 3300025922 Ga0207646_10061224 Ga0207646_100612244 49
877 3300025922 Ga0207646_10064592 Ga0207646_100645926 49
878 3300025922 Ga0207646_10371726 Ga0207646_103717262 49
879 3300025922 Ga0207646_10747916 Ga0207646_107479162 49
880 3300025922 Ga0207646_10897852 Ga0207646_108978522 49
881 3300025923 Ga0207681_10011809 Ga0207681_100118093 49
882 3300025923 Ga0207681_10018647 Ga0207681_100186474 49
883 3300025923 Ga0207681_10020853 Ga0207681_100208539 49
884 3300025923 Ga0207681_11409261 Ga0207681_114092611 49
885 3300025923 Ga0207681_11489715 Ga0207681_114897152 49
886 3300025924 Ga0207694_10000076 Ga0207694_1000007662 49
887 3300025924 Ga0207694_10000085 Ga0207694_1000008594 49
888 3300025924 Ga0207694_10001059 Ga0207694_1000105916 49
889 3300025924 Ga0207694_10012774 Ga0207694_100127746 49
890 3300025924 Ga0207694_10244570 Ga0207694_102445702 49
891 3300025924 Ga0207694_10322145 Ga0207694_103221453 49
892 3300025924 Ga0207694_10534474 Ga0207694_105344742 49
893 3300025924 Ga0207694_11122480 Ga0207694_111224802 49
894 3300025924 Ga0207694_11367276 Ga0207694_113672762 49
895 3300025925 Ga0207650_10008426 Ga0207650_100084266 49
896 3300025925 Ga0207650_10028473 Ga0207650_100284734 49
897 3300025925 Ga0207650_10638442 Ga0207650_106384421 49
898 3300025926 Ga0207659_10011630 Ga0207659_100116308 49
899 3300025926 Ga0207659_10018061 Ga0207659_100180614 49
900 3300025926 Ga0207659_10230470 Ga0207659_102304703 49
901 3300025927 Ga0207687_10007183 Ga0207687_100071835 49
902 3300025927 Ga0207687_10069733 Ga0207687_100697334 49
903 3300025927 Ga0207687_10075565 Ga0207687_100755651 49
904 3300025927 Ga0207687_10085461 Ga0207687_100854611 49
905 3300025927 Ga0207687_10104912 Ga0207687_101049124 49
906 3300025927 Ga0207687_10398889 Ga0207687_103988892 49
907 3300025927 Ga0207687_10536014 Ga0207687_105360142 49
908 3300025928 Ga0207700_10050602 Ga0207700_100506022 49
909 3300025928 Ga0207700_10688130 Ga0207700_106881302 49
910 3300025929 Ga0207664_10140945 Ga0207664_101409451 49
911 3300025929 Ga0207664_10298205 Ga0207664_102982052 49
912 3300025929 Ga0207664_10447526 Ga0207664_104475262 49
913 3300025929 Ga0207664_11013951 Ga0207664_110139512 49
914 3300025931 Ga0207644_10001426 Ga0207644_100014268 49
915 3300025931 Ga0207644_10041382 Ga0207644_100413823 49
916 3300025931 Ga0207644_10056522 Ga0207644_100565223 49
917 3300025931 Ga0207644_10074074 Ga0207644_100740743 49
918 3300025931 Ga0207644_10116851 Ga0207644_101168515 49
919 3300025931 Ga0207644_10166355 Ga0207644_101663552 49
920 3300025931 Ga0207644_10462805 Ga0207644_104628052 49
921 3300025932 Ga0207690_10005886 Ga0207690_100058863 49
922 3300025932 Ga0207690_10014322 Ga0207690_100143226 49
923 3300025933 Ga0207706_10000835 Ga0207706_1000083522 49
924 3300025933 Ga0207706_10022504 Ga0207706_100225042 49
925 3300025933 Ga0207706_10029024 Ga0207706_100290244 49
926 3300025933 Ga0207706_10053786 Ga0207706_100537863 49
927 3300025933 Ga0207706_10058900 Ga0207706_100589003 49
928 3300025933 Ga0207706_10520645 Ga0207706_105206451 49
929 3300025934 Ga0207686_10039911 Ga0207686_100399115 49
930 3300025934 Ga0207686_10202743 Ga0207686_102027434 49
931 3300025934 Ga0207686_10315580 Ga0207686_103155802 49
932 3300025934 Ga0207686_10466054 Ga0207686_104660541 49
933 3300025934 Ga0207686_10546273 Ga0207686_105462731 49
934 3300025934 Ga0207686_10641764 Ga0207686_106417642 49
935 3300025934 Ga0207686_11202376 Ga0207686_112023761 49
936 3300025934 Ga0207686_11511546 Ga0207686_115115461 49
937 3300025935 Ga0207709_10153255 Ga0207709_101532552 49
938 3300025935 Ga0207709_10420036 Ga0207709_104200362 49
939 3300025935 Ga0207709_10490659 Ga0207709_104906593 49
940 3300025935 Ga0207709_11149403 Ga0207709_111494031 49
941 3300025936 Ga0207670_10012608 Ga0207670_100126083 49
942 3300025936 Ga0207670_10034843 Ga0207670_100348432 49
943 3300025936 Ga0207670_10055383 Ga0207670_100553832 49
944 3300025936 Ga0207670_10221545 Ga0207670_102215452 49
945 3300025937 Ga0207669_10002444 Ga0207669_100024446 49
946 3300025938 Ga0207704_10074481 Ga0207704_100744813 49
947 3300025938 Ga0207704_10218092 Ga0207704_102180922 49
948 3300025938 Ga0207704_10990751 Ga0207704_109907511 49
949 3300025939 Ga0207665_10101170 Ga0207665_101011702 49
950 3300025940 Ga0207691_10015890 Ga0207691_100158906 49
951 3300025940 Ga0207691_10259128 Ga0207691_102591283 49
952 3300025940 Ga0207691_10306957 Ga0207691_103069573 49
953 3300025940 Ga0207691_10465035 Ga0207691_104650352 49
954 3300025941 Ga0207711_10000992 Ga0207711_1000099214 49
955 3300025941 Ga0207711_10011105 Ga0207711_100111053 49
956 3300025941 Ga0207711_10015238 Ga0207711_100152386 49
957 3300025941 Ga0207711_10016385 Ga0207711_100163853 49
958 3300025941 Ga0207711_10097307 Ga0207711_100973072 49
959 3300025941 Ga0207711_10850507 Ga0207711_108505071 49
960 3300025941 Ga0207711_10933335 Ga0207711_109333352 49
961 3300025942 Ga0207689_10000936 Ga0207689_1000093616 49
962 3300025942 Ga0207689_10005617 Ga0207689_100056174 49
963 3300025942 Ga0207689_10007815 Ga0207689_100078157 49
964 3300025942 Ga0207689_10079940 Ga0207689_100799402 49
965 3300025942 Ga0207689_10207224 Ga0207689_102072241 49
966 3300025942 Ga0207689_10220434 Ga0207689_102204342 49
967 3300025942 Ga0207689_10249036 Ga0207689_102490362 49
968 3300025944 Ga0207661_10002184 Ga0207661_100021845 49
969 3300025944 Ga0207661_10003133 Ga0207661_100031338 49
970 3300025944 Ga0207661_10005275 Ga0207661_1000527510 49
971 3300025944 Ga0207661_10006124 Ga0207661_100061243 49
972 3300025944 Ga0207661_10036591 Ga0207661_100365913 49
973 3300025944 Ga0207661_10085703 Ga0207661_100857032 49
974 3300025944 Ga0207661_10168298 Ga0207661_101682984 49
975 3300025944 Ga0207661_10561959 Ga0207661_105619592 49
976 3300025944 Ga0207661_10632361 Ga0207661_106323611 49
977 3300025944 Ga0207661_10732003 Ga0207661_107320032 49
978 3300025945 Ga0207679_10086413 Ga0207679_100864135 49
979 3300025945 Ga0207679_10096016 Ga0207679_100960163 49
980 3300025945 Ga0207679_10110884 Ga0207679_101108842 49
981 3300025945 Ga0207679_10221701 Ga0207679_102217012 49
982 3300025945 Ga0207679_10295079 Ga0207679_102950792 49
983 3300025945 Ga0207679_10498582 Ga0207679_104985821 49
984 3300025945 Ga0207679_12106558 Ga0207679_121065581 49
985 3300025949 Ga0207667_10024639 Ga0207667_100246395 49
986 3300025949 Ga0207667_10037735 Ga0207667_100377354 49
987 3300025949 Ga0207667_10062221 Ga0207667_100622213 49
988 3300025949 Ga0207667_10223914 Ga0207667_102239142 49
989 3300025949 Ga0207667_11152628 Ga0207667_111526282 49
990 3300025949 Ga0207667_11237901 Ga0207667_112379011 49
991 3300025949 Ga0207667_11879650 Ga0207667_118796502 49
992 3300025960 Ga0207651_10071094 Ga0207651_100710943 49
993 3300025960 Ga0207651_10116699 Ga0207651_101166992 49
994 3300025960 Ga0207651_10288970 Ga0207651_102889702 49
995 3300025960 Ga0207651_10509413 Ga0207651_105094132 49
996 3300025960 Ga0207651_10924059 Ga0207651_109240591 49
997 3300025960 Ga0207651_11436738 Ga0207651_114367381 49
998 3300025961 Ga0207712_10011388 Ga0207712_100113882 49
999 3300025961 Ga0207712_10044880 Ga0207712_100448803 49
1000 3300025961 Ga0207712_10082829 Ga0207712_100828293 49
1001 3300025961 Ga0207712_10086875 Ga0207712_100868754 49
1002 3300025961 Ga0207712_11367359 Ga0207712_113673592 49
1003 3300025961 Ga0207712_11574167 Ga0207712_115741671 49
1004 3300025972 Ga0207668_10012145 Ga0207668_100121457 49
1005 3300025972 Ga0207668_10036595 Ga0207668_100365955 49
1006 3300025972 Ga0207668_10036798 Ga0207668_100367982 49
1007 3300025972 Ga0207668_10570720 Ga0207668_105707201 49
1008 3300025981 Ga0207640_10041395 Ga0207640_100413954 49
1009 3300025981 Ga0207640_10292782 Ga0207640_102927821 49
1010 3300025981 Ga0207640_10406645 Ga0207640_104066451 49
1011 3300025981 Ga0207640_10533773 Ga0207640_105337732 49
1012 3300025986 Ga0207658_10000721 Ga0207658_1000072125 49
1013 3300025986 Ga0207658_10011703 Ga0207658_100117039 49
1014 3300025986 Ga0207658_10027685 Ga0207658_100276852 49
1015 3300025986 Ga0207658_10637673 Ga0207658_106376732 49
1016 3300025986 Ga0207658_11200364 Ga0207658_112003642 49
1017 3300025986 Ga0207658_11220208 Ga0207658_112202081 49
1018 3300026023 Ga0207677_10000697 Ga0207677_1000069713 49
1019 3300026023 Ga0207677_10169968 Ga0207677_101699682 49
1020 3300026023 Ga0207677_10184760 Ga0207677_101847603 49
1021 3300026023 Ga0207677_10288948 Ga0207677_102889482 49
1022 3300026023 Ga0207677_10336818 Ga0207677_103368183 49
1023 3300026023 Ga0207677_11056612 Ga0207677_110566121 49
1024 3300026023 Ga0207677_12042237 Ga0207677_120422371 49
1025 3300026035 Ga0207703_10002669 Ga0207703_1000266914 49
1026 3300026035 Ga0207703_10018927 Ga0207703_100189273 49
1027 3300026035 Ga0207703_10087496 Ga0207703_100874962 49
1028 3300026035 Ga0207703_10103649 Ga0207703_101036493 49
1029 3300026035 Ga0207703_10609390 Ga0207703_106093901 49
1030 3300026041 Ga0207639_10000072 Ga0207639_100000725 49
1031 3300026041 Ga0207639_10014151 Ga0207639_100141514 49
1032 3300026041 Ga0207639_10091496 Ga0207639_100914962 49
1033 3300026041 Ga0207639_10140214 Ga0207639_101402143 49
1034 3300026041 Ga0207639_10163447 Ga0207639_101634472 49
1035 3300026041 Ga0207639_10721623 Ga0207639_107216232 49
1036 3300026041 Ga0207639_11390124 Ga0207639_113901242 49
1037 3300026041 Ga0207639_11411348 Ga0207639_114113482 49
1038 3300026067 Ga0207678_10069636 Ga0207678_100696361 49
1039 3300026067 Ga0207678_10144168 Ga0207678_101441683 49
1040 3300026067 Ga0207678_10990235 Ga0207678_109902353 49
1041 3300026067 Ga0207678_11023174 Ga0207678_110231741 49
1042 3300026075 Ga0207708_10052624 Ga0207708_100526246 49
1043 3300026078 Ga0207702_10006483 Ga0207702_100064835 49
1044 3300026078 Ga0207702_10016091 Ga0207702_100160912 49
1045 3300026078 Ga0207702_10273811 Ga0207702_102738111 49
1046 3300026078 Ga0207702_10335056 Ga0207702_103350562 49
1047 3300026078 Ga0207702_11255265 Ga0207702_112552651 49
1048 3300026078 Ga0207702_11806514 Ga0207702_118065142 49
1049 3300026078 Ga0207702_11942626 Ga0207702_119426262 49
1050 3300026088 Ga0207641_10003347 Ga0207641_100033473 49
1051 3300026088 Ga0207641_10020959 Ga0207641_100209596 49
1052 3300026088 Ga0207641_10061136 Ga0207641_100611363 49
1053 3300026088 Ga0207641_10105292 Ga0207641_101052924 49
1054 3300026088 Ga0207641_10166113 Ga0207641_101661132 49
1055 3300026088 Ga0207641_10237758 Ga0207641_102377582 49
1056 3300026088 Ga0207641_10333580 Ga0207641_103335802 49
1057 3300026088 Ga0207641_10610842 Ga0207641_106108422 49
1058 3300026089 Ga0207648_10022243 Ga0207648_100222435 49
1059 3300026089 Ga0207648_10073512 Ga0207648_100735122 49
1060 3300026089 Ga0207648_10458456 Ga0207648_104584563 49
1061 3300026089 Ga0207648_10550496 Ga0207648_105504961 49
1062 3300026089 Ga0207648_10862644 Ga0207648_108626442 49
1063 3300026089 Ga0207648_11775287 Ga0207648_117752871 49
1064 3300026095 Ga0207676_10005629 Ga0207676_100056295 49
1065 3300026095 Ga0207676_10039951 Ga0207676_100399513 49
1066 3300026095 Ga0207676_10212667 Ga0207676_102126673 49
1067 3300026095 Ga0207676_10437656 Ga0207676_104376562 49
1068 3300026095 Ga0207676_10628058 Ga0207676_106280581 49
1069 3300026095 Ga0207676_11658607 Ga0207676_116586072 49
1070 3300026095 Ga0207676_11718266 Ga0207676_117182662 49
1071 3300026095 Ga0207676_11985695 Ga0207676_119856952 49
1072 3300026116 Ga0207674_10006105 Ga0207674_100061053 49
1073 3300026116 Ga0207674_10026877 Ga0207674_100268772 49
1074 3300026116 Ga0207674_10112388 Ga0207674_101123883 49
1075 3300026116 Ga0207674_10571134 Ga0207674_105711341 49
1076 3300026116 Ga0207674_10933541 Ga0207674_109335413 49
1077 3300026116 Ga0207674_11152808 Ga0207674_111528082 49
1078 3300026118 Ga0207675_100006619 Ga0207675_1000066199 49
1079 3300026118 Ga0207675_100092204 Ga0207675_1000922043 49
1080 3300026118 Ga0207675_100172832 Ga0207675_1001728322 49
1081 3300026118 Ga0207675_100252565 Ga0207675_1002525653 49
1082 3300026118 Ga0207675_100675252 Ga0207675_1006752522 49
1083 3300026118 Ga0207675_100723374 Ga0207675_1007233742 49
1084 3300026118 Ga0207675_102532205 Ga0207675_1025322051 49
1085 3300026121 Ga0207683_10000392 Ga0207683_1000039215 49
1086 3300026121 Ga0207683_10058359 Ga0207683_100583596 49
1087 3300026142 Ga0207698_10002536 Ga0207698_100025365 49
1088 3300026142 Ga0207698_10006606 Ga0207698_100066066 49
1089 3300026142 Ga0207698_10037024 Ga0207698_100370243 49
1090 3300026142 Ga0207698_10094864 Ga0207698_100948641 49
1091 3300026142 Ga0207698_10575811 Ga0207698_105758112 49
1092 3300026142 Ga0207698_11042794 Ga0207698_110427942 49
1093 3300026142 Ga0207698_11071263 Ga0207698_110712632 49
1094 3300026142 Ga0207698_11134968 Ga0207698_111349683 49
1095 3300027543 Ga0209999_1064506 Ga0209999_10645062 49
1096 3300027717 Ga0209998_10175110 Ga0209998_101751102 49
1097 3300027907 Ga0207428_10000608 Ga0207428_100006083 49
1098 3300027907 Ga0207428_10015891 Ga0207428_100158914 49
1099 3300027907 Ga0207428_10287312 Ga0207428_102873122 49
1100 3300027907 Ga0207428_10567855 Ga0207428_105678552 49
1101 3300027907 Ga0207428_10675362 Ga0207428_106753622 49
1102 3300027907 Ga0207428_11032171 Ga0207428_110321711 49
1103 3300028016 Ga0265354_1000098 Ga0265354_100009811 49
1104 3300028016 Ga0265354_1000950 Ga0265354_10009504 49
1105 3300028036 Ga0265355_1012880 Ga0265355_10128802 49
1106 3300028379 Ga0268266_10028937 Ga0268266_100289376 49
1107 3300028379 Ga0268266_10051630 Ga0268266_100516304 49
1108 3300028379 Ga0268266_10752208 Ga0268266_107522082 49
1109 3300028379 Ga0268266_10872161 Ga0268266_108721613 49
1110 3300028379 Ga0268266_11267437 Ga0268266_112674373 49
1111 3300028379 Ga0268266_12009194 Ga0268266_120091942 49
1112 3300028380 Ga0268265_10036595 Ga0268265_100365954 49
1113 3300028380 Ga0268265_10074665 Ga0268265_100746653 49
1114 3300028380 Ga0268265_10100723 Ga0268265_101007232 49
1115 3300028380 Ga0268265_10139054 Ga0268265_101390543 49
1116 3300028380 Ga0268265_10835675 Ga0268265_108356753 49
1117 3300028380 Ga0268265_11033087 Ga0268265_110330872 49
1118 3300028380 Ga0268265_11459766 Ga0268265_114597661 49
1119 3300028381 Ga0268264_10001264 Ga0268264_100012646 49
1120 3300028381 Ga0268264_10014533 Ga0268264_100145332 49
1121 3300028381 Ga0268264_10016196 Ga0268264_100161963 49
1122 3300028381 Ga0268264_10024740 Ga0268264_100247406 49
1123 3300028381 Ga0268264_10240123 Ga0268264_102401233 49
1124 3300028381 Ga0268264_10247856 Ga0268264_102478562 49
1125 3300028381 Ga0268264_10453754 Ga0268264_104537543 49
1126 3300028558 Ga0265326_10035795 Ga0265326_100357953 49
1127 3300028563 Ga0265319_1093397 Ga0265319_10933972 49
1128 3300028653 Ga0265323_10001642 Ga0265323_100016421 49
1129 3300028653 Ga0265323_10029672 Ga0265323_100296724 49
1130 3300028653 Ga0265323_10035115 Ga0265323_100351155 49
1131 3300028800 Ga0265338_10036426 Ga0265338_100364265 49
1132 3300028800 Ga0265338_10051346 Ga0265338_100513466 49
1133 3300028800 Ga0265338_10716149 Ga0265338_107161492 49
1134 3300030878 Ga0265770_1002035 Ga0265770_10020353 49
1135 3300030879 Ga0265765_1001343 Ga0265765_10013432 49
1136 3300030879 Ga0265765_1036246 Ga0265765_10362462 49
1137 3300031090 Ga0265760_10001198 Ga0265760_100011985 49
1138 3300031090 Ga0265760_10014078 Ga0265760_100140782 49
1139 3300031235 Ga0265330_10004895 Ga0265330_100048954 49
1140 3300031235 Ga0265330_10008926 Ga0265330_1000892610 49
1141 3300031238 Ga0265332_10000009 Ga0265332_10000009144 49
1142 3300031238 Ga0265332_10000042 Ga0265332_1000004249 49
1143 3300031238 Ga0265332_10133215 Ga0265332_101332152 49
1144 3300031239 Ga0265328_10014817 Ga0265328_100148172 49
1145 3300031240 Ga0265320_10050477 Ga0265320_100504772 49
1146 3300031240 Ga0265320_10094376 Ga0265320_100943763 49
1147 3300031242 Ga0265329_10015222 Ga0265329_100152223 49
1148 3300031247 Ga0265340_10005578 Ga0265340_100055782 49
1149 3300031249 Ga0265339_10005067 Ga0265339_100050679 49
1150 3300031250 Ga0265331_10000022 Ga0265331_1000002252 49
1151 3300031344 Ga0265316_10004370 Ga0265316_100043709 49
1152 3300031344 Ga0265316_10024993 Ga0265316_100249934 49
1153 3300031344 Ga0265316_10052764 Ga0265316_100527642 49
1154 3300031344 Ga0265316_10093223 Ga0265316_100932233 49
1155 3300031344 Ga0265316_10693067 Ga0265316_106930672 49
1156 3300031507 Ga0307509_10000076 Ga0307509_1000007614 49
1157 3300031711 Ga0265314_10000681 Ga0265314_1000068123 49
1158 3300031711 Ga0265314_10100234 Ga0265314_101002342 49
1159 3300031711 Ga0265314_10139877 Ga0265314_101398772 49
1160 3300031712 Ga0265342_10004261 Ga0265342_100042614 49
1161 3300031712 Ga0265342_10008059 Ga0265342_100080598 49
1162 3300031712 Ga0265342_10327422 Ga0265342_103274221 49
1163 3300031903 Ga0307407_10815383 Ga0307407_108153833 49
1164 3300032120 Ga0316053_102437 Ga0316053_1024373 49
1165 3300033547 Ga0316212_1002969 Ga0316212_10029693 49
1166 3300033547 Ga0316212_1020776 Ga0316212_10207762 49
1167 3300035085 Ga0373929_0091436 Ga0373929_0091436_98_247 49
1168 3300035086 Ga0373934_0001839 Ga0373934_0001839_1741_1890 49
1169 3300035086 Ga0373934_0128101 Ga0373934_0128101_30_179 49
1170 3300035088 Ga0373940_0154000 Ga0373940_0154000_29_178 49
1171 3300035088 Ga0373940_0294809 Ga0373940_0294809_26_175 49
1172 3300035091 Ga0373951_0019781 Ga0373951_0019781_939_1088 49
1173 3300035111 Ga0373923_0094482 Ga0373923_0094482_283_432 49
1174 3300035111 Ga0373923_0158048 Ga0373923_0158048_315_464 49
1175 3300035113 Ga0373936_0183399 Ga0373936_0183399_692_844 49
1176 3300035113 Ga0373936_0434186 Ga0373936_0434186_21_170 49
1177 3300035117 Ga0373953_0056831 Ga0373953_0056831_470_619 49
1178 3300035117 Ga0373953_0131853 Ga0373953_0131853_828_980 49
1179 3300035117 Ga0373953_0178180 Ga0373953_0178180_716_868 49
1180 3300035117 Ga0373953_0248623 Ga0373953_0248623_553_702 49
1181 3300035118 Ga0373954_0045359 Ga0373954_0045359_766_918 49
1182 3300035118 Ga0373954_0071639 Ga0373954_0071639_83_232 49
1183 3300035119 Ga0373956_0011297 Ga0373956_0011297_2191_2340 49
1184 3300035119 Ga0373956_0025194 Ga0373956_0025194_1280_1432 49
1185 3300035119 Ga0373956_0080257 Ga0373956_0080257_306_455 49
1186 3300035120 Ga0373957_0323409 Ga0373957_0323409_312_461 49
1187 3300035120 Ga0373957_0332543 Ga0373957_0332543_483_632 49
1188 3300035120 Ga0373957_0339927 Ga0373957_0339927_474_623 49
1189 3300035120 Ga0373957_0522703 Ga0373957_0522703_51_200 49
1190 3300035172 Ga0373955_0012644 Ga0373955_0012644_1298_1447 49
1191 3300035172 Ga0373955_0346412 Ga0373955_0346412_434_583 49
1192 3300035172 Ga0373955_0625318 Ga0373955_0625318_440_592 49
1193 3300035241 Ga0373961_0267220 Ga0373961_0267220_12_161 49
1194 3300035398 Ga0316574_0143853 Ga0316574_0143853_161_328 49
1195 3300035410 Ga0373924_0315826 Ga0373924_0315826_222_374 49
1196 3300035691 Ga0373931_0332260 Ga0373931_0332260_138_287 49
1197 3300035691 Ga0373931_0604631 Ga0373931_0604631_478_630 49
1198 3300035692 Ga0373935_0433005 Ga0373935_0433005_697_846 49
1199 3300035724 Ga0373933_0036573 Ga0373933_0036573_908_1057 49
1200 3300035724 Ga0373933_0040062 Ga0373933_0040062_2555_2704 49
1201 3300035724 Ga0373933_0170240 Ga0373933_0170240_791_940 49
1202 3300035724 Ga0373933_0400081 Ga0373933_0400081_82_231 49
1203 3300035724 Ga0373933_0689509 Ga0373933_0689509_467_616 49
1204 3300036401 Ga0373937_0004374 Ga0373937_0004374_3182_3331 49
1205 3300036401 Ga0373937_0060946 Ga0373937_0060946_33_182 49
1206 3300036401 Ga0373937_0084956 Ga0373937_0084956_1416_1565 49
1207 3300036401 Ga0373937_0156351 Ga0373937_0156351_1392_1541 49
1208 3300036401 Ga0373937_0270489 Ga0373937_0270489_532_681 49
1209 3300036401 Ga0373937_0376361 Ga0373937_0376361_24_176 49
1210 3300036401 Ga0373937_0380585 Ga0373937_0380585_325_474 49
1211 3300036401 Ga0373937_0511519 Ga0373937_0511519_564_713 49
1212 3300036401 Ga0373937_0948879 Ga0373937_0948879_477_626 49
1213 3300036401 Ga0373937_0975167 Ga0373937_0975167_429_578 49
1214 3300037068 Ga0373925_1175321 Ga0373925_1175321_379_528 49
1215 3300037068 Ga0373925_1347120 Ga0373925_1347120_247_396 49
1216 3300037312 Ga0395899_0976327 Ga0395899_0976327_295_444 49
1217 3300037418 Ga0395900_0786191 Ga0395900_0786191_646_795 49
1218 3300037418 Ga0395900_0834549 Ga0395900_0834549_103_252 49
1219 3300037466 Ga0395898_1834323 Ga0395898_1834323_210_359 49
1220 3300038443 Ga0395901_0587782 Ga0395901_0587782_140_289 49
1221 3300038443 Ga0395901_2087217 Ga0395901_2087217_50_199 49
1222 3300041460 Ga0451802_1861437 Ga0451802_1861437_300_452 49
1223 3300041486 Ga0451807_0907752 Ga0451807_0907752_621_770 49
1224 3300041496 Ga0451839_1288097 Ga0451839_1288097_73_222 49
1225 3300041509 Ga0451843_0211863 Ga0451843_0211863_97_246 49
1226 3300041509 Ga0451843_1005222 Ga0451843_1005222_36_188 49
1227 3300041512 Ga0451853_2542678 Ga0451853_2542678_577_729 49
1228 3300042461 Ga0439460_0224587 Ga0439460_0224587_26_175 49
1229 3300042876 Ga0451577_0063966 Ga0451577_0063966_417_566 49
1230 3300042876 Ga0451577_0078362 Ga0451577_0078362_1637_1813 49
1231 3300042876 Ga0451577_0106049 Ga0451577_0106049_551_700 49
1232 3300042876 Ga0451577_0822950 Ga0451577_0822950_29_178 49
1233 3300042876 Ga0451577_1515252 Ga0451577_1515252_108_257 49
1234 3300042876 Ga0451577_1554443 Ga0451577_1554443_280_429 49
1235 3300042876 Ga0451577_2017912 Ga0451577_2017912_18_167 49
1236 3300042993 Ga0439440_0146535 Ga0439440_0146535_46_195 49
1237 3300044673 Ga0453683_0019235 Ga0453683_0019235_1967_2116 49
1238 3300044673 Ga0453683_0354812 Ga0453683_0354812_721_873 49
1239 3300044673 Ga0453683_0426242 Ga0453683_0426242_422_571 49
1240 3300044694 Ga0466963_0333165 Ga0466963_0333165_415_567 49
1241 3300044712 Ga0453684_0091154 Ga0453684_0091154_664_813 49
1242 3300044712 Ga0453684_0223641 Ga0453684_0223641_857_1006 49
1243 3300044712 Ga0453684_0518234 Ga0453684_0518234_903_1055 49
1244 3300044712 Ga0453684_1222631 Ga0453684_1222631_265_414 49
1245 3300044712 Ga0453684_1620555 Ga0453684_1620555_56_205 49
1246 3300044712 Ga0453684_2548615 Ga0453684_2548615_37_186 49
1247 3300044842 Ga0466957_0880160 Ga0466957_0880160_396_548 49
1248 3300045051 Ga0451576_0059242 Ga0451576_0059242_1523_1672 49
1249 3300045051 Ga0451576_0059260 Ga0451576_0059260_1074_1223 49
1250 3300045051 Ga0451576_0090653 Ga0451576_0090653_2870_3019 49
1251 3300045051 Ga0451576_0124751 Ga0451576_0124751_329_478 49
1252 3300045051 Ga0451576_0133396 Ga0451576_0133396_1128_1283 49
1253 3300045051 Ga0451576_0240284 Ga0451576_0240284_172_321 49
1254 3300045051 Ga0451576_0375565 Ga0451576_0375565_156_305 49
1255 3300045051 Ga0451576_0401641 Ga0451576_0401641_43_192 49
1256 3300045051 Ga0451576_0464825 Ga0451576_0464825_631_780 49
1257 3300045051 Ga0451576_0502080 Ga0451576_0502080_646_798 49
1258 3300045051 Ga0451576_0786898 Ga0451576_0786898_463_612 49
1259 3300045051 Ga0451576_0855342 Ga0451576_0855342_770_919 49
1260 3300045976 Ga0466967_0002917 Ga0466967_0002917_8562_8714 49
1261 3300046454 Ga0495592_0191652 Ga0495592_0191652_1144_1293 49
1262 3300046455 Ga0495603_0314973 Ga0495603_0314973_400_549 49
1263 3300046459 Ga0495629_0759927 Ga0495629_0759927_16_165 49
1264 3300046459 Ga0495629_0899982 Ga0495629_0899982_125_277 49
1265 3300046462 Ga0495651_1024348 Ga0495651_1024348_323_475 49
1266 3300046472 Ga0495580_0125999 Ga0495580_0125999_1589_1738 49
1267 3300046472 Ga0495580_0139332 Ga0495580_0139332_1400_1549 49
1268 3300046472 Ga0495580_0246831 Ga0495580_0246831_718_870 49
1269 3300046472 Ga0495580_1007317 Ga0495580_1007317_275_424 49
1270 3300046473 Ga0495582_0638181 Ga0495582_0638181_36_188 49
1271 3300046475 Ga0495639_0072580 Ga0495639_0072580_1395_1544 49
1272 3300046492 Ga0495585_0525181 Ga0495585_0525181_305_454 49
1273 3300046511 Ga0495608_0227305 Ga0495608_0227305_706_855 49
1274 3300046514 Ga0495618_0203742 Ga0495618_0203742_283_432 49
1275 3300046516 Ga0495628_0375465 Ga0495628_0375465_491_643 49
1276 3300046517 Ga0495630_0070982 Ga0495630_0070982_100_249 49
1277 3300046529 Ga0495652_0762873 Ga0495652_0762873_430_579 49
1278 3300046535 Ga0495586_0735573 Ga0495586_0735573_18_167 49
1279 3300046535 Ga0495586_0846714 Ga0495586_0846714_23_172 49
1280 3300046536 Ga0495587_0425626 Ga0495587_0425626_109_261 49
1281 3300046557 Ga0495622_0388364 Ga0495622_0388364_231_380 49
1282 3300046559 Ga0495667_0435067 Ga0495667_0435067_284_436 49
1283 3300046642 Ga0495634_0028961 Ga0495634_0028961_3597_3746 49
1284 3300046642 Ga0495634_0285044 Ga0495634_0285044_819_968 49
1285 3300046663 Ga0495635_0809855 Ga0495635_0809855_55_204 49
1286 3300046675 Ga0495657_0305061 Ga0495657_0305061_563_712 49
1287 3300046678 Ga0495599_0515429 Ga0495599_0515429_238_390 49
1288 3300046680 Ga0495646_0676971 Ga0495646_0676971_354_503 49
1289 3300046681 Ga0495647_0253352 Ga0495647_0253352_449_598 49
1290 3300046684 Ga0495669_0066462 Ga0495669_0066462_779_928 49
1291 3300046684 Ga0495669_0432199 Ga0495669_0432199_120_272 49
1292 3300046689 Ga0495613_0095160 Ga0495613_0095160_629_778 49
1293 3300046689 Ga0495613_0179709 Ga0495613_0179709_256_405 49
1294 3300046691 Ga0495670_0830072 Ga0495670_0830072_42_194 49
1295 3300046809 Ga0495600_0417746 Ga0495600_0417746_434_583 49
1296 3300047322 Ga0495680_0243301 Ga0495680_0243301_734_883 49
1297 3300047322 Ga0495680_0853826 Ga0495680_0853826_215_367 49
1298 3300047322 Ga0495680_0878458 Ga0495680_0878458_11_163 49
1299 3300047322 Ga0495680_1016783 Ga0495680_1016783_202_351 49
1300 3300047471 Ga0495684_0178850 Ga0495684_0178850_1169_1318 49
1301 3300047471 Ga0495684_0301944 Ga0495684_0301944_369_521 49
1302 3300047673 Ga0495593_0540647 Ga0495593_0540647_365_514 49
1303 3300048088 Ga0495602_0474726 Ga0495602_0474726_399_551 49
1304 3300048903 Ga0496100_0177343 Ga0496100_0177343_1282_1431 49
1305 3300048903 Ga0496100_0961853 Ga0496100_0961853_234_386 49
1306 3300048904 Ga0496101_0748775 Ga0496101_0748775_265_417 49
1307 3300048905 Ga0496102_0003426 Ga0496102_0003426_2169_2318 49
1308 3300048905 Ga0496102_1363466 Ga0496102_1363466_197_349 49
1309 3300048906 Ga0496103_0223104 Ga0496103_0223104_700_849 49
1310 3300048907 Ga0496104_0578944 Ga0496104_0578944_465_617 49
1311 3300048907 Ga0496104_0874090 Ga0496104_0874090_265_417 49
1312 3300048909 Ga0496106_0112490 Ga0496106_0112490_188_337 49
1313 3300048909 Ga0496106_0639086 Ga0496106_0639086_327_476 49
1314 3300048909 Ga0496106_0903385 Ga0496106_0903385_526_675 49
1315 3300048911 Ga0496108_0008090 Ga0496108_0008090_1168_1317 49
1316 3300048911 Ga0496108_0186752 Ga0496108_0186752_407_559 49
1317 3300048911 Ga0496108_0285755 Ga0496108_0285755_1033_1185 49
1318 3300048911 Ga0496108_0930722 Ga0496108_0930722_530_679 49
1319 3300048911 Ga0496108_1120762 Ga0496108_1120762_211_360 49
1320 3300048912 Ga0496109_0001877 Ga0496109_0001877_561_710 49
1321 3300048913 Ga0496110_0044892 Ga0496110_0044892_1533_1682 49
1322 3300048913 Ga0496110_0592788 Ga0496110_0592788_700_849 49
1323 3300048913 Ga0496110_1231160 Ga0496110_1231160_241_390 49
1324 3300048914 Ga0496111_0676832 Ga0496111_0676832_409_561 49
1325 3300048915 Ga0496112_0147241 Ga0496112_0147241_415_564 49
1326 3300048915 Ga0496112_0353809 Ga0496112_0353809_1042_1191 49
1327 3300048915 Ga0496112_0989787 Ga0496112_0989787_407_556 49
1328 3300048916 Ga0496113_0224189 Ga0496113_0224189_522_671 49
1329 3300048917 Ga0496114_0197160 Ga0496114_0197160_891_1040 49
1330 3300048918 Ga0496115_0051899 Ga0496115_0051899_1196_1351 49
1331 3300048918 Ga0496115_0166618 Ga0496115_0166618_1327_1479 49
1332 3300048929 Ga0496126_0683616 Ga0496126_0683616_492_641 49
1333 3300049568 Ga0501031_0246246 Ga0501031_0246246_856_1005 49
1334 3300049569 Ga0501032_0038061 Ga0501032_0038061_1774_1923 49
1335 3300049569 Ga0501032_0540280 Ga0501032_0540280_251_400 49
1336 3300049570 Ga0501033_0052408 Ga0501033_0052408_2479_2628 49
1337 3300049570 Ga0501033_0868990 Ga0501033_0868990_57_206 49
1338 3300049571 Ga0501034_0026609 Ga0501034_0026609_2049_2198 49
1339 3300049571 Ga0501034_0548433 Ga0501034_0548433_71_220 49
1340 3300049571 Ga0501034_0598232 Ga0501034_0598232_775_924 49
1341 3300049572 Ga0501036_0116535 Ga0501036_0116535_1041_1190 49
1342 3300049572 Ga0501036_0376694 Ga0501036_0376694_831_980 49
1343 3300049573 Ga0501037_0058985 Ga0501037_0058985_1684_1833 49
1344 3300049573 Ga0501037_0062601 Ga0501037_0062601_1507_1656 49
1345 3300049574 Ga0501038_0098967 Ga0501038_0098967_1539_1688 49
1346 3300049574 Ga0501038_0264997 Ga0501038_0264997_67_216 49
1347 3300049574 Ga0501038_0321381 Ga0501038_0321381_945_1094 49
1348 3300049575 Ga0501039_0126887 Ga0501039_0126887_1675_1824 49
1349 3300049575 Ga0501039_0132178 Ga0501039_0132178_629_778 49
1350 3300049575 Ga0501039_1420855 Ga0501039_1420855_261_410 49
1351 3300049576 Ga0501040_0243013 Ga0501040_0243013_154_303 49
1352 3300049576 Ga0501040_1366719 Ga0501040_1366719_199_348 49
1353 3300049577 Ga0501041_0103736 Ga0501041_0103736_461_610 49
1354 3300049577 Ga0501041_0388174 Ga0501041_0388174_445_594 49
1355 3300049578 Ga0501042_0006571 Ga0501042_0006571_2886_3035 49
1356 3300049578 Ga0501042_1141937 Ga0501042_1141937_259_408 49
1357 3300049579 Ga0501043_0049118 Ga0501043_0049118_3143_3292 49
1358 3300049579 Ga0501043_0091498 Ga0501043_0091498_1380_1529 49
1359 3300049579 Ga0501043_0606017 Ga0501043_0606017_612_761 49
1360 3300049580 Ga0501046_0045612 Ga0501046_0045612_43_192 49
1361 3300049580 Ga0501046_0064852 Ga0501046_0064852_444_593 49
1362 3300049580 Ga0501046_0123185 Ga0501046_0123185_430_579 49
1363 3300049581 Ga0501047_0327571 Ga0501047_0327571_762_911 49
1364 3300049581 Ga0501047_0863938 Ga0501047_0863938_86_235 49
1365 3300049581 Ga0501047_1372407 Ga0501047_1372407_302_451 49
1366 3300049582 Ga0501048_0034507 Ga0501048_0034507_1602_1751 49
1367 3300049582 Ga0501048_0079035 Ga0501048_0079035_1930_2079 49
1368 3300049583 Ga0501067_0008902 Ga0501067_0008902_4026_4175 49
1369 3300049583 Ga0501067_0169930 Ga0501067_0169930_1040_1189 49
1370 3300049583 Ga0501067_0188648 Ga0501067_0188648_182_331 49
1371 3300049584 Ga0501068_0032050 Ga0501068_0032050_101_250 49
1372 3300049584 Ga0501068_0052413 Ga0501068_0052413_1052_1204 49
1373 3300049584 Ga0501068_0520520 Ga0501068_0520520_484_633 49
1374 3300049585 Ga0501069_0004494 Ga0501069_0004494_595_744 49
1375 3300049586 Ga0501070_0224127 Ga0501070_0224127_846_995 49
1376 3300049586 Ga0501070_0382453 Ga0501070_0382453_280_429 49
1377 3300049587 Ga0501071_0080954 Ga0501071_0080954_1853_2002 49
1378 3300049587 Ga0501071_0862763 Ga0501071_0862763_228_380 49
1379 3300049587 Ga0501071_1015621 Ga0501071_1015621_327_476 49
1380 3300049587 Ga0501071_1205039 Ga0501071_1205039_361_510 49
1381 3300049588 Ga0501072_0039700 Ga0501072_0039700_2752_2901 49
1382 3300049588 Ga0501072_0097589 Ga0501072_0097589_117_266 49
1383 3300049588 Ga0501072_0146616 Ga0501072_0146616_286_435 49
1384 3300049588 Ga0501072_0867793 Ga0501072_0867793_518_667 49
1385 3300049589 Ga0501073_0059231 Ga0501073_0059231_1460_1609 49
1386 3300049589 Ga0501073_0156069 Ga0501073_0156069_180_329 49
1387 3300049590 Ga0501074_0092132 Ga0501074_0092132_1622_1771 49
1388 3300049591 Ga0501075_0341867 Ga0501075_0341867_938_1087 49
1389 3300049592 Ga0501076_0569224 Ga0501076_0569224_47_196 49
1390 3300049592 Ga0501076_0718961 Ga0501076_0718961_155_304 49
1391 3300049592 Ga0501076_0989290 Ga0501076_0989290_435_584 49
1392 3300049593 Ga0501077_0506966 Ga0501077_0506966_601_750 49
1393 3300049741 Ga0501079_0037276 Ga0501079_0037276_1847_1996 49
1394 3300049741 Ga0501079_1014142 Ga0501079_1014142_300_449 49
1395 3300049741 Ga0501079_1406353 Ga0501079_1406353_230_379 49
1396 3300049742 Ga0501080_0301014 Ga0501080_0301014_219_368 49
1397 3300049742 Ga0501080_0402355 Ga0501080_0402355_491_640 49
1398 3300049742 Ga0501080_0405268 Ga0501080_0405268_898_1047 49
1399 3300049742 Ga0501080_1114728 Ga0501080_1114728_285_434 49
1400 3300049742 Ga0501080_1691947 Ga0501080_1691947_180_329 49
1401 3300049743 Ga0501081_0247611 Ga0501081_0247611_299_448 49
1402 3300049743 Ga0501081_0486427 Ga0501081_0486427_710_859 49
1403 3300049743 Ga0501081_0546611 Ga0501081_0546611_93_242 49
1404 3300049743 Ga0501081_0946984 Ga0501081_0946984_127_276 49
1405 3300049744 Ga0501083_0002089 Ga0501083_0002089_10340_10489 49
1406 3300049744 Ga0501083_0150204 Ga0501083_0150204_588_737 49
1407 3300049744 Ga0501083_0961920 Ga0501083_0961920_273_422 49
1408 3300049822 Ga0501035_0105773 Ga0501035_0105773_657_806 49
1409 3300049823 Ga0501044_0120546 Ga0501044_0120546_2133_2282 49
1410 3300049823 Ga0501044_0189789 Ga0501044_0189789_868_1017 49
1411 3300049823 Ga0501044_0292645 Ga0501044_0292645_1109_1258 49
1412 3300049824 Ga0501045_0080520 Ga0501045_0080520_2122_2271 49
1413 3300049824 Ga0501045_0358615 Ga0501045_0358615_298_447 49
1414 3300050507 nmdc:mga05p37_12092_c1 nmdc:mga05p37_12092_c1_3269_3421 49
1415 3300050507 nmdc:mga05p37_1386757_c1 nmdc:mga05p37_1386757_c1_351_506 49
1416 3300050507 nmdc:mga05p37_204944_c1 nmdc:mga05p37_204944_c1_1931_2080 49
1417 3300050507 nmdc:mga05p37_370855_c1 nmdc:mga05p37_370855_c1_286_441 49
1418 3300050507 nmdc:mga05p37_381218_c1 nmdc:mga05p37_381218_c1_406_555 49
1419 3300050507 nmdc:mga05p37_523024_c1 nmdc:mga05p37_523024_c1_1011_1160 49
1420 3300050507 nmdc:mga05p37_538804_c1 nmdc:mga05p37_538804_c1_226_375 49
1421 3300050507 nmdc:mga05p37_57379_c1 nmdc:mga05p37_57379_c1_751_903 49
1422 3300050508 nmdc:mga09592_234689_c1 nmdc:mga09592_234689_c1_592_741 49
1423 3300050508 nmdc:mga09592_275530_c1 nmdc:mga09592_275530_c1_613_762 49
1424 3300050508 nmdc:mga09592_335945_c1 nmdc:mga09592_335945_c1_476_628 49
1425 3300050508 nmdc:mga09592_460981_c1 nmdc:mga09592_460981_c1_739_894 49
1426 3300050508 nmdc:mga09592_987605_c1 nmdc:mga09592_987605_c1_499_648 49
1427 3300050509 nmdc:mga0qj67_298460_c1 nmdc:mga0qj67_298460_c1_209_361 49
1428 3300050510 nmdc:mga06r32_1154380_c1 nmdc:mga06r32_1154380_c1_221_370 49
1429 3300050510 nmdc:mga06r32_196779_c1 nmdc:mga06r32_196779_c1_1145_1297 49
1430 3300050510 nmdc:mga06r32_643319_c1 nmdc:mga06r32_643319_c1_532_687 49
1431 3300050511 nmdc:mga08y16_1131174_c1 nmdc:mga08y16_1131174_c1_175_324 49
1432 3300050511 nmdc:mga08y16_23201_c1 nmdc:mga08y16_23201_c1_5424_5573 49
1433 3300050511 nmdc:mga08y16_294223_c1 nmdc:mga08y16_294223_c1_1345_1497 49
1434 3300050511 nmdc:mga08y16_342_c1 nmdc:mga08y16_342_c1_13587_13736 49
1435 3300050511 nmdc:mga08y16_602455_c1 nmdc:mga08y16_602455_c1_372_521 49
1436 3300050511 nmdc:mga08y16_90657_c1 nmdc:mga08y16_90657_c1_571_720 49
1437 3300050512 nmdc:mga0n895_1135537_c1 nmdc:mga0n895_1135537_c1_468_623 49
1438 3300050512 nmdc:mga0n895_1910895_c1 nmdc:mga0n895_1910895_c1_390_539 49
1439 3300050512 nmdc:mga0n895_2014993_c1 nmdc:mga0n895_2014993_c1_60_212 49
1440 3300050512 nmdc:mga0n895_397902_c1 nmdc:mga0n895_397902_c1_949_1101 49
1441 3300050513 nmdc:mga0rr50_1239469_c1 nmdc:mga0rr50_1239469_c1_277_426 49
1442 3300050513 nmdc:mga0rr50_1551797_c1 nmdc:mga0rr50_1551797_c1_343_498 49
1443 3300050513 nmdc:mga0rr50_1641393_c1 nmdc:mga0rr50_1641393_c1_195_353 49
1444 3300050514 nmdc:mga08x19_172659_c1 nmdc:mga08x19_172659_c1_1231_1383 49
1445 3300050515 nmdc:mga0a205_1454072_c1 nmdc:mga0a205_1454072_c1_152_301 49
1446 3300050515 nmdc:mga0a205_322471_c1 nmdc:mga0a205_322471_c1_101_250 49
1447 3300050515 nmdc:mga0a205_811202_c1 nmdc:mga0a205_811202_c1_316_471 49
1448 3300050515 nmdc:mga0a205_968792_c1 nmdc:mga0a205_968792_c1_130_285 49
1449 3300053084 Ga0495595_0288838 Ga0495595_0288838_530_682 49
1450 3300053094 Ga0500566_0442418 Ga0500566_0442418_254_403 49
1451 3300053133 Ga0500655_043141 Ga0500655_043141_547_696 49
1452 3300053160 Ga0500633_0195074 Ga0500633_0195074_250_399 49
1453 3300054114 Ga0501084_0499091 Ga0501084_0499091_68_217 49
1454 3300054114 Ga0501084_0618811 Ga0501084_0618811_98_247 49
1455 3300054114 Ga0501084_0732282 Ga0501084_0732282_208_357 49
1456 3300059477 Ga0587084_077701 Ga0587084_077701_467_619 49
1457 3300059478 Ga0587093_012631 Ga0587093_012631_335_490 49
1458 3300059490 Ga0587066_011939 Ga0587066_011939_758_913 49
1459 3300059490 Ga0587066_064411 Ga0587066_064411_28_180 49
1460 3300059491 Ga0587070_018263 Ga0587070_018263_929_1084 49
1461 3300059491 Ga0587070_235916 Ga0587070_235916_331_483 49
1462 3300059492 Ga0587073_0022772 Ga0587073_0022772_1039_1191 49
1463 3300059492 Ga0587073_0028789 Ga0587073_0028789_600_755 49
1464 3300059493 Ga0587077_009896 Ga0587077_009896_953_1108 49
1465 3300059493 Ga0587077_105433 Ga0587077_105433_514_666 49
1466 3300059503 Ga0587080_056529 Ga0587080_056529_291_446 49
1467 3300059503 Ga0587080_180120 Ga0587080_180120_328_480 49
1468 3300059504 Ga0587082_028075 Ga0587082_028075_765_920 49
1469 3300059504 Ga0587082_057398 Ga0587082_057398_585_737 49
1470 3300059505 Ga0587083_0008633 Ga0587083_0008633_339_494 49
1471 3300059505 Ga0587083_0079236 Ga0587083_0079236_25_177 49
1472 3300059506 Ga0587085_003167 Ga0587085_003167_1585_1737 49
1473 3300059507 Ga0587086_006977 Ga0587086_006977_1105_1257 49
1474 3300059507 Ga0587086_038159 Ga0587086_038159_22_174 49
1475 3300059508 Ga0587088_019415 Ga0587088_019415_940_1092 49
1476 3300059508 Ga0587088_036209 Ga0587088_036209_373_528 49
1477 3300059509 Ga0587089_015927 Ga0587089_015927_820_972 49
1478 3300059509 Ga0587089_021932 Ga0587089_021932_291_446 49
1479 3300059509 Ga0587089_058658 Ga0587089_058658_22_174 49
1480 3300059510 Ga0587090_022559 Ga0587090_022559_25_177 49
1481 3300059510 Ga0587090_036723 Ga0587090_036723_375_530 49
1482 3300059511 Ga0587091_014316 Ga0587091_014316_749_904 49
1483 3300059511 Ga0587091_139962 Ga0587091_139962_25_177 49
1484 3300059511 Ga0587091_208683 Ga0587091_208683_28_180 49
1485 3300059512 Ga0587092_024928 Ga0587092_024928_44_199 49
1486 3300059512 Ga0587092_047651 Ga0587092_047651_590_742 49
1487 3300059513 Ga0587094_009876 Ga0587094_009876_25_177 49
1488 3300059513 Ga0587094_030814 Ga0587094_030814_310_465 49
1489 3300059513 Ga0587094_066924 Ga0587094_066924_462_614 49
1490 3300059604 Ga0587098_019251 Ga0587098_019251_291_446 49
1491 3300059605 Ga0587106_013849 Ga0587106_013849_339_494 49
1492 3300059605 Ga0587106_141192 Ga0587106_141192_351_503 49
1493 3300059622 Ga0587099_063986 Ga0587099_063986_44_199 49
1494 3300059623 Ga0587101_011992 Ga0587101_011992_62_214 49
1495 3300059623 Ga0587101_035396 Ga0587101_035396_305_460 49
1496 3300059624 Ga0587109_214206 Ga0587109_214206_307_462 49
1497 3300059625 Ga0587113_006489 Ga0587113_006489_25_177 49
1498 3300059630 Ga0587128_008914 Ga0587128_008914_724_876 49
1499 3300059630 Ga0587128_098881 Ga0587128_098881_27_179 49
1500 3300059631 Ga0587130_017039 Ga0587130_017039_590_742 49
1501 3300059639 Ga0587062_129511 Ga0587062_129511_43_198 49
1502 3300059640 Ga0587067_020773 Ga0587067_020773_363_518 49
1503 3300059640 Ga0587067_030361 Ga0587067_030361_25_177 49
1504 3300059641 Ga0587068_087177 Ga0587068_087177_22_174 49
1505 3300059642 Ga0587069_009019 Ga0587069_009019_371_526 49
1506 3300059643 Ga0587072_031409 Ga0587072_031409_24_176 49
1507 3300059644 Ga0587075_010783 Ga0587075_010783_1039_1191 49
1508 3300059644 Ga0587075_030657 Ga0587075_030657_311_466 49
1509 3300059645 Ga0587076_021837 Ga0587076_021837_335_490 49
1510 3300059646 Ga0587078_026380 Ga0587078_026380_585_737 49
1511 3300059647 Ga0587079_064066 Ga0587079_064066_295_450 49
1512 3300059647 Ga0587079_196547 Ga0587079_196547_22_174 49
1513 3300059649 Ga0587102_045429 Ga0587102_045429_327_482 49
1514 3300059651 Ga0587105_007098 Ga0587105_007098_275_430 49
1515 3300059651 Ga0587105_032989 Ga0587105_032989_330_482 49
1516 3300059652 Ga0587107_145130 Ga0587107_145130_282_437 49
1517 3300059655 Ga0587114_016168 Ga0587114_016168_820_972 49
1518 3300059655 Ga0587114_042778 Ga0587114_042778_213_368 49
1519 3300059658 Ga0587119_031462 Ga0587119_031462_551_703 49
1520 3300060344 Ga0587071_026707 Ga0587071_026707_364_519 49
1521 3300060353 Ga0501082_0000001 Ga0501082_0000001_15881_16033 49
1522 3300060353 Ga0501082_0095630 Ga0501082_0095630_1417_1566 49
1523 3300060353 Ga0501082_0205791 Ga0501082_0205791_96_245 49
1524 3300060353 Ga0501082_0574090 Ga0501082_0574090_783_932 49
1525 3300061734 Ga0530510_0247811 Ga0530510_0247811_782_931 49
1526 3300061734 Ga0530510_0370195 Ga0530510_0370195_506_655 49
1527 3300061734 Ga0530510_0551709 Ga0530510_0551709_167_316 49
1528 3300061734 Ga0530510_1205250 Ga0530510_1205250_343_492 49

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18919

DUF5670

Family of unknown function (DUF5670)

10

53

0.93

Feature Viewer

pLDDT pTM Quality
87.34 0.46 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map