F494560

General Info

Members Datasets Scaffolds Average Seq Length
1524 579 1426 143

Family's Representative Sequence

Representative Sequence 3300031249|Ga0265339_10212455|Ga0265339_102124552
Length 171
Sequence VPTRRSSRGHPTRYLRRGCRRDHGGDTQVVTTTVTYDGVEVGEQLPHRSFPIARADLVRYAGASGDFNPIHWNARFAVEVGLPDVIAHGMFTMATAVRLVTDWIGDPGAVVDYSVRFTKAVVVPDDEGGATLDVEGVVAEKLEDGLVRIDLTARSGDDKVLGMARATVRLS

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
3 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
4 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
5 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
6 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
7 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
8 2643221548 Streptomyces sp. Root55 Isolate Unclassified
9 2643221578 Streptomyces sp. Root63 Isolate Unclassified
10 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
11 2643221647 Streptomyces sp. Root369 Isolate Unclassified
12 2643221670 Streptomyces sp. Root431 Isolate Unclassified
13 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
14 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
15 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
16 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
17 2643221711 Terrabacter sp. Root85 Isolate Unclassified
18 2643221714 Streptomyces sp. Root264 Isolate Unclassified
19 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
20 2773857933 Frankia sp. BMG5.30 Isolate Nodule
21 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
22 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
23 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
24 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
25 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
26 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
27 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
28 2808606448 Streptomyces sp. 193411 Isolate Unclassified
29 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
30 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
31 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
32 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
33 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
34 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
35 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
36 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
37 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
38 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
39 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
40 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
41 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
42 2862574272 Streptomyces sp. AcE210 Isolate Nodule
43 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
44 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
45 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
46 2867428634 Streptomyces sp. RP5T Isolate Unclassified
47 2867475112 Streptomyces sp. TM32 Isolate Unclassified
48 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
49 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
50 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
51 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
52 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
53 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
54 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
55 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
56 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
57 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
58 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
59 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
60 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
61 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
62 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
63 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
64 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
65 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
66 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
67 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
68 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
69 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
70 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
71 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
72 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
73 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
74 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
75 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
76 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
77 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
78 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
79 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
80 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
81 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
82 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
83 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
84 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
85 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
86 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
87 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
88 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
89 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
90 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
91 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
92 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
93 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
95 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
96 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
97 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
98 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
99 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
100 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
101 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
102 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
103 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
104 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
105 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
106 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
107 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
108 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
109 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
110 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
111 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
112 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
113 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
114 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
115 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
116 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
117 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
118 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
119 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
120 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
121 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
122 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
123 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
124 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
125 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
126 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
127 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
128 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
129 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
130 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
131 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
132 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
133 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
134 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
135 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
136 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
137 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
138 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
139 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
140 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
141 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
142 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
143 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
144 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
145 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
146 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
147 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
148 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
149 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
150 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
151 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
152 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
153 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
154 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
155 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
156 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
157 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
158 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
159 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
160 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
161 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
162 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
163 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
164 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
165 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
166 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
167 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
168 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
169 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
170 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
171 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
172 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
173 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
174 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
175 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
176 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
177 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
178 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
179 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
180 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
181 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
182 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
183 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
184 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
185 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
186 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
187 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
188 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
189 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
190 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
191 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
192 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
193 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
194 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
195 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
196 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
197 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
198 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
199 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
200 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
201 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
202 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
203 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
204 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
205 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
206 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
207 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
208 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
209 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
260 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
263 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
264 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
265 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
266 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
267 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
268 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
269 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
270 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
271 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
272 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
273 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
274 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
275 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
276 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
277 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
278 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
279 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
280 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
281 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
282 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
283 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
284 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
285 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
286 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
287 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
288 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
289 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
290 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
291 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
292 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
293 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
294 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
295 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
296 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
297 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
298 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
299 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
300 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
301 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
302 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
303 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
304 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
305 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
306 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
307 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
308 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
309 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
310 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
311 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
312 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
313 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
314 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
315 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
316 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
317 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
318 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
319 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
320 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
321 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
322 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
323 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
324 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
325 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
326 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
327 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
328 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
329 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
330 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
331 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
332 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
333 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
334 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
335 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
336 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
337 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
338 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
339 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
340 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
341 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
342 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
343 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
344 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
345 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
346 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
347 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
348 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
349 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
350 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
351 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
352 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
353 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
354 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
355 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
356 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
357 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
358 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
359 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
360 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
361 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
362 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
363 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
364 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
365 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
366 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
367 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
368 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
369 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
370 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
371 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
372 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
373 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
374 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
375 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
376 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
377 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
378 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
379 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
380 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
381 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
382 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
383 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
384 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
385 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
386 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
387 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
388 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
389 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
390 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
391 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
392 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
393 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
394 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
395 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
396 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
397 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
398 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
399 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
400 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
401 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
402 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
403 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
404 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
405 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
406 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
407 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
408 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
409 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
410 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
411 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
412 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
413 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
414 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
415 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
416 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
417 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
418 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
419 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
420 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
421 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
422 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
423 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
424 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
425 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
426 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
427 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
428 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
429 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
430 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
431 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
432 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
433 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
434 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
435 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
436 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
437 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
438 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
439 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
440 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
441 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
442 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
443 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
444 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
445 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
446 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
447 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
448 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
449 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
450 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
451 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
452 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
453 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
454 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
455 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
456 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
457 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
458 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
459 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
460 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
461 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
462 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
463 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
464 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
465 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
466 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
467 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
468 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
469 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
470 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
471 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
472 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
473 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
474 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
475 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
476 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
477 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
478 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
479 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
480 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
481 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
482 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
483 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
484 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
485 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
486 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
487 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
488 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
489 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
490 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
491 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
492 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
493 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
494 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
495 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
496 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
497 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
498 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
499 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
500 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
501 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
502 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
503 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
504 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
505 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
506 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
507 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
508 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
509 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
510 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
511 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
512 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
513 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
514 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
515 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
516 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
517 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
518 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
519 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
520 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
521 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
522 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
523 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
524 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
525 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
526 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
527 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
528 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
529 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
530 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
531 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
532 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
533 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
534 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
535 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
536 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
537 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
538 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
539 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
540 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
541 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
542 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
543 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
544 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
545 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
546 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
547 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
548 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
549 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
550 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
551 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
552 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
553 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
554 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
555 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
556 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
557 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
558 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
559 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
560 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
561 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
562 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
563 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
564 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
565 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
566 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
567 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
568 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
569 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
570 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
571 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
572 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
573 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
574 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
575 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
576 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
577 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
578 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
579 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.67
Metatranscriptomes 1.9
Isolates 6.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.48
Nodule 0.39
Rhizoplane 7.15
Rhizosphere 80.91
Stem 0
Stem Tuber 0
Unclassified 8.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10011660 3300001989 Bacteria 3241
2 JGI24735J21928_10022149 3300002067 Bacteria 1937
3 JGI24735J21928_10045779 3300002067 Bacteria 1270
4 JGI24738J21930_10009126 3300002075 Bacteria 2242
5 rootH1_10072843 3300003316 Bacteria 2226
6 rootH2_10036674 3300003320 Bacteria 1151
7 rootH2_10036693 3300003320 Bacteria 1850
8 rootL2_10007292 3300003322 Bacteria 1596
9 rootH1_10014055 3300003323 Bacteria 7153
10 Ga0006562J51391_1020917 3300003578 Bacteria 1830
11 Ga0006562J51391_1081456 3300003578 Bacteria 540
12 Ga0006562J51391_1102892 3300003578 Bacteria 3192
13 Ga0058863_11947591 3300004799 Bacteria 1346
14 Ga0070658_10001354 3300005327 Bacteria 20935
15 Ga0070658_10186587 3300005327 Bacteria 1747
16 Ga0070658_10478878 3300005327 Bacteria 1074
17 Ga0070683_100226002 3300005329 Bacteria 1779
18 Ga0070683_101085256 3300005329 Bacteria 769
19 Ga0070683_101279100 3300005329 Bacteria 705
20 Ga0070683_101926068 3300005329 Bacteria 568
21 Ga0068869_100573193 3300005334 Bacteria 951
22 Ga0070680_100186831 3300005336 Bacteria 1746
23 Ga0070680_100249005 3300005336 Bacteria 1502
24 Ga0070682_100879086 3300005337 Bacteria 735
25 Ga0068868_100018642 3300005338 Bacteria 5193
26 Ga0068868_101084353 3300005338 Bacteria 736
27 Ga0070692_10039038 3300005345 Bacteria 2423
28 Ga0070668_100052320 3300005347 Bacteria 3147
29 Ga0070668_100793447 3300005347 Bacteria 841
30 Ga0070669_100678085 3300005353 Bacteria 869
31 Ga0070675_100405559 3300005354 Bacteria 1217
32 Ga0070667_100081897 3300005367 Bacteria 2762
33 Ga0070709_10018736 3300005434 Bacteria 3993
34 Ga0070709_10090044 3300005434 Bacteria 2021
35 Ga0070714_100412516 3300005435 Bacteria 1278
36 Ga0070714_100489079 3300005435 Bacteria 1172
37 Ga0070714_100686475 3300005435 Bacteria 987
38 Ga0070714_102015964 3300005435 Bacteria 563
39 Ga0070713_100058308 3300005436 Bacteria 3220
40 Ga0070713_101037703 3300005436 Bacteria 791
41 Ga0070713_101608829 3300005436 Bacteria 631
42 Ga0070710_10091238 3300005437 Bacteria 1797
43 Ga0070710_10407297 3300005437 Bacteria 913
44 Ga0070710_10860661 3300005437 Bacteria 652
45 Ga0070711_100190843 3300005439 Bacteria 1574
46 Ga0070711_100192512 3300005439 Bacteria 1568
47 Ga0070705_100026312 3300005440 Bacteria 3165
48 Ga0070705_100343119 3300005440 Bacteria 1086
49 Ga0070694_101638601 3300005444 Bacteria 546
50 Ga0070708_100001875 3300005445 Bacteria 16140
51 Ga0070708_100348942 3300005445 Bacteria 1394
52 Ga0070708_101373626 3300005445 Bacteria 659
53 Ga0070708_101599891 3300005445 Unclassified 606
54 Ga0070663_100010329 3300005455 Bacteria 5820
55 Ga0070678_100751757 3300005456 Bacteria 882
56 Ga0070678_100870885 3300005456 Bacteria 822
57 Ga0070662_101742214 3300005457 Bacteria 538
58 Ga0070681_10011834 3300005458 Bacteria 8649
59 Ga0070681_10480692 3300005458 Bacteria 1155
60 Ga0070681_10951620 3300005458 Bacteria 778
61 Ga0070706_100003004 3300005467 Bacteria 16717
62 Ga0070706_100362130 3300005467 Bacteria 1351
63 Ga0070706_100806707 3300005467 Bacteria 869
64 Ga0070707_100062753 3300005468 Bacteria 3565
65 Ga0070698_100030741 3300005471 Bacteria 5568
66 Ga0070698_100060774 3300005471 Bacteria 3812
67 Ga0070698_100143727 3300005471 Bacteria 2336
68 Ga0070699_100831414 3300005518 Bacteria 845
69 Ga0070679_100084804 3300005530 Bacteria 3155
70 Ga0070679_100135799 3300005530 Bacteria 2441
71 Ga0070679_100506736 3300005530 Bacteria 1151
72 Ga0070679_101965451 3300005530 Bacteria 534
73 Ga0070684_101552856 3300005535 Bacteria 624
74 Ga0070684_101617639 3300005535 Bacteria 611
75 Ga0070697_102069519 3300005536 Bacteria 510
76 Ga0068853_101180040 3300005539 Bacteria 739
77 Ga0068853_101940672 3300005539 Bacteria 571
78 Ga0070672_100144409 3300005543 Bacteria 1965
79 Ga0070672_100276201 3300005543 Bacteria 1420
80 Ga0070686_101210094 3300005544 Bacteria 628
81 Ga0070695_100972190 3300005545 Bacteria 689
82 Ga0070696_100965954 3300005546 Bacteria 710
83 Ga0070693_100073433 3300005547 Bacteria 2021
84 Ga0070693_100370704 3300005547 Bacteria 985
85 Ga0070665_100116866 3300005548 Bacteria 2670
86 Ga0070665_100117093 3300005548 Bacteria 2667
87 Ga0070665_100638590 3300005548 Bacteria 1078
88 Ga0070665_101343893 3300005548 Bacteria 724
89 Ga0070665_101616182 3300005548 Bacteria 656
90 Ga0068855_100008080 3300005563 Bacteria 12714
91 Ga0068855_100030378 3300005563 Bacteria 6463
92 Ga0068855_100074080 3300005563 Bacteria 3955
93 Ga0068855_100178768 3300005563 Bacteria 2400
94 Ga0068855_101141126 3300005563 Bacteria 813
95 Ga0068855_101552210 3300005563 Bacteria 679
96 Ga0070664_101253596 3300005564 Bacteria 700
97 Ga0068857_100130597 3300005577 Bacteria 2265
98 Ga0068857_100521743 3300005577 Bacteria 1116
99 Ga0068854_100084723 3300005578 Bacteria 2346
100 Ga0068856_100049229 3300005614 Bacteria 4153
101 Ga0068856_100203297 3300005614 Bacteria 1995
102 Ga0068856_100250444 3300005614 Bacteria 1786
103 Ga0068856_100546252 3300005614 Bacteria 1180
104 Ga0070702_100000897 3300005615 Bacteria 11594
105 Ga0070702_100071712 3300005615 Bacteria 2048
106 Ga0068852_100006407 3300005616 Bacteria 8504
107 Ga0068852_100068687 3300005616 Bacteria 3103
108 Ga0068852_100192985 3300005616 Bacteria 1923
109 Ga0068852_102111659 3300005616 Bacteria 585
110 Ga0068859_100537914 3300005617 Bacteria 1263
111 Ga0068864_100074758 3300005618 Bacteria 2957
112 Ga0068866_10534543 3300005718 Bacteria 781
113 Ga0068851_10335545 3300005834 Bacteria 876
114 Ga0068851_10505550 3300005834 Bacteria 725
115 Ga0068870_10428486 3300005840 Bacteria 867
116 Ga0068863_100307747 3300005841 Bacteria 1538
117 Ga0068863_100836938 3300005841 Bacteria 919
118 Ga0068858_100000010 3300005842 Bacteria 234748
119 Ga0068858_100282401 3300005842 Bacteria 1581
120 Ga0068858_101157046 3300005842 Bacteria 760
121 Ga0068860_100295804 3300005843 Bacteria 1585
122 Ga0068860_100567246 3300005843 Bacteria 1138
123 Ga0068862_100789026 3300005844 Bacteria 927
124 Ga0081539_10145025 3300005985 Bacteria 1149
125 Ga0081539_10242044 3300005985 Bacteria 807
126 Ga0070717_10678970 3300006028 Bacteria 935
127 Ga0075365_10134791 3300006038 Bacteria 1711
128 Ga0075365_10254856 3300006038 Bacteria 1233
129 Ga0075363_100031881 3300006048 Bacteria 2734
130 Ga0075363_100207144 3300006048 Bacteria 1122
131 Ga0075363_100401581 3300006048 Bacteria 805
132 Ga0075432_10029277 3300006058 Bacteria 1901
133 Ga0070715_10007756 3300006163 Bacteria 3707
134 Ga0070715_10456002 3300006163 Bacteria 723
135 Ga0070716_100040250 3300006173 Bacteria 2599
136 Ga0070716_100337695 3300006173 Bacteria 1062
137 Ga0070712_100202487 3300006175 Bacteria 1560
138 Ga0070712_100282974 3300006175 Bacteria 1336
139 Ga0070712_100697229 3300006175 Bacteria 865
140 Ga0075367_10008260 3300006178 Bacteria 5386
141 Ga0075369_10330203 3300006186 Bacteria 714
142 Ga0068871_100164128 3300006358 Bacteria 1901
143 Ga0075428_100107812 3300006844 Bacteria 3035
144 Ga0075428_100268322 3300006844 Bacteria 1837
145 Ga0075431_100259133 3300006847 Bacteria 1765
146 Ga0075429_100060768 3300006880 Bacteria 3291
147 Ga0075429_100110691 3300006880 Bacteria 2401
148 Ga0075436_100156232 3300006914 Bacteria 1607
149 Ga0097620_100537935 3300006931 Bacteria 1263
150 Ga0099826_10067130 3300006948 Bacteria 2297
151 Ga0105251_10010014 3300009011 Bacteria 5542
152 Ga0105251_10039734 3300009011 Bacteria 2296
153 Ga0105244_10189115 3300009036 Bacteria 974
154 Ga0105250_10051640 3300009092 Bacteria 1649
155 Ga0105240_10013885 3300009093 Bacteria 11033
156 Ga0105240_10243122 3300009093 Bacteria 2085
157 Ga0105240_10323843 3300009093 Bacteria 1756
158 Ga0105245_10070926 3300009098 Bacteria 3163
159 Ga0105245_10177094 3300009098 Bacteria 2035
160 Ga0105245_10269028 3300009098 Bacteria 1661
161 Ga0105247_10001725 3300009101 Bacteria 15397
162 Ga0105247_10188401 3300009101 Bacteria 1380
163 Ga0105247_10338425 3300009101 Bacteria 1055
164 Ga0105247_10660053 3300009101 Bacteria 782
165 Ga0105247_11026108 3300009101 Bacteria 646
166 Ga0114129_10087526 3300009147 Bacteria 4319
167 Ga0114129_10243503 3300009147 Bacteria 2417
168 Ga0114129_10691807 3300009147 Bacteria 1311
169 Ga0114129_11478356 3300009147 Bacteria 836
170 Ga0114129_12744997 3300009147 Bacteria 586
171 Ga0105243_10025061 3300009148 Bacteria 4555
172 Ga0105243_10038845 3300009148 Bacteria 3709
173 Ga0105243_10368206 3300009148 Bacteria 1325
174 Ga0105243_10403073 3300009148 Bacteria 1271
175 Ga0105243_10464362 3300009148 Bacteria 1191
176 Ga0105243_10493872 3300009148 Bacteria 1158
177 Ga0105243_11107776 3300009148 Bacteria 800
178 Ga0105241_10032519 3300009174 Bacteria 3911
179 Ga0105241_11107374 3300009174 Bacteria 746
180 Ga0105242_10003644 3300009176 Bacteria 11991
181 Ga0105242_10680509 3300009176 Bacteria 1004
182 Ga0105242_11027954 3300009176 Bacteria 834
183 Ga0105248_10117653 3300009177 Bacteria 2997
184 Ga0105248_10118043 3300009177 Bacteria 2992
185 Ga0105237_10030634 3300009545 Bacteria 5463
186 Ga0105237_10190729 3300009545 Bacteria 2050
187 Ga0105237_10815544 3300009545 Bacteria 940
188 Ga0105237_11051826 3300009545 Bacteria 821
189 Ga0105238_10288393 3300009551 Bacteria 1623
190 Ga0105238_11365671 3300009551 Bacteria 735
191 Ga0105249_10152698 3300009553 Bacteria 2224
192 Ga0105249_11063869 3300009553 Bacteria 879
193 Ga0105249_11175304 3300009553 Bacteria 838
194 Ga0105239_10151565 3300010375 Bacteria 2587
195 Ga0105239_10230226 3300010375 Bacteria 2079
196 Ga0105239_10317415 3300010375 Bacteria 1757
197 Ga0105239_10594532 3300010375 Bacteria 1262
198 Ga0105239_10958531 3300010375 Bacteria 983
199 Ga0105239_12387791 3300010375 Bacteria 616
200 Ga0105246_10022892 3300011119 Bacteria 4037
201 Ga0105246_10358714 3300011119 Bacteria 1197
202 Ga0105246_11205249 3300011119 Bacteria 697
203 Ga0105246_11676273 3300011119 Bacteria 603
204 Ga0157313_1036987 3300012503 Bacteria 582
205 Ga0157371_10121374 3300013102 Bacteria 1858
206 Ga0157371_10750779 3300013102 Bacteria 733
207 Ga0157371_10957452 3300013102 Bacteria 651
208 Ga0157370_10003894 3300013104 Bacteria 17388
209 Ga0157370_10091031 3300013104 Bacteria 2864
210 Ga0157370_11205678 3300013104 Bacteria 683
211 Ga0157369_10079691 3300013105 Bacteria 3507
212 Ga0157369_10082608 3300013105 Bacteria 3437
213 Ga0157369_10133804 3300013105 Bacteria 2626
214 Ga0157369_11163560 3300013105 Bacteria 788
215 Ga0157374_10030439 3300013296 Bacteria 4901
216 Ga0157374_10143042 3300013296 Bacteria 2322
217 Ga0157374_10676767 3300013296 Bacteria 1044
218 Ga0157378_10005048 3300013297 Bacteria 11589
219 Ga0163162_10052449 3300013306 Bacteria 4096
220 Ga0163162_10232737 3300013306 Bacteria 1973
221 Ga0163162_10265737 3300013306 Bacteria 1847
222 Ga0163162_13125673 3300013306 Bacteria 531
223 Ga0157372_10319147 3300013307 Bacteria 1809
224 Ga0157372_10377474 3300013307 Bacteria 1652
225 Ga0157372_10491989 3300013307 Bacteria 1430
226 Ga0157372_10530486 3300013307 Bacteria 1372
227 Ga0157372_11085078 3300013307 Bacteria 926
228 Ga0157372_12520349 3300013307 Bacteria 590
229 Ga0157375_10007540 3300013308 Bacteria 9513
230 Ga0157375_10092104 3300013308 Bacteria 3094
231 Ga0157375_10487230 3300013308 Bacteria 1398
232 Ga0157375_10835112 3300013308 Bacteria 1068
233 Ga0157375_11260027 3300013308 Bacteria 868
234 Ga0163163_10046293 3300014325 Bacteria 4273
235 Ga0163163_10187299 3300014325 Bacteria 2117
236 Ga0163163_10641576 3300014325 Bacteria 1125
237 Ga0163163_11046558 3300014325 Bacteria 879
238 Ga0163163_12860059 3300014325 Bacteria 539
239 Ga0157380_10157965 3300014326 Bacteria 1967
240 Ga0157380_11160904 3300014326 Bacteria 814
241 Ga0157380_12228800 3300014326 Bacteria 612
242 Ga0182008_10004686 3300014497 Bacteria 7940
243 Ga0157377_10685512 3300014745 Bacteria 742
244 Ga0157377_11433935 3300014745 Bacteria 546
245 Ga0157379_10000901 3300014968 Bacteria 24037
246 Ga0157379_10041706 3300014968 Bacteria 4097
247 Ga0157379_10453850 3300014968 Bacteria 1184
248 Ga0157379_10918140 3300014968 Bacteria 831
249 Ga0157376_10020002 3300014969 Bacteria 5169
250 Ga0182006_1028681 3300015261 Bacteria 2262
251 Ga0182007_10006733 3300015262 Bacteria 4906
252 Ga0183367_1002 3300015688 Bacteria 1101531
253 Ga0163161_10061866 3300017792 Bacteria 2726
254 Ga0163161_10098374 3300017792 Bacteria 2174
255 Ga0163161_10547123 3300017792 Bacteria 948
256 Ga0197907_10094630 3300020069 Bacteria 1524
257 Ga0197907_11347725 3300020069 Bacteria 802
258 Ga0206356_11748901 3300020070 Bacteria 1154
259 Ga0206349_1586608 3300020075 Bacteria 1090
260 Ga0206355_1150127 3300020076 Bacteria 1508
261 Ga0206354_10916987 3300020081 Bacteria 805
262 Ga0206353_10391345 3300020082 Bacteria 1296
263 Ga0206353_10498624 3300020082 Bacteria 820
264 Ga0206353_11649892 3300020082 Bacteria 1645
265 Ga0213876_10000813 3300021384 Bacteria 21125
266 Ga0213875_10000904 3300021388 Bacteria 21527
267 Ga0213875_10031231 3300021388 Bacteria 2520
268 Ga0224712_10007165 3300022467 Bacteria 3229
269 Ga0224712_10011494 3300022467 Bacteria 2750
270 Ga0224712_10017796 3300022467 Bacteria 2363
271 Ga0207426_1006340 3300025302 Bacteria 5168
272 Ga0207426_1008834 3300025302 Bacteria 4033
273 Ga0207426_1009606 3300025302 Bacteria 3812
274 Ga0207696_1041246 3300025711 Bacteria 1349
275 Ga0207713_1025636 3300025735 Bacteria 2717
276 Ga0207692_10208612 3300025898 Bacteria 1152
277 Ga0207710_10000048 3300025900 Bacteria 189597
278 Ga0207710_10087734 3300025900 Bacteria 1452
279 Ga0207710_10318003 3300025900 Bacteria 789
280 Ga0207688_10082599 3300025901 Bacteria 1836
281 Ga0207647_10000592 3300025904 Bacteria 28197
282 Ga0207647_10029484 3300025904 Bacteria 3551
283 Ga0207647_10160579 3300025904 Bacteria 1311
284 Ga0207685_10214087 3300025905 Bacteria 913
285 Ga0207699_10008852 3300025906 Bacteria 4986
286 Ga0207699_10016621 3300025906 Bacteria 3853
287 Ga0207699_10451691 3300025906 Bacteria 922
288 Ga0207643_10116798 3300025908 Bacteria 1576
289 Ga0207643_10610749 3300025908 Bacteria 702
290 Ga0207705_10044902 3300025909 Bacteria 3176
291 Ga0207705_10105574 3300025909 Bacteria 2077
292 Ga0207705_10326488 3300025909 Bacteria 1180
293 Ga0207705_10482938 3300025909 Bacteria 962
294 Ga0207707_10093220 3300025912 Bacteria 2631
295 Ga0207707_10420591 3300025912 Bacteria 1146
296 Ga0207707_10464875 3300025912 Bacteria 1082
297 Ga0207707_11235758 3300025912 Bacteria 603
298 Ga0207695_10042388 3300025913 Bacteria 4862
299 Ga0207695_10199119 3300025913 Bacteria 1918
300 Ga0207671_10000128 3300025914 Bacteria 117836
301 Ga0207663_10230129 3300025916 Bacteria 1354
302 Ga0207663_10247933 3300025916 Bacteria 1309
303 Ga0207660_10067455 3300025917 Bacteria 2591
304 Ga0207660_10215256 3300025917 Bacteria 1506
305 Ga0207657_10083860 3300025919 Bacteria 2673
306 Ga0207657_10094200 3300025919 Bacteria 2494
307 Ga0207657_10533020 3300025919 Bacteria 918
308 Ga0207652_10029332 3300025921 Bacteria 4599
309 Ga0207652_10135682 3300025921 Bacteria 2197
310 Ga0207652_10282189 3300025921 Bacteria 1498
311 Ga0207694_10001189 3300025924 Bacteria 22545
312 Ga0207694_10225566 3300025924 Bacteria 1529
313 Ga0207659_10481616 3300025926 Bacteria 1048
314 Ga0207687_10259044 3300025927 Bacteria 1386
315 Ga0207687_10328171 3300025927 Bacteria 1240
316 Ga0207687_10380501 3300025927 Bacteria 1156
317 Ga0207687_10383149 3300025927 Bacteria 1153
318 Ga0207700_10034178 3300025928 Bacteria 3647
319 Ga0207700_10066590 3300025928 Bacteria 2754
320 Ga0207700_10088700 3300025928 Bacteria 2436
321 Ga0207700_10165244 3300025928 Bacteria 1841
322 Ga0207700_10429826 3300025928 Bacteria 1161
323 Ga0207700_10490352 3300025928 Bacteria 1087
324 Ga0207664_10021031 3300025929 Bacteria 4843
325 Ga0207664_10071371 3300025929 Bacteria 2797
326 Ga0207664_10102621 3300025929 Bacteria 2365
327 Ga0207664_10106774 3300025929 Bacteria 2322
328 Ga0207664_10225769 3300025929 Bacteria 1626
329 Ga0207664_10365880 3300025929 Bacteria 1278
330 Ga0207664_10411912 3300025929 Bacteria 1203
331 Ga0207690_10007846 3300025932 Bacteria 6339
332 Ga0207706_10931581 3300025933 Bacteria 733
333 Ga0207686_10156779 3300025934 Bacteria 1591
334 Ga0207686_10976490 3300025934 Bacteria 686
335 Ga0207686_11239852 3300025934 Bacteria 611
336 Ga0207709_10265246 3300025935 Bacteria 1261
337 Ga0207709_10369843 3300025935 Bacteria 1088
338 Ga0207709_10496420 3300025935 Bacteria 952
339 Ga0207709_10726536 3300025935 Bacteria 797
340 Ga0207670_10309830 3300025936 Bacteria 1239
341 Ga0207670_10448677 3300025936 Bacteria 1040
342 Ga0207669_10698223 3300025937 Bacteria 834
343 Ga0207665_10068534 3300025939 Bacteria 2418
344 Ga0207665_10309078 3300025939 Bacteria 1184
345 Ga0207691_10269615 3300025940 Bacteria 1466
346 Ga0207691_10590626 3300025940 Bacteria 940
347 Ga0207711_10351479 3300025941 Bacteria 1365
348 Ga0207711_10711727 3300025941 Bacteria 936
349 Ga0207689_10892131 3300025942 Bacteria 750
350 Ga0207661_10212019 3300025944 Bacteria 1708
351 Ga0207661_11055327 3300025944 Bacteria 748
352 Ga0207661_11903760 3300025944 Bacteria 540
353 Ga0207679_10868886 3300025945 Bacteria 824
354 Ga0207679_11361206 3300025945 Bacteria 651
355 Ga0207667_10034993 3300025949 Bacteria 5391
356 Ga0207667_10203476 3300025949 Bacteria 2031
357 Ga0207667_10718752 3300025949 Bacteria 1000
358 Ga0207667_11012523 3300025949 Bacteria 817
359 Ga0207712_10082682 3300025961 Bacteria 2342
360 Ga0207640_10018649 3300025981 Bacteria 4082
361 Ga0207640_10834054 3300025981 Bacteria 801
362 Ga0207658_11500570 3300025986 Bacteria 616
363 Ga0207677_10002090 3300026023 Bacteria 10514
364 Ga0207677_11168278 3300026023 Bacteria 704
365 Ga0207703_10000002 3300026035 Bacteria 600711
366 Ga0207703_10368599 3300026035 Bacteria 1326
367 Ga0207639_10117843 3300026041 Bacteria 2176
368 Ga0207639_10471143 3300026041 Bacteria 1143
369 Ga0207639_10545909 3300026041 Bacteria 1064
370 Ga0207678_10245716 3300026067 Bacteria 1533
371 Ga0207678_10903177 3300026067 Bacteria 781
372 Ga0207708_10104352 3300026075 Bacteria 2196
373 Ga0207702_10021228 3300026078 Bacteria 5375
374 Ga0207702_10083345 3300026078 Bacteria 2782
375 Ga0207702_10274149 3300026078 Bacteria 1592
376 Ga0207702_10291862 3300026078 Bacteria 1545
377 Ga0207702_10607845 3300026078 Bacteria 1073
378 Ga0207702_11149885 3300026078 Bacteria 770
379 Ga0207641_10659277 3300026088 Bacteria 1028
380 Ga0207676_10035155 3300026095 Bacteria 3800
381 Ga0207674_10190060 3300026116 Bacteria 2003
382 Ga0207674_10433024 3300026116 Bacteria 1271
383 Ga0207674_11845701 3300026116 Bacteria 571
384 Ga0207675_101209775 3300026118 Bacteria 776
385 Ga0207683_10008840 3300026121 Bacteria 8591
386 Ga0207683_10539841 3300026121 Bacteria 1078
387 Ga0207698_10098418 3300026142 Bacteria 2417
388 Ga0207698_10106298 3300026142 Bacteria 2340
389 Ga0207698_10331061 3300026142 Bacteria 1430
390 Ga0207698_10999455 3300026142 Bacteria 847
391 Ga0207698_11729664 3300026142 Bacteria 641
392 Ga0207698_11770536 3300026142 Bacteria 633
393 Ga0209282_1088542 3300027666 Bacteria 1629
394 Ga0268266_10056711 3300028379 Bacteria 3370
395 Ga0268264_10777949 3300028381 Bacteria 955
396 Ga0265336_10008687 3300028666 Bacteria 3546
397 Ga0307515_10001897 3300028794 Bacteria 46523
398 Ga0307515_10101954 3300028794 Bacteria 3458
399 Ga0307515_10202590 3300028794 Bacteria 1855
400 Ga0307515_10361289 3300028794 Bacteria 1093
401 Ga0265338_10001947 3300028800 Bacteria 32225
402 Ga0265338_10008217 3300028800 Bacteria 12710
403 Ga0265338_10011667 3300028800 Bacteria 10121
404 Ga0265338_10247519 3300028800 Bacteria 1317
405 Ga0268256_1069139 3300030500 Bacteria 686
406 Ga0307511_10006642 3300030521 Bacteria 11663
407 Ga0307511_10137380 3300030521 Bacteria 1450
408 Ga0307511_10406167 3300030521 Bacteria 557
409 Ga0307512_10011226 3300030522 Bacteria 8499
410 Ga0307512_10018422 3300030522 Bacteria 6382
411 Ga0316182_1262137 3300030745 Bacteria 818
412 Ga0265325_10038156 3300031241 Bacteria 2536
413 Ga0265325_10076140 3300031241 Bacteria 1675
414 Ga0265340_10004760 3300031247 Bacteria 7546
415 Ga0265340_10052803 3300031247 Bacteria 1964
416 Ga0265339_10212455 3300031249 Bacteria 950
417 Ga0265316_10200137 3300031344 Bacteria 1481
418 Ga0307513_10001546 3300031456 Bacteria 32952
419 Ga0307513_10095693 3300031456 Bacteria 3009
420 Ga0307513_10105129 3300031456 Bacteria 2834
421 Ga0307513_10144890 3300031456 Bacteria 2295
422 Ga0307513_10451308 3300031456 Bacteria 1010
423 Ga0307513_10721841 3300031456 Bacteria 702
424 Ga0307509_10018160 3300031507 Bacteria 8070
425 Ga0307509_10031570 3300031507 Bacteria 5849
426 Ga0307509_10088336 3300031507 Bacteria 3182
427 Ga0307509_10102733 3300031507 Bacteria 2889
428 Ga0307509_10478196 3300031507 Bacteria 934
429 Ga0265313_10007055 3300031595 Bacteria 7772
430 Ga0307508_10031345 3300031616 Bacteria 4804
431 Ga0307508_10056397 3300031616 Bacteria 3479
432 Ga0307508_10078345 3300031616 Bacteria 2885
433 Ga0307508_10220119 3300031616 Bacteria 1498
434 Ga0307508_10224302 3300031616 Bacteria 1479
435 Ga0307508_10252286 3300031616 Bacteria 1360
436 Ga0307514_10105163 3300031649 Bacteria 2017
437 Ga0307514_10200117 3300031649 Bacteria 1257
438 Ga0307514_10342558 3300031649 Bacteria 803
439 Ga0265342_10119139 3300031712 Bacteria 1488
440 Ga0265342_10128557 3300031712 Bacteria 1421
441 Ga0307516_10012550 3300031730 Bacteria 9120
442 Ga0307516_10056363 3300031730 Bacteria 3832
443 Ga0307516_10449917 3300031730 Bacteria 944
444 Ga0307516_10512720 3300031730 Bacteria 853
445 Ga0307405_10556111 3300031731 Bacteria 929
446 Ga0307413_10277578 3300031824 Bacteria 1258
447 Ga0307413_11462590 3300031824 Bacteria 603
448 Ga0307518_10040229 3300031838 Bacteria 3401
449 Ga0307518_10058004 3300031838 Bacteria 2812
450 Ga0307518_10185534 3300031838 Bacteria 1400
451 Ga0307410_10266686 3300031852 Bacteria 1338
452 Ga0307410_10439499 3300031852 Bacteria 1062
453 Ga0307406_10379776 3300031901 Bacteria 1114
454 Ga0307409_100094980 3300031995 Bacteria 2455
455 Ga0307409_100219889 3300031995 Bacteria 1714
456 Ga0307409_100818285 3300031995 Bacteria 940
457 Ga0307416_100757339 3300032002 Bacteria 1064
458 Ga0307416_100890011 3300032002 Bacteria 990
459 Ga0307411_10065279 3300032005 Bacteria 2441
460 Ga0307411_10330816 3300032005 Bacteria 1234
461 Ga0307411_11780865 3300032005 Bacteria 571
462 Ga0307507_10000482 3300033179 Bacteria 83990
463 Ga0307507_10009069 3300033179 Bacteria 13406
464 Ga0307507_10138409 3300033179 Bacteria 1875
465 Ga0307510_10018408 3300033180 Bacteria 8220
466 Ga0307510_10316364 3300033180 Bacteria 1019
467 Ga0373926_0010485 3300035083 Bacteria 3108
468 Ga0373934_0040884 3300035086 Bacteria 1829
469 Ga0373934_0087571 3300035086 Bacteria 1254
470 Ga0373944_0007820 3300035089 Bacteria 2875
471 Ga0373944_0355853 3300035089 Bacteria 558
472 Ga0373949_0111455 3300035090 Bacteria 760
473 Ga0373923_0035685 3300035111 Bacteria 2026
474 Ga0373923_0080123 3300035111 Bacteria 1415
475 Ga0373923_0149317 3300035111 Bacteria 1060
476 Ga0373936_0003144 3300035113 Bacteria 6179
477 Ga0373945_0000841 3300035116 Bacteria 9009
478 Ga0373953_0069189 3300035117 Bacteria 1454
479 Ga0373953_0131078 3300035117 Bacteria 1069
480 Ga0373954_0001336 3300035118 Bacteria 9944
481 Ga0373954_0028020 3300035118 Bacteria 2588
482 Ga0373954_0084459 3300035118 Bacteria 1520
483 Ga0373956_0027999 3300035119 Bacteria 2450
484 Ga0373956_0055399 3300035119 Bacteria 1788
485 Ga0373957_0021397 3300035120 Bacteria 2295
486 Ga0373957_0180638 3300035120 Bacteria 874
487 Ga0373957_0227099 3300035120 Bacteria 782
488 Ga0373943_0004434 3300035170 Bacteria 6350
489 Ga0373943_0455209 3300035170 Bacteria 744
490 Ga0373946_0000825 3300035171 Bacteria 10575
491 Ga0316574_0121060 3300035398 Bacteria 1681
492 Ga0373931_0567946 3300035691 Bacteria 739
493 Ga0373935_0023854 3300035692 Bacteria 3758
494 Ga0373935_0224683 3300035692 Bacteria 1305
495 Ga0373927_0012270 3300035695 Bacteria 5700
496 Ga0373933_0081971 3300035724 Bacteria 1979
497 Ga0373933_0398666 3300035724 Bacteria 897
498 Ga0373947_0003413 3300035725 Bacteria 9402
499 Ga0373947_0671110 3300035725 Bacteria 707
500 Ga0373937_0024186 3300036401 Bacteria 5475
501 Ga0373937_0033269 3300036401 Bacteria 4681
502 Ga0373937_0061238 3300036401 Bacteria 3459
503 Ga0373925_0005181 3300037068 Bacteria 9757
504 Ga0373925_0211308 3300037068 Bacteria 1545
505 Ga0373925_0555270 3300037068 Bacteria 944
506 Ga0373925_0894157 3300037068 Bacteria 732
507 Ga0395899_0113039 3300037312 Bacteria 1951
508 Ga0395899_0267424 3300037312 Bacteria 1167
509 Ga0395900_0130824 3300037418 Bacteria 2572
510 Ga0395900_0690887 3300037418 Bacteria 954
511 Ga0395900_0813045 3300037418 Bacteria 862
512 Ga0395900_1362080 3300037418 Bacteria 623
513 Ga0395898_0026366 3300037466 Bacteria 5849
514 Ga0395898_0092765 3300037466 Bacteria 2903
515 Ga0395898_0237642 3300037466 Bacteria 1738
516 Ga0395898_0467129 3300037466 Bacteria 1201
517 Ga0395898_0537473 3300037466 Bacteria 1111
518 Ga0395898_0587201 3300037466 Bacteria 1057
519 Ga0395898_0652054 3300037466 Bacteria 995
520 Ga0395905_0270188 3300037471 Bacteria 1586
521 Ga0436364_0002567 3300037853 Bacteria 855
522 Ga0436364_1354648 3300037853 Bacteria 115417
523 Ga0436364_1414364 3300037853 Bacteria 2520
524 Ga0395901_0055181 3300038443 Bacteria 4131
525 Ga0395901_0090689 3300038443 Bacteria 3199
526 Ga0395901_0107395 3300038443 Bacteria 2930
527 Ga0395901_0210655 3300038443 Bacteria 2034
528 Ga0395901_0229517 3300038443 Bacteria 1938
529 Ga0395901_0274627 3300038443 Bacteria 1752
530 Ga0395901_0290221 3300038443 Bacteria 1698
531 Ga0395901_0843539 3300038443 Bacteria 902
532 Ga0395901_1212189 3300038443 Bacteria 720
533 Ga0395901_1993519 3300038443 Bacteria 527
534 Ga0436365_0271067 3300039437 Bacteria 17765
535 Ga0436361_0897381 3300039447 Bacteria 569
536 Ga0436363_0135126 3300039450 Bacteria 945
537 Ga0439436_0000987 3300041404 Bacteria 7903
538 Ga0439436_0004595 3300041404 Bacteria 4232
539 Ga0439439_0036403 3300041406 Bacteria 1266
540 Ga0439439_0056864 3300041406 Bacteria 1034
541 Ga0451789_0943076 3300041443 Bacteria 1044
542 Ga0451791_0200477 3300041451 Bacteria 585
543 Ga0451791_0684826 3300041451 Bacteria 657
544 Ga0451795_0622179 3300041456 Bacteria 657
545 Ga0451795_1164976 3300041456 Bacteria 612
546 Ga0451795_1458503 3300041456 Bacteria 1493
547 Ga0451798_0780721 3300041458 Bacteria 973
548 Ga0451800_0832306 3300041459 Bacteria 724
549 Ga0451802_0630685 3300041460 Bacteria 643
550 Ga0451804_0346912 3300041463 Bacteria 924
551 Ga0451807_2017756 3300041486 Bacteria 700
552 Ga0451807_2347865 3300041486 Bacteria 572
553 Ga0451833_0247344 3300041491 Bacteria 586
554 Ga0451835_1235831 3300041492 Bacteria 820
555 Ga0451837_1021945 3300041494 Bacteria 3962
556 Ga0451841_0330448 3300041498 Bacteria 1557
557 Ga0451849_0665405 3300041505 Bacteria 1184
558 Ga0451843_0199401 3300041509 Bacteria 900
559 Ga0451843_0489293 3300041509 Bacteria 521
560 Ga0451843_0756226 3300041509 Bacteria 890
561 Ga0451843_0916359 3300041509 Bacteria 631
562 Ga0451853_0020641 3300041512 Bacteria 1320
563 Ga0451853_0701526 3300041512 Bacteria 2720
564 Ga0451853_1418287 3300041512 Bacteria 2430
565 Ga0451853_2445157 3300041512 Bacteria 3704
566 Ga0451853_3255794 3300041512 Bacteria 521
567 Ga0439433_0004643 3300041999 Bacteria 2951
568 Ga0439442_006134 3300042002 Bacteria 2411
569 Ga0439449_0006827 3300042007 Bacteria 4352
570 Ga0439449_0050763 3300042007 Bacteria 1534
571 Ga0439449_0066425 3300042007 Bacteria 1330
572 Ga0439449_0099891 3300042007 Bacteria 1072
573 Ga0439450_049915 3300042008 Bacteria 992
574 Ga0439455_0009031 3300042012 Bacteria 2154
575 Ga0439457_000226 3300042014 Bacteria 15042
576 Ga0439457_005142 3300042014 Bacteria 3327
577 Ga0439462_0006886 3300042015 Bacteria 2835
578 Ga0450894_000469 3300042131 Bacteria 6884
579 Ga0450895_001743 3300042132 Bacteria 1550
580 Ga0450896_000106 3300042133 Bacteria 6026
581 Ga0450898_000563 3300042134 Bacteria 4394
582 Ga0450899_001353 3300042135 Bacteria 2753
583 Ga0450900_075950 3300042136 Bacteria 536
584 Ga0450903_001178 3300042138 Bacteria 4934
585 Ga0450903_008536 3300042138 Bacteria 1675
586 Ga0439458_0002293 3300042157 Bacteria 4696
587 Ga0439458_0043027 3300042157 Bacteria 1100
588 Ga0466969_0001522 3300044656 Bacteria 12485
589 Ga0466969_0002072 3300044656 Bacteria 10712
590 Ga0466969_0033530 3300044656 Bacteria 2607
591 Ga0466969_0042539 3300044656 Bacteria 2267
592 Ga0466969_0043040 3300044656 Bacteria 2251
593 Ga0466969_0361021 3300044656 Bacteria 658
594 Ga0466972_0010134 3300044658 Bacteria 4734
595 Ga0466972_0024615 3300044658 Bacteria 2987
596 Ga0466972_0057751 3300044658 Bacteria 1863
597 Ga0466972_0279956 3300044658 Bacteria 779
598 Ga0466972_0326545 3300044658 Bacteria 717
599 Ga0466965_0016619 3300044683 Bacteria 3505
600 Ga0466965_0065937 3300044683 Bacteria 1815
601 Ga0466965_0349242 3300044683 Bacteria 810
602 Ga0466965_0367662 3300044683 Bacteria 790
603 Ga0466965_0464444 3300044683 Bacteria 706
604 Ga0466966_0002430 3300044684 Bacteria 12171
605 Ga0466966_0003728 3300044684 Bacteria 10046
606 Ga0466966_0010844 3300044684 Bacteria 6055
607 Ga0466966_0036476 3300044684 Bacteria 3174
608 Ga0466966_0078559 3300044684 Bacteria 2057
609 Ga0466966_0102575 3300044684 Bacteria 1768
610 Ga0466966_0181198 3300044684 Bacteria 1278
611 Ga0466966_0689802 3300044684 Bacteria 615
612 Ga0466961_0000420 3300044693 Bacteria 27093
613 Ga0466961_0003156 3300044693 Bacteria 10263
614 Ga0466961_0011629 3300044693 Bacteria 5625
615 Ga0466961_0011789 3300044693 Bacteria 5587
616 Ga0466961_0016815 3300044693 Bacteria 4703
617 Ga0466961_0019046 3300044693 Bacteria 4416
618 Ga0466961_0022130 3300044693 Bacteria 4090
619 Ga0466961_0029264 3300044693 Bacteria 3542
620 Ga0466961_0049747 3300044693 Bacteria 2678
621 Ga0466961_0091467 3300044693 Bacteria 1921
622 Ga0466961_0340125 3300044693 Bacteria 914
623 Ga0466961_0566857 3300044693 Bacteria 683
624 Ga0466963_0000957 3300044694 Bacteria 14814
625 Ga0466963_0006510 3300044694 Bacteria 6915
626 Ga0466963_0038865 3300044694 Bacteria 3114
627 Ga0466963_0188513 3300044694 Bacteria 1441
628 Ga0466963_0977538 3300044694 Bacteria 596
629 Ga0466964_0189055 3300044706 Bacteria 981
630 Ga0466964_0244860 3300044706 Bacteria 881
631 Ga0466971_0002552 3300044719 Bacteria 7693
632 Ga0466971_0006100 3300044719 Bacteria 5242
633 Ga0466971_0015607 3300044719 Bacteria 3345
634 Ga0466971_0029487 3300044719 Bacteria 2454
635 Ga0466971_0044706 3300044719 Bacteria 1988
636 Ga0466971_0045109 3300044719 Bacteria 1980
637 Ga0466971_0311611 3300044719 Bacteria 757
638 Ga0466968_0092105 3300044735 Bacteria 1345
639 Ga0466968_0213181 3300044735 Bacteria 908
640 Ga0466968_0286607 3300044735 Bacteria 789
641 Ga0466970_0008565 3300044765 Bacteria 5149
642 Ga0466970_0035981 3300044765 Bacteria 2622
643 Ga0466970_0042781 3300044765 Bacteria 2409
644 Ga0466970_0085712 3300044765 Bacteria 1706
645 Ga0466970_0183329 3300044765 Bacteria 1162
646 Ga0466970_0206112 3300044765 Bacteria 1095
647 Ga0466970_0210875 3300044765 Bacteria 1082
648 Ga0466970_0246953 3300044765 Bacteria 999
649 Ga0466970_0284496 3300044765 Bacteria 930
650 Ga0466970_0533599 3300044765 Bacteria 677
651 Ga0466957_0013296 3300044842 Bacteria 4775
652 Ga0466957_0016285 3300044842 Bacteria 4348
653 Ga0466957_0047527 3300044842 Bacteria 2608
654 Ga0466957_0120667 3300044842 Bacteria 1671
655 Ga0466957_0330364 3300044842 Bacteria 1030
656 Ga0466957_0397869 3300044842 Bacteria 942
657 Ga0466957_0810817 3300044842 Bacteria 665
658 Ga0466957_0840906 3300044842 Bacteria 654
659 Ga0466957_0922179 3300044842 Bacteria 625
660 Ga0466960_0042223 3300044901 Bacteria 2164
661 Ga0466960_0085119 3300044901 Bacteria 1601
662 Ga0466960_0098516 3300044901 Bacteria 1502
663 Ga0466960_0101915 3300044901 Bacteria 1479
664 Ga0466960_0156298 3300044901 Bacteria 1221
665 Ga0466959_0014427 3300045049 Bacteria 5740
666 Ga0466959_0019179 3300045049 Bacteria 5028
667 Ga0466959_0021835 3300045049 Bacteria 4725
668 Ga0466959_0050763 3300045049 Bacteria 3044
669 Ga0466959_0075510 3300045049 Bacteria 2435
670 Ga0466959_0106300 3300045049 Bacteria 2006
671 Ga0466959_0164765 3300045049 Bacteria 1557
672 Ga0466959_0195302 3300045049 Bacteria 1411
673 Ga0466959_0204290 3300045049 Bacteria 1375
674 Ga0466959_0300291 3300045049 Bacteria 1100
675 Ga0466959_0605864 3300045049 Bacteria 737
676 Ga0466959_0729710 3300045049 Bacteria 663
677 Ga0466959_0870230 3300045049 Bacteria 601
678 Ga0466959_0991401 3300045049 Bacteria 560
679 Ga0466958_0021709 3300045836 Bacteria 3754
680 Ga0466958_0104809 3300045836 Bacteria 1761
681 Ga0466958_0117946 3300045836 Bacteria 1660
682 Ga0466958_0147770 3300045836 Bacteria 1482
683 Ga0466958_0230149 3300045836 Bacteria 1183
684 Ga0466958_0280482 3300045836 Bacteria 1068
685 Ga0466967_0014444 3300045976 Bacteria 6152
686 Ga0466967_0046949 3300045976 Bacteria 3763
687 Ga0466967_0072565 3300045976 Bacteria 3085
688 Ga0466967_0117546 3300045976 Bacteria 2451
689 Ga0466967_0126930 3300045976 Bacteria 2364
690 Ga0466967_0134590 3300045976 Bacteria 2298
691 Ga0466967_0158328 3300045976 Bacteria 2124
692 Ga0466967_0234088 3300045976 Bacteria 1750
693 Ga0466967_0448931 3300045976 Bacteria 1260
694 Ga0466967_0838355 3300045976 Bacteria 913
695 Ga0466967_0916157 3300045976 Bacteria 872
696 Ga0495617_030494 3300046452 Bacteria 1812
697 Ga0495627_025594 3300046453 Bacteria 1912
698 Ga0495627_056349 3300046453 Bacteria 1172
699 Ga0495592_0026472 3300046454 Bacteria 4398
700 Ga0495592_0029582 3300046454 Bacteria 4147
701 Ga0495592_0030318 3300046454 Bacteria 4092
702 Ga0495592_0038013 3300046454 Bacteria 3622
703 Ga0495592_0040174 3300046454 Bacteria 3511
704 Ga0495592_0049991 3300046454 Bacteria 3107
705 Ga0495592_0860489 3300046454 Bacteria 535
706 Ga0495603_0000669 3300046455 Bacteria 19408
707 Ga0495603_0026568 3300046455 Bacteria 3496
708 Ga0495603_0026701 3300046455 Bacteria 3487
709 Ga0495603_0040921 3300046455 Bacteria 2772
710 Ga0495603_0066223 3300046455 Bacteria 2127
711 Ga0495603_0094025 3300046455 Bacteria 1752
712 Ga0495603_0105016 3300046455 Bacteria 1648
713 Ga0495603_0145490 3300046455 Bacteria 1378
714 Ga0495603_0146297 3300046455 Bacteria 1373
715 Ga0495603_0395514 3300046455 Bacteria 792
716 Ga0495603_0505463 3300046455 Bacteria 692
717 Ga0495603_0590732 3300046455 Bacteria 636
718 Ga0495590_0029568 3300046457 Bacteria 1920
719 Ga0495629_0005008 3300046459 Bacteria 9933
720 Ga0495629_0008159 3300046459 Bacteria 7702
721 Ga0495629_0055400 3300046459 Bacteria 2772
722 Ga0495629_0070609 3300046459 Bacteria 2437
723 Ga0495629_0079118 3300046459 Bacteria 2295
724 Ga0495629_0095982 3300046459 Bacteria 2068
725 Ga0495629_0098282 3300046459 Bacteria 2042
726 Ga0495629_0154578 3300046459 Bacteria 1594
727 Ga0495629_0422480 3300046459 Bacteria 904
728 Ga0495629_0839662 3300046459 Bacteria 604
729 Ga0495629_0903939 3300046459 Bacteria 579
730 Ga0495638_0032430 3300046460 Bacteria 3349
731 Ga0495638_0140368 3300046460 Bacteria 1411
732 Ga0495641_0017674 3300046461 Bacteria 3705
733 Ga0495641_0038441 3300046461 Bacteria 2236
734 Ga0495641_0112735 3300046461 Bacteria 1213
735 Ga0495651_0000937 3300046462 Bacteria 22597
736 Ga0495651_0000980 3300046462 Bacteria 22144
737 Ga0495651_0001402 3300046462 Bacteria 18685
738 Ga0495651_0016264 3300046462 Bacteria 5761
739 Ga0495651_0072771 3300046462 Bacteria 2610
740 Ga0495651_0152601 3300046462 Bacteria 1663
741 Ga0495651_0235064 3300046462 Bacteria 1260
742 Ga0495653_0001557 3300046463 Bacteria 17932
743 Ga0495653_0091259 3300046463 Bacteria 2227
744 Ga0495653_0288751 3300046463 Bacteria 1074
745 Ga0495653_0527235 3300046463 Bacteria 733
746 Ga0495580_0363460 3300046472 Bacteria 979
747 Ga0495580_0885156 3300046472 Bacteria 575
748 Ga0495582_0138486 3300046473 Bacteria 1378
749 Ga0495582_0460976 3300046473 Bacteria 734
750 Ga0495605_0055468 3300046474 Bacteria 1914
751 Ga0495605_0100549 3300046474 Bacteria 1330
752 Ga0495639_0022765 3300046475 Bacteria 2750
753 Ga0495662_0000039 3300046476 Bacteria 43770
754 Ga0495662_0025273 3300046476 Bacteria 2867
755 Ga0495662_0062865 3300046476 Bacteria 1794
756 Ga0495662_0113313 3300046476 Bacteria 1329
757 Ga0495662_0154981 3300046476 Bacteria 1128
758 Ga0495662_0483768 3300046476 Bacteria 607
759 Ga0495664_0001560 3300046477 Bacteria 12137
760 Ga0495664_0018280 3300046477 Bacteria 4013
761 Ga0495664_0019455 3300046477 Bacteria 3904
762 Ga0495664_0267462 3300046477 Bacteria 1033
763 Ga0495664_0269256 3300046477 Bacteria 1029
764 Ga0495664_0296816 3300046477 Bacteria 976
765 Ga0495664_0776727 3300046477 Bacteria 564
766 Ga0495584_0217928 3300046491 Bacteria 970
767 Ga0495584_0394067 3300046491 Bacteria 704
768 Ga0495585_0006093 3300046492 Bacteria 7534
769 Ga0495585_0027126 3300046492 Bacteria 3270
770 Ga0495585_0125024 3300046492 Bacteria 1358
771 Ga0495585_0193273 3300046492 Bacteria 1040
772 Ga0495594_0002244 3300046499 Bacteria 10060
773 Ga0495594_0063501 3300046499 Bacteria 2046
774 Ga0495594_0174376 3300046499 Bacteria 1223
775 Ga0495594_0244581 3300046499 Bacteria 1022
776 Ga0495594_0269746 3300046499 Bacteria 969
777 Ga0495594_0431135 3300046499 Bacteria 750
778 Ga0495594_0446279 3300046499 Bacteria 735
779 Ga0495596_0114341 3300046500 Bacteria 1048
780 Ga0495607_0024376 3300046501 Bacteria 3772
781 Ga0495607_0036715 3300046501 Bacteria 2950
782 Ga0495607_0055495 3300046501 Bacteria 2279
783 Ga0495583_0025119 3300046506 Bacteria 2981
784 Ga0495583_0082931 3300046506 Bacteria 1390
785 Ga0495606_0042550 3300046507 Bacteria 3036
786 Ga0495608_0047041 3300046511 Bacteria 2869
787 Ga0495608_0068990 3300046511 Bacteria 2311
788 Ga0495608_0277913 3300046511 Bacteria 1040
789 Ga0495610_0036888 3300046512 Bacteria 2494
790 Ga0495616_0018387 3300046513 Bacteria 3837
791 Ga0495618_0061843 3300046514 Bacteria 2375
792 Ga0495618_0067905 3300046514 Bacteria 2267
793 Ga0495618_0076097 3300046514 Bacteria 2138
794 Ga0495618_0335230 3300046514 Bacteria 934
795 Ga0495618_0668152 3300046514 Bacteria 613
796 Ga0495620_0001872 3300046515 Bacteria 12383
797 Ga0495620_0048386 3300046515 Bacteria 1825
798 Ga0495620_0197376 3300046515 Bacteria 774
799 Ga0495628_0017262 3300046516 Bacteria 6010
800 Ga0495628_0021408 3300046516 Bacteria 5319
801 Ga0495628_0067910 3300046516 Bacteria 2782
802 Ga0495628_0098450 3300046516 Bacteria 2259
803 Ga0495628_0133203 3300046516 Bacteria 1900
804 Ga0495628_0320746 3300046516 Bacteria 1143
805 Ga0495628_0418027 3300046516 Bacteria 977
806 Ga0495628_0873658 3300046516 Bacteria 625
807 Ga0495630_0409946 3300046517 Bacteria 1038
808 Ga0495630_0901270 3300046517 Bacteria 674
809 Ga0495631_0146730 3300046518 Bacteria 1012
810 Ga0495632_0287471 3300046519 Bacteria 731
811 Ga0495637_0093873 3300046520 Bacteria 1180
812 Ga0495643_0006297 3300046522 Bacteria 7850
813 Ga0495643_0018377 3300046522 Bacteria 4064
814 Ga0495643_0312875 3300046522 Bacteria 712
815 Ga0495643_0350722 3300046522 Bacteria 661
816 Ga0495648_0057012 3300046524 Bacteria 2346
817 Ga0495666_0011232 3300046526 Bacteria 4467
818 Ga0495642_0089812 3300046528 Bacteria 1300
819 Ga0495652_0014862 3300046529 Bacteria 6978
820 Ga0495652_0019700 3300046529 Bacteria 6004
821 Ga0495652_0023121 3300046529 Bacteria 5511
822 Ga0495652_0052821 3300046529 Bacteria 3464
823 Ga0495652_0060614 3300046529 Bacteria 3197
824 Ga0495652_0208878 3300046529 Bacteria 1476
825 Ga0495652_0604153 3300046529 Bacteria 748
826 Ga0495652_0713965 3300046529 Bacteria 674
827 Ga0495654_0051553 3300046530 Bacteria 2007
828 Ga0495665_0055250 3300046531 Bacteria 2097
829 Ga0495640_0022016 3300046533 Bacteria 4667
830 Ga0495640_0025755 3300046533 Bacteria 4260
831 Ga0495640_0057922 3300046533 Bacteria 2643
832 Ga0495640_0095764 3300046533 Bacteria 1953
833 Ga0495640_0125880 3300046533 Bacteria 1662
834 Ga0495640_0197060 3300046533 Bacteria 1278
835 Ga0495586_0021896 3300046535 Bacteria 3411
836 Ga0495586_0080684 3300046535 Bacteria 1787
837 Ga0495587_0060988 3300046536 Bacteria 2210
838 Ga0495587_0094262 3300046536 Bacteria 1728
839 Ga0495587_0117121 3300046536 Bacteria 1527
840 Ga0495587_0143603 3300046536 Bacteria 1361
841 Ga0495587_0180352 3300046536 Bacteria 1198
842 Ga0495587_0223895 3300046536 Bacteria 1060
843 Ga0495587_0441565 3300046536 Bacteria 721
844 Ga0495609_0020901 3300046538 Bacteria 3020
845 Ga0495645_0021671 3300046543 Bacteria 4645
846 Ga0495645_0105921 3300046543 Bacteria 1994
847 Ga0495645_0171907 3300046543 Bacteria 1491
848 Ga0495645_0172793 3300046543 Bacteria 1486
849 Ga0495645_0302407 3300046543 Bacteria 1044
850 Ga0495645_0367650 3300046543 Bacteria 923
851 Ga0495645_0611431 3300046543 Bacteria 669
852 Ga0495622_0017272 3300046557 Bacteria 3359
853 Ga0495622_0058996 3300046557 Bacteria 1777
854 Ga0495622_0090396 3300046557 Bacteria 1407
855 Ga0495622_0106326 3300046557 Bacteria 1285
856 Ga0495622_0194353 3300046557 Bacteria 906
857 Ga0495633_0040675 3300046558 Bacteria 2213
858 Ga0495633_0072369 3300046558 Bacteria 1607
859 Ga0495667_0042988 3300046559 Bacteria 2995
860 Ga0495667_0058275 3300046559 Bacteria 2537
861 Ga0495667_0177662 3300046559 Bacteria 1367
862 Ga0495667_0969395 3300046559 Bacteria 519
863 Ga0495668_0083190 3300046616 Bacteria 1755
864 Ga0495668_0104873 3300046616 Bacteria 1546
865 Ga0495668_0178693 3300046616 Bacteria 1163
866 Ga0495634_0001063 3300046642 Bacteria 25743
867 Ga0495634_0028635 3300046642 Bacteria 3865
868 Ga0495634_0080193 3300046642 Bacteria 2136
869 Ga0495634_0135308 3300046642 Bacteria 1568
870 Ga0495634_0154455 3300046642 Bacteria 1449
871 Ga0495634_0318732 3300046642 Bacteria 936
872 Ga0495634_0548619 3300046642 Bacteria 674
873 Ga0495611_0066209 3300046648 Bacteria 1647
874 Ga0495611_0122645 3300046648 Bacteria 1212
875 Ga0495611_0207183 3300046648 Bacteria 913
876 Ga0495611_0553579 3300046648 Bacteria 521
877 Ga0495625_0010562 3300046660 Bacteria 7626
878 Ga0495625_0081511 3300046660 Bacteria 2252
879 Ga0495625_0153182 3300046660 Bacteria 1548
880 Ga0495625_0627212 3300046660 Bacteria 642
881 Ga0495635_0004318 3300046663 Bacteria 9841
882 Ga0495635_0005104 3300046663 Bacteria 9129
883 Ga0495635_0016482 3300046663 Bacteria 5161
884 Ga0495635_0041648 3300046663 Bacteria 3172
885 Ga0495635_0074129 3300046663 Bacteria 2331
886 Ga0495635_0507285 3300046663 Bacteria 794
887 Ga0495661_0021151 3300046665 Bacteria 4244
888 Ga0495588_0007513 3300046674 Bacteria 4963
889 Ga0495588_0094612 3300046674 Bacteria 1566
890 Ga0495588_0162321 3300046674 Bacteria 1182
891 Ga0495588_0203400 3300046674 Bacteria 1046
892 Ga0495588_0351876 3300046674 Bacteria 774
893 Ga0495657_0001831 3300046675 Bacteria 18169
894 Ga0495657_0009083 3300046675 Bacteria 7555
895 Ga0495657_0017624 3300046675 Bacteria 5181
896 Ga0495657_0128071 3300046675 Bacteria 1592
897 Ga0495657_0132448 3300046675 Bacteria 1561
898 Ga0495657_0467187 3300046675 Bacteria 738
899 Ga0495657_0763951 3300046675 Bacteria 554
900 Ga0495599_0004750 3300046678 Bacteria 8073
901 Ga0495599_0105648 3300046678 Bacteria 1754
902 Ga0495599_0210206 3300046678 Bacteria 1193
903 Ga0495599_0429090 3300046678 Bacteria 784
904 Ga0495599_0583960 3300046678 Bacteria 652
905 Ga0495623_0008165 3300046679 Bacteria 6806
906 Ga0495623_0069142 3300046679 Bacteria 2201
907 Ga0495623_0260261 3300046679 Bacteria 972
908 Ga0495623_0290225 3300046679 Bacteria 907
909 Ga0495646_0000605 3300046680 Bacteria 19528
910 Ga0495646_0007358 3300046680 Bacteria 6995
911 Ga0495646_0100394 3300046680 Bacteria 1660
912 Ga0495646_0134272 3300046680 Bacteria 1390
913 Ga0495646_0174291 3300046680 Bacteria 1183
914 Ga0495646_0212092 3300046680 Bacteria 1050
915 Ga0495658_0010152 3300046683 Bacteria 4705
916 Ga0495658_0120018 3300046683 Bacteria 1589
917 Ga0495658_0166791 3300046683 Bacteria 1361
918 Ga0495658_0204919 3300046683 Bacteria 1230
919 Ga0495658_0291192 3300046683 Bacteria 1032
920 Ga0495613_0004137 3300046689 Bacteria 10861
921 Ga0495613_0005563 3300046689 Bacteria 9461
922 Ga0495613_0007081 3300046689 Bacteria 8349
923 Ga0495613_0037030 3300046689 Bacteria 3617
924 Ga0495613_0229689 3300046689 Bacteria 1300
925 Ga0495613_0399555 3300046689 Bacteria 937
926 Ga0495613_0413515 3300046689 Bacteria 919
927 Ga0495613_0555000 3300046689 Bacteria 768
928 Ga0495624_0027013 3300046690 Bacteria 3760
929 Ga0495624_0122380 3300046690 Bacteria 1597
930 Ga0495624_0126690 3300046690 Bacteria 1567
931 Ga0495624_0151132 3300046690 Bacteria 1420
932 Ga0495670_0006503 3300046691 Bacteria 5743
933 Ga0495670_0047351 3300046691 Bacteria 2149
934 Ga0495670_0103230 3300046691 Bacteria 1470
935 Ga0495670_0308648 3300046691 Bacteria 848
936 Ga0495671_0003890 3300046692 Bacteria 9068
937 Ga0495649_0114629 3300046694 Bacteria 1427
938 Ga0495649_0120547 3300046694 Bacteria 1387
939 Ga0495649_0151395 3300046694 Bacteria 1218
940 Ga0495649_0542133 3300046694 Bacteria 576
941 Ga0495589_0007062 3300046794 Bacteria 5887
942 Ga0495589_0023713 3300046794 Bacteria 3124
943 Ga0495589_0058500 3300046794 Bacteria 1895
944 Ga0495589_0064548 3300046794 Bacteria 1795
945 Ga0495589_0100173 3300046794 Bacteria 1402
946 Ga0495589_0119339 3300046794 Bacteria 1270
947 Ga0495589_0312834 3300046794 Bacteria 726
948 Ga0495600_0015114 3300046809 Bacteria 4875
949 Ga0495600_0027958 3300046809 Bacteria 3647
950 Ga0495600_0078402 3300046809 Bacteria 2157
951 Ga0495600_0111035 3300046809 Bacteria 1785
952 Ga0495600_0140405 3300046809 Bacteria 1567
953 Ga0495600_0199698 3300046809 Bacteria 1284
954 Ga0495600_0291321 3300046809 Bacteria 1031
955 Ga0495600_0324115 3300046809 Bacteria 968
956 Ga0495600_0961746 3300046809 Bacteria 501
957 Ga0495660_0014771 3300046810 Bacteria 4516
958 Ga0495660_0067627 3300046810 Bacteria 1902
959 Ga0495581_0076201 3300047315 Bacteria 1940
960 Ga0495581_0098149 3300047315 Bacteria 1701
961 Ga0495581_0126380 3300047315 Bacteria 1489
962 Ga0495581_0155770 3300047315 Bacteria 1335
963 Ga0495581_0273355 3300047315 Bacteria 988
964 Ga0495581_0286004 3300047315 Bacteria 964
965 Ga0495581_0429608 3300047315 Bacteria 770
966 Ga0495581_0560987 3300047315 Bacteria 662
967 Ga0495604_0000692 3300047317 Bacteria 28601
968 Ga0495604_0027269 3300047317 Bacteria 4544
969 Ga0495604_0036315 3300047317 Bacteria 3884
970 Ga0495604_0044597 3300047317 Bacteria 3463
971 Ga0495604_0269735 3300047317 Bacteria 1153
972 Ga0495604_0315772 3300047317 Bacteria 1045
973 Ga0495604_0353324 3300047317 Bacteria 976
974 Ga0495604_0481431 3300047317 Bacteria 807
975 Ga0495604_0595037 3300047317 Bacteria 710
976 Ga0495636_0072780 3300047318 Bacteria 1469
977 Ga0495636_0137131 3300047318 Bacteria 1091
978 Ga0495636_0164295 3300047318 Bacteria 1001
979 Ga0495636_0180317 3300047318 Bacteria 958
980 Ga0495636_0192147 3300047318 Bacteria 929
981 Ga0495636_0384714 3300047318 Bacteria 666
982 Ga0495674_0003633 3300047319 Bacteria 15018
983 Ga0495674_0102688 3300047319 Bacteria 2431
984 Ga0495674_0537220 3300047319 Bacteria 932
985 Ga0495674_1253279 3300047319 Bacteria 558
986 Ga0495672_0080858 3300047320 Bacteria 1811
987 Ga0495676_0003054 3300047321 Bacteria 15139
988 Ga0495676_0010050 3300047321 Bacteria 8593
989 Ga0495676_0011550 3300047321 Bacteria 7966
990 Ga0495676_0016531 3300047321 Bacteria 6543
991 Ga0495676_0026711 3300047321 Bacteria 4965
992 Ga0495676_0042477 3300047321 Bacteria 3732
993 Ga0495676_0043154 3300047321 Bacteria 3694
994 Ga0495676_0054130 3300047321 Bacteria 3191
995 Ga0495676_0176187 3300047321 Bacteria 1501
996 Ga0495676_0180731 3300047321 Bacteria 1478
997 Ga0495676_0275466 3300047321 Bacteria 1141
998 Ga0495676_0284981 3300047321 Bacteria 1118
999 Ga0495676_0593343 3300047321 Bacteria 722
1000 Ga0495680_0013742 3300047322 Bacteria 7046
1001 Ga0495680_0034007 3300047322 Bacteria 4123
1002 Ga0495680_0049525 3300047322 Bacteria 3290
1003 Ga0495680_0135137 3300047322 Bacteria 1809
1004 Ga0495683_0047980 3300047323 Bacteria 2142
1005 Ga0495683_0118894 3300047323 Bacteria 1255
1006 Ga0495687_002749 3300047443 Bacteria 13636
1007 Ga0495687_022503 3300047443 Bacteria 3024
1008 Ga0495687_027772 3300047443 Bacteria 2643
1009 Ga0495687_067923 3300047443 Bacteria 1440
1010 Ga0495687_133122 3300047443 Bacteria 876
1011 Ga0495675_0005789 3300047444 Bacteria 7554
1012 Ga0495675_0021089 3300047444 Bacteria 4148
1013 Ga0495675_0033922 3300047444 Bacteria 3258
1014 Ga0495675_0164823 3300047444 Bacteria 1363
1015 Ga0495677_0183375 3300047445 Bacteria 812
1016 Ga0495685_000833 3300047447 Bacteria 9405
1017 Ga0495685_001527 3300047447 Bacteria 7093
1018 Ga0495685_018341 3300047447 Bacteria 2401
1019 Ga0495685_042964 3300047447 Bacteria 1542
1020 Ga0495685_114003 3300047447 Bacteria 888
1021 Ga0495685_251875 3300047447 Bacteria 560
1022 Ga0495681_0001709 3300047470 Bacteria 16261
1023 Ga0495681_0084660 3300047470 Bacteria 1409
1024 Ga0495684_0011777 3300047471 Bacteria 6748
1025 Ga0495684_0124875 3300047471 Bacteria 1936
1026 Ga0495684_0156932 3300047471 Bacteria 1699
1027 Ga0495684_0293397 3300047471 Bacteria 1170
1028 Ga0495684_0639697 3300047471 Bacteria 713
1029 Ga0495686_0036187 3300047472 Bacteria 3169
1030 Ga0495593_0009210 3300047673 Bacteria 5725
1031 Ga0495593_0117687 3300047673 Bacteria 1353
1032 Ga0495593_0142836 3300047673 Bacteria 1212
1033 Ga0495593_0399955 3300047673 Bacteria 687
1034 Ga0495593_0552533 3300047673 Bacteria 578
1035 Ga0495593_0595240 3300047673 Bacteria 555
1036 Ga0495602_0002864 3300048088 Bacteria 17659
1037 Ga0495602_0049086 3300048088 Bacteria 3784
1038 Ga0495602_0140524 3300048088 Bacteria 1911
1039 Ga0495602_0349487 3300048088 Bacteria 1067
1040 Ga0495602_0590214 3300048088 Bacteria 765
1041 Ga0495602_1038415 3300048088 Bacteria 539
1042 Ga0495614_0000938 3300048089 Bacteria 12410
1043 Ga0495614_0006161 3300048089 Bacteria 5390
1044 Ga0495614_0012307 3300048089 Bacteria 3757
1045 Ga0495614_0054956 3300048089 Bacteria 1708
1046 Ga0495614_0087677 3300048089 Bacteria 1352
1047 Ga0495614_0612209 3300048089 Bacteria 523
1048 Ga0495626_0084312 3300048091 Bacteria 1406
1049 Ga0495626_0214382 3300048091 Bacteria 784
1050 Ga0496100_0156929 3300048903 Bacteria 1628
1051 Ga0496100_0268592 3300048903 Bacteria 1267
1052 Ga0496100_0409161 3300048903 Bacteria 1034
1053 Ga0496100_0413045 3300048903 Bacteria 1030
1054 Ga0496101_0003982 3300048904 Bacteria 9240
1055 Ga0496101_0217765 3300048904 Bacteria 1481
1056 Ga0496101_0349257 3300048904 Bacteria 1162
1057 Ga0496101_0437097 3300048904 Bacteria 1032
1058 Ga0496101_0515010 3300048904 Bacteria 945
1059 Ga0496101_0628413 3300048904 Bacteria 849
1060 Ga0496101_1272328 3300048904 Bacteria 576
1061 Ga0496101_1315304 3300048904 Bacteria 565
1062 Ga0496102_0001434 3300048905 Bacteria 21160
1063 Ga0496102_0049614 3300048905 Bacteria 3819
1064 Ga0496102_0319276 3300048905 Bacteria 1463
1065 Ga0496102_0356213 3300048905 Bacteria 1377
1066 Ga0496102_0378115 3300048905 Bacteria 1333
1067 Ga0496102_0395611 3300048905 Bacteria 1299
1068 Ga0496102_0470787 3300048905 Bacteria 1177
1069 Ga0496102_0877358 3300048905 Bacteria 819
1070 Ga0496102_1133519 3300048905 Bacteria 702
1071 Ga0496103_0365732 3300048906 Bacteria 927
1072 Ga0496104_0040897 3300048907 Bacteria 4346
1073 Ga0496104_0043849 3300048907 Bacteria 4201
1074 Ga0496104_0073428 3300048907 Bacteria 3255
1075 Ga0496104_0174123 3300048907 Bacteria 2062
1076 Ga0496104_0552608 3300048907 Bacteria 1062
1077 Ga0496104_0623520 3300048907 Bacteria 988
1078 Ga0496104_0939339 3300048907 Bacteria 769
1079 Ga0496104_1032531 3300048907 Bacteria 726
1080 Ga0496104_1314880 3300048907 Bacteria 626
1081 Ga0496105_0012762 3300048908 Bacteria 6654
1082 Ga0496105_0032442 3300048908 Bacteria 4286
1083 Ga0496105_0044721 3300048908 Bacteria 3652
1084 Ga0496105_0095355 3300048908 Bacteria 2457
1085 Ga0496105_0127624 3300048908 Bacteria 2097
1086 Ga0496105_0160289 3300048908 Bacteria 1847
1087 Ga0496105_0401674 3300048908 Bacteria 1088
1088 Ga0496105_0570814 3300048908 Bacteria 881
1089 Ga0496105_1091999 3300048908 Bacteria 593
1090 Ga0496105_1125880 3300048908 Bacteria 581
1091 Ga0496106_0180224 3300048909 Bacteria 1677
1092 Ga0496106_0443474 3300048909 Bacteria 1043
1093 Ga0496107_0104755 3300048910 Bacteria 2076
1094 Ga0496107_0730400 3300048910 Bacteria 727
1095 Ga0496107_1114919 3300048910 Bacteria 570
1096 Ga0496107_1206805 3300048910 Bacteria 544
1097 Ga0496108_0014106 3300048911 Bacteria 6518
1098 Ga0496108_0047129 3300048911 Bacteria 3603
1099 Ga0496108_0139789 3300048911 Bacteria 2086
1100 Ga0496108_0140372 3300048911 Bacteria 2082
1101 Ga0496108_0292629 3300048911 Bacteria 1418
1102 Ga0496108_0578941 3300048911 Bacteria 979
1103 Ga0496108_0648764 3300048911 Bacteria 918
1104 Ga0496109_0046751 3300048912 Bacteria 3932
1105 Ga0496109_0076090 3300048912 Bacteria 3087
1106 Ga0496109_0499849 3300048912 Bacteria 1148
1107 Ga0496109_0693245 3300048912 Bacteria 956
1108 Ga0496109_0781166 3300048912 Bacteria 893
1109 Ga0496109_0965514 3300048912 Bacteria 790
1110 Ga0496109_1633376 3300048912 Bacteria 579
1111 Ga0496109_1907878 3300048912 Bacteria 526
1112 Ga0496110_0031068 3300048913 Bacteria 4607
1113 Ga0496110_0043898 3300048913 Bacteria 3903
1114 Ga0496110_0338926 3300048913 Bacteria 1370
1115 Ga0496110_0339559 3300048913 Bacteria 1368
1116 Ga0496110_0344236 3300048913 Bacteria 1358
1117 Ga0496110_0599777 3300048913 Bacteria 999
1118 Ga0496110_0867570 3300048913 Bacteria 808
1119 Ga0496110_1020699 3300048913 Bacteria 735
1120 Ga0496110_1210462 3300048913 Bacteria 664
1121 Ga0496111_0026125 3300048914 Bacteria 4122
1122 Ga0496111_0158028 3300048914 Bacteria 1682
1123 Ga0496111_0274772 3300048914 Bacteria 1250
1124 Ga0496112_0245755 3300048915 Bacteria 1741
1125 Ga0496112_0583962 3300048915 Bacteria 1050
1126 Ga0496112_1062404 3300048915 Bacteria 728
1127 Ga0496112_1488494 3300048915 Bacteria 591
1128 Ga0496113_0267996 3300048916 Bacteria 1365
1129 Ga0496113_0393016 3300048916 Bacteria 1113
1130 Ga0496113_0518800 3300048916 Bacteria 956
1131 Ga0496113_0526921 3300048916 Bacteria 948
1132 Ga0496113_0580317 3300048916 Bacteria 898
1133 Ga0496113_0653707 3300048916 Bacteria 841
1134 Ga0496113_0677401 3300048916 Bacteria 824
1135 Ga0496113_1277155 3300048916 Bacteria 571
1136 Ga0496114_0025025 3300048917 Bacteria 4876
1137 Ga0496114_0027326 3300048917 Bacteria 4673
1138 Ga0496114_0055470 3300048917 Bacteria 3305
1139 Ga0496114_0240035 3300048917 Bacteria 1593
1140 Ga0496114_0313044 3300048917 Bacteria 1387
1141 Ga0496114_1221231 3300048917 Bacteria 638
1142 Ga0496114_1692835 3300048917 Bacteria 521
1143 Ga0496114_1728291 3300048917 Bacteria 514
1144 Ga0496115_0137577 3300048918 Bacteria 2014
1145 Ga0496115_0202261 3300048918 Bacteria 1641
1146 Ga0496115_0571228 3300048918 Bacteria 902
1147 Ga0496119_0030080 3300048922 Bacteria 3668
1148 Ga0496119_0122203 3300048922 Bacteria 1430
1149 Ga0496121_0031032 3300048924 Bacteria 4894
1150 Ga0496121_0039989 3300048924 Bacteria 4121
1151 Ga0496125_0136148 3300048928 Bacteria 1718
1152 Ga0496125_0509523 3300048928 Bacteria 675
1153 Ga0496126_0000039 3300048929 Bacteria 347353
1154 Ga0496126_0249963 3300048929 Bacteria 1478
1155 Ga0496126_0575769 3300048929 Bacteria 890
1156 Ga0501309_005529 3300049129 Bacteria 1509
1157 Ga0501305_005275 3300049161 Bacteria 1558
1158 Ga0501307_039751 3300049162 Bacteria 680
1159 Ga0495678_084334 3300049459 Bacteria 1133
1160 Ga0495682_0312601 3300049460 Bacteria 554
1161 Ga0501316_014234 3300049532 Bacteria 947
1162 Ga0501317_000493 3300049533 Bacteria 2809
1163 Ga0501317_003362 3300049533 Bacteria 1590
1164 Ga0501317_083066 3300049533 Bacteria 557
1165 Ga0501318_001899 3300049534 Bacteria 1733
1166 Ga0501318_014002 3300049534 Bacteria 941
1167 Ga0501320_053766 3300049536 Bacteria 554
1168 Ga0501321_028519 3300049537 Bacteria 734
1169 Ga0501323_011984 3300049539 Bacteria 1053
1170 Ga0501323_056055 3300049539 Bacteria 607
1171 Ga0501031_0002042 3300049568 Bacteria 12701
1172 Ga0501031_0054206 3300049568 Bacteria 2613
1173 Ga0501031_0065920 3300049568 Bacteria 2359
1174 Ga0501031_0221141 3300049568 Bacteria 1233
1175 Ga0501031_0223959 3300049568 Bacteria 1224
1176 Ga0501031_0342994 3300049568 Bacteria 967
1177 Ga0501031_0708441 3300049568 Bacteria 646
1178 Ga0501032_0006325 3300049569 Bacteria 8727
1179 Ga0501032_0040089 3300049569 Bacteria 3184
1180 Ga0501032_0077246 3300049569 Bacteria 2217
1181 Ga0501032_0081247 3300049569 Bacteria 2157
1182 Ga0501032_0099699 3300049569 Bacteria 1924
1183 Ga0501032_0106060 3300049569 Bacteria 1861
1184 Ga0501032_0183684 3300049569 Bacteria 1368
1185 Ga0501032_0196075 3300049569 Bacteria 1319
1186 Ga0501032_0254580 3300049569 Bacteria 1139
1187 Ga0501032_0640061 3300049569 Bacteria 675
1188 Ga0501032_0734397 3300049569 Bacteria 625
1189 Ga0501033_0028515 3300049570 Bacteria 4193
1190 Ga0501033_0050778 3300049570 Bacteria 3075
1191 Ga0501033_0071280 3300049570 Bacteria 2553
1192 Ga0501033_0650207 3300049570 Bacteria 720
1193 Ga0501034_0006593 3300049571 Bacteria 12455
1194 Ga0501034_0065220 3300049571 Bacteria 3654
1195 Ga0501034_0079607 3300049571 Bacteria 3280
1196 Ga0501034_0136853 3300049571 Bacteria 2430
1197 Ga0501034_0209390 3300049571 Bacteria 1905
1198 Ga0501034_0247234 3300049571 Bacteria 1728
1199 Ga0501034_0358160 3300049571 Bacteria 1386
1200 Ga0501034_0464910 3300049571 Bacteria 1181
1201 Ga0501034_0514333 3300049571 Bacteria 1110
1202 Ga0501036_0003854 3300049572 Bacteria 12035
1203 Ga0501036_0020178 3300049572 Bacteria 5596
1204 Ga0501036_0037447 3300049572 Bacteria 4103
1205 Ga0501036_0040119 3300049572 Bacteria 3960
1206 Ga0501036_0119735 3300049572 Bacteria 2223
1207 Ga0501036_0183634 3300049572 Bacteria 1760
1208 Ga0501036_0195528 3300049572 Bacteria 1701
1209 Ga0501036_0198721 3300049572 Bacteria 1686
1210 Ga0501036_0689353 3300049572 Bacteria 844
1211 Ga0501037_0013207 3300049573 Bacteria 6087
1212 Ga0501037_0014619 3300049573 Bacteria 5776
1213 Ga0501037_0021280 3300049573 Bacteria 4793
1214 Ga0501037_0034831 3300049573 Bacteria 3714
1215 Ga0501037_0039709 3300049573 Bacteria 3464
1216 Ga0501037_0094461 3300049573 Bacteria 2162
1217 Ga0501037_0131120 3300049573 Bacteria 1797
1218 Ga0501037_0179839 3300049573 Bacteria 1501
1219 Ga0501037_0723357 3300049573 Bacteria 661
1220 Ga0501037_0973113 3300049573 Bacteria 554
1221 Ga0501038_0011284 3300049574 Bacteria 8158
1222 Ga0501038_0019158 3300049574 Bacteria 6172
1223 Ga0501038_0030413 3300049574 Bacteria 4779
1224 Ga0501038_0043950 3300049574 Bacteria 3883
1225 Ga0501038_0060289 3300049574 Bacteria 3247
1226 Ga0501038_0076521 3300049574 Bacteria 2826
1227 Ga0501038_0119264 3300049574 Bacteria 2178
1228 Ga0501038_0316145 3300049574 Bacteria 1222
1229 Ga0501038_0432566 3300049574 Bacteria 1014
1230 Ga0501038_1002309 3300049574 Bacteria 613
1231 Ga0501038_1258378 3300049574 Bacteria 535
1232 Ga0501039_0032955 3300049575 Bacteria 3997
1233 Ga0501039_0046430 3300049575 Bacteria 3355
1234 Ga0501039_0049155 3300049575 Bacteria 3260
1235 Ga0501039_0146983 3300049575 Bacteria 1852
1236 Ga0501039_0181754 3300049575 Bacteria 1654
1237 Ga0501039_0233377 3300049575 Bacteria 1446
1238 Ga0501039_0363935 3300049575 Bacteria 1136
1239 Ga0501040_0012893 3300049576 Bacteria 5491
1240 Ga0501040_0028474 3300049576 Bacteria 3767
1241 Ga0501041_0065559 3300049577 Bacteria 2225
1242 Ga0501041_0845222 3300049577 Bacteria 587
1243 Ga0501042_0012626 3300049578 Bacteria 5729
1244 Ga0501042_0048614 3300049578 Bacteria 3024
1245 Ga0501042_0051940 3300049578 Bacteria 2924
1246 Ga0501042_0267414 3300049578 Bacteria 1234
1247 Ga0501042_0289744 3300049578 Bacteria 1182
1248 Ga0501043_0007469 3300049579 Bacteria 8679
1249 Ga0501043_0028654 3300049579 Bacteria 4371
1250 Ga0501043_0040127 3300049579 Bacteria 3679
1251 Ga0501043_0079722 3300049579 Bacteria 2572
1252 Ga0501043_0209148 3300049579 Bacteria 1512
1253 Ga0501043_0255990 3300049579 Bacteria 1347
1254 Ga0501043_0293138 3300049579 Bacteria 1245
1255 Ga0501043_0844094 3300049579 Bacteria 660
1256 Ga0501043_1284203 3300049579 Bacteria 511
1257 Ga0501046_0021332 3300049580 Bacteria 5345
1258 Ga0501046_0039312 3300049580 Bacteria 3789
1259 Ga0501046_0050635 3300049580 Bacteria 3280
1260 Ga0501046_0325989 3300049580 Bacteria 1118
1261 Ga0501047_0000582 3300049581 Bacteria 38847
1262 Ga0501047_0013451 3300049581 Bacteria 7758
1263 Ga0501047_0055647 3300049581 Bacteria 3825
1264 Ga0501047_0057286 3300049581 Bacteria 3768
1265 Ga0501047_0073219 3300049581 Bacteria 3298
1266 Ga0501047_0082776 3300049581 Bacteria 3084
1267 Ga0501047_0194975 3300049581 Bacteria 1888
1268 Ga0501047_0254546 3300049581 Bacteria 1604
1269 Ga0501047_0318857 3300049581 Bacteria 1394
1270 Ga0501047_0853647 3300049581 Bacteria 724
1271 Ga0501047_1165529 3300049581 Bacteria 584
1272 Ga0501048_0012919 3300049582 Bacteria 6202
1273 Ga0501048_0021680 3300049582 Bacteria 4701
1274 Ga0501048_0033632 3300049582 Bacteria 3703
1275 Ga0501048_0039041 3300049582 Bacteria 3406
1276 Ga0501048_0114382 3300049582 Bacteria 1906
1277 Ga0501067_0005472 3300049583 Bacteria 7045
1278 Ga0501068_0022849 3300049584 Bacteria 3661
1279 Ga0501068_0289284 3300049584 Bacteria 1048
1280 Ga0501068_0341085 3300049584 Bacteria 962
1281 Ga0501068_1027458 3300049584 Bacteria 544
1282 Ga0501069_0013387 3300049585 Bacteria 4375
1283 Ga0501069_0019490 3300049585 Bacteria 3669
1284 Ga0501069_0088021 3300049585 Bacteria 1755
1285 Ga0501069_0197553 3300049585 Bacteria 1165
1286 Ga0501069_0416709 3300049585 Bacteria 796
1287 Ga0501069_0447466 3300049585 Bacteria 768
1288 Ga0501069_0646508 3300049585 Bacteria 636
1289 Ga0501070_0031714 3300049586 Bacteria 4427
1290 Ga0501070_0049709 3300049586 Bacteria 3482
1291 Ga0501070_0050464 3300049586 Bacteria 3454
1292 Ga0501070_0059386 3300049586 Bacteria 3170
1293 Ga0501070_0082368 3300049586 Bacteria 2663
1294 Ga0501070_0130316 3300049586 Bacteria 2078
1295 Ga0501070_0211943 3300049586 Bacteria 1590
1296 Ga0501071_0007769 3300049587 Bacteria 7072
1297 Ga0501071_0061242 3300049587 Bacteria 2725
1298 Ga0501072_0002701 3300049588 Bacteria 13305
1299 Ga0501072_0204487 3300049588 Bacteria 1574
1300 Ga0501073_0037446 3300049589 Bacteria 3444
1301 Ga0501073_0056713 3300049589 Bacteria 2740
1302 Ga0501074_0001056 3300049590 Bacteria 17988
1303 Ga0501074_0011815 3300049590 Bacteria 6346
1304 Ga0501074_0021743 3300049590 Bacteria 4657
1305 Ga0501074_0045758 3300049590 Bacteria 3165
1306 Ga0501074_0195596 3300049590 Bacteria 1441
1307 Ga0501075_0080098 3300049591 Bacteria 2472
1308 Ga0501076_0083700 3300049592 Bacteria 2562
1309 Ga0501076_0391766 3300049592 Bacteria 1142
1310 Ga0501077_0084022 3300049593 Bacteria 2018
1311 Ga0501233_200201 3300049668 Bacteria 581
1312 Ga0501079_0737881 3300049741 Bacteria 775
1313 Ga0501079_0847842 3300049741 Bacteria 719
1314 Ga0501080_0022322 3300049742 Bacteria 5862
1315 Ga0501080_0069371 3300049742 Bacteria 3278
1316 Ga0501080_0353588 3300049742 Bacteria 1326
1317 Ga0501080_0426192 3300049742 Bacteria 1191
1318 Ga0501080_0757696 3300049742 Bacteria 853
1319 Ga0501081_0083408 3300049743 Bacteria 2240
1320 Ga0501083_0017409 3300049744 Bacteria 5009
1321 Ga0501035_0006838 3300049822 Bacteria 10658
1322 Ga0501035_0037723 3300049822 Bacteria 4374
1323 Ga0501035_0081350 3300049822 Bacteria 2858
1324 Ga0501035_0082515 3300049822 Bacteria 2836
1325 Ga0501035_0082738 3300049822 Bacteria 2832
1326 Ga0501035_0105935 3300049822 Bacteria 2465
1327 Ga0501035_0166717 3300049822 Bacteria 1904
1328 Ga0501035_0171319 3300049822 Bacteria 1875
1329 Ga0501035_0171324 3300049822 Bacteria 1875
1330 Ga0501035_0195954 3300049822 Bacteria 1735
1331 Ga0501035_0293258 3300049822 Bacteria 1372
1332 Ga0501035_0791210 3300049822 Bacteria 758
1333 Ga0501035_1208008 3300049822 Bacteria 586
1334 Ga0501044_0000806 3300049823 Bacteria 37759
1335 Ga0501044_0016943 3300049823 Bacteria 7818
1336 Ga0501044_0029838 3300049823 Bacteria 5749
1337 Ga0501044_0052436 3300049823 Bacteria 4203
1338 Ga0501044_0071039 3300049823 Bacteria 3540
1339 Ga0501044_0158546 3300049823 Bacteria 2241
1340 Ga0501044_0166076 3300049823 Bacteria 2181
1341 Ga0501044_0224638 3300049823 Bacteria 1827
1342 Ga0501044_0228749 3300049823 Bacteria 1808
1343 Ga0501044_0251459 3300049823 Bacteria 1708
1344 Ga0501044_0330417 3300049823 Bacteria 1447
1345 Ga0501044_0380694 3300049823 Bacteria 1326
1346 Ga0501044_0497594 3300049823 Bacteria 1120
1347 Ga0501045_0015945 3300049824 Bacteria 5330
1348 Ga0501045_0049392 3300049824 Bacteria 3067
1349 Ga0501045_0132674 3300049824 Bacteria 1852
1350 Ga0501045_0154563 3300049824 Bacteria 1707
1351 Ga0501045_0577884 3300049824 Bacteria 833
1352 nmdc:mga0yw44_684204_c1 3300050492 Bacteria 697
1353 nmdc:mga0yw44_887810_c1 3300050492 Bacteria 605
1354 nmdc:mga0yw44_913482_c1 3300050492 Bacteria 595
1355 nmdc:mga06z11_4831_c1 3300050494 Bacteria 5336
1356 nmdc:mga04h51_191831_c1 3300050495 Bacteria 799
1357 nmdc:mga05p37_552239_c1 3300050507 Bacteria 1311
1358 nmdc:mga05p37_838810_c1 3300050507 Bacteria 1000
1359 nmdc:mga05p37_887721_c1 3300050507 Bacteria 963
1360 nmdc:mga09592_149153_c1 3300050508 Bacteria 2017
1361 nmdc:mga0n895_116489_c1 3300050512 Bacteria 2690
1362 Ga0495601_0012855 3300053077 Bacteria 5025
1363 Ga0495601_0076633 3300053077 Bacteria 2141
1364 Ga0495601_0527929 3300053077 Bacteria 760
1365 Ga0495612_0002469 3300053078 Bacteria 7623
1366 Ga0500610_0161031 3300053079 Bacteria 1116
1367 Ga0500635_0118403 3300053080 Bacteria 990
1368 Ga0495655_0058881 3300053083 Bacteria 1042
1369 Ga0495595_0154399 3300053084 Bacteria 1130
1370 Ga0495619_0020589 3300053085 Bacteria 4204
1371 Ga0495619_0226023 3300053085 Bacteria 1297
1372 Ga0495619_0507143 3300053085 Bacteria 829
1373 Ga0500578_0675368 3300053086 Bacteria 558
1374 Ga0500643_000449 3300053087 Bacteria 30555
1375 Ga0500583_0276324 3300053092 Bacteria 825
1376 Ga0500566_0077344 3300053094 Bacteria 1858
1377 Ga0500640_026758 3300053095 Bacteria 2513
1378 Ga0500650_0238259 3300053098 Bacteria 819
1379 Ga0500654_024300 3300053099 Bacteria 3800
1380 Ga0500660_061602 3300053100 Bacteria 1805
1381 Ga0500660_088814 3300053100 Bacteria 1388
1382 Ga0500553_035447 3300053101 Bacteria 2473
1383 Ga0500560_000044 3300053107 Bacteria 12726
1384 Ga0500569_177778 3300053109 Bacteria 722
1385 Ga0500572_004725 3300053111 Bacteria 3088
1386 Ga0500580_118073 3300053113 Bacteria 1014
1387 Ga0500608_137656 3300053122 Bacteria 1087
1388 Ga0500614_017119 3300053123 Bacteria 1634
1389 Ga0500614_029287 3300053123 Bacteria 1336
1390 Ga0500628_001267 3300053129 Bacteria 4369
1391 Ga0500628_060863 3300053129 Bacteria 922
1392 Ga0500658_0010246 3300053134 Bacteria 3454
1393 Ga0500659_0495073 3300053135 Bacteria 500
1394 Ga0500561_0044644 3300053137 Bacteria 1185
1395 Ga0500568_0030065 3300053139 Bacteria 2250
1396 Ga0500573_0036731 3300053140 Bacteria 2829
1397 Ga0500577_0137986 3300053142 Bacteria 1027
1398 Ga0500579_151925 3300053143 Bacteria 1006
1399 Ga0500600_0090829 3300053149 Bacteria 1631
1400 Ga0500600_0093903 3300053149 Bacteria 1596
1401 Ga0500603_162002 3300053150 Bacteria 698
1402 Ga0500604_0023338 3300053151 Bacteria 1764
1403 Ga0500616_0000144 3300053153 Bacteria 121889
1404 Ga0500616_0001051 3300053153 Bacteria 29163
1405 Ga0500616_0296931 3300053153 Bacteria 672
1406 Ga0500624_004805 3300053157 Bacteria 1786
1407 Ga0500634_0017070 3300053161 Bacteria 3882
1408 Ga0500587_002141 3300053739 Bacteria 2817
1409 Ga0501084_0004705 3300054114 Bacteria 11147
1410 Ga0501084_0083945 3300054114 Bacteria 2674
1411 Ga0501084_0718443 3300054114 Bacteria 842
1412 Ga0501084_0744586 3300054114 Bacteria 826
1413 Ga0501084_1736241 3300054114 Bacteria 521
1414 Ga0501082_0011656 3300060353 Bacteria 7558
1415 Ga0501082_0241459 3300060353 Bacteria 1572
1416 Ga0466962_0001665 3300061719 Bacteria 10420
1417 Ga0466962_0001793 3300061719 Bacteria 10099
1418 Ga0466962_0004114 3300061719 Bacteria 6966
1419 Ga0466962_0005065 3300061719 Bacteria 6338
1420 Ga0466962_0009245 3300061719 Bacteria 4721
1421 Ga0466962_0025105 3300061719 Bacteria 2861
1422 Ga0466962_0042214 3300061719 Bacteria 2183
1423 Ga0466962_0226566 3300061719 Bacteria 916
1424 Ga0466962_0249654 3300061719 Bacteria 872
1425 Ga0466962_0357294 3300061719 Bacteria 728
1426 Ga0530510_0891422 3300061734 Bacteria 680

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048904 Ga0496101_1272328 Ga0496101_1272328_177_551 123
2 3300048915 Ga0496112_1062404 Ga0496112_1062404_308_682 123
3 3300053087 Ga0500643_000449 Ga0500643_000449_16919_17356 129
4 3300045976 Ga0466967_0134590 Ga0466967_0134590_602_1027 132
5 3300049569 Ga0501032_0734397 Ga0501032_0734397_32_457 132
6 3300049571 Ga0501034_0079607 Ga0501034_0079607_1769_2194 132
7 3300049572 Ga0501036_0003854 Ga0501036_0003854_3890_4315 132
8 3300049573 Ga0501037_0014619 Ga0501037_0014619_1275_1700 132
9 3300049574 Ga0501038_0019158 Ga0501038_0019158_2006_2431 132
10 3300049575 Ga0501039_0146983 Ga0501039_0146983_576_1001 132
11 3300049578 Ga0501042_0012626 Ga0501042_0012626_2432_2857 132
12 3300049579 Ga0501043_0028654 Ga0501043_0028654_3912_4337 132
13 3300049581 Ga0501047_0057286 Ga0501047_0057286_1271_1696 132
14 3300049582 Ga0501048_0021680 Ga0501048_0021680_1276_1701 132
15 3300049590 Ga0501074_0021743 Ga0501074_0021743_365_790 132
16 3300049592 Ga0501076_0391766 Ga0501076_0391766_394_819 132
17 3300049742 Ga0501080_0757696 Ga0501080_0757696_318_743 132
18 3300049823 Ga0501044_0071039 Ga0501044_0071039_2801_3226 132
19 3300049823 Ga0501044_0158546 Ga0501044_0158546_1236_1661 132
20 3300054114 Ga0501084_0744586 Ga0501084_0744586_72_497 132
21 3300035398 Ga0316574_0121060 Ga0316574_0121060_148_558 133
22 3300044658 Ga0466972_0326545 Ga0466972_0326545_37_459 136
23 3300044693 Ga0466961_0091467 Ga0466961_0091467_160_582 136
24 3300044694 Ga0466963_0188513 Ga0466963_0188513_600_1013 136
25 3300044706 Ga0466964_0189055 Ga0466964_0189055_121_543 136
26 3300044719 Ga0466971_0029487 Ga0466971_0029487_67_489 136
27 3300044765 Ga0466970_0035981 Ga0466970_0035981_1940_2362 136
28 3300044765 Ga0466970_0183329 Ga0466970_0183329_337_750 136
29 3300044842 Ga0466957_0330364 Ga0466957_0330364_541_960 136
30 3300044842 Ga0466957_0922179 Ga0466957_0922179_168_581 136
31 3300044901 Ga0466960_0101915 Ga0466960_0101915_437_859 136
32 3300045049 Ga0466959_0204290 Ga0466959_0204290_265_678 136
33 3300045049 Ga0466959_0605864 Ga0466959_0605864_282_704 136
34 3300045836 Ga0466958_0230149 Ga0466958_0230149_715_1137 136
35 3300045976 Ga0466967_0014444 Ga0466967_0014444_974_1393 136
36 3300045976 Ga0466967_0072565 Ga0466967_0072565_1373_1795 136
37 3300061719 Ga0466962_0005065 Ga0466962_0005065_1607_2029 136
38 3300005445 Ga0070708_101373626 Ga0070708_1013736261 137
39 3300044656 Ga0466969_0033530 Ga0466969_0033530_2152_2574 137
40 3300044656 Ga0466969_0361021 Ga0466969_0361021_215_634 137
41 3300044683 Ga0466965_0367662 Ga0466965_0367662_154_567 137
42 3300044684 Ga0466966_0102575 Ga0466966_0102575_946_1365 137
43 3300044693 Ga0466961_0019046 Ga0466961_0019046_3229_3651 137
44 3300044693 Ga0466961_0566857 Ga0466961_0566857_56_475 137
45 3300045049 Ga0466959_0075510 Ga0466959_0075510_1075_1494 137
46 3300045049 Ga0466959_0300291 Ga0466959_0300291_662_1084 137
47 3300046455 Ga0495603_0094025 Ga0495603_0094025_332_751 137
48 iso_pu_bacteria 3002998708 3003000707 137
49 iso_pu_bacteria 8053945823 8053948598 137
50 3300005338 Ga0068868_100018642 Ga0068868_1000186423 138
51 3300005539 Ga0068853_101940672 Ga0068853_1019406721 138
52 3300017792 Ga0163161_10547123 Ga0163161_105471232 138
53 3300025919 Ga0207657_10094200 Ga0207657_100942004 138
54 3300026023 Ga0207677_10002090 Ga0207677_1000209011 138
55 3300031241 Ga0265325_10038156 Ga0265325_100381562 138
56 3300031507 Ga0307509_10031570 Ga0307509_100315707 138
57 3300041456 Ga0451795_1164976 Ga0451795_1164976_74_520 138
58 3300041509 Ga0451843_0489293 Ga0451843_0489293_43_462 138
59 3300044656 Ga0466969_0002072 Ga0466969_0002072_6541_6972 138
60 3300044684 Ga0466966_0036476 Ga0466966_0036476_1439_1870 138
61 3300044693 Ga0466961_0000420 Ga0466961_0000420_17447_17878 138
62 3300044719 Ga0466971_0002552 Ga0466971_0002552_3726_4157 138
63 3300045049 Ga0466959_0014427 Ga0466959_0014427_3678_4109 138
64 3300046454 Ga0495592_0049991 Ga0495592_0049991_468_899 138
65 3300046462 Ga0495651_0000937 Ga0495651_0000937_3546_3977 138
66 3300046473 Ga0495582_0460976 Ga0495582_0460976_296_715 138
67 3300046476 Ga0495662_0483768 Ga0495662_0483768_98_529 138
68 3300046477 Ga0495664_0019455 Ga0495664_0019455_1934_2365 138
69 3300046514 Ga0495618_0061843 Ga0495618_0061843_1662_2093 138
70 3300046516 Ga0495628_0873658 Ga0495628_0873658_180_611 138
71 3300046529 Ga0495652_0019700 Ga0495652_0019700_3134_3565 138
72 3300046536 Ga0495587_0060988 Ga0495587_0060988_1444_1875 138
73 3300046543 Ga0495645_0172793 Ga0495645_0172793_804_1235 138
74 3300046642 Ga0495634_0135308 Ga0495634_0135308_26_457 138
75 3300046663 Ga0495635_0016482 Ga0495635_0016482_12_443 138
76 3300046679 Ga0495623_0008165 Ga0495623_0008165_1723_2154 138
77 3300046680 Ga0495646_0100394 Ga0495646_0100394_806_1237 138
78 3300046809 Ga0495600_0291321 Ga0495600_0291321_463_894 138
79 3300048088 Ga0495602_0049086 Ga0495602_0049086_94_525 138
80 3300048903 Ga0496100_0268592 Ga0496100_0268592_71_490 138
81 3300048904 Ga0496101_0003982 Ga0496101_0003982_2556_2975 138
82 3300048905 Ga0496102_0001434 Ga0496102_0001434_6432_6851 138
83 3300048905 Ga0496102_1133519 Ga0496102_1133519_145_570 138
84 3300048907 Ga0496104_0043849 Ga0496104_0043849_1993_2412 138
85 3300048908 Ga0496105_0012762 Ga0496105_0012762_815_1234 138
86 3300048909 Ga0496106_0443474 Ga0496106_0443474_93_512 138
87 3300048910 Ga0496107_1206805 Ga0496107_1206805_22_447 138
88 3300048912 Ga0496109_1907878 Ga0496109_1907878_97_516 138
89 3300048917 Ga0496114_0025025 Ga0496114_0025025_3678_4097 138
90 3300048924 Ga0496121_0031032 Ga0496121_0031032_136_552 138
91 3300053077 Ga0495601_0076633 Ga0495601_0076633_1117_1548 138
92 3300053078 Ga0495612_0002469 Ga0495612_0002469_2457_2888 138
93 3300053085 Ga0495619_0020589 Ga0495619_0020589_3655_4086 138
94 3300053153 Ga0500616_0000144 Ga0500616_0000144_79530_79955 138
95 3300061719 Ga0466962_0001665 Ga0466962_0001665_3717_4148 138
96 iso_pu_bacteria 2547132111 2547409987 138
97 iso_pu_bacteria 2554235005 2554256839 138
98 iso_pu_bacteria 2582581312 2585295882 138
99 iso_pu_bacteria 2582581313 2585308124 138
100 iso_pu_bacteria 2582581314 2585319563 138
101 iso_pu_bacteria 2616644814 2616696830 138
102 iso_pu_bacteria 2616644941 2616901965 138
103 iso_pu_bacteria 2643221548 2643764802 138
104 iso_pu_bacteria 2643221578 2643902900 138
105 iso_pu_bacteria 2643221587 2643942023 138
106 iso_pu_bacteria 2643221647 2644261627 138
107 iso_pu_bacteria 2643221670 2644389671 138
108 iso_pu_bacteria 2643221673 2644404590 138
109 iso_pu_bacteria 2643221677 2644429106 138
110 iso_pu_bacteria 2643221678 2644439290 138
111 iso_pu_bacteria 2643221682 2644462187 138
112 iso_pu_bacteria 2643221714 2644633315 138
113 iso_pu_bacteria 2767802112 2768644133 138
114 iso_pu_bacteria 2784132148 2784589684 138
115 iso_pu_bacteria 2784746763 2785341910 138
116 iso_pu_bacteria 2784746768 2785370745 138
117 iso_pu_bacteria 2786546132 2786671926 138
118 iso_pu_bacteria 2802429296 2804845575 138
119 iso_pu_bacteria 2808606359 2808843290 138
120 iso_pu_bacteria 2808606375 2808912899 138
121 iso_pu_bacteria 2808606982 2811845126 138
122 iso_pu_bacteria 2811994879 2812356741 138
123 iso_pu_bacteria 2811994917 2812479453 138
124 iso_pu_bacteria 2818991463 2819695257 138
125 iso_pu_bacteria 2862290372 2862292146 138
126 iso_pu_bacteria 2862382967 2862386015 138
127 iso_pu_bacteria 2862574272 2862578214 138
128 iso_pu_bacteria 2863404153 2863411598 138
129 iso_pu_bacteria 2867346516 2867349928 138
130 iso_pu_bacteria 2867428634 2867429346 138
131 iso_pu_bacteria 2867475112 2867481039 138
132 iso_pu_bacteria 2873151551 2873154728 138
133 iso_pu_bacteria 2875391855 2875395993 138
134 iso_pu_bacteria 2877676314 2877679844 138
135 iso_pu_bacteria 2884693830 2884694531 138
136 iso_pu_bacteria 2895442618 2895444436 138
137 iso_pu_bacteria 2912715099 2912718487 138
138 iso_pu_bacteria 2912723979 2912730819 138
139 iso_pu_bacteria 2918501144 2918505780 138
140 iso_pu_bacteria 2919468124 2919470190 138
141 iso_pu_bacteria 2935390628 2935394917 138
142 iso_pu_bacteria 2946045630 2946048619 138
143 iso_pu_bacteria 2954711539 2954715036 138
144 iso_pu_bacteria 2954721474 2954724978 138
145 iso_pu_bacteria 2954731030 2954736840 138
146 iso_pu_bacteria 2954740390 2954743911 138
147 iso_pu_bacteria 2954749733 2954755688 138
148 iso_pu_bacteria 2954759201 2954762852 138
149 iso_pu_bacteria 2966598605 2966601471 138
150 iso_pu_bacteria 2990059506 2990062271 138
151 iso_pu_bacteria 2990088156 2990093144 138
152 iso_pu_bacteria 2995463766 2995468555 138
153 iso_pu_bacteria 2997451912 2997458198 138
154 iso_pu_bacteria 2997600082 2997606123 138
155 iso_pu_bacteria 3006321560 3006326593 138
156 iso_pu_bacteria 3006393351 3006398736 138
157 iso_pu_bacteria 3006486233 3006490986 138
158 iso_pu_bacteria 3006493962 3006494693 138
159 iso_pu_bacteria 8008558824 8008566523 138
160 iso_pu_bacteria 8008574985 8008577837 138
161 iso_pu_bacteria 8025478263 8025483264 138
162 iso_pu_bacteria 8033684223 8033690317 138
163 iso_pu_bacteria 8048406513 8048413869 138
164 iso_pu_bacteria 8054160619 8054160769 138
165 iso_pu_bacteria 8055066027 8055066379 138
166 iso_pu_bacteria 8056447290 8056453716 138
167 iso_pu_bacteria 8056667051 8056673301 138
168 iso_pu_bacteria 8056829672 8056837652 138
169 3300002067 JGI24735J21928_10045779 JGI24735J21928_100457792 139
170 3300005327 Ga0070658_10478878 Ga0070658_104788782 139
171 3300005329 Ga0070683_101085256 Ga0070683_1010852562 139
172 3300005337 Ga0070682_100879086 Ga0070682_1008790861 139
173 3300005455 Ga0070663_100010329 Ga0070663_1000103297 139
174 3300005530 Ga0070679_101965451 Ga0070679_1019654511 139
175 3300005535 Ga0070684_101552856 Ga0070684_1015528561 139
176 3300005563 Ga0068855_100030378 Ga0068855_1000303782 139
177 3300005578 Ga0068854_100084723 Ga0068854_1000847233 139
178 3300005614 Ga0068856_100049229 Ga0068856_1000492296 139
179 3300005616 Ga0068852_100006407 Ga0068852_10000640710 139
180 3300005834 Ga0068851_10335545 Ga0068851_103355452 139
181 3300005985 Ga0081539_10242044 Ga0081539_102420442 139
182 3300006847 Ga0075431_100259133 Ga0075431_1002591332 139
183 3300009093 Ga0105240_10013885 Ga0105240_100138858 139
184 3300009174 Ga0105241_10032519 Ga0105241_100325194 139
185 3300009545 Ga0105237_10190729 Ga0105237_101907292 139
186 3300010375 Ga0105239_10317415 Ga0105239_103174152 139
187 3300010375 Ga0105239_10594532 Ga0105239_105945322 139
188 3300013105 Ga0157369_10133804 Ga0157369_101338043 139
189 3300013296 Ga0157374_10143042 Ga0157374_101430425 139
190 3300013307 Ga0157372_10530486 Ga0157372_105304862 139
191 3300013308 Ga0157375_10487230 Ga0157375_104872302 139
192 3300014325 Ga0163163_10641576 Ga0163163_106415762 139
193 3300014326 Ga0157380_12228800 Ga0157380_122288001 139
194 3300014968 Ga0157379_10918140 Ga0157379_109181401 139
195 3300020082 Ga0206353_11649892 Ga0206353_116498922 139
196 3300021388 Ga0213875_10000904 Ga0213875_100009042 139
197 3300025904 Ga0207647_10000592 Ga0207647_1000059219 139
198 3300025909 Ga0207705_10326488 Ga0207705_103264882 139
199 3300025913 Ga0207695_10042388 Ga0207695_100423883 139
200 3300025914 Ga0207671_10000128 Ga0207671_1000012877 139
201 3300025919 Ga0207657_10533020 Ga0207657_105330202 139
202 3300025924 Ga0207694_10001189 Ga0207694_1000118914 139
203 3300025928 Ga0207700_10088700 Ga0207700_100887002 139
204 3300025928 Ga0207700_10490352 Ga0207700_104903522 139
205 3300025936 Ga0207670_10448677 Ga0207670_104486772 139
206 3300025944 Ga0207661_11055327 Ga0207661_110553272 139
207 3300025949 Ga0207667_10034993 Ga0207667_100349934 139
208 3300025981 Ga0207640_10018649 Ga0207640_100186497 139
209 3300026041 Ga0207639_10117843 Ga0207639_101178432 139
210 3300026078 Ga0207702_10021228 Ga0207702_100212284 139
211 3300026142 Ga0207698_10999455 Ga0207698_109994552 139
212 3300028379 Ga0268266_10056711 Ga0268266_100567117 139
213 3300031824 Ga0307413_10277578 Ga0307413_102775782 139
214 3300031824 Ga0307413_11462590 Ga0307413_114625902 139
215 3300031852 Ga0307410_10439499 Ga0307410_104394992 139
216 3300031901 Ga0307406_10379776 Ga0307406_103797762 139
217 3300031995 Ga0307409_100094980 Ga0307409_1000949804 139
218 3300031995 Ga0307409_100818285 Ga0307409_1008182851 139
219 3300032002 Ga0307416_100890011 Ga0307416_1008900112 139
220 3300033179 Ga0307507_10000482 Ga0307507_1000048260 139
221 3300035725 Ga0373947_0671110 Ga0373947_0671110_55_480 139
222 3300037068 Ga0373925_0894157 Ga0373925_0894157_300_719 139
223 3300037853 Ga0436364_1354648 Ga0436364_1354648_77215_77634 139
224 3300041491 Ga0451833_0247344 Ga0451833_0247344_43_462 139
225 3300044656 Ga0466969_0042539 Ga0466969_0042539_1393_1812 139
226 3300044684 Ga0466966_0181198 Ga0466966_0181198_756_1175 139
227 3300044693 Ga0466961_0011789 Ga0466961_0011789_2904_3338 139
228 3300044693 Ga0466961_0016815 Ga0466961_0016815_850_1269 139
229 3300044706 Ga0466964_0244860 Ga0466964_0244860_235_654 139
230 3300044719 Ga0466971_0006100 Ga0466971_0006100_3369_3788 139
231 3300044719 Ga0466971_0045109 Ga0466971_0045109_771_1190 139
232 3300044719 Ga0466971_0311611 Ga0466971_0311611_115_543 139
233 3300044765 Ga0466970_0042781 Ga0466970_0042781_1056_1475 139
234 3300044765 Ga0466970_0206112 Ga0466970_0206112_228_647 139
235 3300044842 Ga0466957_0047527 Ga0466957_0047527_507_926 139
236 3300045049 Ga0466959_0019179 Ga0466959_0019179_2408_2827 139
237 3300045049 Ga0466959_0164765 Ga0466959_0164765_860_1279 139
238 3300045836 Ga0466958_0147770 Ga0466958_0147770_910_1329 139
239 3300046455 Ga0495603_0505463 Ga0495603_0505463_83_508 139
240 3300046462 Ga0495651_0235064 Ga0495651_0235064_605_1033 139
241 3300046543 Ga0495645_0302407 Ga0495645_0302407_309_737 139
242 3300046678 Ga0495599_0429090 Ga0495599_0429090_164_592 139
243 3300046689 Ga0495613_0555000 Ga0495613_0555000_296_721 139
244 3300047315 Ga0495581_0126380 Ga0495581_0126380_291_719 139
245 3300047315 Ga0495581_0286004 Ga0495581_0286004_400_822 139
246 3300047321 Ga0495676_0275466 Ga0495676_0275466_22_447 139
247 3300047673 Ga0495593_0552533 Ga0495593_0552533_88_513 139
248 3300048903 Ga0496100_0156929 Ga0496100_0156929_449_871 139
249 3300048904 Ga0496101_0349257 Ga0496101_0349257_230_652 139
250 3300048910 Ga0496107_0104755 Ga0496107_0104755_513_935 139
251 3300048911 Ga0496108_0578941 Ga0496108_0578941_337_756 139
252 3300048913 Ga0496110_1210462 Ga0496110_1210462_97_516 139
253 3300048928 Ga0496125_0136148 Ga0496125_0136148_20_454 139
254 3300048929 Ga0496126_0575769 Ga0496126_0575769_167_595 139
255 3300049568 Ga0501031_0221141 Ga0501031_0221141_76_495 139
256 3300049568 Ga0501031_0708441 Ga0501031_0708441_109_528 139
257 3300049569 Ga0501032_0099699 Ga0501032_0099699_1227_1646 139
258 3300049572 Ga0501036_0119735 Ga0501036_0119735_260_679 139
259 3300049573 Ga0501037_0094461 Ga0501037_0094461_1399_1818 139
260 3300049573 Ga0501037_0179839 Ga0501037_0179839_523_942 139
261 3300049573 Ga0501037_0723357 Ga0501037_0723357_25_444 139
262 3300049574 Ga0501038_0030413 Ga0501038_0030413_3188_3607 139
263 3300049574 Ga0501038_0119264 Ga0501038_0119264_1148_1567 139
264 3300049575 Ga0501039_0049155 Ga0501039_0049155_1098_1517 139
265 3300049575 Ga0501039_0363935 Ga0501039_0363935_41_460 139
266 3300049576 Ga0501040_0028474 Ga0501040_0028474_472_891 139
267 3300049577 Ga0501041_0065559 Ga0501041_0065559_14_433 139
268 3300049578 Ga0501042_0048614 Ga0501042_0048614_710_1129 139
269 3300049579 Ga0501043_0293138 Ga0501043_0293138_702_1121 139
270 3300049579 Ga0501043_1284203 Ga0501043_1284203_77_496 139
271 3300049580 Ga0501046_0050635 Ga0501046_0050635_1594_2013 139
272 3300049582 Ga0501048_0033632 Ga0501048_0033632_2281_2700 139
273 3300049582 Ga0501048_0114382 Ga0501048_0114382_899_1318 139
274 3300049584 Ga0501068_0341085 Ga0501068_0341085_102_521 139
275 3300049585 Ga0501069_0088021 Ga0501069_0088021_77_496 139
276 3300049587 Ga0501071_0061242 Ga0501071_0061242_1348_1767 139
277 3300049588 Ga0501072_0204487 Ga0501072_0204487_190_609 139
278 3300049590 Ga0501074_0045758 Ga0501074_0045758_20_439 139
279 3300049590 Ga0501074_0195596 Ga0501074_0195596_672_1091 139
280 3300049591 Ga0501075_0080098 Ga0501075_0080098_756_1175 139
281 3300049592 Ga0501076_0083700 Ga0501076_0083700_811_1230 139
282 3300049742 Ga0501080_0353588 Ga0501080_0353588_769_1188 139
283 3300049742 Ga0501080_0426192 Ga0501080_0426192_666_1088 139
284 3300049743 Ga0501081_0083408 Ga0501081_0083408_1096_1515 139
285 3300049822 Ga0501035_0195954 Ga0501035_0195954_426_845 139
286 3300049823 Ga0501044_0166076 Ga0501044_0166076_1156_1575 139
287 3300049824 Ga0501045_0049392 Ga0501045_0049392_904_1323 139
288 3300049824 Ga0501045_0154563 Ga0501045_0154563_33_452 139
289 3300049824 Ga0501045_0577884 Ga0501045_0577884_287_706 139
290 3300054114 Ga0501084_0083945 Ga0501084_0083945_1119_1538 139
291 3300054114 Ga0501084_0718443 Ga0501084_0718443_291_710 139
292 3300060353 Ga0501082_0241459 Ga0501082_0241459_696_1115 139
293 3300061719 Ga0466962_0001793 Ga0466962_0001793_5213_5632 139
294 3300061719 Ga0466962_0249654 Ga0466962_0249654_174_593 139
295 iso_pu_bacteria 2946072368 2946077081 139
296 3300003578 Ga0006562J51391_1081456 Ga0006562J51391_10814561 140
297 3300005435 Ga0070714_100489079 Ga0070714_1004890792 140
298 3300005437 Ga0070710_10091238 Ga0070710_100912382 140
299 3300005439 Ga0070711_100190843 Ga0070711_1001908431 140
300 3300005439 Ga0070711_100192512 Ga0070711_1001925122 140
301 3300005445 Ga0070708_100001875 Ga0070708_1000018753 140
302 3300005445 Ga0070708_100348942 Ga0070708_1003489423 140
303 3300005445 Ga0070708_101599891 Ga0070708_1015998911 140
304 3300005456 Ga0070678_100870885 Ga0070678_1008708851 140
305 3300005467 Ga0070706_100362130 Ga0070706_1003621303 140
306 3300005467 Ga0070706_100806707 Ga0070706_1008067072 140
307 3300005468 Ga0070707_100062753 Ga0070707_1000627535 140
308 3300005471 Ga0070698_100060774 Ga0070698_1000607744 140
309 3300005471 Ga0070698_100143727 Ga0070698_1001437273 140
310 3300005518 Ga0070699_100831414 Ga0070699_1008314142 140
311 3300005546 Ga0070696_100965954 Ga0070696_1009659542 140
312 3300005577 Ga0068857_100130597 Ga0068857_1001305972 140
313 3300005614 Ga0068856_100203297 Ga0068856_1002032973 140
314 3300006163 Ga0070715_10456002 Ga0070715_104560022 140
315 3300006844 Ga0075428_100107812 Ga0075428_1001078127 140
316 3300006880 Ga0075429_100110691 Ga0075429_1001106911 140
317 3300006914 Ga0075436_100156232 Ga0075436_1001562322 140
318 3300009147 Ga0114129_10691807 Ga0114129_106918072 140
319 3300009147 Ga0114129_11478356 Ga0114129_114783562 140
320 3300013105 Ga0157369_11163560 Ga0157369_111635602 140
321 3300014745 Ga0157377_11433935 Ga0157377_114339352 140
322 3300025908 Ga0207643_10610749 Ga0207643_106107491 140
323 3300025916 Ga0207663_10230129 Ga0207663_102301293 140
324 3300025936 Ga0207670_10309830 Ga0207670_103098303 140
325 3300025939 Ga0207665_10068534 Ga0207665_100685343 140
326 3300026078 Ga0207702_10274149 Ga0207702_102741492 140
327 3300026116 Ga0207674_10190060 Ga0207674_101900602 140
328 3300026116 Ga0207674_10433024 Ga0207674_104330243 140
329 3300028800 Ga0265338_10001947 Ga0265338_1000194711 140
330 3300028800 Ga0265338_10011667 Ga0265338_100116673 140
331 3300031995 Ga0307409_100219889 Ga0307409_1002198892 140
332 3300037068 Ga0373925_0211308 Ga0373925_0211308_263_685 140
333 3300037418 Ga0395900_0690887 Ga0395900_0690887_440_883 140
334 3300037418 Ga0395900_1362080 Ga0395900_1362080_112_561 140
335 3300037466 Ga0395898_0237642 Ga0395898_0237642_74_523 140
336 3300037466 Ga0395898_0467129 Ga0395898_0467129_541_990 140
337 3300037466 Ga0395898_0537473 Ga0395898_0537473_651_1082 140
338 3300037466 Ga0395898_0587201 Ga0395898_0587201_130_573 140
339 3300037853 Ga0436364_0002567 Ga0436364_0002567_402_824 140
340 3300038443 Ga0395901_0055181 Ga0395901_0055181_1169_1612 140
341 3300038443 Ga0395901_0107395 Ga0395901_0107395_1096_1545 140
342 3300038443 Ga0395901_0210655 Ga0395901_0210655_476_925 140
343 3300038443 Ga0395901_1212189 Ga0395901_1212189_130_579 140
344 3300038443 Ga0395901_1993519 Ga0395901_1993519_78_509 140
345 3300041451 Ga0451791_0684826 Ga0451791_0684826_19_498 140
346 3300044842 Ga0466957_0013296 Ga0466957_0013296_489_911 140
347 3300044842 Ga0466957_0840906 Ga0466957_0840906_71_502 140
348 3300044901 Ga0466960_0042223 Ga0466960_0042223_459_899 140
349 3300045976 Ga0466967_0158328 Ga0466967_0158328_1299_1724 140
350 3300045976 Ga0466967_0234088 Ga0466967_0234088_480_905 140
351 3300045976 Ga0466967_0838355 Ga0466967_0838355_375_806 140
352 3300046459 Ga0495629_0903939 Ga0495629_0903939_37_510 140
353 3300046476 Ga0495662_0154981 Ga0495662_0154981_294_716 140
354 3300047318 Ga0495636_0384714 Ga0495636_0384714_35_457 140
355 3300048904 Ga0496101_0217765 Ga0496101_0217765_114_536 140
356 3300048904 Ga0496101_0515010 Ga0496101_0515010_84_566 140
357 3300048905 Ga0496102_0378115 Ga0496102_0378115_13_486 140
358 3300048907 Ga0496104_0174123 Ga0496104_0174123_1356_1829 140
359 3300048911 Ga0496108_0140372 Ga0496108_0140372_445_915 140
360 3300048914 Ga0496111_0274772 Ga0496111_0274772_214_657 140
361 3300048917 Ga0496114_0027326 Ga0496114_0027326_973_1446 140
362 3300048922 Ga0496119_0122203 Ga0496119_0122203_293_715 140
363 3300048929 Ga0496126_0000039 Ga0496126_0000039_325879_326310 140
364 3300049129 Ga0501309_005529 Ga0501309_005529_88_528 140
365 3300049161 Ga0501305_005275 Ga0501305_005275_137_577 140
366 3300049162 Ga0501307_039751 Ga0501307_039751_37_477 140
367 3300049533 Ga0501317_000493 Ga0501317_000493_1326_1766 140
368 3300049533 Ga0501317_003362 Ga0501317_003362_116_556 140
369 3300049533 Ga0501317_083066 Ga0501317_083066_43_465 140
370 3300049534 Ga0501318_001899 Ga0501318_001899_313_753 140
371 3300049537 Ga0501321_028519 Ga0501321_028519_149_589 140
372 3300049539 Ga0501323_011984 Ga0501323_011984_105_545 140
373 3300049585 Ga0501069_0447466 Ga0501069_0447466_35_484 140
374 3300050507 nmdc:mga05p37_552239_c1 nmdc:mga05p37_552239_c1_494_916 140
375 3300050512 nmdc:mga0n895_116489_c1 nmdc:mga0n895_116489_c1_158_586 140
376 3300053100 Ga0500660_061602 Ga0500660_061602_405_830 140
377 iso_pu_bacteria 2643221711 2644607579 140
378 iso_pu_bacteria 2811994882 2812373667 140
379 iso_pu_bacteria 2818991462 2819691475 140
380 iso_pu_bacteria 2818991469 2819727488 140
381 3300005327 Ga0070658_10001354 Ga0070658_1000135410 141
382 3300005329 Ga0070683_101926068 Ga0070683_1019260681 141
383 3300005334 Ga0068869_100573193 Ga0068869_1005731932 141
384 3300005347 Ga0070668_100052320 Ga0070668_1000523205 141
385 3300005353 Ga0070669_100678085 Ga0070669_1006780851 141
386 3300005354 Ga0070675_100405559 Ga0070675_1004055592 141
387 3300005367 Ga0070667_100081897 Ga0070667_1000818975 141
388 3300005435 Ga0070714_100412516 Ga0070714_1004125162 141
389 3300005435 Ga0070714_102015964 Ga0070714_1020159641 141
390 3300005436 Ga0070713_100058308 Ga0070713_1000583082 141
391 3300005437 Ga0070710_10407297 Ga0070710_104072972 141
392 3300005440 Ga0070705_100026312 Ga0070705_1000263126 141
393 3300005444 Ga0070694_101638601 Ga0070694_1016386011 141
394 3300005456 Ga0070678_100751757 Ga0070678_1007517572 141
395 3300005457 Ga0070662_101742214 Ga0070662_1017422141 141
396 3300005539 Ga0068853_101180040 Ga0068853_1011800401 141
397 3300005543 Ga0070672_100276201 Ga0070672_1002762013 141
398 3300005544 Ga0070686_101210094 Ga0070686_1012100942 141
399 3300005547 Ga0070693_100073433 Ga0070693_1000734332 141
400 3300005547 Ga0070693_100370704 Ga0070693_1003707041 141
401 3300005563 Ga0068855_100008080 Ga0068855_1000080808 141
402 3300005563 Ga0068855_101141126 Ga0068855_1011411262 141
403 3300005614 Ga0068856_100546252 Ga0068856_1005462522 141
404 3300005615 Ga0070702_100000897 Ga0070702_10000089710 141
405 3300005615 Ga0070702_100071712 Ga0070702_1000717123 141
406 3300005616 Ga0068852_100068687 Ga0068852_1000686872 141
407 3300005616 Ga0068852_102111659 Ga0068852_1021116592 141
408 3300005718 Ga0068866_10534543 Ga0068866_105345432 141
409 3300005834 Ga0068851_10505550 Ga0068851_105055502 141
410 3300005840 Ga0068870_10428486 Ga0068870_104284862 141
411 3300005841 Ga0068863_100307747 Ga0068863_1003077472 141
412 3300005844 Ga0068862_100789026 Ga0068862_1007890261 141
413 3300005985 Ga0081539_10145025 Ga0081539_101450252 141
414 3300006038 Ga0075365_10254856 Ga0075365_102548562 141
415 3300006173 Ga0070716_100337695 Ga0070716_1003376951 141
416 3300006175 Ga0070712_100202487 Ga0070712_1002024872 141
417 3300006844 Ga0075428_100268322 Ga0075428_1002683224 141
418 3300006880 Ga0075429_100060768 Ga0075429_1000607683 141
419 3300009093 Ga0105240_10243122 Ga0105240_102431223 141
420 3300009101 Ga0105247_10338425 Ga0105247_103384252 141
421 3300009101 Ga0105247_11026108 Ga0105247_110261082 141
422 3300009147 Ga0114129_10243503 Ga0114129_102435033 141
423 3300009148 Ga0105243_10403073 Ga0105243_104030732 141
424 3300009148 Ga0105243_10464362 Ga0105243_104643622 141
425 3300009148 Ga0105243_10493872 Ga0105243_104938723 141
426 3300009148 Ga0105243_11107776 Ga0105243_111077761 141
427 3300009176 Ga0105242_10003644 Ga0105242_100036447 141
428 3300009176 Ga0105242_11027954 Ga0105242_110279542 141
429 3300009545 Ga0105237_11051826 Ga0105237_110518262 141
430 3300009551 Ga0105238_10288393 Ga0105238_102883932 141
431 3300009553 Ga0105249_10152698 Ga0105249_101526982 141
432 3300009553 Ga0105249_11175304 Ga0105249_111753042 141
433 3300010375 Ga0105239_12387791 Ga0105239_123877911 141
434 3300011119 Ga0105246_10358714 Ga0105246_103587142 141
435 3300011119 Ga0105246_11205249 Ga0105246_112052491 141
436 3300011119 Ga0105246_11676273 Ga0105246_116762732 141
437 3300013102 Ga0157371_10750779 Ga0157371_107507792 141
438 3300013296 Ga0157374_10676767 Ga0157374_106767672 141
439 3300013297 Ga0157378_10005048 Ga0157378_100050487 141
440 3300013306 Ga0163162_10052449 Ga0163162_100524495 141
441 3300013306 Ga0163162_10265737 Ga0163162_102657372 141
442 3300013306 Ga0163162_13125673 Ga0163162_131256731 141
443 3300013307 Ga0157372_11085078 Ga0157372_110850781 141
444 3300013307 Ga0157372_12520349 Ga0157372_125203491 141
445 3300013308 Ga0157375_10007540 Ga0157375_100075406 141
446 3300013308 Ga0157375_10835112 Ga0157375_108351122 141
447 3300013308 Ga0157375_11260027 Ga0157375_112600272 141
448 3300014325 Ga0163163_11046558 Ga0163163_110465582 141
449 3300014326 Ga0157380_10157965 Ga0157380_101579653 141
450 3300014326 Ga0157380_11160904 Ga0157380_111609042 141
451 3300014968 Ga0157379_10453850 Ga0157379_104538502 141
452 3300017792 Ga0163161_10061866 Ga0163161_100618662 141
453 3300017792 Ga0163161_10098374 Ga0163161_100983742 141
454 3300020075 Ga0206349_1586608 Ga0206349_15866081 141
455 3300020081 Ga0206354_10916987 Ga0206354_109169872 141
456 3300020082 Ga0206353_10498624 Ga0206353_104986241 141
457 3300022467 Ga0224712_10007165 Ga0224712_100071655 141
458 3300025898 Ga0207692_10208612 Ga0207692_102086122 141
459 3300025901 Ga0207688_10082599 Ga0207688_100825993 141
460 3300025906 Ga0207699_10451691 Ga0207699_104516912 141
461 3300025908 Ga0207643_10116798 Ga0207643_101167983 141
462 3300025909 Ga0207705_10105574 Ga0207705_101055744 141
463 3300025912 Ga0207707_10420591 Ga0207707_104205912 141
464 3300025912 Ga0207707_10464875 Ga0207707_104648752 141
465 3300025924 Ga0207694_10225566 Ga0207694_102255662 141
466 3300025926 Ga0207659_10481616 Ga0207659_104816162 141
467 3300025927 Ga0207687_10380501 Ga0207687_103805012 141
468 3300025927 Ga0207687_10383149 Ga0207687_103831492 141
469 3300025928 Ga0207700_10066590 Ga0207700_100665906 141
470 3300025928 Ga0207700_10165244 Ga0207700_101652442 141
471 3300025929 Ga0207664_10071371 Ga0207664_100713713 141
472 3300025929 Ga0207664_10365880 Ga0207664_103658803 141
473 3300025929 Ga0207664_10411912 Ga0207664_104119122 141
474 3300025933 Ga0207706_10931581 Ga0207706_109315812 141
475 3300025934 Ga0207686_10156779 Ga0207686_101567791 141
476 3300025934 Ga0207686_10976490 Ga0207686_109764901 141
477 3300025935 Ga0207709_10369843 Ga0207709_103698432 141
478 3300025935 Ga0207709_10496420 Ga0207709_104964202 141
479 3300025937 Ga0207669_10698223 Ga0207669_106982232 141
480 3300025940 Ga0207691_10269615 Ga0207691_102696153 141
481 3300025942 Ga0207689_10892131 Ga0207689_108921312 141
482 3300025944 Ga0207661_10212019 Ga0207661_102120193 141
483 3300025944 Ga0207661_11903760 Ga0207661_119037601 141
484 3300025945 Ga0207679_11361206 Ga0207679_113612062 141
485 3300025949 Ga0207667_10718752 Ga0207667_107187522 141
486 3300025949 Ga0207667_11012523 Ga0207667_110125231 141
487 3300025961 Ga0207712_10082682 Ga0207712_100826822 141
488 3300025981 Ga0207640_10834054 Ga0207640_108340542 141
489 3300025986 Ga0207658_11500570 Ga0207658_115005701 141
490 3300026041 Ga0207639_10545909 Ga0207639_105459092 141
491 3300026067 Ga0207678_10245716 Ga0207678_102457162 141
492 3300026067 Ga0207678_10903177 Ga0207678_109031772 141
493 3300026078 Ga0207702_10607845 Ga0207702_106078452 141
494 3300026078 Ga0207702_11149885 Ga0207702_111498851 141
495 3300026116 Ga0207674_11845701 Ga0207674_118457012 141
496 3300026121 Ga0207683_10008840 Ga0207683_100088408 141
497 3300026121 Ga0207683_10539841 Ga0207683_105398412 141
498 3300026142 Ga0207698_10331061 Ga0207698_103310612 141
499 3300026142 Ga0207698_11729664 Ga0207698_117296642 141
500 3300026142 Ga0207698_11770536 Ga0207698_117705362 141
501 3300031247 Ga0265340_10004760 Ga0265340_100047602 141
502 3300031456 Ga0307513_10451308 Ga0307513_104513082 141
503 3300031731 Ga0307405_10556111 Ga0307405_105561112 141
504 3300032005 Ga0307411_10065279 Ga0307411_100652793 141
505 3300035083 Ga0373926_0010485 Ga0373926_0010485_1453_1920 141
506 3300035086 Ga0373934_0040884 Ga0373934_0040884_457_882 141
507 3300035086 Ga0373934_0087571 Ga0373934_0087571_352_777 141
508 3300035089 Ga0373944_0007820 Ga0373944_0007820_595_1062 141
509 3300035090 Ga0373949_0111455 Ga0373949_0111455_269_697 141
510 3300035111 Ga0373923_0035685 Ga0373923_0035685_933_1358 141
511 3300035111 Ga0373923_0080123 Ga0373923_0080123_353_820 141
512 3300035113 Ga0373936_0003144 Ga0373936_0003144_2823_3290 141
513 3300035116 Ga0373945_0000841 Ga0373945_0000841_3315_3782 141
514 3300035117 Ga0373953_0069189 Ga0373953_0069189_118_585 141
515 3300035117 Ga0373953_0131078 Ga0373953_0131078_480_905 141
516 3300035118 Ga0373954_0084459 Ga0373954_0084459_301_726 141
517 3300035119 Ga0373956_0027999 Ga0373956_0027999_1929_2354 141
518 3300035119 Ga0373956_0055399 Ga0373956_0055399_879_1304 141
519 3300035120 Ga0373957_0021397 Ga0373957_0021397_422_847 141
520 3300035120 Ga0373957_0227099 Ga0373957_0227099_334_759 141
521 3300035170 Ga0373943_0004434 Ga0373943_0004434_2580_3047 141
522 3300035170 Ga0373943_0455209 Ga0373943_0455209_40_468 141
523 3300035171 Ga0373946_0000825 Ga0373946_0000825_3310_3777 141
524 3300035691 Ga0373931_0567946 Ga0373931_0567946_258_683 141
525 3300035692 Ga0373935_0023854 Ga0373935_0023854_2505_2972 141
526 3300035695 Ga0373927_0012270 Ga0373927_0012270_3330_3797 141
527 3300035724 Ga0373933_0398666 Ga0373933_0398666_444_869 141
528 3300035725 Ga0373947_0003413 Ga0373947_0003413_2471_2938 141
529 3300036401 Ga0373937_0033269 Ga0373937_0033269_3759_4184 141
530 3300036401 Ga0373937_0061238 Ga0373937_0061238_611_1036 141
531 3300037068 Ga0373925_0005181 Ga0373925_0005181_7415_7882 141
532 3300038443 Ga0395901_0843539 Ga0395901_0843539_371_826 141
533 3300039447 Ga0436361_0897381 Ga0436361_0897381_68_493 141
534 3300041443 Ga0451789_0943076 Ga0451789_0943076_290_715 141
535 3300041456 Ga0451795_1458503 Ga0451795_1458503_177_602 141
536 3300041458 Ga0451798_0780721 Ga0451798_0780721_46_513 141
537 3300041459 Ga0451800_0832306 Ga0451800_0832306_277_705 141
538 3300041463 Ga0451804_0346912 Ga0451804_0346912_475_900 141
539 3300041492 Ga0451835_1235831 Ga0451835_1235831_63_491 141
540 3300041512 Ga0451853_3255794 Ga0451853_3255794_70_495 141
541 3300044684 Ga0466966_0689802 Ga0466966_0689802_37_465 141
542 3300044842 Ga0466957_0120667 Ga0466957_0120667_81_506 141
543 3300046454 Ga0495592_0030318 Ga0495592_0030318_2921_3346 141
544 3300046454 Ga0495592_0860489 Ga0495592_0860489_27_494 141
545 3300046455 Ga0495603_0145490 Ga0495603_0145490_756_1184 141
546 3300046459 Ga0495629_0070609 Ga0495629_0070609_1793_2221 141
547 3300046461 Ga0495641_0017674 Ga0495641_0017674_2446_2913 141
548 3300046461 Ga0495641_0038441 Ga0495641_0038441_1774_2202 141
549 3300046462 Ga0495651_0000980 Ga0495651_0000980_7094_7519 141
550 3300046463 Ga0495653_0001557 Ga0495653_0001557_3749_4216 141
551 3300046463 Ga0495653_0091259 Ga0495653_0091259_682_1107 141
552 3300046463 Ga0495653_0288751 Ga0495653_0288751_483_911 141
553 3300046476 Ga0495662_0062865 Ga0495662_0062865_214_681 141
554 3300046477 Ga0495664_0018280 Ga0495664_0018280_222_689 141
555 3300046477 Ga0495664_0296816 Ga0495664_0296816_282_710 141
556 3300046511 Ga0495608_0047041 Ga0495608_0047041_223_648 141
557 3300046511 Ga0495608_0068990 Ga0495608_0068990_953_1381 141
558 3300046516 Ga0495628_0098450 Ga0495628_0098450_639_1106 141
559 3300046516 Ga0495628_0320746 Ga0495628_0320746_659_1084 141
560 3300046529 Ga0495652_0014862 Ga0495652_0014862_2784_3209 141
561 3300046529 Ga0495652_0060614 Ga0495652_0060614_2157_2624 141
562 3300046529 Ga0495652_0208878 Ga0495652_0208878_766_1194 141
563 3300046529 Ga0495652_0604153 Ga0495652_0604153_81_509 141
564 3300046531 Ga0495665_0055250 Ga0495665_0055250_437_904 141
565 3300046533 Ga0495640_0022016 Ga0495640_0022016_1031_1498 141
566 3300046533 Ga0495640_0197060 Ga0495640_0197060_358_786 141
567 3300046536 Ga0495587_0094262 Ga0495587_0094262_839_1264 141
568 3300046536 Ga0495587_0143603 Ga0495587_0143603_400_867 141
569 3300046536 Ga0495587_0180352 Ga0495587_0180352_97_525 141
570 3300046536 Ga0495587_0441565 Ga0495587_0441565_52_480 141
571 3300046543 Ga0495645_0171907 Ga0495645_0171907_655_1122 141
572 3300046543 Ga0495645_0367650 Ga0495645_0367650_251_679 141
573 3300046559 Ga0495667_0042988 Ga0495667_0042988_450_875 141
574 3300046559 Ga0495667_0058275 Ga0495667_0058275_762_1229 141
575 3300046642 Ga0495634_0154455 Ga0495634_0154455_565_1032 141
576 3300046642 Ga0495634_0548619 Ga0495634_0548619_144_569 141
577 3300046663 Ga0495635_0005104 Ga0495635_0005104_5361_5828 141
578 3300046674 Ga0495588_0162321 Ga0495588_0162321_506_934 141
579 3300046675 Ga0495657_0017624 Ga0495657_0017624_3454_3879 141
580 3300046675 Ga0495657_0128071 Ga0495657_0128071_820_1287 141
581 3300046675 Ga0495657_0132448 Ga0495657_0132448_641_1069 141
582 3300046675 Ga0495657_0467187 Ga0495657_0467187_117_545 141
583 3300046678 Ga0495599_0105648 Ga0495599_0105648_1180_1605 141
584 3300046678 Ga0495599_0210206 Ga0495599_0210206_193_660 141
585 3300046679 Ga0495623_0069142 Ga0495623_0069142_1303_1728 141
586 3300046680 Ga0495646_0174291 Ga0495646_0174291_678_1103 141
587 3300046680 Ga0495646_0212092 Ga0495646_0212092_42_467 141
588 3300046683 Ga0495658_0166791 Ga0495658_0166791_544_1011 141
589 3300046683 Ga0495658_0291192 Ga0495658_0291192_463_891 141
590 3300046689 Ga0495613_0413515 Ga0495613_0413515_107_535 141
591 3300046690 Ga0495624_0027013 Ga0495624_0027013_2705_3172 141
592 3300046809 Ga0495600_0111035 Ga0495600_0111035_501_926 141
593 3300046809 Ga0495600_0140405 Ga0495600_0140405_824_1291 141
594 3300047315 Ga0495581_0273355 Ga0495581_0273355_28_453 141
595 3300047315 Ga0495581_0429608 Ga0495581_0429608_167_595 141
596 3300047317 Ga0495604_0027269 Ga0495604_0027269_3319_3744 141
597 3300047317 Ga0495604_0269735 Ga0495604_0269735_45_470 141
598 3300047317 Ga0495604_0353324 Ga0495604_0353324_220_687 141
599 3300047319 Ga0495674_0003633 Ga0495674_0003633_11234_11701 141
600 3300047319 Ga0495674_0537220 Ga0495674_0537220_391_819 141
601 3300047321 Ga0495676_0026711 Ga0495676_0026711_838_1263 141
602 3300047321 Ga0495676_0042477 Ga0495676_0042477_1321_1788 141
603 3300047322 Ga0495680_0034007 Ga0495680_0034007_2871_3338 141
604 3300047322 Ga0495680_0049525 Ga0495680_0049525_2368_2793 141
605 3300047322 Ga0495680_0135137 Ga0495680_0135137_349_777 141
606 3300047444 Ga0495675_0021089 Ga0495675_0021089_3199_3624 141
607 3300047471 Ga0495684_0124875 Ga0495684_0124875_711_1178 141
608 3300047471 Ga0495684_0156932 Ga0495684_0156932_912_1337 141
609 3300047471 Ga0495684_0293397 Ga0495684_0293397_64_492 141
610 3300047673 Ga0495593_0142836 Ga0495593_0142836_537_1004 141
611 3300048088 Ga0495602_0002864 Ga0495602_0002864_13903_14328 141
612 3300048088 Ga0495602_0349487 Ga0495602_0349487_296_721 141
613 3300048088 Ga0495602_0590214 Ga0495602_0590214_224_652 141
614 3300048903 Ga0496100_0409161 Ga0496100_0409161_84_539 141
615 3300048903 Ga0496100_0413045 Ga0496100_0413045_221_646 141
616 3300048904 Ga0496101_0437097 Ga0496101_0437097_415_843 141
617 3300048905 Ga0496102_0356213 Ga0496102_0356213_70_525 141
618 3300048905 Ga0496102_0395611 Ga0496102_0395611_294_722 141
619 3300048905 Ga0496102_0470787 Ga0496102_0470787_309_764 141
620 3300048906 Ga0496103_0365732 Ga0496103_0365732_144_599 141
621 3300048907 Ga0496104_0073428 Ga0496104_0073428_1979_2443 141
622 3300048907 Ga0496104_0623520 Ga0496104_0623520_514_969 141
623 3300048907 Ga0496104_0939339 Ga0496104_0939339_132_560 141
624 3300048907 Ga0496104_1032531 Ga0496104_1032531_19_447 141
625 3300048908 Ga0496105_0032442 Ga0496105_0032442_3201_3665 141
626 3300048908 Ga0496105_0044721 Ga0496105_0044721_3081_3545 141
627 3300048908 Ga0496105_0160289 Ga0496105_0160289_1000_1428 141
628 3300048908 Ga0496105_0570814 Ga0496105_0570814_209_664 141
629 3300048908 Ga0496105_1091999 Ga0496105_1091999_142_567 141
630 3300048908 Ga0496105_1125880 Ga0496105_1125880_96_524 141
631 3300048911 Ga0496108_0139789 Ga0496108_0139789_1095_1523 141
632 3300048911 Ga0496108_0648764 Ga0496108_0648764_417_845 141
633 3300048912 Ga0496109_0693245 Ga0496109_0693245_191_646 141
634 3300048913 Ga0496110_0031068 Ga0496110_0031068_3145_3600 141
635 3300048913 Ga0496110_0338926 Ga0496110_0338926_804_1232 141
636 3300048913 Ga0496110_0344236 Ga0496110_0344236_261_716 141
637 3300048913 Ga0496110_0867570 Ga0496110_0867570_19_483 141
638 3300048913 Ga0496110_1020699 Ga0496110_1020699_208_666 141
639 3300048914 Ga0496111_0158028 Ga0496111_0158028_1183_1638 141
640 3300048915 Ga0496112_0583962 Ga0496112_0583962_77_505 141
641 3300048916 Ga0496113_0267996 Ga0496113_0267996_175_600 141
642 3300048916 Ga0496113_0393016 Ga0496113_0393016_75_503 141
643 3300048916 Ga0496113_0526921 Ga0496113_0526921_418_873 141
644 3300048916 Ga0496113_0677401 Ga0496113_0677401_256_684 141
645 3300048916 Ga0496113_1277155 Ga0496113_1277155_65_493 141
646 3300048917 Ga0496114_0240035 Ga0496114_0240035_389_844 141
647 3300048917 Ga0496114_0313044 Ga0496114_0313044_702_1157 141
648 3300048917 Ga0496114_1221231 Ga0496114_1221231_37_495 141
649 3300048917 Ga0496114_1692835 Ga0496114_1692835_80_505 141
650 3300048917 Ga0496114_1728291 Ga0496114_1728291_40_468 141
651 3300048918 Ga0496115_0137577 Ga0496115_0137577_1141_1569 141
652 3300048918 Ga0496115_0571228 Ga0496115_0571228_406_870 141
653 3300049585 Ga0501069_0646508 Ga0501069_0646508_106_531 141
654 3300050492 nmdc:mga0yw44_684204_c1 nmdc:mga0yw44_684204_c1_10_435 141
655 3300050492 nmdc:mga0yw44_887810_c1 nmdc:mga0yw44_887810_c1_115_540 141
656 3300050507 nmdc:mga05p37_838810_c1 nmdc:mga05p37_838810_c1_48_473 141
657 3300050508 nmdc:mga09592_149153_c1 nmdc:mga09592_149153_c1_691_1116 141
658 3300053077 Ga0495601_0527929 Ga0495601_0527929_91_558 141
659 3300053085 Ga0495619_0226023 Ga0495619_0226023_384_812 141
660 iso_pu_bacteria 2818991318 2819426288 141
661 iso_pu_bacteria 2818991458 2819665311 141
662 iso_pu_bacteria 2862178590 2862185370 141
663 iso_pu_bacteria 2862705112 2862709766 141
664 iso_pu_bacteria 2990044586 2990047430 141
665 iso_pu_bacteria 8023623736 8023629384 141
666 iso_pu_bacteria 8025413630 8025415195 141
667 iso_pu_bacteria 8025524527 8025529767 141
668 3300001989 JGI24739J22299_10011660 JGI24739J22299_100116603 142
669 3300002067 JGI24735J21928_10022149 JGI24735J21928_100221494 142
670 3300002075 JGI24738J21930_10009126 JGI24738J21930_100091263 142
671 3300003316 rootH1_10072843 rootH1_100728432 142
672 3300003320 rootH2_10036674 rootH2_100366742 142
673 3300003320 rootH2_10036693 rootH2_100366933 142
674 3300003322 rootL2_10007292 rootL2_100072922 142
675 3300003323 rootH1_10014055 rootH1_100140559 142
676 3300003578 Ga0006562J51391_1020917 Ga0006562J51391_10209172 142
677 3300003578 Ga0006562J51391_1102892 Ga0006562J51391_11028922 142
678 3300004799 Ga0058863_11947591 Ga0058863_119475913 142
679 3300005327 Ga0070658_10186587 Ga0070658_101865872 142
680 3300005329 Ga0070683_100226002 Ga0070683_1002260024 142
681 3300005329 Ga0070683_101279100 Ga0070683_1012791001 142
682 3300005336 Ga0070680_100186831 Ga0070680_1001868312 142
683 3300005336 Ga0070680_100249005 Ga0070680_1002490052 142
684 3300005338 Ga0068868_101084353 Ga0068868_1010843531 142
685 3300005345 Ga0070692_10039038 Ga0070692_100390382 142
686 3300005347 Ga0070668_100793447 Ga0070668_1007934472 142
687 3300005434 Ga0070709_10018736 Ga0070709_100187363 142
688 3300005434 Ga0070709_10090044 Ga0070709_100900442 142
689 3300005435 Ga0070714_100686475 Ga0070714_1006864752 142
690 3300005436 Ga0070713_101037703 Ga0070713_1010377032 142
691 3300005436 Ga0070713_101608829 Ga0070713_1016088291 142
692 3300005437 Ga0070710_10860661 Ga0070710_108606611 142
693 3300005440 Ga0070705_100343119 Ga0070705_1003431191 142
694 3300005458 Ga0070681_10011834 Ga0070681_100118346 142
695 3300005458 Ga0070681_10480692 Ga0070681_104806922 142
696 3300005458 Ga0070681_10951620 Ga0070681_109516202 142
697 3300005467 Ga0070706_100003004 Ga0070706_10000300418 142
698 3300005471 Ga0070698_100030741 Ga0070698_1000307412 142
699 3300005530 Ga0070679_100084804 Ga0070679_1000848044 142
700 3300005530 Ga0070679_100135799 Ga0070679_1001357993 142
701 3300005530 Ga0070679_100506736 Ga0070679_1005067361 142
702 3300005535 Ga0070684_101617639 Ga0070684_1016176391 142
703 3300005536 Ga0070697_102069519 Ga0070697_1020695191 142
704 3300005543 Ga0070672_100144409 Ga0070672_1001444095 142
705 3300005545 Ga0070695_100972190 Ga0070695_1009721901 142
706 3300005548 Ga0070665_100116866 Ga0070665_1001168664 142
707 3300005548 Ga0070665_100117093 Ga0070665_1001170935 142
708 3300005548 Ga0070665_100638590 Ga0070665_1006385901 142
709 3300005548 Ga0070665_101343893 Ga0070665_1013438931 142
710 3300005548 Ga0070665_101616182 Ga0070665_1016161821 142
711 3300005563 Ga0068855_100074080 Ga0068855_1000740802 142
712 3300005563 Ga0068855_100178768 Ga0068855_1001787682 142
713 3300005563 Ga0068855_101552210 Ga0068855_1015522102 142
714 3300005564 Ga0070664_101253596 Ga0070664_1012535962 142
715 3300005577 Ga0068857_100521743 Ga0068857_1005217432 142
716 3300005614 Ga0068856_100250444 Ga0068856_1002504442 142
717 3300005616 Ga0068852_100192985 Ga0068852_1001929852 142
718 3300005617 Ga0068859_100537914 Ga0068859_1005379142 142
719 3300005618 Ga0068864_100074758 Ga0068864_1000747581 142
720 3300005841 Ga0068863_100836938 Ga0068863_1008369382 142
721 3300005842 Ga0068858_100000010 Ga0068858_100000010104 142
722 3300005842 Ga0068858_100282401 Ga0068858_1002824012 142
723 3300005842 Ga0068858_101157046 Ga0068858_1011570461 142
724 3300005843 Ga0068860_100295804 Ga0068860_1002958042 142
725 3300005843 Ga0068860_100567246 Ga0068860_1005672462 142
726 3300006028 Ga0070717_10678970 Ga0070717_106789702 142
727 3300006038 Ga0075365_10134791 Ga0075365_101347912 142
728 3300006048 Ga0075363_100031881 Ga0075363_1000318813 142
729 3300006048 Ga0075363_100207144 Ga0075363_1002071442 142
730 3300006048 Ga0075363_100401581 Ga0075363_1004015811 142
731 3300006058 Ga0075432_10029277 Ga0075432_100292772 142
732 3300006163 Ga0070715_10007756 Ga0070715_100077565 142
733 3300006173 Ga0070716_100040250 Ga0070716_1000402502 142
734 3300006175 Ga0070712_100282974 Ga0070712_1002829742 142
735 3300006175 Ga0070712_100697229 Ga0070712_1006972291 142
736 3300006178 Ga0075367_10008260 Ga0075367_100082603 142
737 3300006186 Ga0075369_10330203 Ga0075369_103302031 142
738 3300006358 Ga0068871_100164128 Ga0068871_1001641281 142
739 3300006931 Ga0097620_100537935 Ga0097620_1005379352 142
740 3300006948 Ga0099826_10067130 Ga0099826_100671302 142
741 3300009011 Ga0105251_10010014 Ga0105251_100100145 142
742 3300009011 Ga0105251_10039734 Ga0105251_100397341 142
743 3300009036 Ga0105244_10189115 Ga0105244_101891152 142
744 3300009092 Ga0105250_10051640 Ga0105250_100516402 142
745 3300009093 Ga0105240_10323843 Ga0105240_103238433 142
746 3300009098 Ga0105245_10070926 Ga0105245_100709263 142
747 3300009098 Ga0105245_10177094 Ga0105245_101770945 142
748 3300009098 Ga0105245_10269028 Ga0105245_102690282 142
749 3300009101 Ga0105247_10001725 Ga0105247_100017256 142
750 3300009101 Ga0105247_10188401 Ga0105247_101884012 142
751 3300009101 Ga0105247_10660053 Ga0105247_106600531 142
752 3300009147 Ga0114129_10087526 Ga0114129_100875262 142
753 3300009147 Ga0114129_12744997 Ga0114129_127449971 142
754 3300009148 Ga0105243_10025061 Ga0105243_1002506110 142
755 3300009148 Ga0105243_10038845 Ga0105243_100388453 142
756 3300009148 Ga0105243_10368206 Ga0105243_103682061 142
757 3300009174 Ga0105241_11107374 Ga0105241_111073742 142
758 3300009176 Ga0105242_10680509 Ga0105242_106805091 142
759 3300009177 Ga0105248_10117653 Ga0105248_101176532 142
760 3300009177 Ga0105248_10118043 Ga0105248_101180433 142
761 3300009545 Ga0105237_10030634 Ga0105237_100306343 142
762 3300009545 Ga0105237_10815544 Ga0105237_108155442 142
763 3300009551 Ga0105238_11365671 Ga0105238_113656712 142
764 3300009553 Ga0105249_11063869 Ga0105249_110638692 142
765 3300010375 Ga0105239_10151565 Ga0105239_101515655 142
766 3300010375 Ga0105239_10230226 Ga0105239_102302265 142
767 3300010375 Ga0105239_10958531 Ga0105239_109585312 142
768 3300011119 Ga0105246_10022892 Ga0105246_100228923 142
769 3300012503 Ga0157313_1036987 Ga0157313_10369871 142
770 3300013102 Ga0157371_10121374 Ga0157371_101213743 142
771 3300013102 Ga0157371_10957452 Ga0157371_109574522 142
772 3300013104 Ga0157370_10003894 Ga0157370_1000389417 142
773 3300013104 Ga0157370_10091031 Ga0157370_100910313 142
774 3300013104 Ga0157370_11205678 Ga0157370_112056782 142
775 3300013105 Ga0157369_10079691 Ga0157369_100796913 142
776 3300013105 Ga0157369_10082608 Ga0157369_100826083 142
777 3300013296 Ga0157374_10030439 Ga0157374_100304393 142
778 3300013306 Ga0163162_10232737 Ga0163162_102327375 142
779 3300013307 Ga0157372_10319147 Ga0157372_103191472 142
780 3300013307 Ga0157372_10377474 Ga0157372_103774743 142
781 3300013307 Ga0157372_10491989 Ga0157372_104919892 142
782 3300013308 Ga0157375_10092104 Ga0157375_100921045 142
783 3300014325 Ga0163163_10046293 Ga0163163_100462932 142
784 3300014325 Ga0163163_10187299 Ga0163163_101872992 142
785 3300014325 Ga0163163_12860059 Ga0163163_128600591 142
786 3300014497 Ga0182008_10004686 Ga0182008_100046863 142
787 3300014745 Ga0157377_10685512 Ga0157377_106855122 142
788 3300014968 Ga0157379_10000901 Ga0157379_1000090110 142
789 3300014968 Ga0157379_10041706 Ga0157379_100417065 142
790 3300014969 Ga0157376_10020002 Ga0157376_100200024 142
791 3300015261 Ga0182006_1028681 Ga0182006_10286816 142
792 3300015262 Ga0182007_10006733 Ga0182007_100067332 142
793 3300015688 Ga0183367_1002 Ga0183367_1002808 142
794 3300020069 Ga0197907_10094630 Ga0197907_100946304 142
795 3300020069 Ga0197907_11347725 Ga0197907_113477252 142
796 3300020070 Ga0206356_11748901 Ga0206356_117489012 142
797 3300020076 Ga0206355_1150127 Ga0206355_11501274 142
798 3300020082 Ga0206353_10391345 Ga0206353_103913452 142
799 3300021384 Ga0213876_10000813 Ga0213876_1000081321 142
800 3300021388 Ga0213875_10031231 Ga0213875_100312313 142
801 3300022467 Ga0224712_10011494 Ga0224712_100114942 142
802 3300022467 Ga0224712_10017796 Ga0224712_100177962 142
803 3300025302 Ga0207426_1006340 Ga0207426_10063403 142
804 3300025302 Ga0207426_1008834 Ga0207426_10088343 142
805 3300025302 Ga0207426_1009606 Ga0207426_10096063 142
806 3300025711 Ga0207696_1041246 Ga0207696_10412462 142
807 3300025735 Ga0207713_1025636 Ga0207713_10256362 142
808 3300025900 Ga0207710_10000048 Ga0207710_1000004859 142
809 3300025900 Ga0207710_10087734 Ga0207710_100877342 142
810 3300025900 Ga0207710_10318003 Ga0207710_103180032 142
811 3300025904 Ga0207647_10029484 Ga0207647_100294842 142
812 3300025904 Ga0207647_10160579 Ga0207647_101605792 142
813 3300025905 Ga0207685_10214087 Ga0207685_102140872 142
814 3300025906 Ga0207699_10008852 Ga0207699_100088525 142
815 3300025906 Ga0207699_10016621 Ga0207699_100166216 142
816 3300025909 Ga0207705_10044902 Ga0207705_100449022 142
817 3300025909 Ga0207705_10482938 Ga0207705_104829382 142
818 3300025912 Ga0207707_10093220 Ga0207707_100932203 142
819 3300025912 Ga0207707_11235758 Ga0207707_112357581 142
820 3300025913 Ga0207695_10199119 Ga0207695_101991192 142
821 3300025916 Ga0207663_10247933 Ga0207663_102479331 142
822 3300025917 Ga0207660_10067455 Ga0207660_100674553 142
823 3300025917 Ga0207660_10215256 Ga0207660_102152562 142
824 3300025919 Ga0207657_10083860 Ga0207657_100838604 142
825 3300025921 Ga0207652_10029332 Ga0207652_100293322 142
826 3300025921 Ga0207652_10135682 Ga0207652_101356822 142
827 3300025921 Ga0207652_10282189 Ga0207652_102821892 142
828 3300025927 Ga0207687_10259044 Ga0207687_102590442 142
829 3300025927 Ga0207687_10328171 Ga0207687_103281711 142
830 3300025928 Ga0207700_10034178 Ga0207700_100341786 142
831 3300025928 Ga0207700_10429826 Ga0207700_104298262 142
832 3300025929 Ga0207664_10021031 Ga0207664_100210312 142
833 3300025929 Ga0207664_10102621 Ga0207664_101026215 142
834 3300025929 Ga0207664_10106774 Ga0207664_101067742 142
835 3300025929 Ga0207664_10225769 Ga0207664_102257692 142
836 3300025932 Ga0207690_10007846 Ga0207690_100078462 142
837 3300025934 Ga0207686_11239852 Ga0207686_112398522 142
838 3300025935 Ga0207709_10265246 Ga0207709_102652462 142
839 3300025935 Ga0207709_10726536 Ga0207709_107265361 142
840 3300025939 Ga0207665_10309078 Ga0207665_103090782 142
841 3300025940 Ga0207691_10590626 Ga0207691_105906262 142
842 3300025941 Ga0207711_10351479 Ga0207711_103514792 142
843 3300025941 Ga0207711_10711727 Ga0207711_107117272 142
844 3300025945 Ga0207679_10868886 Ga0207679_108688861 142
845 3300025949 Ga0207667_10203476 Ga0207667_102034764 142
846 3300026023 Ga0207677_11168278 Ga0207677_111682782 142
847 3300026035 Ga0207703_10000002 Ga0207703_10000002166 142
848 3300026035 Ga0207703_10368599 Ga0207703_103685992 142
849 3300026041 Ga0207639_10471143 Ga0207639_104711432 142
850 3300026075 Ga0207708_10104352 Ga0207708_101043522 142
851 3300026078 Ga0207702_10083345 Ga0207702_100833452 142
852 3300026078 Ga0207702_10291862 Ga0207702_102918621 142
853 3300026088 Ga0207641_10659277 Ga0207641_106592772 142
854 3300026095 Ga0207676_10035155 Ga0207676_100351556 142
855 3300026118 Ga0207675_101209775 Ga0207675_1012097751 142
856 3300026142 Ga0207698_10098418 Ga0207698_100984181 142
857 3300026142 Ga0207698_10106298 Ga0207698_101062983 142
858 3300027666 Ga0209282_1088542 Ga0209282_10885423 142
859 3300028381 Ga0268264_10777949 Ga0268264_107779492 142
860 3300028666 Ga0265336_10008687 Ga0265336_100086872 142
861 3300028794 Ga0307515_10001897 Ga0307515_1000189731 142
862 3300028794 Ga0307515_10101954 Ga0307515_101019543 142
863 3300028794 Ga0307515_10202590 Ga0307515_102025902 142
864 3300028794 Ga0307515_10361289 Ga0307515_103612891 142
865 3300028800 Ga0265338_10008217 Ga0265338_1000821716 142
866 3300028800 Ga0265338_10247519 Ga0265338_102475192 142
867 3300030500 Ga0268256_1069139 Ga0268256_10691392 142
868 3300030521 Ga0307511_10006642 Ga0307511_100066423 142
869 3300030521 Ga0307511_10137380 Ga0307511_101373801 142
870 3300030521 Ga0307511_10406167 Ga0307511_104061671 142
871 3300030522 Ga0307512_10011226 Ga0307512_100112266 142
872 3300030522 Ga0307512_10018422 Ga0307512_100184221 142
873 3300030745 Ga0316182_1262137 Ga0316182_12621372 142
874 3300031241 Ga0265325_10076140 Ga0265325_100761402 142
875 3300031247 Ga0265340_10052803 Ga0265340_100528033 142
876 3300031249 Ga0265339_10212455 Ga0265339_102124552 142
877 3300031344 Ga0265316_10200137 Ga0265316_102001372 142
878 3300031456 Ga0307513_10001546 Ga0307513_1000154633 142
879 3300031456 Ga0307513_10095693 Ga0307513_100956936 142
880 3300031456 Ga0307513_10105129 Ga0307513_101051293 142
881 3300031456 Ga0307513_10144890 Ga0307513_101448902 142
882 3300031456 Ga0307513_10721841 Ga0307513_107218411 142
883 3300031507 Ga0307509_10018160 Ga0307509_100181602 142
884 3300031507 Ga0307509_10088336 Ga0307509_100883363 142
885 3300031507 Ga0307509_10102733 Ga0307509_101027333 142
886 3300031507 Ga0307509_10478196 Ga0307509_104781962 142
887 3300031595 Ga0265313_10007055 Ga0265313_100070557 142
888 3300031616 Ga0307508_10031345 Ga0307508_100313456 142
889 3300031616 Ga0307508_10056397 Ga0307508_100563972 142
890 3300031616 Ga0307508_10078345 Ga0307508_100783453 142
891 3300031616 Ga0307508_10220119 Ga0307508_102201193 142
892 3300031616 Ga0307508_10224302 Ga0307508_102243022 142
893 3300031616 Ga0307508_10252286 Ga0307508_102522863 142
894 3300031649 Ga0307514_10105163 Ga0307514_101051633 142
895 3300031649 Ga0307514_10200117 Ga0307514_102001172 142
896 3300031649 Ga0307514_10342558 Ga0307514_103425581 142
897 3300031712 Ga0265342_10119139 Ga0265342_101191393 142
898 3300031712 Ga0265342_10128557 Ga0265342_101285574 142
899 3300031730 Ga0307516_10012550 Ga0307516_1001255011 142
900 3300031730 Ga0307516_10056363 Ga0307516_100563633 142
901 3300031730 Ga0307516_10449917 Ga0307516_104499172 142
902 3300031730 Ga0307516_10512720 Ga0307516_105127202 142
903 3300031838 Ga0307518_10040229 Ga0307518_100402293 142
904 3300031838 Ga0307518_10058004 Ga0307518_100580042 142
905 3300031838 Ga0307518_10185534 Ga0307518_101855343 142
906 3300031852 Ga0307410_10266686 Ga0307410_102666862 142
907 3300032002 Ga0307416_100757339 Ga0307416_1007573391 142
908 3300032005 Ga0307411_10330816 Ga0307411_103308162 142
909 3300032005 Ga0307411_11780865 Ga0307411_117808652 142
910 3300033179 Ga0307507_10009069 Ga0307507_100090699 142
911 3300033179 Ga0307507_10138409 Ga0307507_101384092 142
912 3300033180 Ga0307510_10018408 Ga0307510_100184089 142
913 3300033180 Ga0307510_10316364 Ga0307510_103163641 142
914 3300035089 Ga0373944_0355853 Ga0373944_0355853_21_464 142
915 3300035111 Ga0373923_0149317 Ga0373923_0149317_551_994 142
916 3300035118 Ga0373954_0001336 Ga0373954_0001336_1488_1916 142
917 3300035118 Ga0373954_0028020 Ga0373954_0028020_2074_2517 142
918 3300035120 Ga0373957_0180638 Ga0373957_0180638_323_766 142
919 3300035692 Ga0373935_0224683 Ga0373935_0224683_257_700 142
920 3300035724 Ga0373933_0081971 Ga0373933_0081971_383_826 142
921 3300036401 Ga0373937_0024186 Ga0373937_0024186_163_606 142
922 3300037068 Ga0373925_0555270 Ga0373925_0555270_47_508 142
923 3300037312 Ga0395899_0113039 Ga0395899_0113039_1232_1660 142
924 3300037312 Ga0395899_0267424 Ga0395899_0267424_283_723 142
925 3300037418 Ga0395900_0130824 Ga0395900_0130824_1850_2290 142
926 3300037418 Ga0395900_0813045 Ga0395900_0813045_270_707 142
927 3300037466 Ga0395898_0026366 Ga0395898_0026366_859_1299 142
928 3300037466 Ga0395898_0092765 Ga0395898_0092765_1451_1879 142
929 3300037466 Ga0395898_0652054 Ga0395898_0652054_178_615 142
930 3300037471 Ga0395905_0270188 Ga0395905_0270188_609_1037 142
931 3300037853 Ga0436364_1414364 Ga0436364_1414364_1902_2336 142
932 3300038443 Ga0395901_0090689 Ga0395901_0090689_1891_2331 142
933 3300038443 Ga0395901_0229517 Ga0395901_0229517_605_1042 142
934 3300038443 Ga0395901_0274627 Ga0395901_0274627_480_908 142
935 3300038443 Ga0395901_0290221 Ga0395901_0290221_292_729 142
936 3300039437 Ga0436365_0271067 Ga0436365_0271067_14309_14737 142
937 3300039450 Ga0436363_0135126 Ga0436363_0135126_225_653 142
938 3300041404 Ga0439436_0000987 Ga0439436_0000987_4882_5310 142
939 3300041404 Ga0439436_0004595 Ga0439436_0004595_812_1240 142
940 3300041406 Ga0439439_0036403 Ga0439439_0036403_753_1181 142
941 3300041406 Ga0439439_0056864 Ga0439439_0056864_565_993 142
942 3300041451 Ga0451791_0200477 Ga0451791_0200477_50_499 142
943 3300041456 Ga0451795_0622179 Ga0451795_0622179_72_509 142
944 3300041460 Ga0451802_0630685 Ga0451802_0630685_42_470 142
945 3300041486 Ga0451807_2017756 Ga0451807_2017756_32_481 142
946 3300041486 Ga0451807_2347865 Ga0451807_2347865_102_530 142
947 3300041494 Ga0451837_1021945 Ga0451837_1021945_1561_1989 142
948 3300041498 Ga0451841_0330448 Ga0451841_0330448_69_518 142
949 3300041505 Ga0451849_0665405 Ga0451849_0665405_72_500 142
950 3300041509 Ga0451843_0199401 Ga0451843_0199401_301_738 142
951 3300041509 Ga0451843_0756226 Ga0451843_0756226_78_518 142
952 3300041509 Ga0451843_0916359 Ga0451843_0916359_113_562 142
953 3300041512 Ga0451853_0020641 Ga0451853_0020641_640_1089 142
954 3300041512 Ga0451853_0701526 Ga0451853_0701526_1465_1893 142
955 3300041512 Ga0451853_1418287 Ga0451853_1418287_1300_1749 142
956 3300041512 Ga0451853_2445157 Ga0451853_2445157_2470_2898 142
957 3300041999 Ga0439433_0004643 Ga0439433_0004643_926_1354 142
958 3300042002 Ga0439442_006134 Ga0439442_006134_1401_1829 142
959 3300042007 Ga0439449_0006827 Ga0439449_0006827_1539_1967 142
960 3300042007 Ga0439449_0050763 Ga0439449_0050763_697_1125 142
961 3300042007 Ga0439449_0066425 Ga0439449_0066425_429_857 142
962 3300042007 Ga0439449_0099891 Ga0439449_0099891_269_697 142
963 3300042008 Ga0439450_049915 Ga0439450_049915_393_827 142
964 3300042012 Ga0439455_0009031 Ga0439455_0009031_208_636 142
965 3300042014 Ga0439457_000226 Ga0439457_000226_14333_14761 142
966 3300042014 Ga0439457_005142 Ga0439457_005142_2211_2639 142
967 3300042015 Ga0439462_0006886 Ga0439462_0006886_1653_2081 142
968 3300042131 Ga0450894_000469 Ga0450894_000469_1101_1529 142
969 3300042132 Ga0450895_001743 Ga0450895_001743_746_1174 142
970 3300042133 Ga0450896_000106 Ga0450896_000106_4277_4705 142
971 3300042134 Ga0450898_000563 Ga0450898_000563_945_1373 142
972 3300042135 Ga0450899_001353 Ga0450899_001353_2201_2629 142
973 3300042136 Ga0450900_075950 Ga0450900_075950_71_499 142
974 3300042138 Ga0450903_001178 Ga0450903_001178_1839_2267 142
975 3300042138 Ga0450903_008536 Ga0450903_008536_804_1232 142
976 3300042157 Ga0439458_0002293 Ga0439458_0002293_2692_3120 142
977 3300042157 Ga0439458_0043027 Ga0439458_0043027_24_452 142
978 3300044656 Ga0466969_0001522 Ga0466969_0001522_9238_9666 142
979 3300044656 Ga0466969_0043040 Ga0466969_0043040_883_1311 142
980 3300044658 Ga0466972_0010134 Ga0466972_0010134_974_1402 142
981 3300044658 Ga0466972_0024615 Ga0466972_0024615_2187_2615 142
982 3300044658 Ga0466972_0057751 Ga0466972_0057751_425_853 142
983 3300044658 Ga0466972_0279956 Ga0466972_0279956_186_614 142
984 3300044683 Ga0466965_0016619 Ga0466965_0016619_2344_2772 142
985 3300044683 Ga0466965_0065937 Ga0466965_0065937_1156_1584 142
986 3300044683 Ga0466965_0349242 Ga0466965_0349242_152_580 142
987 3300044683 Ga0466965_0464444 Ga0466965_0464444_129_557 142
988 3300044684 Ga0466966_0002430 Ga0466966_0002430_4217_4645 142
989 3300044684 Ga0466966_0003728 Ga0466966_0003728_3011_3439 142
990 3300044684 Ga0466966_0010844 Ga0466966_0010844_3871_4299 142
991 3300044684 Ga0466966_0078559 Ga0466966_0078559_1412_1840 142
992 3300044693 Ga0466961_0003156 Ga0466961_0003156_8078_8506 142
993 3300044693 Ga0466961_0011629 Ga0466961_0011629_4767_5195 142
994 3300044693 Ga0466961_0022130 Ga0466961_0022130_1535_1963 142
995 3300044693 Ga0466961_0029264 Ga0466961_0029264_359_787 142
996 3300044693 Ga0466961_0049747 Ga0466961_0049747_1586_2014 142
997 3300044693 Ga0466961_0340125 Ga0466961_0340125_307_735 142
998 3300044694 Ga0466963_0000957 Ga0466963_0000957_3823_4251 142
999 3300044694 Ga0466963_0006510 Ga0466963_0006510_5456_5884 142
1000 3300044694 Ga0466963_0038865 Ga0466963_0038865_2209_2637 142
1001 3300044694 Ga0466963_0977538 Ga0466963_0977538_151_579 142
1002 3300044719 Ga0466971_0015607 Ga0466971_0015607_1242_1670 142
1003 3300044719 Ga0466971_0044706 Ga0466971_0044706_1331_1759 142
1004 3300044735 Ga0466968_0092105 Ga0466968_0092105_756_1184 142
1005 3300044735 Ga0466968_0213181 Ga0466968_0213181_426_854 142
1006 3300044735 Ga0466968_0286607 Ga0466968_0286607_320_748 142
1007 3300044765 Ga0466970_0008565 Ga0466970_0008565_808_1236 142
1008 3300044765 Ga0466970_0085712 Ga0466970_0085712_40_468 142
1009 3300044765 Ga0466970_0210875 Ga0466970_0210875_578_1006 142
1010 3300044765 Ga0466970_0246953 Ga0466970_0246953_61_489 142
1011 3300044765 Ga0466970_0284496 Ga0466970_0284496_185_613 142
1012 3300044765 Ga0466970_0533599 Ga0466970_0533599_98_526 142
1013 3300044842 Ga0466957_0016285 Ga0466957_0016285_2163_2591 142
1014 3300044842 Ga0466957_0397869 Ga0466957_0397869_390_818 142
1015 3300044842 Ga0466957_0810817 Ga0466957_0810817_138_566 142
1016 3300044901 Ga0466960_0085119 Ga0466960_0085119_732_1160 142
1017 3300044901 Ga0466960_0098516 Ga0466960_0098516_960_1388 142
1018 3300044901 Ga0466960_0156298 Ga0466960_0156298_50_478 142
1019 3300045049 Ga0466959_0021835 Ga0466959_0021835_765_1193 142
1020 3300045049 Ga0466959_0050763 Ga0466959_0050763_2264_2692 142
1021 3300045049 Ga0466959_0106300 Ga0466959_0106300_29_457 142
1022 3300045049 Ga0466959_0195302 Ga0466959_0195302_772_1200 142
1023 3300045049 Ga0466959_0729710 Ga0466959_0729710_80_508 142
1024 3300045049 Ga0466959_0870230 Ga0466959_0870230_74_502 142
1025 3300045049 Ga0466959_0991401 Ga0466959_0991401_83_511 142
1026 3300045836 Ga0466958_0021709 Ga0466958_0021709_1111_1539 142
1027 3300045836 Ga0466958_0104809 Ga0466958_0104809_1119_1547 142
1028 3300045836 Ga0466958_0117946 Ga0466958_0117946_179_607 142
1029 3300045836 Ga0466958_0280482 Ga0466958_0280482_495_923 142
1030 3300045976 Ga0466967_0046949 Ga0466967_0046949_2505_2933 142
1031 3300045976 Ga0466967_0117546 Ga0466967_0117546_1588_2016 142
1032 3300045976 Ga0466967_0126930 Ga0466967_0126930_1192_1620 142
1033 3300045976 Ga0466967_0448931 Ga0466967_0448931_248_676 142
1034 3300045976 Ga0466967_0916157 Ga0466967_0916157_325_756 142
1035 3300046452 Ga0495617_030494 Ga0495617_030494_517_945 142
1036 3300046453 Ga0495627_025594 Ga0495627_025594_115_543 142
1037 3300046453 Ga0495627_056349 Ga0495627_056349_632_1066 142
1038 3300046454 Ga0495592_0026472 Ga0495592_0026472_3359_3802 142
1039 3300046454 Ga0495592_0029582 Ga0495592_0029582_57_485 142
1040 3300046454 Ga0495592_0038013 Ga0495592_0038013_863_1291 142
1041 3300046454 Ga0495592_0040174 Ga0495592_0040174_1064_1492 142
1042 3300046455 Ga0495603_0000669 Ga0495603_0000669_4908_5336 142
1043 3300046455 Ga0495603_0026568 Ga0495603_0026568_670_1098 142
1044 3300046455 Ga0495603_0026701 Ga0495603_0026701_478_906 142
1045 3300046455 Ga0495603_0040921 Ga0495603_0040921_671_1099 142
1046 3300046455 Ga0495603_0066223 Ga0495603_0066223_51_479 142
1047 3300046455 Ga0495603_0105016 Ga0495603_0105016_51_479 142
1048 3300046455 Ga0495603_0146297 Ga0495603_0146297_802_1230 142
1049 3300046455 Ga0495603_0395514 Ga0495603_0395514_30_491 142
1050 3300046455 Ga0495603_0590732 Ga0495603_0590732_166_600 142
1051 3300046457 Ga0495590_0029568 Ga0495590_0029568_998_1426 142
1052 3300046459 Ga0495629_0005008 Ga0495629_0005008_739_1167 142
1053 3300046459 Ga0495629_0008159 Ga0495629_0008159_3946_4374 142
1054 3300046459 Ga0495629_0055400 Ga0495629_0055400_671_1099 142
1055 3300046459 Ga0495629_0079118 Ga0495629_0079118_1198_1626 142
1056 3300046459 Ga0495629_0095982 Ga0495629_0095982_1239_1667 142
1057 3300046459 Ga0495629_0098282 Ga0495629_0098282_1125_1553 142
1058 3300046459 Ga0495629_0154578 Ga0495629_0154578_392_820 142
1059 3300046459 Ga0495629_0422480 Ga0495629_0422480_260_688 142
1060 3300046459 Ga0495629_0839662 Ga0495629_0839662_124_552 142
1061 3300046460 Ga0495638_0032430 Ga0495638_0032430_2867_3301 142
1062 3300046460 Ga0495638_0140368 Ga0495638_0140368_227_655 142
1063 3300046461 Ga0495641_0112735 Ga0495641_0112735_595_1056 142
1064 3300046462 Ga0495651_0001402 Ga0495651_0001402_15820_16248 142
1065 3300046462 Ga0495651_0016264 Ga0495651_0016264_4395_4838 142
1066 3300046462 Ga0495651_0072771 Ga0495651_0072771_1335_1763 142
1067 3300046462 Ga0495651_0152601 Ga0495651_0152601_896_1324 142
1068 3300046463 Ga0495653_0527235 Ga0495653_0527235_276_704 142
1069 3300046472 Ga0495580_0363460 Ga0495580_0363460_375_803 142
1070 3300046472 Ga0495580_0885156 Ga0495580_0885156_41_469 142
1071 3300046473 Ga0495582_0138486 Ga0495582_0138486_448_876 142
1072 3300046474 Ga0495605_0055468 Ga0495605_0055468_339_767 142
1073 3300046474 Ga0495605_0100549 Ga0495605_0100549_612_1040 142
1074 3300046475 Ga0495639_0022765 Ga0495639_0022765_342_770 142
1075 3300046476 Ga0495662_0000039 Ga0495662_0000039_28102_28530 142
1076 3300046476 Ga0495662_0025273 Ga0495662_0025273_1907_2335 142
1077 3300046476 Ga0495662_0113313 Ga0495662_0113313_500_928 142
1078 3300046477 Ga0495664_0001560 Ga0495664_0001560_8735_9163 142
1079 3300046477 Ga0495664_0267462 Ga0495664_0267462_511_939 142
1080 3300046477 Ga0495664_0269256 Ga0495664_0269256_32_475 142
1081 3300046477 Ga0495664_0776727 Ga0495664_0776727_89_517 142
1082 3300046491 Ga0495584_0217928 Ga0495584_0217928_108_536 142
1083 3300046491 Ga0495584_0394067 Ga0495584_0394067_32_460 142
1084 3300046492 Ga0495585_0006093 Ga0495585_0006093_2529_2957 142
1085 3300046492 Ga0495585_0027126 Ga0495585_0027126_863_1291 142
1086 3300046492 Ga0495585_0125024 Ga0495585_0125024_20_448 142
1087 3300046492 Ga0495585_0193273 Ga0495585_0193273_539_967 142
1088 3300046499 Ga0495594_0002244 Ga0495594_0002244_8899_9327 142
1089 3300046499 Ga0495594_0063501 Ga0495594_0063501_882_1310 142
1090 3300046499 Ga0495594_0174376 Ga0495594_0174376_766_1194 142
1091 3300046499 Ga0495594_0244581 Ga0495594_0244581_535_963 142
1092 3300046499 Ga0495594_0269746 Ga0495594_0269746_477_905 142
1093 3300046499 Ga0495594_0431135 Ga0495594_0431135_266_694 142
1094 3300046499 Ga0495594_0446279 Ga0495594_0446279_18_446 142
1095 3300046500 Ga0495596_0114341 Ga0495596_0114341_279_707 142
1096 3300046501 Ga0495607_0024376 Ga0495607_0024376_266_694 142
1097 3300046501 Ga0495607_0036715 Ga0495607_0036715_1268_1696 142
1098 3300046501 Ga0495607_0055495 Ga0495607_0055495_1127_1561 142
1099 3300046506 Ga0495583_0025119 Ga0495583_0025119_1775_2203 142
1100 3300046506 Ga0495583_0082931 Ga0495583_0082931_69_497 142
1101 3300046507 Ga0495606_0042550 Ga0495606_0042550_311_739 142
1102 3300046511 Ga0495608_0277913 Ga0495608_0277913_224_652 142
1103 3300046512 Ga0495610_0036888 Ga0495610_0036888_1657_2085 142
1104 3300046513 Ga0495616_0018387 Ga0495616_0018387_332_760 142
1105 3300046514 Ga0495618_0067905 Ga0495618_0067905_726_1154 142
1106 3300046514 Ga0495618_0076097 Ga0495618_0076097_1090_1533 142
1107 3300046514 Ga0495618_0335230 Ga0495618_0335230_286_714 142
1108 3300046514 Ga0495618_0668152 Ga0495618_0668152_172_600 142
1109 3300046515 Ga0495620_0001872 Ga0495620_0001872_11661_12089 142
1110 3300046515 Ga0495620_0048386 Ga0495620_0048386_930_1358 142
1111 3300046515 Ga0495620_0197376 Ga0495620_0197376_274_702 142
1112 3300046516 Ga0495628_0017262 Ga0495628_0017262_4915_5343 142
1113 3300046516 Ga0495628_0021408 Ga0495628_0021408_1507_1935 142
1114 3300046516 Ga0495628_0067910 Ga0495628_0067910_1778_2221 142
1115 3300046516 Ga0495628_0133203 Ga0495628_0133203_790_1218 142
1116 3300046516 Ga0495628_0418027 Ga0495628_0418027_526_954 142
1117 3300046517 Ga0495630_0409946 Ga0495630_0409946_254_682 142
1118 3300046517 Ga0495630_0901270 Ga0495630_0901270_126_554 142
1119 3300046518 Ga0495631_0146730 Ga0495631_0146730_348_776 142
1120 3300046519 Ga0495632_0287471 Ga0495632_0287471_99_527 142
1121 3300046520 Ga0495637_0093873 Ga0495637_0093873_616_1044 142
1122 3300046522 Ga0495643_0006297 Ga0495643_0006297_275_703 142
1123 3300046522 Ga0495643_0018377 Ga0495643_0018377_178_612 142
1124 3300046522 Ga0495643_0312875 Ga0495643_0312875_259_687 142
1125 3300046522 Ga0495643_0350722 Ga0495643_0350722_78_506 142
1126 3300046524 Ga0495648_0057012 Ga0495648_0057012_262_690 142
1127 3300046526 Ga0495666_0011232 Ga0495666_0011232_3523_3951 142
1128 3300046528 Ga0495642_0089812 Ga0495642_0089812_24_452 142
1129 3300046529 Ga0495652_0023121 Ga0495652_0023121_3826_4254 142
1130 3300046529 Ga0495652_0052821 Ga0495652_0052821_1190_1633 142
1131 3300046529 Ga0495652_0713965 Ga0495652_0713965_170_598 142
1132 3300046530 Ga0495654_0051553 Ga0495654_0051553_129_557 142
1133 3300046533 Ga0495640_0025755 Ga0495640_0025755_270_698 142
1134 3300046533 Ga0495640_0057922 Ga0495640_0057922_1574_2002 142
1135 3300046533 Ga0495640_0095764 Ga0495640_0095764_795_1223 142
1136 3300046533 Ga0495640_0125880 Ga0495640_0125880_631_1059 142
1137 3300046535 Ga0495586_0021896 Ga0495586_0021896_2781_3209 142
1138 3300046535 Ga0495586_0080684 Ga0495586_0080684_715_1143 142
1139 3300046536 Ga0495587_0117121 Ga0495587_0117121_25_468 142
1140 3300046536 Ga0495587_0223895 Ga0495587_0223895_307_735 142
1141 3300046538 Ga0495609_0020901 Ga0495609_0020901_2327_2755 142
1142 3300046543 Ga0495645_0021671 Ga0495645_0021671_434_862 142
1143 3300046543 Ga0495645_0105921 Ga0495645_0105921_1290_1733 142
1144 3300046543 Ga0495645_0611431 Ga0495645_0611431_123_551 142
1145 3300046557 Ga0495622_0017272 Ga0495622_0017272_2272_2700 142
1146 3300046557 Ga0495622_0058996 Ga0495622_0058996_752_1180 142
1147 3300046557 Ga0495622_0090396 Ga0495622_0090396_52_480 142
1148 3300046557 Ga0495622_0106326 Ga0495622_0106326_565_993 142
1149 3300046557 Ga0495622_0194353 Ga0495622_0194353_44_472 142
1150 3300046558 Ga0495633_0040675 Ga0495633_0040675_303_731 142
1151 3300046558 Ga0495633_0072369 Ga0495633_0072369_228_662 142
1152 3300046559 Ga0495667_0177662 Ga0495667_0177662_135_563 142
1153 3300046559 Ga0495667_0969395 Ga0495667_0969395_41_469 142
1154 3300046616 Ga0495668_0083190 Ga0495668_0083190_548_976 142
1155 3300046616 Ga0495668_0104873 Ga0495668_0104873_1082_1510 142
1156 3300046616 Ga0495668_0178693 Ga0495668_0178693_21_449 142
1157 3300046642 Ga0495634_0001063 Ga0495634_0001063_9003_9431 142
1158 3300046642 Ga0495634_0028635 Ga0495634_0028635_2938_3381 142
1159 3300046642 Ga0495634_0080193 Ga0495634_0080193_672_1100 142
1160 3300046642 Ga0495634_0318732 Ga0495634_0318732_290_718 142
1161 3300046648 Ga0495611_0066209 Ga0495611_0066209_252_680 142
1162 3300046648 Ga0495611_0122645 Ga0495611_0122645_711_1145 142
1163 3300046648 Ga0495611_0207183 Ga0495611_0207183_258_686 142
1164 3300046648 Ga0495611_0553579 Ga0495611_0553579_49_477 142
1165 3300046660 Ga0495625_0010562 Ga0495625_0010562_2672_3100 142
1166 3300046660 Ga0495625_0081511 Ga0495625_0081511_1182_1610 142
1167 3300046660 Ga0495625_0153182 Ga0495625_0153182_73_501 142
1168 3300046660 Ga0495625_0627212 Ga0495625_0627212_45_473 142
1169 3300046663 Ga0495635_0004318 Ga0495635_0004318_6311_6739 142
1170 3300046663 Ga0495635_0041648 Ga0495635_0041648_2040_2483 142
1171 3300046663 Ga0495635_0074129 Ga0495635_0074129_1688_2116 142
1172 3300046663 Ga0495635_0507285 Ga0495635_0507285_213_641 142
1173 3300046665 Ga0495661_0021151 Ga0495661_0021151_3552_3980 142
1174 3300046674 Ga0495588_0007513 Ga0495588_0007513_216_644 142
1175 3300046674 Ga0495588_0094612 Ga0495588_0094612_137_565 142
1176 3300046674 Ga0495588_0203400 Ga0495588_0203400_322_750 142
1177 3300046674 Ga0495588_0351876 Ga0495588_0351876_237_665 142
1178 3300046675 Ga0495657_0001831 Ga0495657_0001831_10713_11141 142
1179 3300046675 Ga0495657_0009083 Ga0495657_0009083_6003_6431 142
1180 3300046675 Ga0495657_0763951 Ga0495657_0763951_31_459 142
1181 3300046678 Ga0495599_0004750 Ga0495599_0004750_1357_1800 142
1182 3300046678 Ga0495599_0583960 Ga0495599_0583960_30_458 142
1183 3300046679 Ga0495623_0260261 Ga0495623_0260261_29_457 142
1184 3300046679 Ga0495623_0290225 Ga0495623_0290225_13_441 142
1185 3300046680 Ga0495646_0000605 Ga0495646_0000605_3424_3852 142
1186 3300046680 Ga0495646_0007358 Ga0495646_0007358_5496_5939 142
1187 3300046680 Ga0495646_0134272 Ga0495646_0134272_42_470 142
1188 3300046683 Ga0495658_0010152 Ga0495658_0010152_3526_3960 142
1189 3300046683 Ga0495658_0120018 Ga0495658_0120018_129_572 142
1190 3300046683 Ga0495658_0204919 Ga0495658_0204919_627_1055 142
1191 3300046689 Ga0495613_0004137 Ga0495613_0004137_790_1218 142
1192 3300046689 Ga0495613_0005563 Ga0495613_0005563_7705_8133 142
1193 3300046689 Ga0495613_0007081 Ga0495613_0007081_636_1064 142
1194 3300046689 Ga0495613_0037030 Ga0495613_0037030_2436_2864 142
1195 3300046689 Ga0495613_0229689 Ga0495613_0229689_130_558 142
1196 3300046689 Ga0495613_0399555 Ga0495613_0399555_426_854 142
1197 3300046690 Ga0495624_0122380 Ga0495624_0122380_1125_1553 142
1198 3300046690 Ga0495624_0126690 Ga0495624_0126690_726_1160 142
1199 3300046690 Ga0495624_0151132 Ga0495624_0151132_970_1398 142
1200 3300046691 Ga0495670_0006503 Ga0495670_0006503_2069_2503 142
1201 3300046691 Ga0495670_0047351 Ga0495670_0047351_132_560 142
1202 3300046691 Ga0495670_0103230 Ga0495670_0103230_49_477 142
1203 3300046691 Ga0495670_0308648 Ga0495670_0308648_409_837 142
1204 3300046692 Ga0495671_0003890 Ga0495671_0003890_938_1366 142
1205 3300046694 Ga0495649_0114629 Ga0495649_0114629_820_1248 142
1206 3300046694 Ga0495649_0120547 Ga0495649_0120547_394_822 142
1207 3300046694 Ga0495649_0151395 Ga0495649_0151395_445_873 142
1208 3300046694 Ga0495649_0542133 Ga0495649_0542133_28_456 142
1209 3300046794 Ga0495589_0007062 Ga0495589_0007062_2547_2975 142
1210 3300046794 Ga0495589_0023713 Ga0495589_0023713_2214_2642 142
1211 3300046794 Ga0495589_0058500 Ga0495589_0058500_537_965 142
1212 3300046794 Ga0495589_0064548 Ga0495589_0064548_405_833 142
1213 3300046794 Ga0495589_0100173 Ga0495589_0100173_274_702 142
1214 3300046794 Ga0495589_0119339 Ga0495589_0119339_565_993 142
1215 3300046794 Ga0495589_0312834 Ga0495589_0312834_235_663 142
1216 3300046809 Ga0495600_0015114 Ga0495600_0015114_4252_4680 142
1217 3300046809 Ga0495600_0027958 Ga0495600_0027958_67_495 142
1218 3300046809 Ga0495600_0078402 Ga0495600_0078402_707_1150 142
1219 3300046809 Ga0495600_0199698 Ga0495600_0199698_37_465 142
1220 3300046809 Ga0495600_0324115 Ga0495600_0324115_289_717 142
1221 3300046809 Ga0495600_0961746 Ga0495600_0961746_35_463 142
1222 3300046810 Ga0495660_0014771 Ga0495660_0014771_1412_1846 142
1223 3300046810 Ga0495660_0067627 Ga0495660_0067627_557_985 142
1224 3300047315 Ga0495581_0076201 Ga0495581_0076201_724_1152 142
1225 3300047315 Ga0495581_0098149 Ga0495581_0098149_434_862 142
1226 3300047315 Ga0495581_0155770 Ga0495581_0155770_166_594 142
1227 3300047315 Ga0495581_0560987 Ga0495581_0560987_58_486 142
1228 3300047317 Ga0495604_0000692 Ga0495604_0000692_11762_12190 142
1229 3300047317 Ga0495604_0036315 Ga0495604_0036315_2537_2965 142
1230 3300047317 Ga0495604_0044597 Ga0495604_0044597_1310_1738 142
1231 3300047317 Ga0495604_0315772 Ga0495604_0315772_262_690 142
1232 3300047317 Ga0495604_0481431 Ga0495604_0481431_286_720 142
1233 3300047317 Ga0495604_0595037 Ga0495604_0595037_268_696 142
1234 3300047318 Ga0495636_0072780 Ga0495636_0072780_693_1121 142
1235 3300047318 Ga0495636_0137131 Ga0495636_0137131_582_1022 142
1236 3300047318 Ga0495636_0164295 Ga0495636_0164295_26_454 142
1237 3300047318 Ga0495636_0180317 Ga0495636_0180317_248_676 142
1238 3300047318 Ga0495636_0192147 Ga0495636_0192147_21_449 142
1239 3300047319 Ga0495674_0102688 Ga0495674_0102688_1718_2161 142
1240 3300047319 Ga0495674_1253279 Ga0495674_1253279_76_504 142
1241 3300047320 Ga0495672_0080858 Ga0495672_0080858_243_671 142
1242 3300047321 Ga0495676_0003054 Ga0495676_0003054_13674_14102 142
1243 3300047321 Ga0495676_0010050 Ga0495676_0010050_903_1331 142
1244 3300047321 Ga0495676_0011550 Ga0495676_0011550_2620_3048 142
1245 3300047321 Ga0495676_0016531 Ga0495676_0016531_4533_4961 142
1246 3300047321 Ga0495676_0043154 Ga0495676_0043154_1109_1537 142
1247 3300047321 Ga0495676_0054130 Ga0495676_0054130_736_1164 142
1248 3300047321 Ga0495676_0176187 Ga0495676_0176187_51_479 142
1249 3300047321 Ga0495676_0180731 Ga0495676_0180731_670_1098 142
1250 3300047321 Ga0495676_0284981 Ga0495676_0284981_164_598 142
1251 3300047321 Ga0495676_0593343 Ga0495676_0593343_180_623 142
1252 3300047322 Ga0495680_0013742 Ga0495680_0013742_330_773 142
1253 3300047323 Ga0495683_0047980 Ga0495683_0047980_960_1388 142
1254 3300047323 Ga0495683_0118894 Ga0495683_0118894_160_594 142
1255 3300047443 Ga0495687_002749 Ga0495687_002749_9140_9568 142
1256 3300047443 Ga0495687_022503 Ga0495687_022503_1916_2350 142
1257 3300047443 Ga0495687_027772 Ga0495687_027772_1524_1952 142
1258 3300047443 Ga0495687_067923 Ga0495687_067923_294_722 142
1259 3300047443 Ga0495687_133122 Ga0495687_133122_312_740 142
1260 3300047444 Ga0495675_0005789 Ga0495675_0005789_4161_4589 142
1261 3300047444 Ga0495675_0033922 Ga0495675_0033922_2652_3095 142
1262 3300047444 Ga0495675_0164823 Ga0495675_0164823_226_654 142
1263 3300047445 Ga0495677_0183375 Ga0495677_0183375_171_599 142
1264 3300047447 Ga0495685_000833 Ga0495685_000833_5562_5996 142
1265 3300047447 Ga0495685_001527 Ga0495685_001527_286_714 142
1266 3300047447 Ga0495685_018341 Ga0495685_018341_730_1158 142
1267 3300047447 Ga0495685_042964 Ga0495685_042964_649_1077 142
1268 3300047447 Ga0495685_114003 Ga0495685_114003_156_584 142
1269 3300047447 Ga0495685_251875 Ga0495685_251875_25_453 142
1270 3300047470 Ga0495681_0001709 Ga0495681_0001709_5629_6057 142
1271 3300047470 Ga0495681_0084660 Ga0495681_0084660_57_485 142
1272 3300047471 Ga0495684_0011777 Ga0495684_0011777_2765_3208 142
1273 3300047471 Ga0495684_0639697 Ga0495684_0639697_208_636 142
1274 3300047472 Ga0495686_0036187 Ga0495686_0036187_2706_3140 142
1275 3300047673 Ga0495593_0009210 Ga0495593_0009210_4040_4468 142
1276 3300047673 Ga0495593_0117687 Ga0495593_0117687_719_1147 142
1277 3300047673 Ga0495593_0399955 Ga0495593_0399955_128_556 142
1278 3300047673 Ga0495593_0595240 Ga0495593_0595240_60_488 142
1279 3300048088 Ga0495602_0140524 Ga0495602_0140524_708_1136 142
1280 3300048088 Ga0495602_1038415 Ga0495602_1038415_77_505 142
1281 3300048089 Ga0495614_0000938 Ga0495614_0000938_8560_8988 142
1282 3300048089 Ga0495614_0006161 Ga0495614_0006161_1017_1445 142
1283 3300048089 Ga0495614_0012307 Ga0495614_0012307_2744_3172 142
1284 3300048089 Ga0495614_0054956 Ga0495614_0054956_1051_1479 142
1285 3300048089 Ga0495614_0087677 Ga0495614_0087677_329_772 142
1286 3300048089 Ga0495614_0612209 Ga0495614_0612209_37_465 142
1287 3300048091 Ga0495626_0084312 Ga0495626_0084312_199_627 142
1288 3300048091 Ga0495626_0214382 Ga0495626_0214382_58_486 142
1289 3300048904 Ga0496101_0628413 Ga0496101_0628413_361_789 142
1290 3300048904 Ga0496101_1315304 Ga0496101_1315304_69_497 142
1291 3300048905 Ga0496102_0049614 Ga0496102_0049614_234_677 142
1292 3300048905 Ga0496102_0319276 Ga0496102_0319276_54_482 142
1293 3300048905 Ga0496102_0877358 Ga0496102_0877358_338_766 142
1294 3300048907 Ga0496104_0040897 Ga0496104_0040897_1189_1632 142
1295 3300048907 Ga0496104_0552608 Ga0496104_0552608_615_1043 142
1296 3300048907 Ga0496104_1314880 Ga0496104_1314880_115_543 142
1297 3300048908 Ga0496105_0095355 Ga0496105_0095355_1062_1505 142
1298 3300048908 Ga0496105_0127624 Ga0496105_0127624_784_1212 142
1299 3300048908 Ga0496105_0401674 Ga0496105_0401674_571_999 142
1300 3300048909 Ga0496106_0180224 Ga0496106_0180224_516_959 142
1301 3300048910 Ga0496107_0730400 Ga0496107_0730400_118_546 142
1302 3300048910 Ga0496107_1114919 Ga0496107_1114919_86_529 142
1303 3300048911 Ga0496108_0014106 Ga0496108_0014106_4361_4804 142
1304 3300048911 Ga0496108_0047129 Ga0496108_0047129_2381_2809 142
1305 3300048911 Ga0496108_0292629 Ga0496108_0292629_898_1326 142
1306 3300048912 Ga0496109_0046751 Ga0496109_0046751_1195_1638 142
1307 3300048912 Ga0496109_0076090 Ga0496109_0076090_1941_2369 142
1308 3300048912 Ga0496109_0499849 Ga0496109_0499849_143_571 142
1309 3300048912 Ga0496109_0781166 Ga0496109_0781166_59_487 142
1310 3300048912 Ga0496109_0965514 Ga0496109_0965514_336_767 142
1311 3300048912 Ga0496109_1633376 Ga0496109_1633376_12_443 142
1312 3300048913 Ga0496110_0043898 Ga0496110_0043898_2160_2603 142
1313 3300048913 Ga0496110_0339559 Ga0496110_0339559_289_717 142
1314 3300048913 Ga0496110_0599777 Ga0496110_0599777_334_765 142
1315 3300048914 Ga0496111_0026125 Ga0496111_0026125_3628_4071 142
1316 3300048915 Ga0496112_0245755 Ga0496112_0245755_1206_1649 142
1317 3300048915 Ga0496112_1488494 Ga0496112_1488494_92_520 142
1318 3300048916 Ga0496113_0518800 Ga0496113_0518800_490_933 142
1319 3300048916 Ga0496113_0580317 Ga0496113_0580317_77_505 142
1320 3300048916 Ga0496113_0653707 Ga0496113_0653707_220_648 142
1321 3300048917 Ga0496114_0055470 Ga0496114_0055470_313_756 142
1322 3300048918 Ga0496115_0202261 Ga0496115_0202261_585_1013 142
1323 3300048922 Ga0496119_0030080 Ga0496119_0030080_2619_3047 142
1324 3300048924 Ga0496121_0039989 Ga0496121_0039989_2729_3157 142
1325 3300048928 Ga0496125_0509523 Ga0496125_0509523_45_473 142
1326 3300048929 Ga0496126_0249963 Ga0496126_0249963_1012_1440 142
1327 3300049459 Ga0495678_084334 Ga0495678_084334_14_442 142
1328 3300049460 Ga0495682_0312601 Ga0495682_0312601_72_500 142
1329 3300049532 Ga0501316_014234 Ga0501316_014234_460_888 142
1330 3300049534 Ga0501318_014002 Ga0501318_014002_454_882 142
1331 3300049536 Ga0501320_053766 Ga0501320_053766_101_529 142
1332 3300049539 Ga0501323_056055 Ga0501323_056055_106_534 142
1333 3300049568 Ga0501031_0002042 Ga0501031_0002042_8600_9028 142
1334 3300049568 Ga0501031_0054206 Ga0501031_0054206_1061_1489 142
1335 3300049568 Ga0501031_0065920 Ga0501031_0065920_24_452 142
1336 3300049568 Ga0501031_0223959 Ga0501031_0223959_751_1179 142
1337 3300049568 Ga0501031_0342994 Ga0501031_0342994_303_731 142
1338 3300049569 Ga0501032_0006325 Ga0501032_0006325_5590_6018 142
1339 3300049569 Ga0501032_0040089 Ga0501032_0040089_2219_2647 142
1340 3300049569 Ga0501032_0077246 Ga0501032_0077246_499_927 142
1341 3300049569 Ga0501032_0081247 Ga0501032_0081247_669_1097 142
1342 3300049569 Ga0501032_0106060 Ga0501032_0106060_806_1234 142
1343 3300049569 Ga0501032_0183684 Ga0501032_0183684_85_513 142
1344 3300049569 Ga0501032_0196075 Ga0501032_0196075_384_812 142
1345 3300049569 Ga0501032_0254580 Ga0501032_0254580_63_491 142
1346 3300049569 Ga0501032_0640061 Ga0501032_0640061_74_502 142
1347 3300049570 Ga0501033_0028515 Ga0501033_0028515_3218_3646 142
1348 3300049570 Ga0501033_0050778 Ga0501033_0050778_2403_2831 142
1349 3300049570 Ga0501033_0071280 Ga0501033_0071280_1106_1534 142
1350 3300049570 Ga0501033_0650207 Ga0501033_0650207_70_498 142
1351 3300049571 Ga0501034_0006593 Ga0501034_0006593_3005_3433 142
1352 3300049571 Ga0501034_0065220 Ga0501034_0065220_2361_2789 142
1353 3300049571 Ga0501034_0136853 Ga0501034_0136853_21_449 142
1354 3300049571 Ga0501034_0209390 Ga0501034_0209390_698_1126 142
1355 3300049571 Ga0501034_0247234 Ga0501034_0247234_568_996 142
1356 3300049571 Ga0501034_0358160 Ga0501034_0358160_758_1186 142
1357 3300049571 Ga0501034_0464910 Ga0501034_0464910_633_1061 142
1358 3300049571 Ga0501034_0514333 Ga0501034_0514333_60_488 142
1359 3300049572 Ga0501036_0020178 Ga0501036_0020178_3779_4207 142
1360 3300049572 Ga0501036_0037447 Ga0501036_0037447_2982_3410 142
1361 3300049572 Ga0501036_0040119 Ga0501036_0040119_2646_3074 142
1362 3300049572 Ga0501036_0183634 Ga0501036_0183634_512_940 142
1363 3300049572 Ga0501036_0195528 Ga0501036_0195528_541_969 142
1364 3300049572 Ga0501036_0198721 Ga0501036_0198721_1236_1664 142
1365 3300049572 Ga0501036_0689353 Ga0501036_0689353_17_445 142
1366 3300049573 Ga0501037_0013207 Ga0501037_0013207_733_1161 142
1367 3300049573 Ga0501037_0021280 Ga0501037_0021280_3656_4084 142
1368 3300049573 Ga0501037_0034831 Ga0501037_0034831_2607_3035 142
1369 3300049573 Ga0501037_0039709 Ga0501037_0039709_745_1173 142
1370 3300049573 Ga0501037_0131120 Ga0501037_0131120_143_571 142
1371 3300049573 Ga0501037_0973113 Ga0501037_0973113_68_496 142
1372 3300049574 Ga0501038_0011284 Ga0501038_0011284_279_707 142
1373 3300049574 Ga0501038_0043950 Ga0501038_0043950_2409_2837 142
1374 3300049574 Ga0501038_0060289 Ga0501038_0060289_2128_2556 142
1375 3300049574 Ga0501038_0076521 Ga0501038_0076521_30_458 142
1376 3300049574 Ga0501038_0316145 Ga0501038_0316145_59_487 142
1377 3300049574 Ga0501038_0432566 Ga0501038_0432566_485_913 142
1378 3300049574 Ga0501038_1002309 Ga0501038_1002309_62_490 142
1379 3300049574 Ga0501038_1258378 Ga0501038_1258378_20_448 142
1380 3300049575 Ga0501039_0032955 Ga0501039_0032955_881_1309 142
1381 3300049575 Ga0501039_0046430 Ga0501039_0046430_1128_1556 142
1382 3300049575 Ga0501039_0181754 Ga0501039_0181754_647_1075 142
1383 3300049575 Ga0501039_0233377 Ga0501039_0233377_210_638 142
1384 3300049576 Ga0501040_0012893 Ga0501040_0012893_4161_4589 142
1385 3300049577 Ga0501041_0845222 Ga0501041_0845222_135_563 142
1386 3300049578 Ga0501042_0051940 Ga0501042_0051940_502_930 142
1387 3300049578 Ga0501042_0267414 Ga0501042_0267414_154_582 142
1388 3300049578 Ga0501042_0289744 Ga0501042_0289744_22_450 142
1389 3300049579 Ga0501043_0007469 Ga0501043_0007469_8051_8479 142
1390 3300049579 Ga0501043_0040127 Ga0501043_0040127_733_1161 142
1391 3300049579 Ga0501043_0079722 Ga0501043_0079722_1519_1947 142
1392 3300049579 Ga0501043_0209148 Ga0501043_0209148_658_1086 142
1393 3300049579 Ga0501043_0255990 Ga0501043_0255990_113_541 142
1394 3300049579 Ga0501043_0844094 Ga0501043_0844094_85_513 142
1395 3300049580 Ga0501046_0021332 Ga0501046_0021332_2505_2933 142
1396 3300049580 Ga0501046_0039312 Ga0501046_0039312_1858_2286 142
1397 3300049580 Ga0501046_0325989 Ga0501046_0325989_183_611 142
1398 3300049581 Ga0501047_0000582 Ga0501047_0000582_23852_24280 142
1399 3300049581 Ga0501047_0013451 Ga0501047_0013451_6370_6798 142
1400 3300049581 Ga0501047_0055647 Ga0501047_0055647_2519_2947 142
1401 3300049581 Ga0501047_0073219 Ga0501047_0073219_1567_1995 142
1402 3300049581 Ga0501047_0082776 Ga0501047_0082776_1877_2305 142
1403 3300049581 Ga0501047_0194975 Ga0501047_0194975_1393_1821 142
1404 3300049581 Ga0501047_0254546 Ga0501047_0254546_799_1227 142
1405 3300049581 Ga0501047_0318857 Ga0501047_0318857_277_705 142
1406 3300049581 Ga0501047_0853647 Ga0501047_0853647_101_529 142
1407 3300049581 Ga0501047_1165529 Ga0501047_1165529_141_569 142
1408 3300049582 Ga0501048_0012919 Ga0501048_0012919_4925_5353 142
1409 3300049582 Ga0501048_0039041 Ga0501048_0039041_588_1016 142
1410 3300049583 Ga0501067_0005472 Ga0501067_0005472_5211_5639 142
1411 3300049584 Ga0501068_0022849 Ga0501068_0022849_3024_3452 142
1412 3300049584 Ga0501068_0289284 Ga0501068_0289284_351_779 142
1413 3300049584 Ga0501068_1027458 Ga0501068_1027458_43_471 142
1414 3300049585 Ga0501069_0013387 Ga0501069_0013387_3508_3936 142
1415 3300049585 Ga0501069_0019490 Ga0501069_0019490_733_1161 142
1416 3300049585 Ga0501069_0197553 Ga0501069_0197553_276_704 142
1417 3300049585 Ga0501069_0416709 Ga0501069_0416709_284_712 142
1418 3300049586 Ga0501070_0031714 Ga0501070_0031714_3971_4399 142
1419 3300049586 Ga0501070_0049709 Ga0501070_0049709_1446_1889 142
1420 3300049586 Ga0501070_0050464 Ga0501070_0050464_1046_1474 142
1421 3300049586 Ga0501070_0059386 Ga0501070_0059386_308_736 142
1422 3300049586 Ga0501070_0082368 Ga0501070_0082368_1840_2268 142
1423 3300049586 Ga0501070_0130316 Ga0501070_0130316_1366_1794 142
1424 3300049586 Ga0501070_0211943 Ga0501070_0211943_529_957 142
1425 3300049587 Ga0501071_0007769 Ga0501071_0007769_4068_4496 142
1426 3300049588 Ga0501072_0002701 Ga0501072_0002701_6640_7068 142
1427 3300049589 Ga0501073_0037446 Ga0501073_0037446_2359_2787 142
1428 3300049589 Ga0501073_0056713 Ga0501073_0056713_2145_2573 142
1429 3300049590 Ga0501074_0001056 Ga0501074_0001056_13063_13491 142
1430 3300049590 Ga0501074_0011815 Ga0501074_0011815_5890_6318 142
1431 3300049593 Ga0501077_0084022 Ga0501077_0084022_373_801 142
1432 3300049668 Ga0501233_200201 Ga0501233_200201_101_529 142
1433 3300049741 Ga0501079_0737881 Ga0501079_0737881_254_697 142
1434 3300049741 Ga0501079_0847842 Ga0501079_0847842_135_563 142
1435 3300049742 Ga0501080_0022322 Ga0501080_0022322_2916_3344 142
1436 3300049742 Ga0501080_0069371 Ga0501080_0069371_365_793 142
1437 3300049744 Ga0501083_0017409 Ga0501083_0017409_154_582 142
1438 3300049822 Ga0501035_0006838 Ga0501035_0006838_4717_5145 142
1439 3300049822 Ga0501035_0037723 Ga0501035_0037723_3052_3480 142
1440 3300049822 Ga0501035_0081350 Ga0501035_0081350_551_979 142
1441 3300049822 Ga0501035_0082515 Ga0501035_0082515_1476_1904 142
1442 3300049822 Ga0501035_0082738 Ga0501035_0082738_621_1049 142
1443 3300049822 Ga0501035_0105935 Ga0501035_0105935_1235_1663 142
1444 3300049822 Ga0501035_0166717 Ga0501035_0166717_1305_1733 142
1445 3300049822 Ga0501035_0171319 Ga0501035_0171319_838_1266 142
1446 3300049822 Ga0501035_0171324 Ga0501035_0171324_614_1042 142
1447 3300049822 Ga0501035_0293258 Ga0501035_0293258_207_635 142
1448 3300049822 Ga0501035_0791210 Ga0501035_0791210_16_444 142
1449 3300049822 Ga0501035_1208008 Ga0501035_1208008_124_552 142
1450 3300049823 Ga0501044_0000806 Ga0501044_0000806_1610_2038 142
1451 3300049823 Ga0501044_0016943 Ga0501044_0016943_2377_2805 142
1452 3300049823 Ga0501044_0029838 Ga0501044_0029838_836_1264 142
1453 3300049823 Ga0501044_0052436 Ga0501044_0052436_2382_2810 142
1454 3300049823 Ga0501044_0224638 Ga0501044_0224638_919_1347 142
1455 3300049823 Ga0501044_0228749 Ga0501044_0228749_147_575 142
1456 3300049823 Ga0501044_0251459 Ga0501044_0251459_863_1291 142
1457 3300049823 Ga0501044_0330417 Ga0501044_0330417_92_520 142
1458 3300049823 Ga0501044_0380694 Ga0501044_0380694_740_1168 142
1459 3300049823 Ga0501044_0497594 Ga0501044_0497594_465_893 142
1460 3300049824 Ga0501045_0015945 Ga0501045_0015945_3971_4399 142
1461 3300049824 Ga0501045_0132674 Ga0501045_0132674_721_1149 142
1462 3300050492 nmdc:mga0yw44_913482_c1 nmdc:mga0yw44_913482_c1_157_585 142
1463 3300050494 nmdc:mga06z11_4831_c1 nmdc:mga06z11_4831_c1_2347_2775 142
1464 3300050495 nmdc:mga04h51_191831_c1 nmdc:mga04h51_191831_c1_220_648 142
1465 3300050507 nmdc:mga05p37_887721_c1 nmdc:mga05p37_887721_c1_328_768 142
1466 3300053077 Ga0495601_0012855 Ga0495601_0012855_287_730 142
1467 3300053079 Ga0500610_0161031 Ga0500610_0161031_114_542 142
1468 3300053080 Ga0500635_0118403 Ga0500635_0118403_68_496 142
1469 3300053083 Ga0495655_0058881 Ga0495655_0058881_394_822 142
1470 3300053084 Ga0495595_0154399 Ga0495595_0154399_140_583 142
1471 3300053085 Ga0495619_0507143 Ga0495619_0507143_29_472 142
1472 3300053086 Ga0500578_0675368 Ga0500578_0675368_29_463 142
1473 3300053092 Ga0500583_0276324 Ga0500583_0276324_307_735 142
1474 3300053094 Ga0500566_0077344 Ga0500566_0077344_1391_1825 142
1475 3300053095 Ga0500640_026758 Ga0500640_026758_1326_1754 142
1476 3300053098 Ga0500650_0238259 Ga0500650_0238259_119_547 142
1477 3300053099 Ga0500654_024300 Ga0500654_024300_2011_2445 142
1478 3300053100 Ga0500660_088814 Ga0500660_088814_142_576 142
1479 3300053101 Ga0500553_035447 Ga0500553_035447_253_687 142
1480 3300053107 Ga0500560_000044 Ga0500560_000044_3572_4000 142
1481 3300053109 Ga0500569_177778 Ga0500569_177778_179_613 142
1482 3300053111 Ga0500572_004725 Ga0500572_004725_1711_2139 142
1483 3300053113 Ga0500580_118073 Ga0500580_118073_10_444 142
1484 3300053122 Ga0500608_137656 Ga0500608_137656_133_561 142
1485 3300053123 Ga0500614_017119 Ga0500614_017119_553_987 142
1486 3300053123 Ga0500614_029287 Ga0500614_029287_256_684 142
1487 3300053129 Ga0500628_001267 Ga0500628_001267_2022_2456 142
1488 3300053129 Ga0500628_060863 Ga0500628_060863_414_842 142
1489 3300053134 Ga0500658_0010246 Ga0500658_0010246_2099_2533 142
1490 3300053135 Ga0500659_0495073 Ga0500659_0495073_41_475 142
1491 3300053137 Ga0500561_0044644 Ga0500561_0044644_288_722 142
1492 3300053139 Ga0500568_0030065 Ga0500568_0030065_1138_1626 142
1493 3300053140 Ga0500573_0036731 Ga0500573_0036731_353_787 142
1494 3300053142 Ga0500577_0137986 Ga0500577_0137986_337_771 142
1495 3300053143 Ga0500579_151925 Ga0500579_151925_524_958 142
1496 3300053149 Ga0500600_0090829 Ga0500600_0090829_216_644 142
1497 3300053149 Ga0500600_0093903 Ga0500600_0093903_981_1409 142
1498 3300053150 Ga0500603_162002 Ga0500603_162002_34_468 142
1499 3300053151 Ga0500604_0023338 Ga0500604_0023338_767_1204 142
1500 3300053153 Ga0500616_0001051 Ga0500616_0001051_20976_21413 142
1501 3300053153 Ga0500616_0296931 Ga0500616_0296931_15_449 142
1502 3300053157 Ga0500624_004805 Ga0500624_004805_712_1140 142
1503 3300053161 Ga0500634_0017070 Ga0500634_0017070_2002_2436 142
1504 3300053739 Ga0500587_002141 Ga0500587_002141_2057_2491 142
1505 3300054114 Ga0501084_0004705 Ga0501084_0004705_5041_5469 142
1506 3300054114 Ga0501084_1736241 Ga0501084_1736241_58_486 142
1507 3300060353 Ga0501082_0011656 Ga0501082_0011656_6147_6575 142
1508 3300061719 Ga0466962_0004114 Ga0466962_0004114_6371_6799 142
1509 3300061719 Ga0466962_0009245 Ga0466962_0009245_2198_2626 142
1510 3300061719 Ga0466962_0025105 Ga0466962_0025105_423_851 142
1511 3300061719 Ga0466962_0042214 Ga0466962_0042214_834_1262 142
1512 3300061719 Ga0466962_0226566 Ga0466962_0226566_365_793 142
1513 3300061719 Ga0466962_0357294 Ga0466962_0357294_85_513 142
1514 3300061734 Ga0530510_0891422 Ga0530510_0891422_32_460 142
1515 iso_pu_bacteria 2773857933 2774902927 142
1516 iso_pu_bacteria 2808606448 2809233358 142
1517 iso_pu_bacteria 2862281513 2862286820 142
1518 iso_pu_bacteria 2947224130 2947227813 142
1519 iso_pu_bacteria 2954002825 2954003084 142
1520 iso_pu_bacteria 2954380949 2954384765 142
1521 iso_pu_bacteria 2954673503 2954678198 142
1522 iso_pu_bacteria 2954682443 2954685959 142
1523 iso_pu_bacteria 2954691527 2954695608 142
1524 iso_pu_bacteria 2954701450 2954710801 142

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01575

MaoC_dehydratas

MaoC like domain

37

154

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rlj-assembly1.cif.gz_B crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium tuberculosis 0.9734 3 141
4rv2-assembly1.cif.gz_B-2 crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium smegmatis 0.971 3 141
5i7n-assembly1.cif.gz_A-2 maoc-like dehydratase 0.9656 4 141
4rlj-assembly1.cif.gz_B crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium tuberculosis 0.9533 3 141
5i7n-assembly1.cif.gz_A-2 maoc-like dehydratase 0.9389 4 141
ID Description Score Start End Superfamily
4rltB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9674 3 141 3.10.129.10
4rltB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9474 3 141 3.10.129.10
af_P07149_1491_1658_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8824 10 139 3.10.129.10
3k67A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8767 10 139 3.10.129.10
4w78F00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8685 11 141 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A6B3HFS5-F1-model_v4 Dehydratase 1.001 37 141
AF-A0A7K3ETA0-F1-model_v4 Dehydratase 1 5 141 GO:0004312
GO:0005835
GO:0006633
AF-A0A6J7QZ86-F1-model_v4 Unannotated protein 0.9985 52 141
AF-A0A6B3GD80-F1-model_v4 Dehydratase 0.9978 76 141
AF-A0A6G3Q1I8-F1-model_v4 MaoC family dehydratase 0.9964 3 140 GO:0004312
GO:0005835
GO:0006633

Feature Viewer

pLDDT pTM Quality
96.36 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map